CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP035395	Bacillus subtilis strain SRCM103697 chromosome, complete genome	1 crisprs	csa3,RT,cas3,DEDDh,WYL,DinG	0	1	12	0
CP035396	Bacillus subtilis strain SRCM103697 plasmid unnamed1, complete sequence	0 crisprs	NA	0	0	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP035395_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP035395_2

2917797-2917904

Orphan

Consensus_repeat	Method
TGATGGGAATCGAACCCACGACAT	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP035395_2

>merge|CP035395|2|2917797-2917904|CRISPRCasFinder
TGATGGGAATCGAACCCACGACATCAGCTTGGAAGGCTGAGGTTTTACCACTAAACTACACCCGCAATTTTTATTTGGGGCGATTGATGGGAATCGAACCCACGAATG

>CP035395|2|2|2917797-2917904|CRISPRCasFinder
TGATGGGAATCGAACCCACGACAT	CAGCTTGGAAGGCTGAGGTTTTACCACTAAACTACACCCGCAATTTTTATTTGGGGCGAT
TGATGGGAATCGAACCCACGAATG

Protein	Signature genes	Signature genes Name	Protein_function
CP035395.1\|QAW05315.1\|2904737_2905871_-\|glycosyltransferase-family-1-protein	unknown	unknown	gnl\|CDD\|340831
CP035395.1\|QAW05316.1\|2906060_2907134_+\|CotS-family-spore-coat-protein	unknown	unknown	gnl\|CDD\|131952
CP035395.1\|QAW05328.1\|2930474_2931947_-\|betaine-aldehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143437
CP035395.1\|QAW05319.1\|2911657_2913112_-\|glycogen-synthase-GlgA	unknown	unknown	gnl\|CDD\|234809
CP035395.1\|QAW05314.1\|2903667_2904723_-\|CotS-family-spore-coat-protein	unknown	unknown	gnl\|CDD\|131952
CP035395.1\|QAW05331.1\|2933795_2934464_+\|TrkA-family-potassium-uptake-protein	unknown	unknown	gnl\|CDD\|223643
CP035395.1\|QAW05317.1\|2907213_2907681_+\|tryptophan-rich-sensory-protein	unknown	unknown	gnl\|CDD\|226007
CP035395.1\|QAW05322.1\|2915302_2917186_-\|1,4-alpha-glucan-branching-enzyme	unknown	unknown	gnl\|CDD\|273667
CP035395.1\|QAW05318.1\|2909274_2911671_-\|glycogen/starch/alpha-glucan-phosphorylase	unknown	unknown	gnl\|CDD\|273967
CP035395.1\|QAW05320.1\|2913108_2914140_-\|glucose-1-phosphate-adenylyltransferase-subunit-GlgD	unknown	unknown	gnl\|CDD\|273966
CP035395.1\|QAW05325.1\|2926012_2927542_-\|flotillin-family-protein	unknown	unknown	gnl\|CDD\|225177
CP035395.1\|QAW05326.1\|2927562_2928087_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|376684
CP035395.1\|QAW05323.1\|2924853_2925432_+\|energy-coupled-thiamine-transporter-ThiT	unknown	unknown	gnl\|CDD\|226377
CP035395.1\|QAW06546.1\|2929249_2930458_-\|iron-containing-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|341481
CP035395.1\|QAW05329.1\|2932145_2932688_+\|GbsR/MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224427
CP035395.1\|QAW05321.1\|2914163_2915306_-\|glucose-1-phosphate-adenylyltransferase	unknown	unknown	gnl\|CDD\|179997
CP035395.1\|QAW05313.1\|2903237_2903666_-\|hypothetical-protein	unknown	unknown	unknown
CP035395.1\|QAW05327.1\|2928583_2929162_-\|MOSC-domain-containing-protein	unknown	unknown	gnl\|CDD\|377051
CP035395.1\|QAW05324.1\|2925473_2925995_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|224168
CP035395.1\|QAW05330.1\|2932884_2933430_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379999

Protein	Function_ID	Function_description	E-value
CP035395.1\|QAW05315.1\|2904737_2905871_-\|glycosyltransferase-family-1-protein	gnl\|CDD\|340831	cd03801, GT4_PimA-like, phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.	2.38164e-74
CP035395.1\|QAW05316.1\|2906060_2907134_+\|CotS-family-spore-coat-protein	gnl\|CDD\|131952	TIGR02906, Spore_coat_protein_S, spore coat protein, CotS family. Members of this family include the spore coat proteins CotS and YtaA from Bacillus subtilis and, from other endospore-forming bacteria, homologs that are more closely related to these two than to the spore coat proteins YutH and YsxE. The CotS family is more broadly distributed than YutH or YsxE, but still is not universal among spore-formers. [Cellular processes, Sporulation and germination].	4.64632e-132
CP035395.1\|QAW05328.1\|2930474_2931947_-\|betaine-aldehyde-dehydrogenase	gnl\|CDD\|143437	cd07119, ALDH_BADH-GbsA, Bacillus subtilis NAD+-dependent betaine aldehyde dehydrogenase-like. Included in this CD is the NAD+-dependent, betaine aldehyde dehydrogenase (BADH, GbsA, EC=1.2.1.8) of Bacillus subtilis involved in the synthesis of the osmoprotectant glycine betaine from choline or glycine betaine aldehyde.	0
CP035395.1\|QAW05319.1\|2911657_2913112_-\|glycogen-synthase-GlgA	gnl\|CDD\|234809	PRK00654, glgA, glycogen synthase GlgA.	0
CP035395.1\|QAW05314.1\|2903667_2904723_-\|CotS-family-spore-coat-protein	gnl\|CDD\|131952	TIGR02906, Spore_coat_protein_S, spore coat protein, CotS family. Members of this family include the spore coat proteins CotS and YtaA from Bacillus subtilis and, from other endospore-forming bacteria, homologs that are more closely related to these two than to the spore coat proteins YutH and YsxE. The CotS family is more broadly distributed than YutH or YsxE, but still is not universal among spore-formers. [Cellular processes, Sporulation and germination].	6.9211e-130
CP035395.1\|QAW05331.1\|2933795_2934464_+\|TrkA-family-potassium-uptake-protein	gnl\|CDD\|223643	COG0569, TrkA, K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism].	3.00569e-69
CP035395.1\|QAW05317.1\|2907213_2907681_+\|tryptophan-rich-sensory-protein	gnl\|CDD\|226007	COG3476, COG3476, Tryptophan-rich sensory protein (mitochondrial benzodiazepine receptor homolog) [Signal transduction mechanisms].	2.06085e-39
CP035395.1\|QAW05322.1\|2915302_2917186_-\|1,4-alpha-glucan-branching-enzyme	gnl\|CDD\|273667	TIGR01515, branching_enzym, alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase. This model describes the glycogen branching enzymes which are responsible for the transfer of chains of approx. 7 alpha(1--4)-linked glucosyl residues to other similar chains (in new alpha(1--6) linkages) in the biosynthesis of glycogen. This enzyme is a member of the broader amylase family of starch hydrolases which fold as (beta/alpha)8 barrels, the so-called TIM-barrel structure. All of the sequences comprising the seed of this model have been experimentally characterized. This model encompasses both bacterial and eukaryotic species. No archaea have this enzyme, although Aquifex aolicus does. Two species, Bacillus thuringiensis and Clostridium perfringens have two sequences each which are annotated as amylases. These annotations are aparrently in error. GP\|18143720 from C. perfringens, for instance, contains the note "674 aa, similar to gp:A14658_1 amylase (1,4-alpha-glucan branching enzyme (EC 2.4.1.18) ) from Bacillus thuringiensis (648 aa); 51.1% identity in 632 aa overlap." A branching enzyme from Porphyromonas gingivales, OMNI\|PG1793, appears to be more closely related to the eukaryotic species (across a deep phylogenetic split) and may represent an instance of lateral transfer from this species' host. A sequence from Arabidopsis thaliana, GP\|9294564, scores just above trusted, but appears either to contain corrupt sequence or, more likely, to be a pseudogene as some of the conserved catalytic residues common to the alpha amylase family are not conserved here. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0
CP035395.1\|QAW05318.1\|2909274_2911671_-\|glycogen/starch/alpha-glucan-phosphorylase	gnl\|CDD\|273967	TIGR02093, Glycogen_phosphorylase, glycogen/starch/alpha-glucan phosphorylases. This family consists of phosphorylases. Members use phosphate to break alpha 1,4 linkages between pairs of glucose residues at the end of long glucose polymers, releasing alpha-D-glucose 1-phosphate. The nomenclature convention is to preface the name according to the natural substrate, as in glycogen phosphorylase, starch phosphorylase, maltodextrin phosphorylase, etc. Name differences among these substrates reflect differences in patterns of branching with alpha 1,6 linkages. Members include allosterically regulated and unregulated forms. A related family, TIGR02094, contains examples known to act well on particularly small alpha 1,4 glucans, as may be found after import from exogenous sources. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0
CP035395.1\|QAW05320.1\|2913108_2914140_-\|glucose-1-phosphate-adenylyltransferase-subunit-GlgD	gnl\|CDD\|273966	TIGR02092, Glycogen_biosynthesis_protein_GlgD, glucose-1-phosphate adenylyltransferase, GlgD subunit. This family is GlgD, an apparent regulatory protein that appears in an alpha2/beta2 heterotetramer with GlgC (glucose-1-phosphate adenylyltransferase, TIGR02091) in a subset of bacteria that use GlgC for glycogen biosynthesis. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0
CP035395.1\|QAW05325.1\|2926012_2927542_-\|flotillin-family-protein	gnl\|CDD\|225177	COG2268, COG2268, Uncharacterized protein conserved in bacteria [Function unknown].	1.34239e-122
CP035395.1\|QAW05326.1\|2927562_2928087_-\|hypothetical-protein	gnl\|CDD\|376684	pfam01957, NfeD, NfeD-like C-terminal, partner-binding. NfeD-like proteins are widely distributed throughout prokaryotes and are frequently associated with genes encoding stomatin-like proteins (slipins). There appear to be three major groups: an ancestral group with only an N-terminal serine protease domain and this C-terminal beta sheet-rich domain which is structurally very similar to the OB-fold domain, associated with its neighboring slipin cluster; a second major group with an additional middle, membrane-spanning domain, associated in some species with eoslipin and in others with yqfA; a final 'artificial' group which unites truncated forms lacking the protease region and associated with their ancestral gene partner, either yqfA or eoslipin. This NefD, C-terminal, domain appears to be the major one for relating to the associated protein. NfeD homologs are clearly reliant on their conserved gene neighbor which is assumed to be necessary for function, either through direct physical interaction or by functioning in the same pathway, possibly involve with lipid-rafts.	0.000254791
CP035395.1\|QAW05323.1\|2924853_2925432_+\|energy-coupled-thiamine-transporter-ThiT	gnl\|CDD\|226377	COG3859, COG3859, Predicted membrane protein [Function unknown].	1.328e-72
CP035395.1\|QAW06546.1\|2929249_2930458_-\|iron-containing-alcohol-dehydrogenase	gnl\|CDD\|341481	cd08551, Fe-ADH, iron-containing alcohol dehydrogenases (Fe-ADH)-like. This family contains large metal-containing alcohol dehydrogenases (ADH), known as iron-containing alcohol dehydrogenases. They contain a dehydroquinate synthase-like protein structural fold and mostly contain iron. They are distinct from other alcohol dehydrogenases which contains different protein domains. There are several distinct families of alcohol dehydrogenases: Zinc-containing long-chain alcohol dehydrogenases, insect-type, or short-chain alcohol dehydrogenases, iron-containing alcohol dehydrogenases, among others. The iron-containing family has a Rossmann fold-like topology that resembles the fold of the zinc-dependent alcohol dehydrogenases, but lacks sequence homology, and differs in strand arrangement. ADH catalyzes the reversible oxidation of alcohol to acetaldehyde with the simultaneous reduction of NAD(P)+ to NAD(P)H.	1.69004e-175
CP035395.1\|QAW05329.1\|2932145_2932688_+\|GbsR/MarR-family-transcriptional-regulator	gnl\|CDD\|224427	COG1510, COG1510, Predicted transcriptional regulators [Transcription].	1.21185e-72
CP035395.1\|QAW05321.1\|2914163_2915306_-\|glucose-1-phosphate-adenylyltransferase	gnl\|CDD\|179997	PRK05293, glgC, glucose-1-phosphate adenylyltransferase; Provisional.	0
CP035395.1\|QAW05327.1\|2928583_2929162_-\|MOSC-domain-containing-protein	gnl\|CDD\|377051	pfam03473, MOSC, MOSC domain. The MOSC (MOCO sulfurase C-terminal) domain is a superfamily of beta-strand-rich domains identified in the molybdenum cofactor sulfurase and several other proteins from both prokaryotes and eukaryotes. These MOSC domains contain an absolutely conserved cysteine and occur either as stand-alone forms or fused to other domains such as NifS-like catalytic domain in Molybdenum cofactor sulfurase. The MOSC domain is predicted to be a sulfur-carrier domain that receives sulfur abstracted by the pyridoxal phosphate-dependent NifS-like enzymes, on its conserved cysteine, and delivers it for the formation of diverse sulfur-metal clusters.	8.64446e-05
CP035395.1\|QAW05324.1\|2925473_2925995_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|224168	COG1247, COG1247, Sortase and related acyltransferases [Cell envelope biogenesis, outer membrane].	8.3921e-11
CP035395.1\|QAW05330.1\|2932884_2933430_+\|hypothetical-protein	gnl\|CDD\|379999	pfam17735, BslA, Biofilm surface layer A. This family includes members such as BslA (previously called YuaB). Secreted BslA from Bacillus subtillis has been shown to form surface layers around the biofilm self-assembling at interfaces of B. subtilis biofilms, forming an elastic film. structural analysis revealed that BslA consists of an Ig-type fold with the addition of an unusual, extremely hydrophobic cap region. The hydrophobic cap exhibits physiochemical properties similar to the hydrophobic surface found in fungal hydrophobins; thus, BslA is defined as member of a class of bacterially produced hydrophobins.	5.35887e-46

>CP035395.1|QAW05322.1|2915302_2917186_-|1,4-alpha-glucan-branching-enzyme
MAAASPTAHDVYLFHEGSLFKSYQLFGSHYRELNGKSGYEFCVWAPHASEVRVAGDFNSWSGEEHVMHRVNDNGIWTLFIPGIGEKERYKYEIVTNNGEIRLKADPYAIYSEVRPNTASLTYDLEGYSWQDQKWQKKQKAKTLYEKPVFIYELHLGSWKKHSDGRHYSYIELSQTLIPYIKEHGFTHIELLPVYEHPYDRSWGYQGTGYYSPTSRFGTPHDLMKFVDECHQQNIGVILDWVPGHFCKDAHGLYMFDGEPLYEYKEERDRENWLWGTANFDLGKPEVHSFLISNALYWAEFYHIDGFRVDAVANILYWPNQDERHTNPYAVDFLKKLNQTMREAYPYVMMIAEDSTEWPQVTGAVEEGGLGFHYKWNMGWMNDVLKYMETPPEERRHCHQLISFSLLYAFSEHFVLPFSHDEVVYGKKSLLNKMPGDYWQKFAQYRLLLGYMTVHPGKKLIFMGSEFAQFDEWKDTEQLDWFLDSFPMHQKASVFTQDLLRFYQKSKILYEHDHRAQSFEWIDVHNDEQSIFSFIRYGKNHGEALVIICNFTPVVYHQYDVGVPFFTQYIEVLNSDSETYGGSGQINKKPLSAKKGALHHKPCYITMTIPPYGISILRAVKKRGEIKR
>CP035395.1|QAW05321.1|2914163_2915306_-|glucose-1-phosphate-adenylyltransferase
MKKQCVAMLLAGGKGSRLSGLTKNMAKPAVSFGGKYRIIDFTLSNCSNSGIDTVGILTQYQPLELNSYIGIGSAWDLDRYNGGVTVLPPYAESSEVKWYKGTASAIYENLNYLNQYDPEYVLILSGDHIYKMDYAKMLDYHIEKKADVTISVIEVGWEEASRFGIMKANPDGTITHFDEKPKFPKSNLASMGIYIFNWPLLKQYLEMDDQNPYSSHDFGKDIIPLLLEEKKKLSAYPFKGYWKDVGTVQSLWEANMDLLKEDSELKLFERKWKIYSVNPNQPPQFISSDAQVQDSLVNEGCVVYGNVSHSVLFQGVTVGKHTTVTSSVIMPDVTIGEHVVIENAIVPNGMVLPDGAVIRSEKDIEEVLLVSEEFVEKELI
>CP035395.1|QAW05320.1|2913108_2914140_-|glucose-1-phosphate-adenylyltransferase-subunit-GlgD
MFNNQMLGVIDETTYKHSLQDLTAQRSLGAIPFAGRYRLIDFMLSNMVNADIRSVAIFPKYRYRSLMDHLGAGKEWDLHRKKDGLFFFPSPHLHHEYDEFGSFRQFSDHLDYFHRSTQQYAVISNSHTVCNIQFQYVLKRHQEVGCDVTEVFQDGQSLQIYIMSTTLLKDLIYGHSEKGYKTIQEAVEKESSALTICPYEYSGYAAVIDSVEKYYTHSMELIQPRFWQQVFLPQQPIYTKVKDEPPTKYGKHSTVKNSLVANGCALEGEVENCILFRAVHVGKGTKLKNCIIMQKTQIGEDCLLEQVISDKDVKIGKATEAAGTAEQPLVLRKGLVQGELMNS
>CP035395.1|QAW05319.1|2911657_2913112_-|glycogen-synthase-GlgA
MKILFAVSECTPFVKSGGLADVAGALPKALARLGNAVAVMLPKYSQIPEPWKKRMKKKAECTVAVGWRQQYCGIEHMAKDDVNYYFIDNEYYFNRDSLYGHYDDGERFAFFSRAVLEAAKVVNVQADIVHTHDWHTAMVNYLLKEEYRKHPFYERMKSVLTIHNLQFQGIFPPDVTHDLLGLEMDHFHYERLECNGFVNFMKAGIIAADHVTTVSPTYRNEILTPYYGEQLEQVLQYREDDVTGILNGIDDTFYQPKSDPYIEAQYDSGDLACKLENKTKLQRRMGLPEKNDIPLISMVTRLTKQKGLDLVRRIMHELLEEQDIQLVVLGTGEREFEDYFRYAEFAFHEKCRAYIGFDEPLAHQIYAGSDMFLMPSKFEPCGLGQLIALQYGAIPIVRETGGLYDTVRAYQEEEGTGNGFTFSAFNAHDLKFTIERALAFYRQQDVWKSIVKTAMNADYSWGKSAKEYQRIFEQVTRSGRDVLE
>CP035395.1|QAW05318.1|2909274_2911671_-|glycogen/starch/alpha-glucan-phosphorylase
MFSSKERFADLFLKRLEMTCGKSFKDSAKLDQYKTLGNMVREYISANWIETNEKSRSNSGKQTYYLSIEFLLGQLLEQNLMNLGVRDVVEAGLKEIGINLEEILQIENDAGLGNGGLGRLAACFLDSLASLNLPGHGMGIRYKHGLFEQKIVDGHQVELPEQWLKNGNVWEVRNADQAVDVPFWGEVHMTEKSGRLHFRHEQATIVTAVPYDIPIIGYETGTVNTLRLWNAEPYAHYHGGNILSYKRETEAVSEFLYPDDTHDEGKILRLKQQYFLVCASLKSIVNNYRKTHKSLSGLHKEVSIHINDTHPALAVPELMRILLDEENMSWEEAWHITVHTISYTNHTTLSEALEKWPIHLFKPLLPRMYMIIEEINERFCRAVWEKYPGDWKRIEDMAITAHGVVKMAHLAIVGSYSVNGVAKIHSDILKEREMRDFHLLFPNRFNNKTNGIAHRRWLLKANPGLSAIITEAIGDEWVKQPESLIRLEPYATDPAFIEQFQNNKSKKKQELADLIFCTAGVVVNPDSIFDVQVKRLHAYKRQLLNVLHIMYLYNRLKEDAGFSIYPQTFIFGAKASPSYYYAKKIIKLIHSVAEKVNYDPAVKQLIKVVFLENYRVSMAERIFTASDVSEQISTASKEASGTGNMKFMMNGALTIGTHDGANIEILERVGPDCIYTFGLKADEVLSYQENGGYRSREYYQHDRRIRQVADQLINGFFEGEADEFESIFDSLLPHNDEYFVLKDFSSYADAQERIQADYRERRKWSERSIVNIAHSGYFSSDRTIREYAKDIWGIKPMM
>CP035395.1|QAW05317.1|2907213_2907681_+|tryptophan-rich-sensory-protein
MKKIVGALAVFVITYALFSAAGYLFPVDQEWYNSLKKPDWTPSVTAIGIIWATLFALISLSAAIVYAAFSFKGAKSFRFTLLINYVLNQAFSYFQFTQKNLLAASLDCLLVAITAIVLLIIAKKYNRAASYLLLPYYLWSAFATFLSFTINSMNL
>CP035395.1|QAW05316.1|2906060_2907134_+|CotS-family-spore-coat-protein
MCPLMAENHEVIEEGNSSELPLSAEDAKKLTELAENVLQGWDVQAEKIDVIQGNQMALVWKVHTDSGALCLKRIHRPEKKALFSIFAQDYLAKKGMNVPGILPNKKGSLYSKHGSFLFVVYDWIEGRPFELTVKQDLEFIMKGLADFHTASVGYQPPNGVPVFTKLGRWPNHYTKRCKQMETWKLMAEAEKEDPFSQFYLQEIDGFIEDGLRIKDRLLQSTYVPWTEQLKKSPNLCHQDYGTGNTLLGENEQIWVIDLDTVSFDLPIRDLRKMIIPLLDTTGVWDEETFHVMLNAYESRAPLTEEQKQVMFIDMLFPYELYDVIREKYVRKSALPKEELESAFEYERIKANALRQLI
>CP035395.1|QAW05315.1|2904737_2905871_-|glycosyltransferase-family-1-protein
MKIALIATEKLPVPSVRGGAIQIYLEAVAPLIAKKHEVTVFSIKDPNLADREKVDGVHYVHLDEDRYEEAVGEELKKSRFDLVHVCNRPSWVPKLKKKAPDAVFILSVHNEMFAYDKISQAEGEICIDSVAQIVTVSDYIGQTITSRFPSARSKTKTVYSGVDLKAYHPRWTNEGQRAREEMRSELGLHGKKIVLFVGRLSKVKGPHILLQALPDIIEEHPDVMMVFIGSKWFGDNELNNYVKHLHTLGAMQKDHVTFIQFVKPKDIPRLYTMSDVFVCSSQWQEPLARVHYEAMAAGLPIITSNRGGNPEVIEEGKNGYIIHDFENPKQYAERINDLLSSSEKRERLGKYSRREAENKFGWQRVAENLLSVYEKNR
>CP035395.1|QAW05314.1|2903667_2904723_-|CotS-family-spore-coat-protein
MYQKEHEEQIVSEILSYYPFHIDHVALKSNKSGRKIWEVETDHGPKLLKEAQMKPERMLFITQAHAHLQEQGLPIAPIHQTKNGGSCLGTDQVSYSLYDKVTGKEMIYYDAEQMKKVMSFAGHFHHASKGYVCTDESKKRSRLGKWHKLYRWKLQELEGNMQIAASYPDDVFSQTFLKHADKMLARGKEALQALDDSEYETWTKETLEHGGFCFQDFTLARLTEIEGEPFLKELHSITYDLPSRDLRILLNKVMVKLSVWDTDFMVALLAAYDAVYPLTEKQYEVLWIDLAFPHLFCAIGHKYYLKQKKTWSDEKYNWALQNMISVEGSKDSFLDNLPELYKKIKAYREAN
>CP035395.1|QAW05313.1|2903237_2903666_-|hypothetical-protein
MRSSRQKASISKLDLDQFVFTPPGPMGWQAHDSIPAEKGEEEKHLDMGSIRELPHINASKEYQEETKEKETDHKIVDDEEETKFETTPEPEEERDSKRSAPPYEEEDEEEPDVAEEARVEIIILPSESKPAPWFSQTVKRKA
>CP035395.1|QAW05323.1|2924853_2925432_+|energy-coupled-thiamine-transporter-ThiT
MNQSKQLVRLIEIAIMTAAAVILDIVSGMFLSMPQGGSVSIMMIPIFLISFRWGVKAGLTTGLLTGLVQIAIGNLFAQHPVQLLLDYIVAFAAIGISGCFASSVRKAAVSKTKGKLIVSVVSAVFIGSLLRYAAHVISGAVFFGSFAPKGTPVWIYSLTYNATYMVPSFIICAIVLCLLFMTAPRLLKSDKA
>CP035395.1|QAW05324.1|2925473_2925995_-|GNAT-family-N-acetyltransferase
MVTVREAKLEDIKDIAKVHVDSWRTTYHEIIPIDYLNSLNYKEFEDKWKSRSLKGVFVAQDEMGSVFGFASFGPIRSEQEGYDGELYAIYLLEERQRQGAGRALLAKGAEYLLQHGFSSMFVWVIEQNPSIIFYQAYSPERVAEDNFEIAGVRLKEVGLGWPDLSALKTLLNR
>CP035395.1|QAW05325.1|2926012_2927542_-|flotillin-family-protein
MTMPIIMIIGVVFFLLIALIAVFITKYRTAGPDEALIVTGSYLGNKNVHVDEGGNRIKIVRGGGTFVLPVFQQAEPLSLLSSKLDVSTPEVYTEQGVPVMADGTAIIKIGGSIGEIATAAEQFLGKSKDDREQEAREVLEGHLRSILGSMTVEEIYKNREKFSQEVQRVASQDLAKMGLVIVSFTIKDVRDKNGYLESLGKPRIAQVKRDADIATAEADKETRIKRAEADKDAKKSELERATEIAEAEKLNQLKMAEFRREQDTAKANADQAYDLETARARQQVTEQEMQVKIIERQKQIELEEKEILRRERQYDSEVKKKADADRYSVEQSAAAEKAKQLAEADAKKYSIEAMAKAEAEKVRIDGLAKAEAEKAKGETEAEVIRLKGLAEAEAKEKIAAAFEQYGQAAIFDMIVKMLPEYAKQAAAPLSNIDKITVVDTGGSGESSGANKVTSYATNLMSSLQESLKASSGIDVKEMLENFSGKGNVKQSINELTNEIKEAKTVQKSE
>CP035395.1|QAW05326.1|2927562_2928087_-|hypothetical-protein
MELFGVPIQTIYLYTLIIAGSLTLLFLFFGDVFAGLSEGIPFLNPTLVLSFFTCFSAGGYIGELVLPLSSLLIALLSCILSIMLVVLLHIFVLVPLSSAEESLAYREDDLRGRLGKVITAVPVDGFGEVVIEGIGGTISKSAVSFDNQQISYGTTVLVVDINNGVLSVTPHEPI
>CP035395.1|QAW05327.1|2928583_2929162_-|MOSC-domain-containing-protein
MWKRMTAKAEGLYIAETESFVTKQMDKLDFDYGGIPGDLHFGLTKKAGAREPMFSRGTEIFNRRQISIVSIEECNEIALKMGVPRILPEWLGANVAVSGMPDLTSLKEGSRIIFPSGAALLCEGENDPCIQPGEVIQSYYPDKPKLTPAFVHHALGIRGIVCIVERPGAVYTGDEIEVHSYQRKVKRKAERV
>CP035395.1|QAW06546.1|2929249_2930458_-|iron-containing-alcohol-dehydrogenase
MTLNMKVESMQKFHTFEIPTVIKHGIGAIKHTGEEVAALGVSKALLVTDPGIYKAGVADPVIESLKEAGIEVVLFNKVEPNPPVRLVNEGSELYKKENCNGLVAVGGGSSMDTAKAIGVEATHEGSVLDYEAADGKKPLENRIPPLTTIPTTAGTGSEVTQWAVITDEEREFKFNTGGPLIAAHLTIIDPELHVSMPPHVTAMTGIDALAHAIECYTMKFAQPITDAVALMAIEYAAHYIKRAFADGEDLEARYGMAQAAMLAGLSYGSESAGAAHAMSQTLGGIIPVAHGQCVAAMMGPVMEYNWKGYPEKFARIAKAFGIDTSKMTTEEAAKASVNWMYDLVEDLEVPTLEEQGVSPDMIERLSKEAMKDPQTFGNPRDLNEKAYNWIYKRCFNLTPKTV
>CP035395.1|QAW05328.1|2930474_2931947_-|betaine-aldehyde-dehydrogenase
MSQTLFIDGEWISAEKEQIRSIINPFNQEEIATVSEGGREDAIKAIAAARRAFDKGEWSSLSGLERGKIVLKIAELIRRDLEELAELESLDTGKTLEESKADMDDIANVFQYYAGLADKDGGEIVSSPIPDSESKIIREPIGVCGQITPWNYPLLQASWKIAPALAAGNTIVMKPSEITPLTTIKVFKLMEEAGVPKGVANLVLGPGATVGDELAVNKDVDLISFTGGIETGKKIMRAASGNVKKIALELGGKNPNIVFKDADLEVAVDQALNAVFFHAGQVCSAGSRLLVEDAIHDQFLAELVKRAKRIKLGNGFHAETESGPLISAEHRAKVEKYVEIGIEEGAKLETGGKRPEDPALQNGFFYEPTIFSNCNSDMRIVQEEVFGPVLTVETFSSEEEVIELANDTIYGLAGAVWSKDIEKCERVAARLRMGTVWINDFHPYFAQAPWGGYKQSGFGRELGKIGLEEYTEVKHVYRNTKPAAVNWFNS
>CP035395.1|QAW05329.1|2932145_2932688_+|GbsR/MarR-family-transcriptional-regulator
MDENPEFAAIEQARDLVIDSIAETMDLYGITRSVGILYGTMYMRDEMTLDEMREELQMSKPSMSTGVKKLQDLNVVKKTFHRGIRKHTFVAEKDFFKFFTNFFPPKWEREVQVNVAAIEEAQADLQKVLCKEDLDEDIKNEALQLYDQLESSKAYYDWLKRLAESVQTGEIFKFIPIETK
>CP035395.1|QAW05330.1|2932884_2933430_+|hypothetical-protein
MKRKLLSSLAISALSLGLLVSAPTASFAAESTSTKAHTESTMRTQSTASLFATITGASKTEWSFSDIELTYRPNTLLSLGVMEFTLPSGFTANTKDTLNGNALRTTQILNNGKTVRVPLALDLLGAGEFKLKLNNKTLPAAGTYTFRAENKSLSIGNKFYAEASIDVAKRSTPPTQPCGCN
>CP035395.1|QAW05331.1|2933795_2934464_+|TrkA-family-potassium-uptake-protein
MGRIKNKQFAVIGLGRFGGSICKELHRMGHEVLAVDINEEKVNAYASYATHAVIANATEENELLSLGIRNFEYVIVAIGANIQASTLTTLLLKELDIPNIWVKAQNYYHHKVLEKIGADLIIHPEKDMGVKIAQSLSDENVLNYIDLSDEYSIVELLATRKLDSKSIIDLNVRAKYGCTILAIKHHGDICLSPAPEDIIHEQDCLVIMGHKKDIKRFENEGM

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP035395_2	2.1\|2917821\|60\|CP035395\|CRISPRCasFinder	2917821-2917880	60	NZ_CP024037	Bacillus aryabhattai strain K13 plasmid unnamed2	10417-10476	7	0.883
CP035395_2	2.1\|2917821\|60\|CP035395\|CRISPRCasFinder	2917821-2917880	60	NZ_CP026740	Bacillus megaterium strain YC4-R4 plasmid unnamed4	70764-70823	7	0.883
CP035395_2	2.1\|2917821\|60\|CP035395\|CRISPRCasFinder	2917821-2917880	60	NC_017139	Bacillus megaterium WSH-002 plasmid WSH-002_p1, complete sequence	1318-1377	7	0.883
CP035395_2	2.1\|2917821\|60\|CP035395\|CRISPRCasFinder	2917821-2917880	60	NZ_CP010587	Bacillus megaterium Q3 plasmid p1, complete sequence	838-897	7	0.883
CP035395_2	2.1\|2917821\|60\|CP035395\|CRISPRCasFinder	2917821-2917880	60	NZ_CP023319	Bacillus megaterium strain A plasmid p2, complete sequence	75825-75884	7	0.883
CP035395_2	2.1\|2917821\|60\|CP035395\|CRISPRCasFinder	2917821-2917880	60	NC_020451	Vibrio coralliilyticus strain ATCC BAA-450 plasmid, complete sequence	1960-2019	9	0.85
CP035395_2	2.1\|2917821\|60\|CP035395\|CRISPRCasFinder	2917821-2917880	60	NZ_CP015440	Anoxybacillus amylolyticus strain DSM 15939 plasmid pDSM15939_2, complete sequence	64773-64832	12	0.8
CP035395_2	2.1\|2917821\|60\|CP035395\|CRISPRCasFinder	2917821-2917880	60	NZ_CP033045	Bacillus foraminis strain Bac44 plasmid unnamed, complete sequence	483791-483850	13	0.783
CP035395_2	2.1\|2917821\|60\|CP035395\|CRISPRCasFinder	2917821-2917880	60	NZ_LR134399	Listeria monocytogenes strain NCTC7974 plasmid 2, complete sequence	57361-57420	14	0.767

1. spacer 2.1|2917821|60|CP035395|CRISPRCasFinder matches to NZ_CP024037 (Bacillus aryabhattai strain K13 plasmid unnamed2) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

2. spacer 2.1|2917821|60|CP035395|CRISPRCasFinder matches to NZ_CP026740 (Bacillus megaterium strain YC4-R4 plasmid unnamed4) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

3. spacer 2.1|2917821|60|CP035395|CRISPRCasFinder matches to NC_017139 (Bacillus megaterium WSH-002 plasmid WSH-002_p1, complete sequence) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

4. spacer 2.1|2917821|60|CP035395|CRISPRCasFinder matches to NZ_CP010587 (Bacillus megaterium Q3 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

5. spacer 2.1|2917821|60|CP035395|CRISPRCasFinder matches to NZ_CP023319 (Bacillus megaterium strain A plasmid p2, complete sequence) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

6. spacer 2.1|2917821|60|CP035395|CRISPRCasFinder matches to NC_020451 (Vibrio coralliilyticus strain ATCC BAA-450 plasmid, complete sequence) position: , mismatch: 9, identity: 0.85

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcattttagttatggcccggg	Protospacer
****************************************** ***   * ***  **.

7. spacer 2.1|2917821|60|CP035395|CRISPRCasFinder matches to NZ_CP015440 (Anoxybacillus amylolyticus strain DSM 15939 plasmid pDSM15939_2, complete sequence) position: , mismatch: 12, identity: 0.8

cagcttggaaggctgaggttttaccactaaactacacccgca-------atttttatttg	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcataataatatataccattg	Protospacer
******************************************       ** * .  ***

8. spacer 2.1|2917821|60|CP035395|CRISPRCasFinder matches to NZ_CP033045 (Bacillus foraminis strain Bac44 plasmid unnamed, complete sequence) position: , mismatch: 13, identity: 0.783

cagcttggaaggctgaggttttaccactaaactacacccgc--------aatttttattt	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatggttaaaagttttgcca	Protospacer
*****************************************        ** ****...

9. spacer 2.1|2917821|60|CP035395|CRISPRCasFinder matches to NZ_LR134399 (Listeria monocytogenes strain NCTC7974 plasmid 2, complete sequence) position: , mismatch: 14, identity: 0.767

cagcttggaaggctgaggttttaccactaaactacacccgc---------aatttttatt	CRISPR spacer
cagcttggaaggctgtagttttaccactaaactacacccgcatagtaagtagttcttagt	Protospacer
*************** .************************         *.**.*** *

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

680079 : 688445

Synechococcus_phage(50.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAW03163.1\|680079_681375_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	5.9e-19	25.7
QAW03164.1\|681448_682174_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0E3G7P8	Synechococcus_phage	1.2e-45	44.5
QAW03165.1\|682166_682421_+	phosphoribosylformylglycinamidine synthase, purS protein	NA	NA	NA	NA
QAW03166.1\|682417_683101_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
QAW03167.1\|683084_685313_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	6.5e-159	40.1
QAW03168.1\|685288_686719_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.2e-52	32.5
QAW03169.1\|686820_687861_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	1.7e-64	42.0
QAW03170.1\|687857_688445_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	2.4e-28	41.0

DBSCAN-SWA_2

714094 : 724994

Erysipelothrix_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAW06441.1\|714094_717253_+	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	6.6e-64	23.4
QAW03192.1\|717403_718315_+	diacylglycerol kinase	A0A1V0SBJ0	Catovirus	1.2e-21	29.7
QAW03193.1\|718370_719753_+	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	9.4e-116	46.9
QAW03194.1\|720159_721410_+	DNA cytosine methyltransferase	Q6DMX0	Streptococcus_phage	1.4e-65	44.1
QAW03195.1\|721464_722664_-	type II restriction endonuclease	NA	NA	NA	NA
QAW03196.1\|722720_722924_-	XRE family transcriptional regulator	A0A2K5B261	Erysipelothrix_phage	2.8e-21	74.2
QAW03197.1\|723125_724994_+	XRE family transcriptional regulator	E4ZFJ9	Streptococcus_phage	1.1e-77	30.2

DBSCAN-SWA_3

1197588 : 1245959

Planktothrix_phage(22.22%)

tRNA,transposase,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAW03632.1\|1197588_1198739_-\|transposase	IS3 family transposase	A0A0N9SIX5	Staphylococcus_phage	1.7e-38	61.2
QAW06459.1\|1198916_1199096_+	YjzC family protein	NA	NA	NA	NA
QAW03633.1\|1199142_1199328_-	DUF2929 domain-containing protein	NA	NA	NA	NA
QAW03634.1\|1199576_1200311_+	hypothetical protein	NA	NA	NA	NA
QAW03635.1\|1200392_1200950_+	hypothetical protein	NA	NA	NA	NA
QAW03636.1\|1201040_1201994_+	BMP family ABC transporter substrate-binding protein	NA	NA	NA	NA
QAW03637.1\|1202008_1202200_+	competence protein ComG	NA	NA	NA	NA
QAW03638.1\|1202229_1202469_-	hypothetical protein	NA	NA	NA	NA
QAW03639.1\|1202633_1203572_+	beta-ketoacyl-ACP synthase III	NA	NA	NA	NA
QAW03640.1\|1203594_1204836_+	beta-ketoacyl-[acyl-carrier-protein] synthase II	NA	NA	NA	NA
QAW03641.1\|1204911_1205697_+	hypothetical protein	NA	NA	NA	NA
QAW03642.1\|1205888_1206875_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.7e-22	32.9
QAW03643.1\|1206871_1207861_+	dipeptide ABC transporter ATP-binding protein	F2Y302	Organic_Lake_phycodnavirus	6.7e-07	26.1
QAW03644.1\|1207948_1209580_+	oligopeptide-binding protein AppA	NA	NA	NA	NA
QAW03645.1\|1209655_1210606_+	peptide ABC transporter permease	NA	NA	NA	NA
QAW03646.1\|1210622_1211534_+	peptide ABC transporter permease	NA	NA	NA	NA
QAW03647.1\|1211739_1212492_+	DUF3603 family protein	A0A0A0RP53	Bacillus_phage	9.2e-49	43.5
QAW03648.1\|1212525_1213518_-\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
QAW03649.1\|1214261_1215899_+	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
QAW03650.1\|1216006_1216942_+	ABC transporter permease	NA	NA	NA	NA
QAW03651.1\|1216945_1217863_+	peptide ABC transporter permease	NA	NA	NA	NA
QAW03652.1\|1217867_1218944_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.1e-17	30.8
QAW03653.1\|1218945_1219863_+	ATP-binding cassette domain-containing protein	M1HP82	Acanthocystis_turfacea_Chlorella_virus	1.2e-05	24.6
QAW06460.1\|1219970_1221188_+	MFS transporter	NA	NA	NA	NA
QAW03654.1\|1221351_1221930_+	N-acetyltransferase	NA	NA	NA	NA
QAW03655.1\|1222110_1222506_+	transcriptional regulator Spx	NA	NA	NA	NA
QAW03656.1\|1222548_1223205_-	TerC family protein	A0A2R2YAT9	Pseudomonas_phage	1.1e-29	38.0
QAW03657.1\|1223374_1223515_+	hypothetical protein	NA	NA	NA	NA
QAW03658.1\|1223481_1224138_+	adaptor protein MecA	NA	NA	NA	NA
QAW03659.1\|1224132_1224255_-	hypothetical protein	NA	NA	NA	NA
QAW03660.1\|1224298_1225450_+	competence protein CoiA	NA	NA	NA	NA
QAW03661.1\|1225496_1227509_+	oligoendopeptidase F	NA	NA	NA	NA
QAW03662.1\|1227546_1227714_-	hypothetical protein	NA	NA	NA	NA
QAW03663.1\|1227809_1228010_-	hypothetical protein	NA	NA	NA	NA
QAW03664.1\|1228028_1228928_-	DsbA family protein	NA	NA	NA	NA
QAW03665.1\|1228924_1229323_-	thiol management oxidoreductase	NA	NA	NA	NA
QAW06461.1\|1229577_1230123_-	lytic transglycosylase domain-containing protein	A0A1P8CWQ1	Bacillus_phage	5.1e-41	73.7
QAW03666.1\|1230326_1230899_-	CYTH domain-containing protein	NA	NA	NA	NA
QAW03667.1\|1231023_1231392_+	hypothetical protein	NA	NA	NA	NA
QAW06462.1\|1231420_1232056_+	GTP pyrophosphokinase YjbM	NA	NA	NA	NA
QAW03668.1\|1232074_1232875_+	NAD(+) kinase	NA	NA	NA	NA
QAW06463.1\|1232937_1233789_+	RluA family pseudouridine synthase	NA	NA	NA	NA
QAW03669.1\|1233801_1234536_-	bis(5'-nucleosyl)-tetraphosphatase PrpE	A8E2N0	Enterococcus_phage	7.2e-06	24.8
QAW03670.1\|1234771_1236616_+	sodium:proton antiporter	NA	NA	NA	NA
QAW03671.1\|1236864_1237575_+	thiaminase II	NA	NA	NA	NA
QAW03672.1\|1237549_1238167_+	thiazole tautomerase TenI	NA	NA	NA	NA
QAW03673.1\|1238150_1239260_+	glycine oxidase ThiO	NA	NA	NA	NA
QAW06464.1\|1239259_1239460_+	sulfur carrier protein ThiS	NA	NA	NA	NA
QAW03674.1\|1239456_1240227_+	thiazole synthase	NA	NA	NA	NA
QAW03675.1\|1240223_1241234_+	thiazole biosynthesis adenylyltransferase ThiF	NA	NA	NA	NA
QAW03676.1\|1241252_1242068_+	bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase	NA	NA	NA	NA
QAW03677.1\|1242203_1242980_+	enoyl-[acyl-carrier-protein] reductase FabI	NA	NA	NA	NA
QAW03678.1\|1243080_1243764_+\|coat	spore coat protein	NA	NA	NA	NA
QAW03679.1\|1243857_1244304_-\|coat	spore coat protein Z	NA	NA	NA	NA
QAW03680.1\|1244431_1244920_-\|coat	spore coat protein Y	NA	NA	NA	NA
QAW03681.1\|1245071_1245554_-\|coat	spore coat protein	NA	NA	NA	NA
QAW03682.1\|1245638_1245959_-\|coat	spore coat protein	NA	NA	NA	NA

DBSCAN-SWA_4

1276911 : 1363275

uncultured_Caudovirales_phage(26.19%)

portal,protease,terminase,transposase,coat,holin,tail,plate,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAW03709.1\|1276911_1278123_+\|transposase	IS256 family transposase	A0A220NQR7	Corynebacterium_phage	2.2e-23	26.8
QAW03710.1\|1278253_1278760_-	N-acetyltransferase	NA	NA	NA	NA
QAW03711.1\|1278978_1279374_-	hypothetical protein	NA	NA	NA	NA
QAW03712.1\|1279602_1280082_+\|tRNA	Cys-tRNA(Pro) deacylase	NA	NA	NA	NA
QAW03713.1\|1280121_1280277_-	DUF4177 domain-containing protein	NA	NA	NA	NA
QAW03714.1\|1280306_1280636_-	DUF4306 domain-containing protein	NA	NA	NA	NA
QAW03715.1\|1281042_1281237_+	hypothetical protein	NA	NA	NA	NA
QAW03716.1\|1281255_1282245_-	protoheme IX farnesyltransferase	NA	NA	NA	NA
QAW03717.1\|1282367_1282616_-\|coat	spore coat protein CotT	NA	NA	NA	NA
QAW03718.1\|1282869_1284273_+	DUF4163 domain-containing protein	NA	NA	NA	NA
QAW03719.1\|1284312_1284786_-	DUF2690 domain-containing protein	NA	NA	NA	NA
QAW03720.1\|1284910_1285078_-	putative motility protein	NA	NA	NA	NA
QAW03721.1\|1285204_1286104_+	hypothetical protein	NA	NA	NA	NA
QAW03722.1\|1286113_1286512_-	DUF2809 domain-containing protein	NA	NA	NA	NA
QAW03723.1\|1286612_1287188_-	DUF4309 domain-containing protein	NA	NA	NA	NA
QAW03724.1\|1290279_1290825_+	DUF1641 domain-containing protein	NA	NA	NA	NA
QAW03725.1\|1291036_1291681_+	DUF4352 domain-containing protein	NA	NA	NA	NA
QAW03726.1\|1291755_1292382_+	NUDIX domain-containing protein	NA	NA	NA	NA
QAW03727.1\|1292412_1292691_-	hypothetical protein	NA	NA	NA	NA
QAW03728.1\|1293081_1294272_+	cytochrome P450	NA	NA	NA	NA
QAW03729.1\|1294294_1295473_+	UDP-glucosyltransferase	Q0IKX4	Leucania_separata_nucleopolyhedrovirus	5.6e-08	28.3
QAW03730.1\|1295513_1295702_-	hypothetical protein	A0A1P8CWV7	Bacillus_phage	3.4e-21	77.6
QAW03731.1\|1295875_1296688_+	uroporphyrinogen-III synthase	NA	NA	NA	NA
QAW03732.1\|1296733_1297486_-	iron export ABC transporter permease subunit FetB	NA	NA	NA	NA
QAW03733.1\|1297485_1298238_-	phosphate ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.4e-18	31.4
QAW03734.1\|1298357_1299332_-	multidrug resistance efflux transporter family protein	NA	NA	NA	NA
QAW03735.1\|1299463_1299961_+	cupin domain-containing protein	NA	NA	NA	NA
QAW03736.1\|1300349_1300772_+	DUF1641 domain-containing protein	NA	NA	NA	NA
QAW03737.1\|1300811_1301990_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
QAW03738.1\|1302186_1303608_+	glucuronate isomerase	NA	NA	NA	NA
QAW03739.1\|1303675_1305055_+	MFS transporter	NA	NA	NA	NA
QAW03740.1\|1305159_1306173_+	ureidoglycolate dehydrogenase	NA	NA	NA	NA
QAW03741.1\|1306178_1307198_+	zinc-binding alcohol dehydrogenase family protein	NA	NA	NA	NA
QAW03742.1\|1307222_1308302_+	mannonate dehydratase	NA	NA	NA	NA
QAW03743.1\|1308298_1309135_+	SDR family NAD(P)-dependent oxidoreductase	M1NMS3	Moumouvirus	3.6e-09	30.4
QAW03744.1\|1309182_1310451_+	MFS transporter	NA	NA	NA	NA
QAW03745.1\|1310538_1311540_+	LacI family transcriptional regulator	NA	NA	NA	NA
QAW03746.1\|1311614_1313057_+	tagaturonate reductase	NA	NA	NA	NA
QAW03747.1\|1313053_1314547_+	altronate dehydratase	NA	NA	NA	NA
QAW03748.1\|1314585_1315350_-	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
QAW03749.1\|1315568_1316033_-	hypothetical protein	NA	NA	NA	NA
QAW03750.1\|1317323_1318474_-\|transposase	IS3 family transposase	A0A0N9SIX5	Staphylococcus_phage	1.7e-38	61.2
QAW03751.1\|1318886_1320023_+	tetratricopeptide repeat protein	A0A1P8CWN8	Bacillus_phage	4.9e-94	47.4
QAW03752.1\|1320012_1320147_+	phosphatase RapA inhibitor PhrA	NA	NA	NA	NA
QAW03753.1\|1320544_1321498_+	LysM peptidoglycan-binding domain-containing protein	A0A218KC88	Bacillus_phage	1.6e-66	73.8
QAW06468.1\|1321537_1321915_-	PH domain-containing protein	A5GYQ0	Lactococcus_phage	7.9e-17	42.3
QAW03754.1\|1322019_1322622_+	hypothetical protein	F8WQ53	Bacillus_phage	1.4e-44	48.7
QAW03755.1\|1322698_1323535_+	manganese catalase family protein	NA	NA	NA	NA
QAW03756.1\|1323578_1324175_-	ImmA/IrrE family metallo-endopeptidase	A0A2H4JA43	uncultured_Caudovirales_phage	8.1e-40	51.7
QAW03757.1\|1324337_1324679_-	XRE family transcriptional regulator	A0A2H4J6F9	uncultured_Caudovirales_phage	1.3e-18	45.8
QAW03758.1\|1324857_1325037_+	hypothetical protein	NA	NA	NA	NA
QAW03759.1\|1325023_1325860_+\|portal	phage portal protein	S6BFM4	Thermus_phage	6.7e-24	27.8
QAW03760.1\|1325759_1326560_+	ATP-binding protein	A6XMI1	Bacillus_virus	5.0e-61	51.7
QAW03761.1\|1326559_1326727_+	hypothetical protein	NA	NA	NA	NA
QAW03762.1\|1326811_1327162_+\|portal	phage portal protein	NA	NA	NA	NA
QAW03763.1\|1327158_1327365_+	phage-like element PBSX protein XtrA	A0A2H4J4M6	uncultured_Caudovirales_phage	2.1e-11	50.0
QAW03764.1\|1327480_1327990_+	sigma-70 family RNA polymerase sigma factor	A0A1L2JY33	Aeribacillus_phage	6.5e-22	39.2
QAW03765.1\|1328105_1328903_+\|terminase	PBSX phage terminase small subunit	A0A0S2MVB6	Bacillus_phage	8.0e-59	50.2
QAW03766.1\|1328899_1330201_+\|terminase	PBSX family phage terminase large subunit	A0A2P1JTW5	Anoxybacillus_phage	9.1e-153	60.0
QAW03767.1\|1330204_1331692_+\|portal	phage portal protein	A0A1B1P7C8	Bacillus_phage	1.7e-139	55.7
QAW03768.1\|1331711_1332539_+\|portal	phage portal protein	A0A1B1P7E4	Bacillus_phage	1.6e-54	59.2
QAW03769.1\|1332564_1333500_+	phage-like element PBSX protein XkdG	A0A1B1P7E3	Bacillus_phage	1.1e-104	63.8
QAW03770.1\|1333521_1333905_+	DUF3199 family protein	A0A1B1P7D6	Bacillus_phage	1.4e-13	40.5
QAW03771.1\|1333901_1334258_+	DUF3599 family protein	NA	NA	NA	NA
QAW03772.1\|1334254_1334740_+	HK97 gp10 family phage protein	A0A249XXA4	Clostridium_phage	2.1e-38	47.0
QAW03773.1\|1334752_1335193_+	phage-like element PBSX protein XkdJ	NA	NA	NA	NA
QAW03774.1\|1335196_1335415_+	hypothetical protein	NA	NA	NA	NA
QAW03775.1\|1335411_1336812_+\|tail	phage tail sheath protein	A0A0A7S087	Clostridium_phage	3.0e-77	39.3
QAW03776.1\|1336813_1337257_+	phage-like element PBSX protein XkdM	A0A0K2CNG3	Brevibacillus_phage	1.9e-25	44.5
QAW03777.1\|1337348_1337795_+\|portal	phage portal protein	A0A0A7RTY8	Clostridium_phage	1.0e-10	36.8
QAW06469.1\|1337836_1337977_+	hypothetical protein	NA	NA	NA	NA
QAW03778.1\|1337977_1342981_+\|portal	phage portal protein	A0A2H4JA91	uncultured_Caudovirales_phage	6.4e-37	44.8
QAW03779.1\|1342973_1343633_+	LysM peptidoglycan-binding domain-containing protein	A0A0A8WJR4	Clostridium_phage	1.1e-24	33.2
QAW06470.1\|1343648_1344626_+	phage-like element PBSX protein XkdQ	H7BV96	unidentified_phage	1.0e-39	32.6
QAW03780.1\|1344625_1344892_+	DUF2577 domain-containing protein	S6C459	Thermus_phage	1.7e-05	36.4
QAW03781.1\|1344949_1345375_+	DUF2634 domain-containing protein	A0A2H4J6K5	uncultured_Caudovirales_phage	3.0e-12	38.0
QAW03782.1\|1345367_1346414_+\|plate	baseplate J/gp47 family protein	S6AVU3	Thermus_phage	1.3e-72	44.3
QAW03783.1\|1346397_1346976_+	DUF2313 domain-containing protein	A0A2H4J717	uncultured_Caudovirales_phage	3.9e-15	34.2
QAW03784.1\|1346972_1347245_+	hypothetical protein	NA	NA	NA	NA
QAW03785.1\|1347247_1349311_+\|terminase	terminase	A0A2H4J4R1	uncultured_Caudovirales_phage	2.6e-29	34.5
QAW03786.1\|1349322_1349652_+\|portal	phage portal protein	A0A2H4JCI0	uncultured_Caudovirales_phage	1.3e-15	40.7
QAW03787.1\|1349648_1349813_+	XkdX family protein	A0A2H4JAA1	uncultured_Caudovirales_phage	5.5e-15	66.0
QAW03788.1\|1349856_1350696_+\|portal	phage portal protein	NA	NA	NA	NA
QAW03789.1\|1350748_1351018_+	protein xhlA	A0A2H4JD40	uncultured_Caudovirales_phage	6.2e-24	64.8
QAW03790.1\|1351030_1351294_+\|holin	phage holin	A0A2H4J6M0	uncultured_Caudovirales_phage	8.8e-23	63.2
QAW03791.1\|1351306_1352200_+	LysM peptidoglycan-binding domain-containing protein	Q9ZXD7	Bacillus_phage	5.2e-83	69.2
QAW03792.1\|1352237_1352375_-	hypothetical protein	NA	NA	NA	NA
QAW03793.1\|1352460_1352631_-	type II toxin-antitoxin system SpoIISB family antitoxin	NA	NA	NA	NA
QAW03794.1\|1352630_1353377_-	type II toxin-antitoxin system SpoIISA family toxin	NA	NA	NA	NA
QAW03795.1\|1353486_1354488_-	inorganic phosphate transporter	E5ES24	Ostreococcus_lucimarinus_virus	8.6e-10	28.7
QAW03796.1\|1354500_1355118_-	DUF47 domain-containing protein	NA	NA	NA	NA
QAW03797.1\|1355393_1356710_-	amino acid permease	NA	NA	NA	NA
QAW03798.1\|1357098_1358049_+	ring-cleaving dioxygenase	NA	NA	NA	NA
QAW06471.1\|1358265_1360416_+	glycosyltransferase family 39 protein	NA	NA	NA	NA
QAW03799.1\|1360427_1361399_+	glycosyltransferase	A0A2H5BFL1	Salmonella_phage	1.9e-62	41.0
QAW06472.1\|1361916_1363275_-\|protease	serine protease	A0A1B1IT49	uncultured_Mediterranean_phage	5.8e-25	33.7

DBSCAN-SWA_5

1783005 : 1832710

Bacillus_phage(50.0%)

protease,transposase,terminase,coat,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAW04209.1\|1783005_1784535_+\|tRNA	tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB	NA	NA	NA	NA
QAW04210.1\|1784536_1784968_+	hypothetical protein	NA	NA	NA	NA
QAW04211.1\|1785229_1785775_+\|coat	outer spore coat protein CotE	NA	NA	NA	NA
QAW04212.1\|1785907_1788484_+	DNA mismatch repair protein MutS	A0A1V0SC35	Catovirus	2.4e-40	27.7
QAW04213.1\|1788499_1790383_+	DNA mismatch repair endonuclease MutL	A0A1B2LRQ5	Wolbachia_phage	7.6e-68	31.3
QAW04214.1\|1791492_1791741_+	hypothetical protein	A0A2H4JA61	uncultured_Caudovirales_phage	4.6e-05	44.9
QAW04215.1\|1791791_1792154_-	hypothetical protein	NA	NA	NA	NA
QAW04216.1\|1792426_1793176_+	hypothetical protein	NA	NA	NA	NA
QAW04217.1\|1795319_1795637_+	hypothetical protein	NA	NA	NA	NA
QAW04218.1\|1795812_1796058_+	hypothetical protein	NA	NA	NA	NA
QAW04219.1\|1796047_1796662_+	hypothetical protein	NA	NA	NA	NA
QAW04220.1\|1796674_1796899_+	hypothetical protein	NA	NA	NA	NA
QAW04221.1\|1796895_1797270_+	HNH endonuclease	Q38456	Bacillus_phage	1.3e-64	87.1
QAW04222.1\|1797649_1798183_+\|terminase	phage terminase small subunit P27 family	Q9ZXG2	Bacillus_phage	1.0e-70	82.5
QAW04223.1\|1798470_1799682_-\|transposase	IS256 family transposase	A0A220NQR7	Corynebacterium_phage	2.2e-23	26.8
QAW06486.1\|1800728_1801184_-	hypothetical protein	NA	NA	NA	NA
QAW04224.1\|1801338_1801896_-	hypothetical protein	NA	NA	NA	NA
QAW04225.1\|1802016_1802631_+	TetR family transcriptional regulator	NA	NA	NA	NA
QAW04226.1\|1802769_1803126_-	hypothetical protein	NA	NA	NA	NA
QAW04227.1\|1803204_1804029_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
QAW04228.1\|1804139_1805468_-\|protease	serine protease	A0A1B0T6A2	Bacillus_phage	9.3e-28	33.6
QAW04229.1\|1805692_1805926_+	hypothetical protein	NA	NA	NA	NA
QAW04230.1\|1806205_1806913_+	hypothetical protein	F8WQ53	Bacillus_phage	3.2e-51	56.9
QAW04231.1\|1806982_1807435_+	OsmC family peroxiredoxin	NA	NA	NA	NA
QAW04232.1\|1807448_1807802_-	multidrug efflux SMR transporter subunit EbrB	NA	NA	NA	NA
QAW06487.1\|1807815_1808133_-	multidrug efflux SMR transporter subunit EbrA	NA	NA	NA	NA
QAW04233.1\|1808269_1808545_-	hypothetical protein	NA	NA	NA	NA
QAW04234.1\|1808633_1809047_+	hypothetical protein	NA	NA	NA	NA
QAW04235.1\|1809146_1810091_+\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
QAW04236.1\|1810130_1810352_+	RNA chaperone Hfq	NA	NA	NA	NA
QAW04237.1\|1810547_1810820_+	hypothetical protein	NA	NA	NA	NA
QAW04238.1\|1810901_1811132_+	hypothetical protein	NA	NA	NA	NA
QAW04239.1\|1811373_1811766_+	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	G3MBF1	Bacillus_virus	2.5e-29	58.3
QAW04240.1\|1811725_1813828_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	U5PY35	Bacillus_phage	0.0e+00	86.8
QAW04241.1\|1813845_1814835_+	class 1b ribonucleoside-diphosphate reductase subunit beta	F8WQ21	Bacillus_phage	1.9e-155	83.5
QAW04242.1\|1814884_1815505_+	hypothetical protein	A0A127AYS1	Bacillus_phage	1.6e-46	48.4
QAW04243.1\|1815568_1816336_-	N-acetylmuramoyl-L-alanine amidase	E5DV68	Deep-sea_thermophilic_phage	1.2e-51	49.5
QAW04244.1\|1816976_1817945_+	stage V sporulation protein K	G3MAX6	Bacillus_virus	5.2e-52	40.5
QAW04245.1\|1818077_1819340_+	GTPase HflX	NA	NA	NA	NA
QAW04246.1\|1819357_1820623_+	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
QAW04247.1\|1820732_1821140_+	transcriptional repressor GlnR	NA	NA	NA	NA
QAW04248.1\|1821198_1822533_+	type I glutamate--ammonia ligase	NA	NA	NA	NA
QAW06488.1\|1822642_1822843_+	hypothetical protein	NA	NA	NA	NA
QAW04249.1\|1822862_1824110_+\|transposase	IS256-like element ISBsu2 family transposase	A0A220NQR7	Corynebacterium_phage	2.6e-24	22.6
QAW04250.1\|1824184_1824484_-	hypothetical protein	NA	NA	NA	NA
QAW04251.1\|1824537_1824846_-	hypothetical protein	NA	NA	NA	NA
QAW04252.1\|1824866_1826750_-	hypothetical protein	A0A1P8CWI7	Bacillus_phage	5.2e-125	61.3
QAW04253.1\|1826998_1827178_+	hypothetical protein	NA	NA	NA	NA
QAW04254.1\|1828370_1828862_+	hypothetical protein	NA	NA	NA	NA
QAW04255.1\|1829042_1829894_+	toxin	O64021	Bacillus_phage	1.4e-85	60.3
QAW04256.1\|1830407_1831166_-	ATP-binding protein	U5N3V8	Enterobacteria_phage	5.8e-43	38.6
QAW06489.1\|1831162_1832710_-\|transposase	IS21 family transposase	NA	NA	NA	NA

DBSCAN-SWA_6

1931081 : 1988178

Bacillus_phage(57.69%)

holin,transposase,integrase

attL 1915387:1915402|attR 1963720:1963735

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1915387:1915402	attL	NA	NA	NA	NA
QAW04339.1\|1931081_1931627_-\|integrase	site-specific integrase	A0A1B0T6D2	Bacillus_phage	3.6e-42	51.4
QAW04340.1\|1931943_1932174_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
QAW04341.1\|1932358_1934122_+	gamma-glutamyltransferase	NA	NA	NA	NA
QAW04342.1\|1934283_1935141_-	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	4.5e-07	35.0
QAW04343.1\|1935268_1936258_+	NAD(P)-dependent alcohol dehydrogenase	NA	NA	NA	NA
QAW04344.1\|1936313_1937795_-	glutamate synthase small subunit	NA	NA	NA	NA
QAW04345.1\|1937811_1942374_-	glutamate synthase large subunit	NA	NA	NA	NA
QAW04346.1\|1942520_1943423_+	LysR family transcriptional regulator	NA	NA	NA	NA
QAW04347.1\|1943473_1944589_-	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	5.3e-69	41.5
QAW04348.1\|1944585_1945479_-	pyrroline-5-carboxylate reductase	A0A1X9I6T5	Streptococcus_phage	1.0e-30	32.7
QAW06495.1\|1945626_1945995_-	replication termination protein	A0A0K2CP62	Brevibacillus_phage	9.2e-18	41.8
QAW04349.1\|1946293_1947010_-	3-ketoacyl-ACP reductase	W8CYX9	Bacillus_phage	9.7e-48	78.0
QAW04350.1\|1947160_1947469_+	DUF948 domain-containing protein	NA	NA	NA	NA
QAW04351.1\|1947535_1948306_+	hypothetical protein	NA	NA	NA	NA
QAW04352.1\|1948349_1948883_+	N-acetyltransferase	NA	NA	NA	NA
QAW04353.1\|1949022_1950015_-	ABC transporter permease	NA	NA	NA	NA
QAW04354.1\|1950008_1950755_-	ABC transporter permease	NA	NA	NA	NA
QAW04355.1\|1950764_1951703_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	6.1e-26	32.7
QAW04356.1\|1951718_1952270_-	MarR family transcriptional regulator	NA	NA	NA	NA
QAW04357.1\|1952665_1953910_-	MFS transporter	NA	NA	NA	NA
QAW04358.1\|1954008_1955256_+\|transposase	IS256-like element ISBsu2 family transposase	A0A220NQR7	Corynebacterium_phage	2.6e-24	22.6
QAW04359.1\|1955257_1955554_-	hypothetical protein	NA	NA	NA	NA
QAW04360.1\|1955706_1956003_-	hypothetical protein	NA	NA	NA	NA
QAW04361.1\|1956362_1957512_+\|transposase	IS3 family transposase	A0A0N9SIX5	Staphylococcus_phage	1.7e-38	61.2
QAW04362.1\|1957553_1957793_-	DUF4365 domain-containing protein	NA	NA	NA	NA
QAW04363.1\|1957829_1958063_-	3-ketosteroid-delta-1-dehydrogenase	NA	NA	NA	NA
QAW06496.1\|1958149_1958461_-	hypothetical protein	NA	NA	NA	NA
QAW04364.1\|1958477_1958609_-	hypothetical protein	A0A1P8CWV9	Bacillus_phage	2.7e-17	93.0
QAW04365.1\|1958845_1959097_-	hypothetical protein	A0A1P8CWV6	Bacillus_phage	1.5e-35	94.0
QAW04366.1\|1959465_1960893_-	class A beta-lactamase-related serine hydrolase	NA	NA	NA	NA
QAW04367.1\|1961026_1961257_+	hypothetical protein	NA	NA	NA	NA
QAW04368.1\|1961266_1961659_-	UPF0715 family protein	O64087	Bacillus_phage	3.7e-49	81.4
QAW04369.1\|1961703_1961928_-	hypothetical protein	NA	NA	NA	NA
QAW06497.1\|1961962_1962316_-	hypothetical protein	NA	NA	NA	NA
QAW04370.1\|1962434_1963079_-	DUF3885 domain-containing protein	NA	NA	NA	NA
QAW04371.1\|1963230_1963479_-	XRE family transcriptional regulator	A0A1P8CWU2	Bacillus_phage	2.3e-25	86.4
QAW04372.1\|1963570_1964008_-	hypothetical protein	NA	NA	NA	NA
1963720:1963735	attR	NA	NA	NA	NA
QAW04373.1\|1964098_1964482_-	hypothetical protein	O64087	Bacillus_phage	4.0e-08	34.2
QAW04374.1\|1965074_1965629_-	hypothetical protein	NA	NA	NA	NA
QAW04375.1\|1967188_1967563_+	hypothetical protein	A0A1P8CWZ2	Bacillus_phage	1.1e-26	52.8
QAW04376.1\|1968672_1969833_+	tetratricopeptide repeat protein	A0A1P8CWN8	Bacillus_phage	3.2e-32	26.0
QAW04377.1\|1970068_1970647_+	N-acetyltransferase	NA	NA	NA	NA
QAW04378.1\|1970669_1971521_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
QAW04379.1\|1971694_1972840_-	ThiF family adenylyltransferase	A0A1V0SCZ9	Indivirus	4.3e-05	21.1
QAW04380.1\|1972844_1973264_-	hypothetical protein	NA	NA	NA	NA
QAW06498.1\|1973465_1975013_+\|transposase	IS21 family transposase	NA	NA	NA	NA
QAW04381.1\|1975009_1975768_+	ATP-binding protein	U5N3V8	Enterobacteria_phage	5.8e-43	38.6
QAW04382.1\|1975807_1976161_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
QAW04383.1\|1976172_1977405_-	MFS transporter	NA	NA	NA	NA
QAW04384.1\|1977488_1978736_+\|transposase	IS256-like element ISBsu2 family transposase	A0A220NQR7	Corynebacterium_phage	2.6e-24	22.6
QAW04385.1\|1980942_1981302_-	hypothetical protein	A0A1P8CWJ9	Bacillus_phage	2.2e-61	98.3
QAW06499.1\|1981561_1981645_+\|holin	putative holin-like toxin	NA	NA	NA	NA
QAW04386.1\|1981933_1982467_-	N-acetyltransferase	O64026	Bacillus_phage	4.0e-99	98.9
QAW04387.1\|1982502_1983081_-	SMI1/KNR4 family protein	O64025	Bacillus_phage	6.1e-101	92.7
QAW04388.1\|1983136_1983595_-	SMI1/KNR4 family protein	A0A1P8CWJ1	Bacillus_phage	2.8e-72	85.5
QAW04389.1\|1983687_1984146_-	SMI1/KNR4 family protein	NA	NA	NA	NA
QAW04390.1\|1984155_1985958_-	hypothetical protein	A0A1P8CWI7	Bacillus_phage	2.3e-218	86.8
QAW04391.1\|1986056_1986614_-	SMI1/KNR4 family protein	O64022	Bacillus_phage	7.0e-102	95.7
QAW04392.1\|1986741_1988178_+	flavin monoamine oxidase family protein	A0A2K9L022	Tupanvirus	2.6e-07	30.6

DBSCAN-SWA_7

2200626 : 2206721

Staphylococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAW04628.1\|2200626_2201220_-	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	2.6e-14	35.4
QAW06506.1\|2201209_2201965_-	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	5.5e-09	29.2
QAW04629.1\|2202244_2202769_+	DUF309 domain-containing protein	NA	NA	NA	NA
QAW04630.1\|2202782_2203157_-	GNAT family N-acetyltransferase RibT	NA	NA	NA	NA
QAW04631.1\|2203269_2203734_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	5.5e-44	60.0
QAW04632.1\|2203766_2204963_-	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	4.1e-115	54.9
QAW04633.1\|2204977_2205625_-	riboflavin synthase subunit alpha	A0A2H4PQS5	Staphylococcus_phage	8.5e-43	45.9
QAW04634.1\|2205635_2206721_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	5.1e-56	36.1

DBSCAN-SWA_8

2588765 : 2655036

Faustovirus(10.0%)

protease,integrase,tRNA,coat

attL 2643899:2643958|attR 2655299:2655361

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAW05024.1\|2588765_2589929_-\|coat	spore coat assembly protein SafA	NA	NA	NA	NA
QAW05025.1\|2590045_2591152_-	quinolinate synthase NadA	NA	NA	NA	NA
QAW05026.1\|2591138_2592008_-	carboxylating nicotinate-nucleotide diphosphorylase	NA	NA	NA	NA
QAW05027.1\|2591961_2593557_-	L-aspartate oxidase	NA	NA	NA	NA
QAW05028.1\|2593659_2594847_+	aminotransferase class V-fold PLP-dependent enzyme	A0A141ZJV0	Faustovirus	3.9e-33	27.4
QAW05029.1\|2594806_2595349_+	transcription repressor NadR	NA	NA	NA	NA
QAW05030.1\|2595372_2596230_-	prephenate dehydratase	NA	NA	NA	NA
QAW05031.1\|2596246_2596690_-	ACT domain-containing protein	NA	NA	NA	NA
QAW05032.1\|2596750_2598037_-	GTPase ObgE	NA	NA	NA	NA
QAW05033.1\|2598070_2598649_-	sporulation initiation phosphotransferase B	NA	NA	NA	NA
QAW05034.1\|2598726_2598849_+	hypothetical protein	NA	NA	NA	NA
QAW05035.1\|2598969_2599254_-	50S ribosomal protein L27	NA	NA	NA	NA
QAW05036.1\|2599266_2599605_-\|protease	ribosomal-processing cysteine protease Prp	NA	NA	NA	NA
QAW05037.1\|2599607_2599916_-	50S ribosomal protein L21	NA	NA	NA	NA
QAW05038.1\|2600062_2600929_-	stage IV sporulation protein FB	NA	NA	NA	NA
QAW05039.1\|2600921_2601716_-	M23 family metallopeptidase	NA	NA	NA	NA
QAW05040.1\|2601864_2602671_-	septum site-determining protein MinD	NA	NA	NA	NA
QAW05041.1\|2602672_2603353_-	septum site-determining protein MinC	NA	NA	NA	NA
QAW05042.1\|2603405_2603924_-	rod shape-determining protein MreD	NA	NA	NA	NA
QAW05043.1\|2603920_2604793_-	rod shape-determining protein MreC	NA	NA	NA	NA
QAW05044.1\|2604823_2605837_-	rod shape-determining protein MreB	NA	NA	NA	NA
QAW05045.1\|2605928_2606624_-	JAB domain-containing protein	NA	NA	NA	NA
QAW05046.1\|2606660_2607230_-	septum formation protein Maf	NA	NA	NA	NA
QAW05047.1\|2607382_2608381_-	SPOR domain-containing protein	NA	NA	NA	NA
QAW05048.1\|2608514_2609261_-	prepilin peptidase	NA	NA	NA	NA
QAW05049.1\|2609400_2610693_-	bifunctional folylpolyglutamate synthase/dihydrofolate synthase	NA	NA	NA	NA
QAW06537.1\|2610752_2613395_-\|tRNA	valine--tRNA ligase	A0A1V0S951	Catovirus	3.7e-161	42.6
QAW05050.1\|2613842_2614034_+	hypothetical protein	NA	NA	NA	NA
QAW05051.1\|2614052_2615078_-\|coat	spore coat protein YsxE	NA	NA	NA	NA
QAW05052.1\|2615110_2616838_-	LysM peptidoglycan-binding domain-containing protein	NA	NA	NA	NA
QAW05053.1\|2616968_2618261_-	glutamate-1-semialdehyde-2,1-aminomutase	NA	NA	NA	NA
QAW05054.1\|2618290_2619265_-	porphobilinogen synthase	NA	NA	NA	NA
QAW05055.1\|2619261_2620050_-	uroporphyrinogen-III synthase	NA	NA	NA	NA
QAW05056.1\|2620039_2620984_-	hydroxymethylbilane synthase	NA	NA	NA	NA
QAW05057.1\|2621016_2621847_-	protein HemX	NA	NA	NA	NA
QAW05058.1\|2621854_2623222_-\|tRNA	glutamyl-tRNA reductase	NA	NA	NA	NA
QAW05059.1\|2623451_2623949_+	hypothetical protein	NA	NA	NA	NA
QAW05060.1\|2623970_2624558_-	YihA family ribosome biogenesis GTP-binding protein	NA	NA	NA	NA
QAW05061.1\|2624554_2626879_-	endopeptidase La	A0A0R6PGP8	Moraxella_phage	4.4e-182	43.7
QAW05062.1\|2627059_2628718_-\|protease	Lon protease 2	A0A1V0SHJ7	Hokovirus	8.1e-05	33.7
QAW05063.1\|2628871_2630134_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.3e-148	64.9
QAW05064.1\|2630405_2631680_-	trigger factor	NA	NA	NA	NA
QAW05065.1\|2631907_2632912_-	tetratricopeptide repeat protein	NA	NA	NA	NA
QAW05066.1\|2633030_2633630_-	3-isopropylmalate dehydratase small subunit	NA	NA	NA	NA
QAW05067.1\|2633642_2635061_-	3-isopropylmalate dehydratase large subunit	NA	NA	NA	NA
QAW05068.1\|2635110_2636208_-	3-isopropylmalate dehydrogenase	NA	NA	NA	NA
QAW05069.1\|2636228_2637785_-	2-isopropylmalate synthase	E5EQ69	Micromonas_sp._RCC1109_virus	1.7e-09	38.8
QAW05070.1\|2637771_2638800_-	ketol-acid reductoisomerase	NA	NA	NA	NA
QAW05071.1\|2638823_2639342_-	acetolactate synthase small subunit	NA	NA	NA	NA
QAW05072.1\|2639338_2641063_-	acetolactate synthase large subunit	A0A0P0YLY7	Yellowstone_lake_phycodnavirus	2.4e-60	30.2
QAW05073.1\|2641875_2642211_+	hypothetical protein	NA	NA	NA	NA
QAW05074.1\|2643012_2643837_+	YsnF/AvaK domain-containing protein	NA	NA	NA	NA
2643899:2643958	attL	NA	NA	NA	NA
QAW05075.1\|2645283_2646603_-	restriction endonuclease subunit S	A0A2H4PQP5	Staphylococcus_phage	1.3e-16	35.9
QAW05076.1\|2646599_2648030_-	SAM-dependent methyltransferase	A0A220A2U4	Liberibacter_phage	2.6e-28	25.9
QAW05077.1\|2648162_2651369_-	type I restriction-modification system endonuclease	Q5YA94	Bacillus_phage	1.7e-06	29.5
QAW05078.1\|2651673_2652765_-	hypothetical protein	NA	NA	NA	NA
QAW05079.1\|2653514_2653811_-	hypothetical protein	NA	NA	NA	NA
QAW06538.1\|2654148_2655036_-\|integrase	site-specific integrase	NA	NA	NA	NA
2655299:2655361	attR	NA	NA	NA	NA

DBSCAN-SWA_9

3078169 : 3174878

116

Bacillus_phage(34.78%)

protease,portal,capsid,transposase,coat,terminase,holin,tail,head,plate,integrase

attL 3118866:3118884|attR 3156146:3156164

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAW05465.1\|3078169_3079189_-\|coat	spore coat protein YutH	NA	NA	NA	NA
QAW05466.1\|3079341_3079842_+	phosphatidylglycerophosphatase A	G3MBC5	Bacillus_virus	1.2e-41	56.0
QAW05467.1\|3079868_3080639_-	TIGR01457 family HAD-type hydrolase	NA	NA	NA	NA
QAW05468.1\|3080667_3081102_-	DUF86 domain-containing protein	NA	NA	NA	NA
QAW05469.1\|3081125_3081401_-	DUF1027 domain-containing protein	NA	NA	NA	NA
QAW05470.1\|3081513_3082146_+	hypothetical protein	NA	NA	NA	NA
QAW05471.1\|3082161_3083058_-	lipoyl synthase	NA	NA	NA	NA
QAW05472.1\|3083292_3084273_+	M23 family metallopeptidase	A0A075BS18	Microcystis_phage	3.0e-07	37.3
QAW05473.1\|3084300_3085065_-	sporulation protein YunB	NA	NA	NA	NA
QAW05474.1\|3085137_3085443_-	DUF1805 domain-containing protein	NA	NA	NA	NA
QAW05475.1\|3085507_3086896_-	bifunctional metallophosphatase/5'-nucleotidase	NA	NA	NA	NA
QAW05476.1\|3086915_3087737_-	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
QAW06556.1\|3087754_3088603_-	DUF72 domain-containing protein	NA	NA	NA	NA
QAW05477.1\|3088640_3088988_-	hypothetical protein	NA	NA	NA	NA
QAW05478.1\|3089084_3090425_-	allantoinase	NA	NA	NA	NA
QAW05479.1\|3090599_3092195_+	PucR family transcriptional regulator	NA	NA	NA	NA
QAW05480.1\|3092339_3093689_+	purine permease	Q9KX94	Enterobacteria_phage	5.2e-26	28.1
QAW05481.1\|3093694_3094975_+	purine permease	Q9KX94	Enterobacteria_phage	2.0e-27	30.0
QAW05482.1\|3094995_3096480_+	urate oxidase	NA	NA	NA	NA
QAW05483.1\|3096479_3096824_+	hydroxyisourate hydrolase	NA	NA	NA	NA
QAW05484.1\|3097247_3097379_+	YhzE/YjcZ family sporulation protein YuzJ	NA	NA	NA	NA
QAW05485.1\|3097585_3098107_-	xanthine dehydrogenase subunit E	NA	NA	NA	NA
QAW05486.1\|3098097_3100335_-	xanthine dehydrogenase subunit D	NA	NA	NA	NA
QAW05487.1\|3100335_3101169_-	xanthine dehydrogenase subunit C	NA	NA	NA	NA
QAW05488.1\|3101165_3101783_-	xanthine dehydrogenase accessory protein PucB	NA	NA	NA	NA
QAW05489.1\|3101779_3102772_-	XdhC family protein	NA	NA	NA	NA
QAW05490.1\|3102998_3104249_-	alanine--glyoxylate aminotransferase family protein	NA	NA	NA	NA
QAW05491.1\|3104265_3105504_-	allantoate amidohydrolase	NA	NA	NA	NA
QAW05492.1\|3105949_3106816_+	ribonuclease	NA	NA	NA	NA
QAW05493.1\|3106994_3108098_-	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	Q6GZ03	Mycoplasma_phage	5.0e-19	29.7
QAW05494.1\|3108279_3109008_+	transcriptional regulator PhoB	NA	NA	NA	NA
QAW05495.1\|3109032_3109887_-	fructoselysine 6-kinase	NA	NA	NA	NA
QAW05496.1\|3109900_3110803_-	carbohydrate ABC transporter permease	NA	NA	NA	NA
QAW05497.1\|3110806_3111685_-	sugar ABC transporter permease	NA	NA	NA	NA
QAW05498.1\|3111742_3113011_-	carbohydrate ABC transporter substrate-binding protein	NA	NA	NA	NA
QAW05499.1\|3113091_3114078_-	SIS domain-containing protein	A0A2L2DN46	Acanthamoeba_polyphaga_mimivirus	1.9e-09	23.6
QAW05500.1\|3114293_3114668_-	nucleotide excision repair endonuclease	NA	NA	NA	NA
QAW05501.1\|3114770_3115889_-	FAD-binding oxidoreductase	NA	NA	NA	NA
QAW05502.1\|3116047_3116194_+	acid-soluble spore protein SspG	NA	NA	NA	NA
QAW05503.1\|3116193_3116469_+	hypothetical protein	NA	NA	NA	NA
QAW05504.1\|3116579_3117729_+\|transposase	IS3 family transposase	A0A0N9SIX5	Staphylococcus_phage	1.7e-38	61.2
QAW05505.1\|3117822_3118206_-	VOC family protein	NA	NA	NA	NA
QAW05506.1\|3118316_3118595_-	ArsR family transcriptional regulator	NA	NA	NA	NA
3118866:3118884	attL	NA	NA	NA	NA
QAW06557.1\|3119327_3119516_+	hypothetical protein	A0A2H4J4T3	uncultured_Caudovirales_phage	3.2e-11	50.0
QAW05507.1\|3119675_3121448_+	hypothetical protein	A0A1P8CWI7	Bacillus_phage	1.6e-120	54.7
QAW05508.1\|3121460_3121922_+	SMI1/KNR4 family protein	NA	NA	NA	NA
QAW05509.1\|3121972_3122914_-	LysM peptidoglycan-binding domain-containing protein	Q9ZXD7	Bacillus_phage	3.0e-97	77.1
QAW05510.1\|3122955_3123378_-\|holin	holin family protein	D6R405	Bacillus_phage	3.0e-57	85.7
QAW05511.1\|3123431_3123602_-	XkdX family protein	NA	NA	NA	NA
QAW05512.1\|3123598_3123898_-	hypothetical protein	M4ZR44	Bacillus_phage	1.5e-39	79.2
QAW05513.1\|3123913_3125137_-\|plate	phage baseplate upper protein	M4ZRP1	Bacillus_phage	9.1e-179	80.3
QAW05514.1\|3126761_3128636_-	autolysin	D6R400	Bacillus_phage	5.5e-50	27.8
QAW05515.1\|3128649_3129483_-\|tail	phage tail family protein	M4ZS20	Bacillus_phage	3.5e-33	34.1
QAW05516.1\|3129495_3133236_-	hypothetical protein	A0A0S2SXL7	Bacillus_phage	9.1e-105	60.4
QAW05517.1\|3133298_3133481_-	hypothetical protein	NA	NA	NA	NA
QAW05518.1\|3133492_3133855_-	hypothetical protein	NA	NA	NA	NA
QAW05519.1\|3133914_3134499_-\|tail	major tail protein	U5U3Z7	Lactobacillus_phage	9.1e-28	36.5
QAW05520.1\|3134504_3134912_-	hypothetical protein	NA	NA	NA	NA
QAW05521.1\|3134908_3135301_-\|tail	phage tail protein	A0A0M5M1E5	Enterococcus_phage	3.0e-11	37.9
QAW05522.1\|3135300_3135627_-\|head,tail	head-tail adaptor protein	NA	NA	NA	NA
QAW05523.1\|3135616_3135910_-\|head,tail	phage gp6-like head-tail connector protein	A0A2H4JB77	uncultured_Caudovirales_phage	2.6e-07	33.0
QAW05524.1\|3135964_3136348_-	collagen-like protein	D6R3Z0	Bacillus_phage	1.4e-05	56.8
QAW05525.1\|3136375_3137578_-\|capsid	phage major capsid protein	A0A2H4J824	uncultured_Caudovirales_phage	8.3e-76	49.8
QAW05526.1\|3137626_3138223_-\|head,protease	HK97 family phage prohead protease	A0A1J0MFL1	Staphylococcus_phage	3.6e-48	53.3
QAW05527.1\|3138215_3139442_-\|portal	phage portal protein	A0A2H4J331	uncultured_Caudovirales_phage	5.3e-70	38.8
QAW05528.1\|3139446_3139653_-	hypothetical protein	NA	NA	NA	NA
QAW05529.1\|3139669_3141376_-\|terminase	terminase large subunit	A0A2H4JC16	uncultured_Caudovirales_phage	1.9e-121	42.8
QAW05530.1\|3141368_3141863_-\|terminase	phage terminase small subunit P27 family	A0A1Q1PVW3	Staphylococcus_phage	9.1e-21	36.1
QAW05531.1\|3142096_3142309_-	hypothetical protein	NA	NA	NA	NA
QAW05532.1\|3142311_3142695_-	HNH endonuclease	A0A075M5R4	Enterococcus_phage	1.1e-18	44.2
QAW05533.1\|3142797_3143412_-	hypothetical protein	NA	NA	NA	NA
QAW05534.1\|3143548_3144109_-	hypothetical protein	NA	NA	NA	NA
QAW05535.1\|3144366_3144909_-\|integrase	site-specific integrase	D2XR58	Bacillus_phage	5.8e-61	63.9
QAW06558.1\|3144905_3145358_-	ArpU family transcriptional regulator	S6AVV9	Thermus_phage	1.7e-37	55.9
QAW05536.1\|3145967_3146354_-	hypothetical protein	A0A1P8CWX0	Bacillus_phage	3.8e-14	36.2
QAW05537.1\|3146350_3146830_-	hypothetical protein	F8WQ59	Bacillus_phage	1.0e-21	53.8
QAW05538.1\|3146829_3147522_-	dUTPase	R9TQ23	Paenibacillus_phage	6.7e-38	43.7
QAW05539.1\|3147684_3147933_-	hypothetical protein	A0A2H4JA61	uncultured_Caudovirales_phage	6.0e-05	44.9
QAW05540.1\|3147929_3148337_-	hypothetical protein	W8CYU3	Bacillus_phage	2.9e-25	45.0
QAW05541.1\|3148333_3148618_-	hypothetical protein	NA	NA	NA	NA
QAW05542.1\|3148661_3148859_-	hypothetical protein	NA	NA	NA	NA
QAW05543.1\|3149106_3149247_-	BH0509 family protein	NA	NA	NA	NA
QAW05544.1\|3149354_3149903_-	hypothetical protein	A0A0K2CYJ0	Paenibacillus_phage	4.6e-05	39.3
QAW05545.1\|3150202_3151057_-	AAA family ATPase	Q4ZAS1	Staphylococcus_virus	2.2e-22	29.4
QAW05546.1\|3151007_3151847_-	DNA replication protein DnaD	A0A0U3TZZ4	Bacillus_phage	1.4e-66	51.4
QAW05547.1\|3151839_3152070_-	hypothetical protein	NA	NA	NA	NA
QAW05548.1\|3152093_3152306_-	hypothetical protein	R9TQ08	Paenibacillus_phage	5.3e-18	70.7
QAW05549.1\|3152363_3152648_-	XRE family transcriptional regulator	NA	NA	NA	NA
QAW05550.1\|3152751_3153147_+	XRE family transcriptional regulator	I3VYZ1	Thermoanaerobacterium_phage	6.6e-06	39.1
QAW05551.1\|3153378_3153573_-	hypothetical protein	NA	NA	NA	NA
QAW05552.1\|3153569_3154694_-	XRE family transcriptional regulator	A0A1B1P786	Bacillus_phage	2.8e-09	24.0
QAW05553.1\|3155026_3156064_+\|integrase	site-specific integrase	A0A223LI82	Staphylococcus_phage	1.8e-87	47.1
QAW05554.1\|3156138_3157536_-	Fe-S cluster assembly protein SufB	NA	NA	NA	NA
3156146:3156164	attR	NA	NA	NA	NA
QAW05555.1\|3157556_3158000_-	iron-sulfur cluster assembly scaffold protein SufU	A0A2P1CJL8	Mycobacterium_phage	1.9e-14	38.7
QAW05556.1\|3157989_3159210_-	cysteine desulfurase SufS	Q2XUY6	environmental_halophage	3.4e-117	47.8
QAW05557.1\|3159209_3160523_-	Fe-S cluster assembly protein SufD	NA	NA	NA	NA
QAW05558.1\|3160540_3161326_-	Fe-S cluster assembly ATPase SufC	W8CYL7	Bacillus_phage	6.5e-05	23.6
QAW05559.1\|3161359_3161557_-	hypothetical protein	NA	NA	NA	NA
QAW05560.1\|3161519_3161657_-	hypothetical protein	NA	NA	NA	NA
QAW05561.1\|3161850_3162228_-	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
QAW05562.1\|3162312_3163137_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
QAW05563.1\|3163150_3163819_-	methionine import system permease MetP	NA	NA	NA	NA
QAW05564.1\|3163811_3164837_-	methionine ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.4e-31	36.5
QAW05565.1\|3165163_3165508_-	hypothetical protein	NA	NA	NA	NA
QAW05566.1\|3165614_3165935_-	thioredoxin	NA	NA	NA	NA
QAW05567.1\|3165936_3166377_-	toprim domain-containing protein	NA	NA	NA	NA
QAW05568.1\|3166376_3166613_-	DUF2553 family protein	NA	NA	NA	NA
QAW05569.1\|3166668_3167052_-	glycine cleavage system protein GcvH	NA	NA	NA	NA
QAW05570.1\|3167118_3167475_-	arsenate reductase family protein	M1PLC0	Streptococcus_phage	1.8e-23	54.6
QAW05571.1\|3167585_3169370_-	acyl-CoA dehydrogenase	NA	NA	NA	NA
QAW05572.1\|3169384_3170560_-	acetyl-CoA C-acetyltransferase	NA	NA	NA	NA
QAW05573.1\|3170570_3172940_-	3-hydroxyacyl-CoA dehydrogenase	NA	NA	NA	NA
QAW05574.1\|3173114_3173261_+	YuzL family protein	NA	NA	NA	NA
QAW05575.1\|3173285_3174194_-	proline dehydrogenase	A0A2H4PQT6	Staphylococcus_phage	3.9e-62	42.2
QAW05576.1\|3174287_3174533_+	hypothetical protein	NA	NA	NA	NA
QAW05577.1\|3174545_3174878_+\|coat	spore coat protein	NA	NA	NA	NA

DBSCAN-SWA_10

3267701 : 3317948

Bacillus_phage(72.5%)

protease,portal,capsid,terminase,holin,tail,head

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAW05658.1\|3267701_3269285_+	hypothetical protein	A0A1P8CWI7	Bacillus_phage	3.2e-75	59.7
QAW05659.1\|3269299_3269689_+	hypothetical protein	NA	NA	NA	NA
QAW06565.1\|3270031_3270634_+	hypothetical protein	NA	NA	NA	NA
QAW05660.1\|3270673_3271615_-	LysM peptidoglycan-binding domain-containing protein	Q9ZXD7	Bacillus_phage	3.0e-97	77.1
QAW05661.1\|3271656_3272079_-\|holin	holin family protein	D6R405	Bacillus_phage	6.3e-55	83.5
QAW05662.1\|3272132_3272303_-	XkdX family protein	NA	NA	NA	NA
QAW05663.1\|3272299_3272599_-	hypothetical protein	M4ZR44	Bacillus_phage	2.0e-39	79.2
QAW05664.1\|3272614_3273736_-	DUF2479 domain-containing protein	M4ZRP1	Bacillus_phage	1.6e-193	92.0
QAW05665.1\|3273772_3275326_-	hypothetical protein	M4ZSB3	Bacillus_phage	1.6e-257	86.7
QAW05666.1\|3275362_3277069_-	alkaline phosphatase	D6R400	Bacillus_phage	1.7e-268	82.2
QAW05667.1\|3277080_3277920_-\|tail	phage tail family protein	D6R3Z9	Bacillus_phage	8.5e-136	83.2
QAW05668.1\|3277919_3281798_-\|tail	phage tail tape measure protein	D6R3Z8	Bacillus_phage	0.0e+00	81.0
QAW05669.1\|3281810_3281990_-	hypothetical protein	D6R3Z7	Bacillus_phage	1.6e-12	68.5
QAW05670.1\|3281992_3282331_-	hypothetical protein	Q9ZXE8	Bacillus_phage	3.0e-39	70.5
QAW05671.1\|3282385_3282997_-\|tail	phage tail protein	Q9ZXE9	Bacillus_phage	7.9e-99	89.7
QAW05672.1\|3282997_3283378_-	DUF3168 domain-containing protein	Q9ZXF0	Bacillus_phage	2.6e-39	66.1
QAW05673.1\|3283374_3283758_-	HK97 gp10 family phage protein	Q9ZXF1	Bacillus_phage	2.9e-59	86.6
QAW05674.1\|3283750_3284122_-\|head,tail	head-tail adaptor protein	Q9ZXF2	Bacillus_phage	3.5e-41	68.3
QAW05675.1\|3284054_3284402_-\|head,tail	phage gp6-like head-tail connector protein	Q9ZXF3	Bacillus_phage	2.0e-51	87.0
QAW05676.1\|3284417_3284909_-	collagen-like protein	D6R3Z0	Bacillus_phage	1.3e-27	69.1
QAW05677.1\|3284937_3285252_-	hypothetical protein	Q9ZXF5	Bacillus_phage	6.8e-30	68.8
QAW05678.1\|3285267_3286470_-\|capsid	phage major capsid protein	Q9ZXF6	Bacillus_phage	5.1e-158	71.8
QAW05679.1\|3286506_3287133_-\|head,protease	HK97 family phage prohead protease	Q9ZXF7	Bacillus_phage	1.8e-106	92.8
QAW05680.1\|3287122_3288370_-\|portal	phage portal protein	D6R3Y6	Bacillus_phage	1.1e-216	86.3
QAW05681.1\|3288375_3288591_-	hypothetical protein	Q9ZXF9	Bacillus_phage	1.3e-24	80.6
QAW05682.1\|3288603_3290313_-\|terminase	terminase large subunit	D6R3Y4	Bacillus_phage	0.0e+00	92.1
QAW05683.1\|3290312_3290846_-\|terminase	phage terminase small subunit P27 family	Q9ZXG2	Bacillus_phage	1.1e-69	81.4
QAW05684.1\|3291225_3291600_-	HNH endonuclease	Q38456	Bacillus_phage	7.5e-60	82.3
QAW05685.1\|3291649_3292396_-	hypothetical protein	NA	NA	NA	NA
QAW05686.1\|3292786_3293560_-	hypothetical protein	NA	NA	NA	NA
QAW05687.1\|3293710_3294076_-	hypothetical protein	NA	NA	NA	NA
QAW05688.1\|3295284_3295737_-	ArpU family transcriptional regulator	S6AVV9	Thermus_phage	3.4e-38	56.6
QAW05689.1\|3295990_3296191_-	hypothetical protein	NA	NA	NA	NA
QAW05690.1\|3296187_3296607_-	hypothetical protein	A0A2I6UHP7	Bacillus_phage	1.6e-42	61.2
QAW05691.1\|3296603_3296936_-	hypothetical protein	F8WQ59	Bacillus_phage	8.3e-18	53.3
QAW05692.1\|3296935_3297592_-	dUTPase	R9TQ23	Paenibacillus_phage	5.8e-39	46.0
QAW05693.1\|3297709_3297967_-	hypothetical protein	A0A2H4JA61	uncultured_Caudovirales_phage	6.6e-07	41.7
QAW05694.1\|3297963_3298371_-	hypothetical protein	W8CYU3	Bacillus_phage	2.5e-24	45.0
QAW05695.1\|3298367_3298685_-	hypothetical protein	NA	NA	NA	NA
QAW05696.1\|3298681_3299044_-	VWA domain-containing protein	NA	NA	NA	NA
QAW05697.1\|3299086_3299284_-	hypothetical protein	NA	NA	NA	NA
QAW05698.1\|3299530_3299671_-	BH0509 family protein	NA	NA	NA	NA
QAW05699.1\|3299778_3300327_-	hypothetical protein	NA	NA	NA	NA
QAW06566.1\|3300641_3301469_-	ATP-binding protein	A0A0U3U1U1	Bacillus_phage	3.7e-35	35.9
QAW05700.1\|3301452_3302334_-	replication protein	V9QKF6	Oenococcus_phage	6.8e-27	33.1
QAW05701.1\|3302326_3302545_-	hypothetical protein	NA	NA	NA	NA
QAW05702.1\|3302569_3302761_-	helix-turn-helix domain-containing protein	A0A1B2APY7	Phage_Wrath	1.0e-12	59.0
QAW05703.1\|3302812_3303016_-	XRE family transcriptional regulator	NA	NA	NA	NA
QAW05704.1\|3303250_3303649_+	XRE family transcriptional regulator	S5M5X8	Brevibacillus_phage	4.3e-05	33.7
QAW05705.1\|3304081_3305182_-	XRE family transcriptional regulator	NA	NA	NA	NA
QAW05706.1\|3307106_3307577_-	SsrA-binding protein	W5RAM5	Staphylococcus_phage	3.2e-47	63.4
QAW05707.1\|3307721_3310061_-	ribonuclease R	Q0GXV6	Lactococcus_phage	1.3e-88	43.4
QAW05708.1\|3310079_3310820_-	carboxylesterase	NA	NA	NA	NA
QAW05709.1\|3310951_3311182_-	preprotein translocase subunit SecG	NA	NA	NA	NA
QAW05710.1\|3311330_3312104_+	alpha/beta hydrolase	NA	NA	NA	NA
QAW05711.1\|3312137_3312371_-	XRE family transcriptional regulator	NA	NA	NA	NA
QAW05712.1\|3312522_3312930_+	XRE family transcriptional regulator	S6C481	Thermus_phage	1.9e-16	64.8
QAW05713.1\|3312959_3313379_+	XRE family transcriptional regulator	S6C481	Thermus_phage	5.4e-14	62.7
QAW05714.1\|3313470_3313797_+	HxlR family transcriptional regulator	NA	NA	NA	NA
QAW05715.1\|3313924_3315625_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	8.0e-24	29.8
QAW05716.1\|3315665_3316346_-	ABC transporter permease	NA	NA	NA	NA
QAW05717.1\|3316362_3317283_-	osmoprotectant ABC transporter substrate-binding protein	NA	NA	NA	NA
QAW05718.1\|3317294_3317948_-\|holin	choline ABC transporter permease	NA	NA	NA	NA

DBSCAN-SWA_11

3684585 : 3764994

Bacillus_phage(25.0%)

protease,transposase,coat,bacteriocin,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAW06060.1\|3684585_3686256_-\|tRNA	arginine--tRNA ligase	NA	NA	NA	NA
QAW06061.1\|3686252_3686681_-	DUF1934 domain-containing protein	NA	NA	NA	NA
QAW06062.1\|3686993_3687125_+\|bacteriocin	subtilosin A family bacteriocin	NA	NA	NA	NA
QAW06063.1\|3687081_3687234_+\|bacteriocin	bacteriocin-like protein SboX	NA	NA	NA	NA
QAW06064.1\|3687258_3688605_+	subtilosin maturase AlbA	NA	NA	NA	NA
QAW06065.1\|3688617_3688779_+\|bacteriocin	antilisterial bacteriocin subtilosin biosynthesis protein AlbB	NA	NA	NA	NA
QAW06066.1\|3688775_3689495_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	7.3e-19	27.2
QAW06067.1\|3689487_3690798_+\|bacteriocin	antilisterial bacteriocin subtilosin biosynthesis protein AlbD	NA	NA	NA	NA
QAW06582.1\|3690787_3691948_+	insulinase family protein	NA	NA	NA	NA
QAW06068.1\|3691952_3693233_+	insulinase family protein	NA	NA	NA	NA
QAW06069.1\|3693229_3693931_+\|bacteriocin	antilisterial bacteriocin subtilosin biosynthesis protein AlbG	NA	NA	NA	NA
QAW06070.1\|3693936_3695313_-	YncE family protein	NA	NA	NA	NA
QAW06071.1\|3695351_3696707_-	YncE family protein	NA	NA	NA	NA
QAW06072.1\|3696936_3698082_+	tetratricopeptide repeat protein	A0A1P8CWN8	Bacillus_phage	1.7e-78	43.5
QAW06073.1\|3698065_3698185_+	phosphatase RapF inhibitor	NA	NA	NA	NA
QAW06074.1\|3698786_3699659_-	agmatinase	NA	NA	NA	NA
QAW06075.1\|3699719_3700550_-	spermidine synthase	NA	NA	NA	NA
QAW06076.1\|3700752_3702828_+	penicillin-binding protein	NA	NA	NA	NA
QAW06583.1\|3702855_3703290_-	hypothetical protein	NA	NA	NA	NA
QAW06077.1\|3703428_3703947_-	hypothetical protein	NA	NA	NA	NA
QAW06078.1\|3703960_3704620_-\|protease	site-2 protease family protein	NA	NA	NA	NA
QAW06079.1\|3704728_3704917_+	2-hydroxymuconate tautomerase	NA	NA	NA	NA
QAW06080.1\|3704959_3705379_-	MarR family transcriptional regulator	NA	NA	NA	NA
QAW06081.1\|3705498_3707415_-\|tRNA	threonine--tRNA ligase	A0A2K9L6B6	Tupanvirus	7.4e-143	43.2
QAW06082.1\|3708030_3708174_-	hypothetical protein	NA	NA	NA	NA
QAW06083.1\|3708245_3709655_-	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
QAW06084.1\|3709654_3710125_-	Rrf2 family transcriptional regulator	NA	NA	NA	NA
QAW06085.1\|3710236_3710737_-	YwgA family protein	NA	NA	NA	NA
QAW06086.1\|3710772_3712074_-	HD domain-containing protein	E3T4P8	Cafeteria_roenbergensis_virus	4.2e-25	28.9
QAW06087.1\|3712235_3712460_-	DUF1450 domain-containing protein	NA	NA	NA	NA
QAW06088.1\|3712674_3713454_+	RsfA family transcriptional regulator	A0A1D6X8E5	Bacillus_phage	2.9e-05	28.4
QAW06089.1\|3713597_3714488_-	DMT family transporter	NA	NA	NA	NA
QAW06090.1\|3714655_3715501_-	octanoyl-[GcvH]:protein N-octanoyltransferase	NA	NA	NA	NA
QAW06091.1\|3715549_3716449_-	LysR family transcriptional regulator	A0A2H4J8I9	uncultured_Caudovirales_phage	3.6e-07	42.5
QAW06092.1\|3716593_3717565_-	phosphate acetyltransferase	NA	NA	NA	NA
QAW06093.1\|3717834_3718599_+	heme-dependent peroxidase	NA	NA	NA	NA
QAW06094.1\|3719512_3720712_-	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
QAW06095.1\|3720712_3721897_-	MFS transporter	NA	NA	NA	NA
QAW06096.1\|3721893_3723312_-	ATP-grasp domain-containing protein	NA	NA	NA	NA
QAW06097.1\|3723330_3724092_-	dihydroanticapsin 7-dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	2.8e-21	30.9
QAW06098.1\|3724778_3725393_-	bacilysin biosynthesis protein BacA	NA	NA	NA	NA
QAW06099.1\|3725544_3726783_-	MFS transporter	NA	NA	NA	NA
QAW06100.1\|3726992_3728405_-	amino acid permease	NA	NA	NA	NA
QAW06101.1\|3728404_3730105_-	M20/M25/M40 family metallo-hydrolase	NA	NA	NA	NA
QAW06102.1\|3730178_3731726_-	L-glutamate gamma-semialdehyde dehydrogenase	NA	NA	NA	NA
QAW06103.1\|3731952_3733227_-	Glu/Leu/Phe/Val dehydrogenase	NA	NA	NA	NA
QAW06104.1\|3733404_3733869_-	hypothetical protein	NA	NA	NA	NA
QAW06105.1\|3734192_3734648_-\|coat	spore coat protein	NA	NA	NA	NA
QAW06106.1\|3734640_3735492_-	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	1.3e-38	39.3
QAW06107.1\|3735505_3736453_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	4.4e-72	43.8
QAW06108.1\|3736452_3737193_-	glucose-1-phosphate thymidylyltransferase	I7I009	Enterobacteria_phage	4.5e-48	41.9
QAW06109.1\|3737217_3738237_-\|coat	spore coat protein	NA	NA	NA	NA
QAW06110.1\|3738239_3738962_-\|coat	spore coat protein	NA	NA	NA	NA
QAW06111.1\|3738954_3740076_-\|coat	spore coat protein	NA	NA	NA	NA
QAW06112.1\|3740075_3740945_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
QAW06113.1\|3740945_3742115_-	DegT/DnrJ/EryC1/StrS aminotransferase family protein	A0A1D8KU11	Synechococcus_phage	1.4e-16	26.9
QAW06114.1\|3742135_3743560_-	CDP-glycerol glycerophosphotransferase family protein	NA	NA	NA	NA
QAW06115.1\|3743564_3744335_-	glycosyltransferase family 2 protein	A0A0F7L2F7	uncultured_marine_virus	3.4e-06	28.6
QAW06116.1\|3744653_3745199_+\|coat	spore coat protein GerQ	NA	NA	NA	NA
QAW06117.1\|3745242_3745614_-	DUF423 domain-containing protein	NA	NA	NA	NA
QAW06118.1\|3745675_3746998_-	purine permease	NA	NA	NA	NA
QAW06119.1\|3747017_3747335_-	hypothetical protein	NA	NA	NA	NA
QAW06120.1\|3747502_3748873_+	aldehyde dehydrogenase	NA	NA	NA	NA
QAW06121.1\|3748897_3749575_-	uracil-DNA glycosylase	A0A172DS90	Canid_alphaherpesvirus	1.8e-48	45.7
QAW06122.1\|3749588_3750395_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
QAW06123.1\|3750484_3751018_-	hypothetical protein	NA	NA	NA	NA
QAW06124.1\|3751065_3751701_-	hypothetical protein	NA	NA	NA	NA
QAW06125.1\|3751693_3752032_-	PadR family transcriptional regulator	NA	NA	NA	NA
QAW06126.1\|3752175_3752991_+	bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase	NA	NA	NA	NA
QAW06127.1\|3753081_3753330_-	hypothetical protein	NA	NA	NA	NA
QAW06128.1\|3753423_3754863_-	sucrose-6-phosphate hydrolase	F8WPR5	Bacillus_phage	3.5e-20	26.3
QAW06129.1\|3754859_3756245_-	PTS system sucrose transporter subunit IIBC	NA	NA	NA	NA
QAW06130.1\|3756546_3757317_+	transporter	NA	NA	NA	NA
QAW06131.1\|3757355_3758186_-	transcription antiterminator	NA	NA	NA	NA
QAW06132.1\|3758225_3758528_-	hypothetical protein	NA	NA	NA	NA
QAW06133.1\|3759057_3761478_+	peptidase S8	A0A217EQY2	Bacillus_phage	5.3e-21	38.2
QAW06134.1\|3761515_3762517_-	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
QAW06135.1\|3762690_3763440_-	oxygen-insensitive NADPH nitroreductase	NA	NA	NA	NA
QAW06136.1\|3763641_3764994_+\|transposase	IS1182 family transposase	A0A1X9I5T2	Streptococcus_phage	1.4e-87	41.8

DBSCAN-SWA_12

3959957 : 4015715

Klosneuvirus(20.0%)

holin,protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAW06314.1\|3959957_3960362_+\|holin	CidA/LrgA family holin-like protein	NA	NA	NA	NA
QAW06315.1\|3960331_3961024_+	LrgB family protein	NA	NA	NA	NA
QAW06316.1\|3961063_3962095_-	general stress protein 30	NA	NA	NA	NA
QAW06317.1\|3962187_3963336_-	glycerate kinase	W6LM47	Streptococcus_phage	2.6e-50	43.0
QAW06318.1\|3963531_3964263_+	gluconate operon transcriptional repressor GntR	NA	NA	NA	NA
QAW06319.1\|3964255_3965797_+	gluconokinase	NA	NA	NA	NA
QAW06320.1\|3965825_3967172_+	gluconate permease	NA	NA	NA	NA
QAW06321.1\|3967194_3968601_+	decarboxylating NADP(+)-dependent phosphogluconate dehydrogenase	E3SJC4	Synechococcus_phage	1.7e-32	30.6
QAW06322.1\|3969091_3969655_+	peroxiredoxin	NA	NA	NA	NA
QAW06323.1\|3969668_3971198_+	alkyl hydroperoxide reductase subunit F	A0A1V0SIN1	Klosneuvirus	1.7e-33	29.3
QAW06324.1\|3971309_3972749_-	6-phospho-beta-glucosidase	NA	NA	NA	NA
QAW06325.1\|3973316_3974027_+	GntR family transcriptional regulator	NA	NA	NA	NA
QAW06326.1\|3974052_3974211_+	hypothetical protein	NA	NA	NA	NA
QAW06327.1\|3974341_3975064_-	peptide ABC transporter permease	NA	NA	NA	NA
QAW06328.1\|3975084_3975714_-	ATP-binding cassette domain-containing protein	NA	NA	NA	NA
QAW06329.1\|3976204_3978130_+	fructose-bisphosphatase class III	NA	NA	NA	NA
QAW06591.1\|3978580_3978931_-	hypothetical protein	NA	NA	NA	NA
QAW06592.1\|3979411_3979852_+	Hsp20/alpha crystallin family protein	A0A1B2LRT2	Wolbachia_phage	3.4e-11	34.4
QAW06330.1\|3979852_3980032_+	hypothetical protein	NA	NA	NA	NA
QAW06331.1\|3980271_3981030_-	ATP-binding protein	U5N3V8	Enterobacteria_phage	5.8e-43	38.6
QAW06593.1\|3981026_3982574_-\|transposase	IS21 family transposase	NA	NA	NA	NA
QAW06332.1\|3982703_3983144_-	hypothetical protein	NA	NA	NA	NA
QAW06333.1\|3983551_3985015_+	hypothetical protein	A0A0S2MYH0	Enterococcus_phage	1.0e-11	36.0
QAW06334.1\|3985249_3987136_-	ATP-dependent helicase	S5MMD7	Bacillus_phage	6.6e-19	21.8
QAW06335.1\|3987113_3989147_-	DUF2813 domain-containing protein	NA	NA	NA	NA
QAW06336.1\|3989663_3990814_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	9.8e-151	98.9
QAW06594.1\|3991512_3991776_-	hypothetical protein	NA	NA	NA	NA
QAW06337.1\|3992159_3993074_-\|transposase	IS3 family transposase	A0A1B3AZE5	Gordonia_phage	9.0e-06	22.9
QAW06338.1\|3993070_3993388_-\|transposase	transposase	NA	NA	NA	NA
QAW06339.1\|3993652_3996775_-	DEAD/DEAH box helicase	A7WKM3	Acidianus_filamentous_virus	6.6e-08	26.4
QAW06340.1\|3996731_3997640_-	hypothetical protein	NA	NA	NA	NA
QAW06341.1\|3997927_3998407_-	23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH	NA	NA	NA	NA
QAW06342.1\|3998487_3998658_-	CxxH/CxxC protein	NA	NA	NA	NA
QAW06343.1\|3998842_3999256_+	hypothetical protein	NA	NA	NA	NA
QAW06344.1\|4000582_4000753_-	hypothetical protein	NA	NA	NA	NA
QAW06345.1\|4000857_4001106_-	DUF2651 domain-containing protein	NA	NA	NA	NA
QAW06346.1\|4001121_4002279_-	hypothetical protein	NA	NA	NA	NA
QAW06347.1\|4002289_4003027_-	hypothetical protein	NA	NA	NA	NA
QAW06348.1\|4003168_4003639_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
QAW06349.1\|4003749_4004847_+	tetratricopeptide repeat protein	D6R410	Bacillus_phage	2.1e-73	39.6
QAW06350.1\|4004847_4004964_+	Phr family secreted Rap phosphatase inhibitor	NA	NA	NA	NA
QAW06351.1\|4005199_4006090_-	arginase	A0A1V0SJM8	Klosneuvirus	2.0e-26	29.1
QAW06352.1\|4006163_4007567_-	amino acid permease	NA	NA	NA	NA
QAW06353.1\|4007789_4008995_-	ornithine aminotransferase	A0A1V0SKB7	Klosneuvirus	2.0e-29	28.5
QAW06595.1\|4009326_4009929_-	sporulation delaying protein family toxin	NA	NA	NA	NA
QAW06354.1\|4009990_4010944_-	hypothetical protein	NA	NA	NA	NA
QAW06355.1\|4010928_4011483_-	SdpA family antimicrobial peptide system protein	NA	NA	NA	NA
QAW06596.1\|4011666_4012302_-	SdpI family protein	NA	NA	NA	NA
QAW06597.1\|4012301_4012586_-	ArsR family transcriptional regulator	A0A218MNF3	uncultured_virus	2.8e-06	41.3
QAW06356.1\|4012812_4014198_+	arginine utilization regulatory protein RocR	NA	NA	NA	NA
QAW06357.1\|4014512_4015715_-\|protease	serine protease	W5SAB9	Pithovirus	5.9e-13	40.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage