CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP035402	Bacillus subtilis strain SRCM103576 chromosome, complete genome	1 crisprs	csa3,cas3,DEDDh,WYL,DinG	0	1	9	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP035402_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP035402_2

2938770-2938877

Orphan

Consensus_repeat	Method
TGATGGGAATCGAACCCACGACAT	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP035402_2

>merge|CP035402|2|2938770-2938877|CRISPRCasFinder
TGATGGGAATCGAACCCACGACATCAGCTTGGAAGGCTGAGGTTTTACCACTAAACTACACCCGCAATTTTTATTTGGGGCGATTGATGGGAATCGAACCCACGAATG

>CP035402|2|2|2938770-2938877|CRISPRCasFinder
TGATGGGAATCGAACCCACGACAT	CAGCTTGGAAGGCTGAGGTTTTACCACTAAACTACACCCGCAATTTTTATTTGGGGCGAT
TGATGGGAATCGAACCCACGAATG

Protein	Signature genes	Signature genes Name	Protein_function
CP035402.1\|QAW01414.1\|2945826_2946405_+\|energy-coupled-thiamine-transporter-ThiT	unknown	unknown	gnl\|CDD\|226377
CP035402.1\|QAW01417.1\|2948535_2949060_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|376684
CP035402.1\|QAW01419.1\|2951612_2953085_-\|betaine-aldehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143437
CP035402.1\|QAW01405.1\|2926203_2927259_-\|CotS-family-spore-coat-protein	unknown	unknown	gnl\|CDD\|131952
CP035402.1\|QAW01413.1\|2936275_2938159_-\|1,4-alpha-glucan-branching-enzyme	unknown	unknown	gnl\|CDD\|273667
CP035402.1\|QAW01408.1\|2929749_2930217_+\|tryptophan-rich-sensory-protein	unknown	unknown	gnl\|CDD\|226007
CP035402.1\|QAW01418.1\|2949721_2950300_-\|MOSC-domain-containing-protein	unknown	unknown	gnl\|CDD\|377051
CP035402.1\|QAW01411.1\|2934081_2935113_-\|glucose-1-phosphate-adenylyltransferase-subunit-GlgD	unknown	unknown	gnl\|CDD\|273966
CP035402.1\|QAW01410.1\|2932630_2934085_-\|glycogen-synthase-GlgA	unknown	unknown	gnl\|CDD\|234809
CP035402.1\|QAW02530.1\|2949227_2949716_+\|DinB-family-protein	unknown	unknown	gnl\|CDD\|378981
CP035402.1\|QAW01415.1\|2946446_2946968_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|224168
CP035402.1\|QAW01421.1\|2954022_2954568_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379999
CP035402.1\|QAW01412.1\|2935136_2936279_-\|glucose-1-phosphate-adenylyltransferase	unknown	unknown	gnl\|CDD\|179997
CP035402.1\|QAW01409.1\|2930247_2932644_-\|glycogen/starch/alpha-glucan-phosphorylase	unknown	unknown	gnl\|CDD\|273967
CP035402.1\|QAW01416.1\|2946985_2948515_-\|flotillin-family-protein	unknown	unknown	gnl\|CDD\|225177
CP035402.1\|QAW01406.1\|2927273_2928407_-\|glycosyltransferase-family-1-protein	unknown	unknown	gnl\|CDD\|340831
CP035402.1\|QAW01420.1\|2953283_2953826_+\|GbsR/MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224427
CP035402.1\|QAW01404.1\|2925773_2926202_-\|hypothetical-protein	unknown	unknown	unknown
CP035402.1\|QAW01407.1\|2928596_2929670_+\|CotS-family-spore-coat-protein	unknown	unknown	gnl\|CDD\|131952
CP035402.1\|QAW02531.1\|2950387_2951596_-\|iron-containing-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|341481

Protein	Function_ID	Function_description	E-value
CP035402.1\|QAW01414.1\|2945826_2946405_+\|energy-coupled-thiamine-transporter-ThiT	gnl\|CDD\|226377	COG3859, COG3859, Predicted membrane protein [Function unknown].	1.328e-72
CP035402.1\|QAW01417.1\|2948535_2949060_-\|hypothetical-protein	gnl\|CDD\|376684	pfam01957, NfeD, NfeD-like C-terminal, partner-binding. NfeD-like proteins are widely distributed throughout prokaryotes and are frequently associated with genes encoding stomatin-like proteins (slipins). There appear to be three major groups: an ancestral group with only an N-terminal serine protease domain and this C-terminal beta sheet-rich domain which is structurally very similar to the OB-fold domain, associated with its neighboring slipin cluster; a second major group with an additional middle, membrane-spanning domain, associated in some species with eoslipin and in others with yqfA; a final 'artificial' group which unites truncated forms lacking the protease region and associated with their ancestral gene partner, either yqfA or eoslipin. This NefD, C-terminal, domain appears to be the major one for relating to the associated protein. NfeD homologs are clearly reliant on their conserved gene neighbor which is assumed to be necessary for function, either through direct physical interaction or by functioning in the same pathway, possibly involve with lipid-rafts.	0.000254791
CP035402.1\|QAW01419.1\|2951612_2953085_-\|betaine-aldehyde-dehydrogenase	gnl\|CDD\|143437	cd07119, ALDH_BADH-GbsA, Bacillus subtilis NAD+-dependent betaine aldehyde dehydrogenase-like. Included in this CD is the NAD+-dependent, betaine aldehyde dehydrogenase (BADH, GbsA, EC=1.2.1.8) of Bacillus subtilis involved in the synthesis of the osmoprotectant glycine betaine from choline or glycine betaine aldehyde.	0
CP035402.1\|QAW01405.1\|2926203_2927259_-\|CotS-family-spore-coat-protein	gnl\|CDD\|131952	TIGR02906, Spore_coat_protein_S, spore coat protein, CotS family. Members of this family include the spore coat proteins CotS and YtaA from Bacillus subtilis and, from other endospore-forming bacteria, homologs that are more closely related to these two than to the spore coat proteins YutH and YsxE. The CotS family is more broadly distributed than YutH or YsxE, but still is not universal among spore-formers. [Cellular processes, Sporulation and germination].	6.9211e-130
CP035402.1\|QAW01413.1\|2936275_2938159_-\|1,4-alpha-glucan-branching-enzyme	gnl\|CDD\|273667	TIGR01515, branching_enzym, alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase. This model describes the glycogen branching enzymes which are responsible for the transfer of chains of approx. 7 alpha(1--4)-linked glucosyl residues to other similar chains (in new alpha(1--6) linkages) in the biosynthesis of glycogen. This enzyme is a member of the broader amylase family of starch hydrolases which fold as (beta/alpha)8 barrels, the so-called TIM-barrel structure. All of the sequences comprising the seed of this model have been experimentally characterized. This model encompasses both bacterial and eukaryotic species. No archaea have this enzyme, although Aquifex aolicus does. Two species, Bacillus thuringiensis and Clostridium perfringens have two sequences each which are annotated as amylases. These annotations are aparrently in error. GP\|18143720 from C. perfringens, for instance, contains the note "674 aa, similar to gp:A14658_1 amylase (1,4-alpha-glucan branching enzyme (EC 2.4.1.18) ) from Bacillus thuringiensis (648 aa); 51.1% identity in 632 aa overlap." A branching enzyme from Porphyromonas gingivales, OMNI\|PG1793, appears to be more closely related to the eukaryotic species (across a deep phylogenetic split) and may represent an instance of lateral transfer from this species' host. A sequence from Arabidopsis thaliana, GP\|9294564, scores just above trusted, but appears either to contain corrupt sequence or, more likely, to be a pseudogene as some of the conserved catalytic residues common to the alpha amylase family are not conserved here. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0
CP035402.1\|QAW01408.1\|2929749_2930217_+\|tryptophan-rich-sensory-protein	gnl\|CDD\|226007	COG3476, COG3476, Tryptophan-rich sensory protein (mitochondrial benzodiazepine receptor homolog) [Signal transduction mechanisms].	3.41396e-40
CP035402.1\|QAW01411.1\|2934081_2935113_-\|glucose-1-phosphate-adenylyltransferase-subunit-GlgD	gnl\|CDD\|273966	TIGR02092, Glycogen_biosynthesis_protein_GlgD, glucose-1-phosphate adenylyltransferase, GlgD subunit. This family is GlgD, an apparent regulatory protein that appears in an alpha2/beta2 heterotetramer with GlgC (glucose-1-phosphate adenylyltransferase, TIGR02091) in a subset of bacteria that use GlgC for glycogen biosynthesis. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0
CP035402.1\|QAW01410.1\|2932630_2934085_-\|glycogen-synthase-GlgA	gnl\|CDD\|234809	PRK00654, glgA, glycogen synthase GlgA.	0
CP035402.1\|QAW02530.1\|2949227_2949716_+\|DinB-family-protein	gnl\|CDD\|378981	pfam12867, DinB_2, DinB superfamily. The DinB family are an uncharacterized family of potential enzymes. The structure of these proteins is composed of a four helix bundle.	2.35984e-17
CP035402.1\|QAW01415.1\|2946446_2946968_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|224168	COG1247, COG1247, Sortase and related acyltransferases [Cell envelope biogenesis, outer membrane].	3.65478e-10
CP035402.1\|QAW01421.1\|2954022_2954568_+\|hypothetical-protein	gnl\|CDD\|379999	pfam17735, BslA, Biofilm surface layer A. This family includes members such as BslA (previously called YuaB). Secreted BslA from Bacillus subtillis has been shown to form surface layers around the biofilm self-assembling at interfaces of B. subtilis biofilms, forming an elastic film. structural analysis revealed that BslA consists of an Ig-type fold with the addition of an unusual, extremely hydrophobic cap region. The hydrophobic cap exhibits physiochemical properties similar to the hydrophobic surface found in fungal hydrophobins; thus, BslA is defined as member of a class of bacterially produced hydrophobins.	5.35887e-46
CP035402.1\|QAW01412.1\|2935136_2936279_-\|glucose-1-phosphate-adenylyltransferase	gnl\|CDD\|179997	PRK05293, glgC, glucose-1-phosphate adenylyltransferase; Provisional.	0
CP035402.1\|QAW01409.1\|2930247_2932644_-\|glycogen/starch/alpha-glucan-phosphorylase	gnl\|CDD\|273967	TIGR02093, Glycogen_phosphorylase, glycogen/starch/alpha-glucan phosphorylases. This family consists of phosphorylases. Members use phosphate to break alpha 1,4 linkages between pairs of glucose residues at the end of long glucose polymers, releasing alpha-D-glucose 1-phosphate. The nomenclature convention is to preface the name according to the natural substrate, as in glycogen phosphorylase, starch phosphorylase, maltodextrin phosphorylase, etc. Name differences among these substrates reflect differences in patterns of branching with alpha 1,6 linkages. Members include allosterically regulated and unregulated forms. A related family, TIGR02094, contains examples known to act well on particularly small alpha 1,4 glucans, as may be found after import from exogenous sources. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0
CP035402.1\|QAW01416.1\|2946985_2948515_-\|flotillin-family-protein	gnl\|CDD\|225177	COG2268, COG2268, Uncharacterized protein conserved in bacteria [Function unknown].	1.34239e-122
CP035402.1\|QAW01406.1\|2927273_2928407_-\|glycosyltransferase-family-1-protein	gnl\|CDD\|340831	cd03801, GT4_PimA-like, phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.	2.38164e-74
CP035402.1\|QAW01420.1\|2953283_2953826_+\|GbsR/MarR-family-transcriptional-regulator	gnl\|CDD\|224427	COG1510, COG1510, Predicted transcriptional regulators [Transcription].	1.21185e-72
CP035402.1\|QAW01418.1\|2949721_2950300_-\|MOSC-domain-containing-protein	gnl\|CDD\|377051	pfam03473, MOSC, MOSC domain. The MOSC (MOCO sulfurase C-terminal) domain is a superfamily of beta-strand-rich domains identified in the molybdenum cofactor sulfurase and several other proteins from both prokaryotes and eukaryotes. These MOSC domains contain an absolutely conserved cysteine and occur either as stand-alone forms or fused to other domains such as NifS-like catalytic domain in Molybdenum cofactor sulfurase. The MOSC domain is predicted to be a sulfur-carrier domain that receives sulfur abstracted by the pyridoxal phosphate-dependent NifS-like enzymes, on its conserved cysteine, and delivers it for the formation of diverse sulfur-metal clusters.	4.89511e-05
CP035402.1\|QAW01407.1\|2928596_2929670_+\|CotS-family-spore-coat-protein	gnl\|CDD\|131952	TIGR02906, Spore_coat_protein_S, spore coat protein, CotS family. Members of this family include the spore coat proteins CotS and YtaA from Bacillus subtilis and, from other endospore-forming bacteria, homologs that are more closely related to these two than to the spore coat proteins YutH and YsxE. The CotS family is more broadly distributed than YutH or YsxE, but still is not universal among spore-formers. [Cellular processes, Sporulation and germination].	3.5517e-131
CP035402.1\|QAW02531.1\|2950387_2951596_-\|iron-containing-alcohol-dehydrogenase	gnl\|CDD\|341481	cd08551, Fe-ADH, iron-containing alcohol dehydrogenases (Fe-ADH)-like. This family contains large metal-containing alcohol dehydrogenases (ADH), known as iron-containing alcohol dehydrogenases. They contain a dehydroquinate synthase-like protein structural fold and mostly contain iron. They are distinct from other alcohol dehydrogenases which contains different protein domains. There are several distinct families of alcohol dehydrogenases: Zinc-containing long-chain alcohol dehydrogenases, insect-type, or short-chain alcohol dehydrogenases, iron-containing alcohol dehydrogenases, among others. The iron-containing family has a Rossmann fold-like topology that resembles the fold of the zinc-dependent alcohol dehydrogenases, but lacks sequence homology, and differs in strand arrangement. ADH catalyzes the reversible oxidation of alcohol to acetaldehyde with the simultaneous reduction of NAD(P)+ to NAD(P)H.	1.69004e-175

>CP035402.1|QAW01413.1|2936275_2938159_-|1,4-alpha-glucan-branching-enzyme
MAAASPTAHDVYLFHEGSLFKSYQLFGSHYRELNGKSGYEFCVWAPHASEVRVAGDFNSWSGEEHVMHRVNDNGIWTLFIPGIGEKERYKYEIVTNNGEIRLKADPYAIYSEVRPNTASLTYDLEGYSWQDQKWQKKQKAKTLYEKPVFIYELHLGSWKKHSDGRHYSYIELSQTLIPYIKEHGFTHIELLPVYEHPYDRSWGYQGTGYYSPTSRFGTPHDLMKFVDECHQQNIGVILDWVPGHFCKDAHGLYMFDGEPLYEYKEERDRENWLWGTANFDLGKPEVHSFLISNALYWAEFYHIDGFRVDAVANILYWPNQDERHTNPYAVEFLKKLNQTMREAYPYVMMIAEDSTEWPQVTGAVEEGGLGFHYKWNMGWMNDVLKYMETPPEERRHCHQLISFSLLYAFSEHFVLPFSHDEVVYGKKSLLNKMPGDYWQKFAQYRLLLGYMTVHPGKKLIFMGSEFAQFDEWKDTEQLDWFLDSFPMHQKASVFTQDLLRFYQKSKILYEHDHRAQSFEWIDVHNDEQSIFSFIRYGKKHGEALVIICNFTPVVYHQYDVGVPFFTQYIEVLNSDSETYGGSGQINKKPLSAKKGALHHKPCYITMTIPPYGISILRAVKKRGEIKR
>CP035402.1|QAW01412.1|2935136_2936279_-|glucose-1-phosphate-adenylyltransferase
MKKQCVAMLLAGGKGSRLSGLTKNMAKPAVSFGGKYRIIDFTLSNCSNSGIDTVGILTQYQPLELNSYIGIGSAWDLDRYNGGVTVLPPYAESSEVKWYKGTASAIYENLNYLNQYDPEYVLILSGDHIYKMDYGKMLDYHIEKKADVTISVIEVGWEEASRFGIMKANPDGTITHFDEKPKFPKSNLASMGIYIFNWPLLKQYLEMDDQNPYSSHDFGKDIIPLLLEEKKKLSAYPFKGYWKDVGTVQSLWEANMDLLKEDSELKLFERKWKIYSVNPNQPPQFISSDAQVQDSLVNEGCVVYGNVSHSVLFQGVTVGKHTTVTSSVIMPDVTIGEHVVIENAIVPNGMVLPDGAVIRSEKDIEEVLLVSEEFVEKELI
>CP035402.1|QAW01411.1|2934081_2935113_-|glucose-1-phosphate-adenylyltransferase-subunit-GlgD
MFNNQMLGVIDETTYKHSLQDLTAQRSLGAIPFAGRYRLIDFMLSNMVNADIRSVAIFPKYRYRSLMDHLGAGKEWDLHRKKDGLFFFPSPHLHHEYDEFGSFRQFSDHLDYFHRSTQQYAVISNSHTVCNIQFQYVLKRHQEVGCDVTEVFQDGQSLQIYIMSTTLLKDLIYGHSEKGYKTIQEAVEKESSALTICPYEYSGYAAVIDSVEKYYTHSMELIQPRFWQQVFLPQQPIYTKVKDEPPTKYGKHSTVKNSLVANGCVLEGEVENCILFRAVHVGKGTKLKNCIIMQKTQIGEDCLLEQVISDKDVKIGKATEAAGTAEQPLVLRKGLVQGELMNS
>CP035402.1|QAW01410.1|2932630_2934085_-|glycogen-synthase-GlgA
MKILLAVSECTPFVKSGGLADVAGALPKALARLGNAVAVMLPKYSQIPEPWKKRMKKKAECTVAVGWRQQYCGIEHMAEDDVNYYFIDNEYYFNRDSLYGHYDDGERFAYFSRAVLEAAKVVNVPADIVHTHDWHTAMVNYLLKEEYRKHPFYERMKSVLTIHNLQFQGIFPPDVTHDLLGLEMDHFHYERLECNSFVNFMKAGIIAADHVTTVSPTYRNEILTPYYGEQLEQVLQYREDDVTGILNGIDDTFYQPKSDPYIEAQYDSGDLACKLENKTKLQRRMGLPEKNDIPLISMVTRLTKQKGLDLVRRIMHELLEEQDIQLVVLGTGEREFEDYFRYAEFAFHEKCRAYIGFDEPLAHQIYAGSDMFLMPSKFEPCGLGQLIALQYGAIPIVRETGGLYDTVRAYQEEEGTGNGFTFSAFNAHDLKFTIERALAFYRQQDVWKSIVKTAMNADYSWGKSAKEYQRIFEQVTRSGRDVLE
>CP035402.1|QAW01409.1|2930247_2932644_-|glycogen/starch/alpha-glucan-phosphorylase
MFSSKERFADLFLKRLEMTCGKSFKDSVKLDQYKTLGNMVREYISANWIETNEKSRSNSGKQTYYLSIEFLLGQLLEQNLMNLGVRDVVEAGLKEIGINLEEILQIENDAGLGNGGLGRLAACFLDSLASLNLPGHGMGIRYKHGLFEQKIVDGHQVELPEQWLKNGNVWEVRNADQAVDVPFWGEVHMTEKSGRLHFRHEQATIVTAVPYDIPIIGYETGTVNTLRLWNAEPYAHYHGGNILSYKRETEAVSEFLYPDDTHDEGKILRLKQQYFLVCASLKSIVNNYRKTHKSLSGLHKKVSIHINDTHPALAVPELMRILLDEENMSWEEAWHITVHTISYTNHTTLSEALEKWPIHLFKPLLPRMYMIIEEINERFCRAVWEKYPGDWKRIEDMAITAHGVVKMAHLAIVGSYSVNGVAKIHSDILMEREMRDFHLLFPNRFNNKTNGIAHRRWLLKANPGLSAIITEAIGDEWVKQPESLIRLEPYATDPAFIEQFQNNKSKKKQELADLIFCTAGVVVNPDSIFDVQVKRLHAYKRQLLNVLHIMYLYNRLKEDAGFSIYPQTFIFGAKASPSYYYAKKVIKLIHSVAEKVNYDPAVKQLIKVVFLENYRVSMAERIFPASDVSEQISTASKEASGTGNMKFMMNGALTIGTHDGANIEILERVGPDCIYTFGLKADEVLSYQENGGYRSREYYQHDRRIRQVADQLINGFFEGEADEFESIFDSLLPHNDEYFVLKDFSSYADAQERIQADYRERRKWSERSIVNIAHSGYFSSDRTIREYAKDIWSIKPMM
>CP035402.1|QAW01408.1|2929749_2930217_+|tryptophan-rich-sensory-protein
MKKIVGALAVFVITYALFSAAGYLFPVDQEWYNSLKKPDWTPSGTAIGIIWAILFALISLSAAIVYAAFSFKGAKSFWFTLLINYVLNQAFSYFQFTQKNLLAASFDCLLVAITAIVLLIIAKKYSRAASYLLLPYFLWSAFATFLSFTINSMNL
>CP035402.1|QAW01407.1|2928596_2929670_+|CotS-family-spore-coat-protein
MCPLMAENHEVIEEGNSSELPLSAEDAKKLTELAENVLQGWDVQAEKIDVIQGNQMALVWKVHTDSGALCLKRIHRPEKKALFSIFAQDYLAKKGMNVPGILPNKKGSLYSKHGSFLFVVYDWIEGRPFELTVKQDLEFIMKGLADFHTASVGYQPPNGVPVFTKLGRWPNHYTKRCKQMETWKLMAEAEKEDPFSQFYLQEIDGFIEDGLRIKDRLLQSAYVPWTEQLKKSPNLCHQDYGTGNTLLGENEQIWVIDLDTVSFDLPIRDLRKMIIPLLDTTGVWDEETFHVMLNAYESRAPLTEEQKQVMFIDMLFPYELYDVIREKYVRKSALPMEELESAFEYERIKANALRQLI
>CP035402.1|QAW01406.1|2927273_2928407_-|glycosyltransferase-family-1-protein
MKIALIATEKLPVPSVRGGAIQIYLEAVAPLIAKKHEVTVFSIKDPNLADREKVDGVHYVHLDEDRYEEAVGEELKKSRFDLVHVCNRPSWVPKLKKKAPDAVFILSVHNEMFAYDKISQAEGEICIDSVAQIVTVSDYIGQTITSRFPSARSKTKTVYSGVDLKAYHPRWTNEGQRAREEMRSELGLHGKKIVLFVGRLSKVKGPHILLQALPDIIEEHPDVMMVFIGSKWFGDNELNNYVKHLHTLGAMQKDHVTFIQFVKPKDIPRLYTMSDVFVCSSQWQEPLARVHYEAMAAGLPIITSNRGGNPEVIEEGKNGYIIHDFENPKQYAERINDLLSSSEKRERLGKYSRREAENKFGWQRVAENLLSVYEKNR
>CP035402.1|QAW01405.1|2926203_2927259_-|CotS-family-spore-coat-protein
MYQKEHEEQIVSEILSYYPFHIDHVALKSNKSGRKIWEVETDHGPKLLKEAQMKPERMLFITQAHAHLQEQGLPIAPIHQTKNGGSCLGTDQVSYSLYDKVTGKEMIYYDAEQMKKVMSFAGHFHHASKGYVCTDESKKRSRLGKWHKLYRWKLQELEGNMQIAASYPDDVFSQTFLKHADKMLARGKEALQALDDSEYETWTKETLEHGGFCFQDFTLARLTEIEGEPFLKELHSITYDLPSRDLRILLNKVMVKLSVWDTDFMVALLAAYDAVYPLTEKQYEVLWIDLAFPHLFCAIGHKYYLKQKKTWSDEKYNWALQNMISVEGSKDSFLDNLPELYKKIKAYREAN
>CP035402.1|QAW01404.1|2925773_2926202_-|hypothetical-protein
MRSSRQKASISKLDLDQFVFTPPGPMGWQAHDSIPAEKGEEEKHLDMGSIRELPHINASKEYQEETKEKETDHKIVDDEEETKFETTPEPEEERDSKRSAPPYEEEDEEEPDVAEEARVEIIILPSESKPAPWFSQTVKRKA
>CP035402.1|QAW01414.1|2945826_2946405_+|energy-coupled-thiamine-transporter-ThiT
MNQSKQLVRLIEIAIMTAAAVILDIVSGMFLSMPQGGSVSIMMIPIFLISFRWGVKAGLTTGLLTGLVQIAIGNLFAQHPVQLLLDYIVAFAAIGISGCFASSVRKAAVSKTKGKLIVSVVSAVFIGSLLRYAAHVISGAVFFGSFAPKGTPVWIYSLTYNATYMVPSFIICAIVLCLLFMTAPRLLKSDKA
>CP035402.1|QAW01415.1|2946446_2946968_-|GNAT-family-N-acetyltransferase
MVTVREAKLEDIKDIAKVHVDSWRTTYHEIIPIDYLNSLNYKEFEDKWKSRSLKGVFVAQDEMDSVFGFASFGPIRSEQEGYDGELYAIYLLEERQRQGAGRALLAKGAEYLLQHGFSSMFVWVIEQNPSIIFYQAYSPERVAEDNFEIAGVRLKEVGLGWPDLSALKTLLNR
>CP035402.1|QAW01416.1|2946985_2948515_-|flotillin-family-protein
MTMPIIMIIGVVFFLLIALIAVFITKYRTAGPDEALIVTGSYLGNKNVHVDEGGNRIKIVRGGGTFVLPVFQQAEPLSLLSSKLDVSTPEVYTEQGVPVMADGTAIIKIGGSIGEIATAAEQFLGKSKDDREQEAREVLEGHLRSILGSMTVEEIYKNREKFSQEVQRVASQDLAKMGLVIVSFTIKDVRDKNGYLESLGKPRIAQVKRDADIATAEADKETRIKRAEADKDAKKSELERATEIAEAEKLNQLKMAEFRREQDTAKANADQAYDLETARARQQVTEQEMQVKIIERQKQIELEEKEILRRERQYDSEVKKKADADRYSVEQSAAAEKAKQLAEADAKKYSIEAMAKAEAEKVRIDGLAKAEAEKAKGETEAEVIRLKGLAEAEAKEKIAAAFEQYGQAAIFDMIVKMLPEYAKQAAAPLSNIDKITVVDTGGSGESSGANKVTSYATNLMSSLQESLKASSGIDVKEMLENFSGKGNVKQSINELTNEIKEAKTVQKSE
>CP035402.1|QAW01417.1|2948535_2949060_-|hypothetical-protein
MELFGVPIQTIYLYTLIIAGSLTLLFLFFGDVFAGLSEGIPFLNPTLVLSFFTCFSAGGYIGELVLPLSSLLIALLSCILSIMLVVLLHIFVLVPLSSAEESLAYREDDLRGRLGKVITAVPVDGFGEVVIEGIGGTISKSAVSFDNQQISYGTTVLVVDINNGVLSVTPHEPI
>CP035402.1|QAW02530.1|2949227_2949716_+|DinB-family-protein
MSIFNEARLETWNELKGLSDEKLNQKPSAEEWSIREVLDHLKKIDMTAQKMLKERVKDAPIKEIEEKSLEVAQDRNNKRKAPSHLEPAHDFISGSQMKRELDVVREQLTAAIASLKEEDFERVLPHPVFQELTVRQWIDFIGHHEKRHLSQMKEIKEKIERA
>CP035402.1|QAW01418.1|2949721_2950300_-|MOSC-domain-containing-protein
MWKRMTAKAEGLYIAETESFVTKQMDKLDFDYGGIPGDLHFGLTKKAGAREPMFSRGTEIFNRRQISIVSIEECNEIALKMGVPRILPEWLGANVAVSGMPDLTSLKEGSRIIFPSGAALLCEGENDPCIQPGEVIQSYYPDKPKLTPAFVRHALGIRGIVCIVERPGAVYTGDEIEVHSYQRKVKRKAERV
>CP035402.1|QAW02531.1|2950387_2951596_-|iron-containing-alcohol-dehydrogenase
MTLNMKVESMQKFHTFEIPTVIKHGIGAIKHTGEEVAALGVSKALLVTDPGIYKAGVADPVIESLKEAGIEVVLFNKVEPNPPVRLVNEGSELYKKENCNGLVAVGGGSSMDTAKAIGVEATHEGSVLDYEAADGKKPLENRIPPLTTIPTTAGTGSEVTQWAVITDEEREFKFNTGGPLIAAHLTIIDPELHVSMPPHVTAMTGIDALAHAIECYTMKFAQPITDAVALMAIEYAAHYIKRAFADGEDLEARYGMAQAAMLAGLSYGSESAGAAHAMSQTLGGIIPVAHGQCVAAMMGPVMEYNWKGYPEKFARIAKAFGIDTSKMTTEEAAKASVNWMYDLVEDLEVPTLEEQGVSPDMIERLSKEAMKDPQTFGNPRDLNEKAYNWIYKRCFNLTPKTV
>CP035402.1|QAW01419.1|2951612_2953085_-|betaine-aldehyde-dehydrogenase
MSQTLFIDGEWISAEKEQIRSIINPFNQEEIATVSEGGREDAIKAIAAARRAFDKGEWSSLSGLERGKIVLKIAELIRRDLEELAELESLDTGKTLEESKADMDDIANVFQYYAGLADKDGGEIVSSPIPDSESKIIREPIGVCGQITPWNYPLLQASWKIAPALAAGNTIVMKPSEITPLTTIKVFKLMEEAGVPKGVANLVLGPGATVGDELAVNKDVDLISFTGGIETGKKIMRAASGNVKKIALELGGKNPNIVFKDADLEVAVDQALNAVFFHAGQVCSAGSRLLVEDAIHDQFLAELVKRAKRIKLGNGFHAETESGPLISAEHRAKVEKYVEIGIEEGAKLETGGKRPEDPALQNGFFYEPTIFSNCNSDMRIVQEEVFGPVLTVETFSSEEEVIELANDTIYGLAGAVWSKDIEKCERVAARLRMGTVWINDFHPYFAQAPWGGYKQSGFGRELGKIGLEEYTEVKHVYRNTKPAAVNWFNS
>CP035402.1|QAW01420.1|2953283_2953826_+|GbsR/MarR-family-transcriptional-regulator
MDENPEFAAIEQARDLVIDSIAETMDLYGITRSVGILYGTMYMRDEMTLDEMREELQMSKPSMSTGVKKLQDLNVVKKTFHRGIRKHTFVAEKDFFKFFTNFFPPKWEREVQVNVAAIEEAQADLQKVLCKEDLDEDIKNEALQLYDQLESSKAYYDWLKRLAESVQTGEIFKFIPIETK
>CP035402.1|QAW01421.1|2954022_2954568_+|hypothetical-protein
MKRKLLSSLAISALSLGLLVSAPTASFAAESTSTKAHTESTMRTQSTASLFATITGASKTEWSFSDIELTYRPNTLLSLGVMEFTLPSGFTANTKDTLNGNALRTTQILNNGKTVRVPLALDLLGAGEFKLKLNNKTLPAAGTYTFRAENKSLSIGNKFYAEASIDVAKRSTPPTQPCGCN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP035402_2	2.1\|2938794\|60\|CP035402\|CRISPRCasFinder	2938794-2938853	60	NZ_CP024037	Bacillus aryabhattai strain K13 plasmid unnamed2	10417-10476	7	0.883
CP035402_2	2.1\|2938794\|60\|CP035402\|CRISPRCasFinder	2938794-2938853	60	NZ_CP026740	Bacillus megaterium strain YC4-R4 plasmid unnamed4	70764-70823	7	0.883
CP035402_2	2.1\|2938794\|60\|CP035402\|CRISPRCasFinder	2938794-2938853	60	NC_017139	Bacillus megaterium WSH-002 plasmid WSH-002_p1, complete sequence	1318-1377	7	0.883
CP035402_2	2.1\|2938794\|60\|CP035402\|CRISPRCasFinder	2938794-2938853	60	NZ_CP010587	Bacillus megaterium Q3 plasmid p1, complete sequence	838-897	7	0.883
CP035402_2	2.1\|2938794\|60\|CP035402\|CRISPRCasFinder	2938794-2938853	60	NZ_CP023319	Bacillus megaterium strain A plasmid p2, complete sequence	75825-75884	7	0.883
CP035402_2	2.1\|2938794\|60\|CP035402\|CRISPRCasFinder	2938794-2938853	60	NC_020451	Vibrio coralliilyticus strain ATCC BAA-450 plasmid, complete sequence	1960-2019	9	0.85
CP035402_2	2.1\|2938794\|60\|CP035402\|CRISPRCasFinder	2938794-2938853	60	NZ_CP015440	Anoxybacillus amylolyticus strain DSM 15939 plasmid pDSM15939_2, complete sequence	64773-64832	12	0.8
CP035402_2	2.1\|2938794\|60\|CP035402\|CRISPRCasFinder	2938794-2938853	60	NZ_CP033045	Bacillus foraminis strain Bac44 plasmid unnamed, complete sequence	483791-483850	13	0.783
CP035402_2	2.1\|2938794\|60\|CP035402\|CRISPRCasFinder	2938794-2938853	60	NZ_LR134399	Listeria monocytogenes strain NCTC7974 plasmid 2, complete sequence	57361-57420	14	0.767

1. spacer 2.1|2938794|60|CP035402|CRISPRCasFinder matches to NZ_CP024037 (Bacillus aryabhattai strain K13 plasmid unnamed2) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

2. spacer 2.1|2938794|60|CP035402|CRISPRCasFinder matches to NZ_CP026740 (Bacillus megaterium strain YC4-R4 plasmid unnamed4) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

3. spacer 2.1|2938794|60|CP035402|CRISPRCasFinder matches to NC_017139 (Bacillus megaterium WSH-002 plasmid WSH-002_p1, complete sequence) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

4. spacer 2.1|2938794|60|CP035402|CRISPRCasFinder matches to NZ_CP010587 (Bacillus megaterium Q3 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

5. spacer 2.1|2938794|60|CP035402|CRISPRCasFinder matches to NZ_CP023319 (Bacillus megaterium strain A plasmid p2, complete sequence) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

6. spacer 2.1|2938794|60|CP035402|CRISPRCasFinder matches to NC_020451 (Vibrio coralliilyticus strain ATCC BAA-450 plasmid, complete sequence) position: , mismatch: 9, identity: 0.85

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcattttagttatggcccggg	Protospacer
****************************************** ***   * ***  **.

7. spacer 2.1|2938794|60|CP035402|CRISPRCasFinder matches to NZ_CP015440 (Anoxybacillus amylolyticus strain DSM 15939 plasmid pDSM15939_2, complete sequence) position: , mismatch: 12, identity: 0.8

cagcttggaaggctgaggttttaccactaaactacacccgca-------atttttatttg	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcataataatatataccattg	Protospacer
******************************************       ** * .  ***

8. spacer 2.1|2938794|60|CP035402|CRISPRCasFinder matches to NZ_CP033045 (Bacillus foraminis strain Bac44 plasmid unnamed, complete sequence) position: , mismatch: 13, identity: 0.783

cagcttggaaggctgaggttttaccactaaactacacccgc--------aatttttattt	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatggttaaaagttttgcca	Protospacer
*****************************************        ** ****...

9. spacer 2.1|2938794|60|CP035402|CRISPRCasFinder matches to NZ_LR134399 (Listeria monocytogenes strain NCTC7974 plasmid 2, complete sequence) position: , mismatch: 14, identity: 0.767

cagcttggaaggctgaggttttaccactaaactacacccgc---------aatttttatt	CRISPR spacer
cagcttggaaggctgtagttttaccactaaactacacccgcatagtaagtagttcttagt	Protospacer
*************** .************************         *.**.*** *

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

692038 : 700404

Synechococcus_phage(50.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAV99226.1\|692038_693334_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	5.9e-19	25.7
QAV99227.1\|693407_694133_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0E3G7P8	Synechococcus_phage	1.2e-45	44.1
QAV99228.1\|694125_694380_+	phosphoribosylformylglycinamidine synthase, purS protein	NA	NA	NA	NA
QAV99229.1\|694376_695060_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
QAV99230.1\|695043_697272_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	6.5e-159	40.1
QAV99231.1\|697247_698678_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.2e-52	32.5
QAV99232.1\|698779_699820_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	1.7e-64	42.0
QAV99233.1\|699816_700404_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	2.4e-28	41.0

DBSCAN-SWA_2

1184560 : 1232883

Planktothrix_phage(22.22%)

coat,tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAV99673.1\|1184560_1185711_-\|transposase	IS3 family transposase	A0A0N9SIX5	Staphylococcus_phage	1.7e-38	61.2
QAW02449.1\|1185888_1186068_+	YjzC family protein	NA	NA	NA	NA
QAV99674.1\|1186114_1186300_-	DUF2929 domain-containing protein	NA	NA	NA	NA
QAV99675.1\|1186548_1187283_+	hypothetical protein	NA	NA	NA	NA
QAV99676.1\|1187364_1187922_+	hypothetical protein	NA	NA	NA	NA
QAV99677.1\|1188012_1188966_+	BMP family ABC transporter substrate-binding protein	NA	NA	NA	NA
QAV99678.1\|1188980_1189172_+	competence protein ComG	NA	NA	NA	NA
QAV99679.1\|1189201_1189441_-	hypothetical protein	NA	NA	NA	NA
QAV99680.1\|1189605_1190544_+	beta-ketoacyl-ACP synthase III	NA	NA	NA	NA
QAV99681.1\|1190566_1191808_+	beta-ketoacyl-[acyl-carrier-protein] synthase II	NA	NA	NA	NA
QAV99682.1\|1191883_1192669_+	hypothetical protein	NA	NA	NA	NA
QAV99683.1\|1192860_1193847_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.7e-22	32.9
QAV99684.1\|1193843_1194833_+	dipeptide ABC transporter ATP-binding protein	F2Y302	Organic_Lake_phycodnavirus	6.7e-07	26.1
QAV99685.1\|1194920_1196552_+	peptide-binding protein	NA	NA	NA	NA
QAV99686.1\|1196627_1197578_+	peptide ABC transporter permease	NA	NA	NA	NA
QAV99687.1\|1197594_1198506_+	ABC transporter permease	NA	NA	NA	NA
QAV99688.1\|1198711_1199464_+	DUF3603 family protein	A0A0A0RP53	Bacillus_phage	5.4e-49	43.9
QAV99689.1\|1199498_1200491_-\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
QAV99690.1\|1201234_1202872_+	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
QAV99691.1\|1202979_1203915_+	ABC transporter permease	NA	NA	NA	NA
QAV99692.1\|1203918_1204836_+	peptide ABC transporter permease	NA	NA	NA	NA
QAV99693.1\|1204840_1205917_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.1e-17	30.8
QAV99694.1\|1205918_1206836_+	ATP-binding cassette domain-containing protein	M1HP82	Acanthocystis_turfacea_Chlorella_virus	1.2e-05	24.6
QAV99695.1\|1206942_1208160_+	MFS transporter	NA	NA	NA	NA
QAV99696.1\|1208324_1208903_+	N-acetyltransferase	NA	NA	NA	NA
QAV99697.1\|1209083_1209479_+	transcriptional regulator Spx	NA	NA	NA	NA
QAV99698.1\|1209521_1210178_-	TerC family protein	A0A2R2YAT9	Pseudomonas_phage	1.1e-29	38.0
QAV99699.1\|1210347_1210488_+	hypothetical protein	NA	NA	NA	NA
QAV99700.1\|1210454_1211111_+	adaptor protein MecA	NA	NA	NA	NA
QAV99701.1\|1211105_1211228_-	hypothetical protein	NA	NA	NA	NA
QAV99702.1\|1211271_1212423_+	competence protein CoiA	NA	NA	NA	NA
QAV99703.1\|1212469_1214482_+	oligoendopeptidase F	NA	NA	NA	NA
QAV99704.1\|1214519_1214687_-	hypothetical protein	NA	NA	NA	NA
QAV99705.1\|1214782_1214983_-	hypothetical protein	NA	NA	NA	NA
QAV99706.1\|1215001_1215901_-	DsbA family protein	NA	NA	NA	NA
QAV99707.1\|1215897_1216296_-	thiol management oxidoreductase	NA	NA	NA	NA
QAW02450.1\|1216550_1217096_-	lytic transglycosylase domain-containing protein	A0A1P8CWQ1	Bacillus_phage	5.1e-41	73.7
QAV99708.1\|1217299_1217872_-	CYTH domain-containing protein	NA	NA	NA	NA
QAV99709.1\|1217996_1218365_+	hypothetical protein	NA	NA	NA	NA
QAW02451.1\|1218393_1219029_+	GTP pyrophosphokinase YjbM	NA	NA	NA	NA
QAV99710.1\|1219047_1219848_+	NAD(+) kinase	NA	NA	NA	NA
QAW02452.1\|1219910_1220762_+	RluA family pseudouridine synthase	NA	NA	NA	NA
QAV99711.1\|1220774_1221509_-	bis(5'-nucleosyl)-tetraphosphatase PrpE	A8E2N0	Enterococcus_phage	7.2e-06	24.8
QAV99712.1\|1221744_1223589_+	sodium:proton antiporter	NA	NA	NA	NA
QAV99713.1\|1223837_1224497_+	thiaminase II	NA	NA	NA	NA
QAV99714.1\|1224471_1225089_+	thiazole tautomerase TenI	NA	NA	NA	NA
QAV99715.1\|1225072_1226182_+	glycine oxidase ThiO	NA	NA	NA	NA
QAW02453.1\|1226181_1226382_+	sulfur carrier protein ThiS	NA	NA	NA	NA
QAV99716.1\|1226378_1227149_+	thiazole synthase	NA	NA	NA	NA
QAV99717.1\|1227145_1228156_+	thiazole biosynthesis adenylyltransferase ThiF	NA	NA	NA	NA
QAV99718.1\|1228174_1228990_+	bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase	NA	NA	NA	NA
QAV99719.1\|1229125_1229902_+	enoyl-[acyl-carrier-protein] reductase FabI	NA	NA	NA	NA
QAV99720.1\|1230002_1230686_+\|coat	spore coat protein	NA	NA	NA	NA
QAV99721.1\|1230778_1231228_-\|coat	spore coat protein	NA	NA	NA	NA
QAV99722.1\|1231355_1231844_-\|coat	spore coat protein	NA	NA	NA	NA
QAV99723.1\|1231995_1232478_-\|coat	spore coat protein	NA	NA	NA	NA
QAV99724.1\|1232562_1232883_-\|coat	spore coat protein	NA	NA	NA	NA

DBSCAN-SWA_3

1261340 : 1338910

uncultured_Caudovirales_phage(27.5%)

plate,terminase,portal,transposase,tail,coat,tRNA,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAV99750.1\|1261340_1262552_+\|transposase	IS256 family transposase	A0A220NQR7	Corynebacterium_phage	2.2e-23	26.8
QAV99751.1\|1262682_1263189_-	N-acetyltransferase	NA	NA	NA	NA
QAV99752.1\|1263407_1263803_-	hypothetical protein	NA	NA	NA	NA
QAV99753.1\|1264031_1264511_+\|tRNA	Cys-tRNA(Pro) deacylase	NA	NA	NA	NA
QAV99754.1\|1264550_1264706_-	DUF4177 domain-containing protein	NA	NA	NA	NA
QAV99755.1\|1264735_1265065_-	DUF4306 domain-containing protein	NA	NA	NA	NA
QAV99756.1\|1265471_1265666_+	hypothetical protein	NA	NA	NA	NA
QAV99757.1\|1265684_1266674_-	protoheme IX farnesyltransferase	NA	NA	NA	NA
QAV99758.1\|1266796_1267045_-\|coat	spore coat protein CotT	NA	NA	NA	NA
QAV99759.1\|1267298_1268702_+	DUF4163 domain-containing protein	NA	NA	NA	NA
QAV99760.1\|1268741_1269215_-	DUF2690 domain-containing protein	NA	NA	NA	NA
QAV99761.1\|1269339_1269507_-	putative motility protein	NA	NA	NA	NA
QAV99762.1\|1269633_1270533_+	hypothetical protein	NA	NA	NA	NA
QAV99763.1\|1270542_1270941_-	DUF2809 domain-containing protein	NA	NA	NA	NA
QAV99764.1\|1271041_1271617_-	DUF4309 domain-containing protein	NA	NA	NA	NA
QAV99765.1\|1274708_1275254_+	DUF1641 domain-containing protein	NA	NA	NA	NA
QAW02456.1\|1275463_1276108_+	DUF4352 domain-containing protein	NA	NA	NA	NA
QAV99766.1\|1276183_1276810_+	NUDIX domain-containing protein	NA	NA	NA	NA
QAV99767.1\|1276840_1277119_-	hypothetical protein	NA	NA	NA	NA
QAV99768.1\|1277509_1278700_+	cytochrome P450	NA	NA	NA	NA
QAV99769.1\|1278722_1279901_+	UDP-glucosyltransferase	Q0IKX4	Leucania_separata_nucleopolyhedrovirus	5.6e-08	28.3
QAV99770.1\|1279941_1280130_-	hypothetical protein	A0A1P8CWV7	Bacillus_phage	3.4e-21	77.6
QAV99771.1\|1280303_1281116_+	uroporphyrinogen-III synthase	NA	NA	NA	NA
QAV99772.1\|1281161_1281914_-	iron export ABC transporter permease subunit FetB	NA	NA	NA	NA
QAV99773.1\|1281913_1282666_-	phosphate ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.4e-18	31.4
QAV99774.1\|1282785_1283760_-	multidrug resistance efflux transporter family protein	NA	NA	NA	NA
QAV99775.1\|1284776_1285199_+	DUF1641 domain-containing protein	NA	NA	NA	NA
QAV99776.1\|1285238_1286417_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
QAV99777.1\|1286614_1288036_+	glucuronate isomerase	NA	NA	NA	NA
QAV99778.1\|1289586_1290600_+	ureidoglycolate dehydrogenase	NA	NA	NA	NA
QAV99779.1\|1290605_1291625_+	zinc-binding alcohol dehydrogenase family protein	NA	NA	NA	NA
QAV99780.1\|1291649_1292729_+	mannonate dehydratase	NA	NA	NA	NA
QAV99781.1\|1292725_1293562_+	SDR family NAD(P)-dependent oxidoreductase	M1NMS3	Moumouvirus	2.7e-09	30.4
QAV99782.1\|1293609_1294878_+	MFS transporter	NA	NA	NA	NA
QAV99783.1\|1294965_1295967_+	LacI family transcriptional regulator	NA	NA	NA	NA
QAV99784.1\|1296041_1297484_+	tagaturonate reductase	NA	NA	NA	NA
QAV99785.1\|1297480_1298974_+	altronate dehydratase	NA	NA	NA	NA
QAV99786.1\|1299012_1299777_-	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
QAV99787.1\|1299995_1300460_-	hypothetical protein	NA	NA	NA	NA
QAV99788.1\|1301750_1302901_-\|transposase	IS3 family transposase	A0A0N9SIX5	Staphylococcus_phage	1.7e-38	61.2
QAV99789.1\|1303313_1304450_+	tetratricopeptide repeat protein	A0A1P8CWN8	Bacillus_phage	4.9e-94	47.4
QAV99790.1\|1304439_1304574_+	phosphatase RapA inhibitor PhrA	NA	NA	NA	NA
QAV99791.1\|1304971_1305925_+	LysM peptidoglycan-binding domain-containing protein	A0A218KC88	Bacillus_phage	1.6e-66	73.8
QAW02457.1\|1305964_1306342_-	PH domain-containing protein	A5GYQ0	Lactococcus_phage	7.9e-17	42.3
QAV99792.1\|1306446_1307049_+	hypothetical protein	F8WQ53	Bacillus_phage	1.4e-44	48.7
QAV99793.1\|1307125_1307962_+	manganese catalase family protein	NA	NA	NA	NA
QAV99794.1\|1308005_1308602_-	ImmA/IrrE family metallo-endopeptidase	A0A2H4JA43	uncultured_Caudovirales_phage	8.1e-40	51.7
QAV99795.1\|1308764_1309106_-	XRE family transcriptional regulator	A0A2H4J6F9	uncultured_Caudovirales_phage	1.3e-18	45.8
QAV99796.1\|1309284_1309464_+	hypothetical protein	NA	NA	NA	NA
QAV99797.1\|1309450_1310287_+\|portal	phage portal protein	S6BFM4	Thermus_phage	6.7e-24	27.8
QAV99798.1\|1310186_1310987_+	ATP-binding protein	A6XMI1	Bacillus_virus	5.0e-61	51.7
QAV99799.1\|1310986_1311154_+	hypothetical protein	NA	NA	NA	NA
QAV99800.1\|1311238_1311589_+\|portal	phage portal protein	NA	NA	NA	NA
QAV99801.1\|1311585_1311792_+	phage-like element PBSX protein XtrA	A0A2H4J4M6	uncultured_Caudovirales_phage	2.1e-11	50.0
QAV99802.1\|1311907_1312417_+	sigma-70 family RNA polymerase sigma factor	A0A1L2JY33	Aeribacillus_phage	6.5e-22	39.2
QAV99803.1\|1312532_1313330_+\|terminase	PBSX phage terminase small subunit	A0A0S2MVB6	Bacillus_phage	8.0e-59	50.2
QAV99804.1\|1313326_1314628_+\|terminase	PBSX family phage terminase large subunit	A0A2P1JTW5	Anoxybacillus_phage	9.1e-153	60.0
QAV99805.1\|1314631_1316119_+\|portal	phage portal protein	A0A1B1P7C8	Bacillus_phage	1.7e-139	55.7
QAV99806.1\|1316138_1316966_+	phage-like element PBSX protein XkdF	A0A1B1P7E4	Bacillus_phage	2.1e-54	58.7
QAV99807.1\|1316991_1317927_+	phage-like element PBSX protein XkdG	A0A1B1P7E3	Bacillus_phage	1.1e-104	63.8
QAV99808.1\|1317948_1318332_+	DUF3199 family protein	A0A1B1P7D6	Bacillus_phage	4.9e-14	41.1
QAV99809.1\|1318328_1318685_+	DUF3599 family protein	NA	NA	NA	NA
QAV99810.1\|1318681_1319167_+	HK97 gp10 family phage protein	A0A249XXA4	Clostridium_phage	9.5e-39	47.7
QAV99811.1\|1319179_1319620_+	phage-like element PBSX protein XkdJ	NA	NA	NA	NA
QAV99812.1\|1319623_1319842_+	hypothetical protein	NA	NA	NA	NA
QAV99813.1\|1319838_1321239_+\|tail	phage tail sheath protein	A0A0A7S087	Clostridium_phage	3.0e-77	39.3
QAV99814.1\|1321240_1321684_+	phage-like element PBSX protein XkdM	A0A0K2CNG3	Brevibacillus_phage	1.1e-25	45.2
QAV99815.1\|1321768_1322215_+\|portal	phage portal protein	A0A0A7RTY8	Clostridium_phage	1.0e-10	36.8
QAW02458.1\|1322256_1322397_+	hypothetical protein	NA	NA	NA	NA
QAV99816.1\|1322397_1327401_+\|portal	phage portal protein	A0A2H4JA91	uncultured_Caudovirales_phage	6.4e-37	44.8
QAV99817.1\|1327393_1328053_+	LysM peptidoglycan-binding domain-containing protein	A0A0A8WJR4	Clostridium_phage	1.1e-24	33.2
QAW02459.1\|1328068_1329046_+	phage-like element PBSX protein XkdQ	H7BV96	unidentified_phage	1.0e-39	32.6
QAV99818.1\|1329045_1329312_+	DUF2577 domain-containing protein	S6C459	Thermus_phage	1.7e-05	36.4
QAV99819.1\|1329368_1329794_+	DUF2634 domain-containing protein	A0A2H4J6K5	uncultured_Caudovirales_phage	7.8e-13	38.0
QAV99820.1\|1329786_1330833_+\|plate	baseplate J/gp47 family protein	S6AVU3	Thermus_phage	5.7e-73	44.3
QAV99821.1\|1330816_1331395_+	DUF2313 domain-containing protein	A0A2H4J717	uncultured_Caudovirales_phage	2.3e-15	33.1
QAV99822.1\|1331391_1331664_+	hypothetical protein	NA	NA	NA	NA
QAV99823.1\|1331666_1333730_+\|terminase	terminase	A0A2H4J4R1	uncultured_Caudovirales_phage	2.6e-29	34.5
QAV99824.1\|1333741_1334071_+\|portal	phage portal protein	A0A2H4JCI0	uncultured_Caudovirales_phage	1.3e-15	40.7
QAV99825.1\|1334067_1334232_+	XkdX family protein	A0A2H4JAA1	uncultured_Caudovirales_phage	1.9e-15	67.9
QAV99826.1\|1334278_1335118_+\|portal	phage portal protein	NA	NA	NA	NA
QAV99827.1\|1335170_1335440_+	protein xhlA	A0A2H4JD40	uncultured_Caudovirales_phage	1.4e-23	64.8
QAV99828.1\|1335452_1335716_+\|holin	phage holin	A0A2H4J6M0	uncultured_Caudovirales_phage	6.1e-24	64.4
QAV99829.1\|1335728_1336622_+	LysM peptidoglycan-binding domain-containing protein	Q9ZXD7	Bacillus_phage	1.8e-83	69.7
QAV99830.1\|1336659_1336797_-	hypothetical protein	NA	NA	NA	NA
QAV99831.1\|1336882_1337053_-	type II toxin-antitoxin system SpoIISB family antitoxin	NA	NA	NA	NA
QAV99832.1\|1337052_1337799_-	type II toxin-antitoxin system SpoIISA family toxin	NA	NA	NA	NA
QAV99833.1\|1337908_1338910_-	inorganic phosphate transporter	E5ES24	Ostreococcus_lucimarinus_virus	8.6e-10	28.7

DBSCAN-SWA_4

1771588 : 1854076

Bacillus_phage(59.62%)

protease,terminase,portal,integrase,transposase,head,tail,plate,capsid,coat,tRNA,holin

attL 1784441:1784460|attR 1849485:1849504

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAW00253.1\|1771588_1772122_+\|terminase	phage terminase small subunit P27 family	Q9ZXG2	Bacillus_phage	1.0e-70	82.5
QAW00254.1\|1772372_1773620_-\|transposase	IS256-like element ISBsu2 family transposase	A0A220NQR7	Corynebacterium_phage	2.6e-24	22.6
QAW00255.1\|1774660_1775116_-	hypothetical protein	NA	NA	NA	NA
QAW00256.1\|1775270_1775828_-	hypothetical protein	NA	NA	NA	NA
QAW00257.1\|1775948_1776563_+	TetR family transcriptional regulator	NA	NA	NA	NA
QAW00258.1\|1776698_1777055_-	hypothetical protein	NA	NA	NA	NA
QAW00259.1\|1777133_1777958_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
QAW00260.1\|1778068_1779397_-\|protease	serine protease	A0A1B0T6A2	Bacillus_phage	9.3e-28	33.6
QAW00261.1\|1779621_1779855_+	hypothetical protein	NA	NA	NA	NA
QAW00262.1\|1780134_1780842_+	hypothetical protein	F8WQ53	Bacillus_phage	3.2e-51	56.9
QAW00263.1\|1780911_1781364_+	OsmC family peroxiredoxin	NA	NA	NA	NA
QAW00264.1\|1781377_1781731_-	multidrug efflux SMR transporter subunit EbrB	NA	NA	NA	NA
QAW02472.1\|1781744_1782062_-	multidrug efflux SMR transporter subunit EbrA	NA	NA	NA	NA
QAW00265.1\|1782198_1782474_-	hypothetical protein	NA	NA	NA	NA
QAW00266.1\|1782562_1782976_+	hypothetical protein	NA	NA	NA	NA
QAW00267.1\|1783075_1784020_+\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
QAW00268.1\|1784059_1784281_+	RNA chaperone Hfq	NA	NA	NA	NA
1784441:1784460	attL	NA	NA	NA	NA
QAW00269.1\|1784476_1784749_+	hypothetical protein	NA	NA	NA	NA
QAW00270.1\|1784830_1785061_+	hypothetical protein	NA	NA	NA	NA
QAW00271.1\|1785302_1785695_+	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	G3MBF1	Bacillus_virus	2.5e-29	58.3
QAW00272.1\|1785654_1787757_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	U5PY35	Bacillus_phage	0.0e+00	86.8
QAW00273.1\|1787774_1788764_+	class 1b ribonucleoside-diphosphate reductase subunit beta	F8WQ21	Bacillus_phage	1.9e-155	83.5
QAW00274.1\|1788813_1789434_+	hypothetical protein	A0A127AYS1	Bacillus_phage	1.6e-46	48.4
QAW00275.1\|1789497_1790265_-	N-acetylmuramoyl-L-alanine amidase	E5DV68	Deep-sea_thermophilic_phage	1.2e-51	49.5
QAW00276.1\|1790905_1791874_+	stage V sporulation protein K	G3MAX6	Bacillus_virus	5.2e-52	40.5
QAW00277.1\|1792006_1793269_+	GTPase HflX	NA	NA	NA	NA
QAW00278.1\|1793286_1794552_+	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
QAW00279.1\|1794661_1795069_+	transcriptional repressor GlnR	NA	NA	NA	NA
QAW00280.1\|1795127_1796462_+	type I glutamate--ammonia ligase	NA	NA	NA	NA
QAW00281.1\|1796574_1797732_-\|integrase	site-specific integrase	A0A0M5M609	Bacillus_phage	8.3e-65	38.9
QAW00282.1\|1797747_1798803_-	ImmA/IrrE family metallo-endopeptidase	A0A0F6N3H6	Staphylococcus_phage	1.7e-08	24.2
QAW00283.1\|1798786_1799173_-	XRE family transcriptional regulator	R9W020	Paenibacillus_phage	9.0e-08	31.4
QAW00284.1\|1799297_1799516_+	XRE family transcriptional regulator	A0A0K2CZL1	Paenibacillus_phage	2.1e-17	63.2
QAW00285.1\|1799630_1800395_+	Rha family transcriptional regulator	A8ATN0	Listeria_phage	1.0e-47	49.1
QAW00286.1\|1800410_1800722_+	DNA-binding protein	NA	NA	NA	NA
QAW02473.1\|1800782_1800974_+	hypothetical protein	Q9ZXD0	Bacillus_phage	7.1e-06	53.1
QAW00287.1\|1800970_1801246_+	hypothetical protein	Q9ZXC9	Bacillus_phage	1.2e-19	47.1
QAW00288.1\|1801441_1801996_+	hypothetical protein	Q9ZXC8	Bacillus_phage	3.1e-94	96.2
QAW00289.1\|1801999_1802935_+	hypothetical protein	Q9ZXC7	Bacillus_phage	2.0e-170	96.5
QAW00290.1\|1802924_1803239_+	hypothetical protein	Q9ZXC6	Bacillus_phage	1.5e-53	99.0
QAW00291.1\|1803259_1803697_+	DUF669 domain-containing protein	Q9ZXC5	Bacillus_phage	1.3e-79	97.2
QAW00292.1\|1803757_1806175_+	DNA primase	D6R422	Bacillus_phage	0.0e+00	88.7
QAW00293.1\|1806374_1806812_+	hypothetical protein	Q9ZXC3	Bacillus_phage	4.8e-74	91.7
QAW00294.1\|1806808_1807348_+	nuclease	Q9ZXC2	Bacillus_phage	6.7e-94	95.5
QAW00295.1\|1807381_1807897_+	hypothetical protein	D6R425	Bacillus_phage	1.7e-94	96.5
QAW00296.1\|1807897_1808089_+	hypothetical protein	D6R426	Bacillus_phage	8.1e-18	80.4
QAW00297.1\|1808054_1808510_+	hypothetical protein	D9J0I1	Brochothrix_phage	1.1e-15	41.2
QAW00298.1\|1808506_1808710_+	hypothetical protein	NA	NA	NA	NA
QAW00299.1\|1808795_1809209_+	ArpU family transcriptional regulator	D6R428	Bacillus_phage	4.7e-63	98.5
QAW00300.1\|1809582_1810068_+	hypothetical protein	NA	NA	NA	NA
QAW00301.1\|1810170_1810554_+	HNH endonuclease	A0A075M5R4	Enterococcus_phage	1.1e-18	44.2
QAW00302.1\|1810556_1810763_+	hypothetical protein	NA	NA	NA	NA
QAW00303.1\|1811001_1811496_+\|terminase	phage terminase small subunit P27 family	A0A1Q1PVW3	Staphylococcus_phage	9.1e-21	36.1
QAW00304.1\|1811488_1813195_+\|terminase	terminase large subunit	A0A2H4JC16	uncultured_Caudovirales_phage	1.9e-121	42.8
QAW00305.1\|1813211_1813418_+	hypothetical protein	NA	NA	NA	NA
QAW00306.1\|1813422_1814649_+\|portal	phage portal protein	A0A2H4J331	uncultured_Caudovirales_phage	2.0e-69	38.5
QAW00307.1\|1814641_1815238_+\|head,protease	HK97 family phage prohead protease	A0A1J0MFL1	Staphylococcus_phage	3.6e-48	53.3
QAW00308.1\|1815286_1816489_+\|capsid	phage major capsid protein	A0A2H4J824	uncultured_Caudovirales_phage	8.3e-76	49.8
QAW00309.1\|1816516_1816900_+	collagen-like protein	D6R3Z0	Bacillus_phage	1.4e-05	56.8
QAW00310.1\|1816954_1817248_+\|head,tail	phage gp6-like head-tail connector protein	A0A2H4JB77	uncultured_Caudovirales_phage	2.6e-07	33.0
QAW00311.1\|1817237_1817564_+\|head,tail	head-tail adaptor protein	NA	NA	NA	NA
QAW00312.1\|1817563_1817956_+\|tail	phage tail protein	A0A0M5M1E5	Enterococcus_phage	3.0e-11	37.9
QAW00313.1\|1817952_1818360_+	hypothetical protein	NA	NA	NA	NA
QAW00314.1\|1818365_1818950_+\|tail	major tail protein	U5U3Z7	Lactobacillus_phage	9.1e-28	36.5
QAW00315.1\|1819009_1819372_+	hypothetical protein	NA	NA	NA	NA
QAW00316.1\|1819383_1819566_+	hypothetical protein	NA	NA	NA	NA
QAW00317.1\|1819628_1823369_+	hypothetical protein	A0A0S2SXL7	Bacillus_phage	9.1e-105	60.4
QAW00318.1\|1823381_1824215_+\|tail	phage tail family protein	M4ZS20	Bacillus_phage	3.5e-33	34.1
QAW00319.1\|1824228_1826103_+	autolysin	D6R400	Bacillus_phage	5.5e-50	27.8
QAW00320.1\|1827727_1828951_+\|plate	phage baseplate upper protein	M4ZRP1	Bacillus_phage	1.4e-163	75.2
QAW00321.1\|1828966_1829266_+	hypothetical protein	M4ZR44	Bacillus_phage	2.0e-39	79.2
QAW00322.1\|1829262_1829433_+	XkdX family protein	NA	NA	NA	NA
QAW00323.1\|1829484_1829697_+	hypothetical protein	A0A290GDY2	Caldibacillus_phage	1.9e-15	59.4
QAW00324.1\|1829711_1829975_+\|holin	phage holin	A0A2H4J6M0	uncultured_Caudovirales_phage	2.7e-24	66.7
QAW00325.1\|1830030_1831008_+	LysM peptidoglycan-binding domain-containing protein	A0A218KC88	Bacillus_phage	2.0e-64	71.4
QAW00326.1\|1831053_1831518_-	SMI1/KNR4 family protein	NA	NA	NA	NA
QAW00327.1\|1831536_1833300_-	hypothetical protein	A0A1P8CWI7	Bacillus_phage	3.3e-121	52.3
QAW02474.1\|1833469_1833541_+	hypothetical protein	NA	NA	NA	NA
QAW00328.1\|1833556_1834642_-	DUF4917 family protein	NA	NA	NA	NA
QAW00329.1\|1834678_1834879_-	hypothetical protein	NA	NA	NA	NA
QAW00330.1\|1836001_1836490_+	hypothetical protein	NA	NA	NA	NA
QAW00331.1\|1836670_1837522_+	toxin	O64021	Bacillus_phage	1.4e-85	60.3
QAW00332.1\|1837820_1838072_+	hypothetical protein	NA	NA	NA	NA
QAW00333.1\|1838308_1839067_-	ATP-binding protein	U5N3V8	Enterobacteria_phage	5.8e-43	38.6
QAW02475.1\|1839063_1840611_-\|transposase	IS21 family transposase	NA	NA	NA	NA
QAW02476.1\|1840708_1841176_+	SMI1/KNR4 family protein	NA	NA	NA	NA
QAW00334.1\|1843474_1844110_-	thermonuclease family protein	A0A1P8CWK6	Bacillus_phage	7.7e-73	68.5
QAW00335.1\|1844522_1845938_+	sugar porter family MFS transporter	NA	NA	NA	NA
QAW00336.1\|1846039_1847224_-	alanine racemase	NA	NA	NA	NA
QAW00337.1\|1847634_1848060_-	endonuclease	NA	NA	NA	NA
QAW00338.1\|1848978_1849413_+	dUTP diphosphatase	A0A1P8CX51	Bacillus_phage	5.8e-72	92.3
QAW00339.1\|1849998_1850259_-	hypothetical protein	NA	NA	NA	NA
1849485:1849504	attR	NA	NA	NA	NA
QAW00340.1\|1850663_1850828_+	hypothetical protein	NA	NA	NA	NA
QAW00341.1\|1851102_1851942_+	thymidylate synthase	A0A1P8CX42	Bacillus_phage	5.6e-164	98.2
QAW00342.1\|1852064_1852352_-	hypothetical protein	NA	NA	NA	NA
QAW00343.1\|1852394_1853114_-	hypothetical protein	NA	NA	NA	NA
QAW00344.1\|1853273_1853630_-	hypothetical protein	NA	NA	NA	NA
QAW00345.1\|1853875_1854076_-\|coat	spore coat protein CotC	NA	NA	NA	NA

DBSCAN-SWA_5

2008411 : 2018500

Bacillus_phage(77.78%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAW00479.1\|2008411_2009170_+	ATP-binding protein	U5N3V8	Enterobacteria_phage	5.8e-43	38.6
QAW00480.1\|2010883_2011219_+	hypothetical protein	A0A1P8CWM9	Bacillus_phage	4.2e-54	100.0
QAW00481.1\|2011262_2011622_-	hypothetical protein	A0A1P8CWJ9	Bacillus_phage	2.9e-61	99.2
QAW02485.1\|2011881_2011965_+\|holin	putative holin-like toxin	NA	NA	NA	NA
QAW00482.1\|2012253_2012787_-	N-acetyltransferase	O64026	Bacillus_phage	4.0e-99	98.9
QAW00483.1\|2012822_2013401_-	SMI1/KNR4 family protein	O64025	Bacillus_phage	1.4e-100	93.2
QAW00484.1\|2013456_2013915_-	SMI1/KNR4 family protein	A0A1P8CWJ1	Bacillus_phage	9.2e-68	82.2
QAW00485.1\|2014007_2014466_-	SMI1/KNR4 family protein	NA	NA	NA	NA
QAW00486.1\|2014475_2016278_-	hypothetical protein	A0A1P8CWI7	Bacillus_phage	1.3e-218	87.0
QAW00487.1\|2016378_2016936_-	SMI1/KNR4 family protein	O64022	Bacillus_phage	5.3e-102	95.1
QAW00488.1\|2017063_2018500_+	flavin monoamine oxidase family protein	A0A2K9L3H9	Tupanvirus	7.5e-07	41.8

DBSCAN-SWA_6

2232233 : 2238329

Staphylococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAW00725.1\|2232233_2232827_-	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	2.0e-14	35.4
QAW02493.1\|2232816_2233572_-	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	5.5e-09	29.2
QAW00726.1\|2233852_2234377_+	DUF309 domain-containing protein	NA	NA	NA	NA
QAW00727.1\|2234390_2234765_-	GNAT family N-acetyltransferase RibT	NA	NA	NA	NA
QAW00728.1\|2234877_2235342_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	5.5e-44	60.0
QAW00729.1\|2235374_2236571_-	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	6.9e-115	54.9
QAW00730.1\|2236585_2237233_-	riboflavin synthase subunit alpha	A0A2H4PQS5	Staphylococcus_phage	8.5e-43	45.9
QAW00731.1\|2237243_2238329_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	5.1e-56	36.1

DBSCAN-SWA_7

3232495 : 3282851

Bacillus_phage(72.5%)

protease,tail,portal,head,terminase,capsid,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAW01681.1\|3232495_3234079_+	hypothetical protein	A0A1P8CWI7	Bacillus_phage	4.2e-75	59.7
QAW01682.1\|3234093_3234483_+	hypothetical protein	NA	NA	NA	NA
QAW01683.1\|3234672_3235428_+	hypothetical protein	NA	NA	NA	NA
QAW01684.1\|3235468_3236410_-	LysM peptidoglycan-binding domain-containing protein	Q9ZXD7	Bacillus_phage	3.0e-97	77.1
QAW01685.1\|3236451_3236874_-\|holin	holin family protein	D6R405	Bacillus_phage	3.0e-57	85.7
QAW01686.1\|3236927_3237098_-	XkdX family protein	NA	NA	NA	NA
QAW01687.1\|3237094_3237394_-	hypothetical protein	M4ZR44	Bacillus_phage	1.5e-39	79.2
QAW01688.1\|3237409_3238633_-	DUF2479 domain-containing protein	M4ZRP1	Bacillus_phage	1.1e-176	79.6
QAW01689.1\|3238669_3240244_-	hypothetical protein	M4ZSB3	Bacillus_phage	1.1e-264	88.7
QAW01690.1\|3240280_3241978_-	alkaline phosphatase	D6R400	Bacillus_phage	3.2e-267	79.5
QAW01691.1\|3241989_3242829_-\|tail	phage tail family protein	D6R3Z9	Bacillus_phage	8.5e-136	83.2
QAW01692.1\|3242828_3246707_-\|tail	phage tail tape measure protein	D6R3Z8	Bacillus_phage	0.0e+00	81.0
QAW01693.1\|3246719_3246899_-	hypothetical protein	D6R3Z7	Bacillus_phage	1.6e-12	68.5
QAW01694.1\|3246901_3247240_-	hypothetical protein	Q9ZXE8	Bacillus_phage	3.0e-39	70.5
QAW01695.1\|3247294_3247906_-\|tail	phage tail protein	Q9ZXE9	Bacillus_phage	7.9e-99	89.7
QAW01696.1\|3247906_3248287_-	DUF3168 domain-containing protein	Q9ZXF0	Bacillus_phage	2.6e-39	66.1
QAW01697.1\|3248283_3248667_-	HK97 gp10 family phage protein	Q9ZXF1	Bacillus_phage	2.9e-59	86.6
QAW01698.1\|3248659_3249031_-\|head,tail	head-tail adaptor protein	Q9ZXF2	Bacillus_phage	3.5e-41	68.3
QAW01699.1\|3248963_3249311_-\|head,tail	phage gp6-like head-tail connector protein	Q9ZXF3	Bacillus_phage	2.0e-51	87.0
QAW01700.1\|3249326_3249818_-	collagen-like protein	D6R3Z0	Bacillus_phage	1.3e-27	69.1
QAW01701.1\|3249846_3250161_-	hypothetical protein	Q9ZXF5	Bacillus_phage	6.8e-30	68.8
QAW01702.1\|3250176_3251379_-\|capsid	phage major capsid protein	Q9ZXF6	Bacillus_phage	3.3e-157	71.5
QAW01703.1\|3251415_3252042_-\|head,protease	HK97 family phage prohead protease	Q9ZXF7	Bacillus_phage	1.8e-106	92.8
QAW01704.1\|3252031_3253279_-\|portal	phage portal protein	D6R3Y6	Bacillus_phage	1.3e-217	86.5
QAW01705.1\|3253284_3253500_-	hypothetical protein	Q9ZXF9	Bacillus_phage	1.3e-24	80.6
QAW01706.1\|3253512_3255222_-\|terminase	terminase large subunit	D6R3Y4	Bacillus_phage	0.0e+00	92.6
QAW01707.1\|3255221_3255755_-\|terminase	phage terminase small subunit P27 family	Q9ZXG2	Bacillus_phage	2.3e-70	81.9
QAW01708.1\|3256134_3256509_-	HNH endonuclease	Q38456	Bacillus_phage	7.5e-60	82.3
QAW01709.1\|3256558_3257305_-	hypothetical protein	NA	NA	NA	NA
QAW01710.1\|3257695_3258463_-	hypothetical protein	NA	NA	NA	NA
QAW01711.1\|3258613_3258979_-	hypothetical protein	NA	NA	NA	NA
QAW01712.1\|3260187_3260640_-	ArpU family transcriptional regulator	S6AVV9	Thermus_phage	3.4e-38	56.6
QAW01713.1\|3260893_3261094_-	hypothetical protein	NA	NA	NA	NA
QAW01714.1\|3261090_3261510_-	hypothetical protein	A0A2I6UHP7	Bacillus_phage	1.6e-42	61.2
QAW01715.1\|3261506_3261839_-	hypothetical protein	F8WQ59	Bacillus_phage	8.3e-18	53.3
QAW01716.1\|3261838_3262495_-	dUTPase	R9TQ23	Paenibacillus_phage	5.8e-39	46.0
QAW01717.1\|3262612_3262870_-	hypothetical protein	A0A2H4JA61	uncultured_Caudovirales_phage	6.6e-07	41.7
QAW01718.1\|3262866_3263274_-	hypothetical protein	W8CYU3	Bacillus_phage	1.3e-25	45.8
QAW01719.1\|3263270_3263588_-	hypothetical protein	NA	NA	NA	NA
QAW01720.1\|3263584_3263947_-	VWA domain-containing protein	NA	NA	NA	NA
QAW01721.1\|3263989_3264187_-	hypothetical protein	NA	NA	NA	NA
QAW01722.1\|3264433_3264574_-	BH0509 family protein	NA	NA	NA	NA
QAW01723.1\|3264681_3265230_-	hypothetical protein	NA	NA	NA	NA
QAW02548.1\|3265544_3266372_-	ATP-binding protein	A0A0U3U1U1	Bacillus_phage	3.7e-35	35.9
QAW01724.1\|3266355_3267237_-	replication protein	V9QKF6	Oenococcus_phage	6.8e-27	33.1
QAW01725.1\|3267229_3267448_-	hypothetical protein	NA	NA	NA	NA
QAW01726.1\|3267472_3267664_-	helix-turn-helix domain-containing protein	A0A1B2APY7	Phage_Wrath	1.0e-12	59.0
QAW01727.1\|3267715_3267919_-	XRE family transcriptional regulator	NA	NA	NA	NA
QAW01728.1\|3268153_3268552_+	XRE family transcriptional regulator	S5M5X8	Brevibacillus_phage	4.3e-05	33.7
QAW01729.1\|3268984_3270085_-	XRE family transcriptional regulator	NA	NA	NA	NA
QAW01730.1\|3272009_3272480_-	SsrA-binding protein	W5RAM5	Staphylococcus_phage	3.2e-47	63.4
QAW01731.1\|3272624_3274964_-	ribonuclease R	Q0GXV6	Lactococcus_phage	1.3e-88	43.4
QAW01732.1\|3274982_3275723_-	carboxylesterase	NA	NA	NA	NA
QAW01733.1\|3275854_3276085_-	preprotein translocase subunit SecG	NA	NA	NA	NA
QAW01734.1\|3276233_3277007_+	alpha/beta hydrolase	NA	NA	NA	NA
QAW01735.1\|3277040_3277274_-	XRE family transcriptional regulator	NA	NA	NA	NA
QAW01736.1\|3277425_3277833_+	XRE family transcriptional regulator	S6C481	Thermus_phage	1.9e-16	64.8
QAW01737.1\|3277862_3278282_+	XRE family transcriptional regulator	S6C481	Thermus_phage	5.4e-14	62.7
QAW01738.1\|3278373_3278700_+	HxlR family transcriptional regulator	NA	NA	NA	NA
QAW01739.1\|3278827_3280528_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	8.0e-24	29.8
QAW01740.1\|3280568_3281249_-	ABC transporter permease	NA	NA	NA	NA
QAW01741.1\|3281265_3282186_-	osmoprotectant ABC transporter substrate-binding protein	NA	NA	NA	NA
QAW01742.1\|3282197_3282851_-\|holin	choline ABC transporter permease	NA	NA	NA	NA

DBSCAN-SWA_8

3627830 : 3648569

Shigella_phage(25.0%)

bacteriocin,tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAW02060.1\|3627830_3629020_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	1.6e-31	36.6
QAW02061.1\|3629121_3630729_-	CTP synthase (glutamine hydrolyzing)	A0A1J0FA14	Only_Syngen_Nebraska_virus	1.0e-153	52.1
QAW02062.1\|3630970_3631477_-	DNA-directed RNA polymerase subunit delta	NA	NA	NA	NA
QAW02063.1\|3631659_3632799_-	acyl-CoA dehydrogenase AcdA	NA	NA	NA	NA
QAW02064.1\|3632795_3634913_-	4Fe-4S dicluster domain-containing protein	NA	NA	NA	NA
QAW02065.1\|3635067_3636264_+	cardiolipin synthase	NA	NA	NA	NA
QAW02066.1\|3636276_3637239_+	UV DNA damage repair endonuclease UvsE	A0A127AW32	Bacillus_phage	1.7e-39	34.2
QAW02067.1\|3637319_3637592_+	hypothetical protein	NA	NA	NA	NA
QAW02068.1\|3639221_3640892_-\|tRNA	arginine--tRNA ligase	NA	NA	NA	NA
QAW02069.1\|3640888_3641317_-	DUF1934 domain-containing protein	NA	NA	NA	NA
QAW02070.1\|3641631_3641763_+\|bacteriocin	subtilosin A family bacteriocin	NA	NA	NA	NA
QAW02071.1\|3641719_3641872_+\|bacteriocin	bacteriocin-like protein SboX	NA	NA	NA	NA
QAW02072.1\|3641896_3643243_+	subtilosin maturase AlbA	NA	NA	NA	NA
QAW02073.1\|3643255_3643417_+\|bacteriocin	antilisterial bacteriocin subtilosin biosynthesis protein AlbB	NA	NA	NA	NA
QAW02074.1\|3643413_3644133_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	7.3e-19	27.2
QAW02075.1\|3644125_3645436_+\|bacteriocin	antilisterial bacteriocin subtilosin biosynthesis protein AlbD	NA	NA	NA	NA
QAW02566.1\|3645425_3646586_+	insulinase family protein	NA	NA	NA	NA
QAW02076.1\|3646590_3647871_+	insulinase family protein	NA	NA	NA	NA
QAW02077.1\|3647867_3648569_+\|bacteriocin	antilisterial bacteriocin subtilosin biosynthesis protein AlbG	NA	NA	NA	NA

DBSCAN-SWA_9

3658581 : 3699857

Enterobacteria_phage(20.0%)

protease,tRNA,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAW02085.1\|3658581_3659241_-\|protease	site-2 protease family protein	NA	NA	NA	NA
QAW02086.1\|3659349_3659538_+	2-hydroxymuconate tautomerase	NA	NA	NA	NA
QAW02087.1\|3659580_3660000_-	MarR family transcriptional regulator	NA	NA	NA	NA
QAW02088.1\|3660119_3662036_-\|tRNA	threonine--tRNA ligase	A0A2K9L6B6	Tupanvirus	1.9e-143	43.4
QAW02089.1\|3662645_3662801_-	hypothetical protein	NA	NA	NA	NA
QAW02090.1\|3662880_3664281_-	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
QAW02091.1\|3664280_3664751_-	Rrf2 family transcriptional regulator	NA	NA	NA	NA
QAW02092.1\|3664862_3665363_-	YwgA family protein	NA	NA	NA	NA
QAW02093.1\|3665398_3666700_-	HD domain-containing protein	E3T4P8	Cafeteria_roenbergensis_virus	2.5e-25	29.2
QAW02094.1\|3666861_3667086_-	DUF1450 domain-containing protein	NA	NA	NA	NA
QAW02095.1\|3667300_3668077_+	RsfA family transcriptional regulator	A0A1D6X8E5	Bacillus_phage	7.6e-06	50.0
QAW02096.1\|3668220_3669111_-	DMT family transporter	NA	NA	NA	NA
QAW02097.1\|3669279_3670125_-	lipoate--protein ligase family protein	NA	NA	NA	NA
QAW02098.1\|3670173_3671073_-	LysR family transcriptional regulator	A0A2H4J8I9	uncultured_Caudovirales_phage	3.6e-07	42.5
QAW02099.1\|3671218_3672190_-	phosphate acetyltransferase	NA	NA	NA	NA
QAW02100.1\|3672459_3673224_+	heme-dependent peroxidase	NA	NA	NA	NA
QAW02101.1\|3673356_3674136_+	SDR family oxidoreductase	NA	NA	NA	NA
QAW02102.1\|3674150_3675350_-	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
QAW02103.1\|3675350_3676535_-	MFS transporter	NA	NA	NA	NA
QAW02104.1\|3676531_3677950_-	ATP-grasp domain-containing protein	NA	NA	NA	NA
QAW02105.1\|3677968_3678730_-	dihydroanticapsin 7-dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	2.8e-21	30.9
QAW02568.1\|3678732_3679440_-	cupin domain-containing protein	NA	NA	NA	NA
QAW02106.1\|3679429_3680044_-	bacilysin biosynthesis protein BacA	NA	NA	NA	NA
QAW02107.1\|3680195_3681434_-	MFS transporter	NA	NA	NA	NA
QAW02569.1\|3681643_3683056_-	amino acid permease	NA	NA	NA	NA
QAW02108.1\|3683055_3684756_-	M20/M25/M40 family metallo-hydrolase	NA	NA	NA	NA
QAW02109.1\|3684829_3686377_-	L-glutamate gamma-semialdehyde dehydrogenase	NA	NA	NA	NA
QAW02110.1\|3686603_3687878_-	Glu/Leu/Phe/Val dehydrogenase	NA	NA	NA	NA
QAW02111.1\|3688055_3688520_-	hypothetical protein	NA	NA	NA	NA
QAW02112.1\|3688837_3689293_-\|coat	spore coat protein	NA	NA	NA	NA
QAW02113.1\|3689285_3690137_-	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	1.7e-38	39.3
QAW02114.1\|3690150_3691098_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	9.8e-72	43.8
QAW02115.1\|3691097_3691838_-	glucose-1-phosphate thymidylyltransferase	I7I009	Enterobacteria_phage	7.7e-48	42.0
QAW02116.1\|3691862_3692882_-\|coat	spore coat protein	NA	NA	NA	NA
QAW02117.1\|3692884_3693607_-\|coat	spore coat protein	NA	NA	NA	NA
QAW02118.1\|3693599_3694721_-\|coat	spore coat protein	NA	NA	NA	NA
QAW02119.1\|3694720_3695590_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
QAW02120.1\|3695590_3696760_-	DegT/DnrJ/EryC1/StrS aminotransferase family protein	A0A1D8KU11	Synechococcus_phage	1.9e-16	26.9
QAW02121.1\|3696780_3698205_-	CDP-glycerol glycerophosphotransferase family protein	NA	NA	NA	NA
QAW02122.1\|3698209_3698980_-	glycosyltransferase family 2 protein	A0A0F7L2F7	uncultured_marine_virus	3.4e-06	28.6
QAW02123.1\|3698972_3699152_-	hypothetical protein	NA	NA	NA	NA
QAW02124.1\|3699299_3699857_+\|coat	spore coat protein GerQ	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage