CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP035403	Bacillus subtilis strain SRCM103581 chromosome, complete genome	2 crisprs	csa3,cas3,DEDDh,WYL,DinG	0	1	13	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP035403_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP035403_2

3026887-3026994

Orphan

Consensus_repeat	Method
TGATGGGAATCGAACCCACGACAT	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP035403_2

>merge|CP035403|2|3026887-3026994|CRISPRCasFinder
TGATGGGAATCGAACCCACGACATCAGCTTGGAAGGCTGAGGTTTTACCACTAAACTACACCCGCAATTTTTATTTGGGGCGATTGATGGGAATCGAACCCACGAATG

>CP035403|2|2|3026887-3026994|CRISPRCasFinder
TGATGGGAATCGAACCCACGACAT	CAGCTTGGAAGGCTGAGGTTTTACCACTAAACTACACCCGCAATTTTTATTTGGGGCGAT
TGATGGGAATCGAACCCACGAATG

Protein	Signature genes	Signature genes Name	Protein_function
CP035403.1\|QAW09570.1\|3016713_3017787_+\|CotS-family-spore-coat-protein	unknown	unknown	gnl\|CDD\|131952
CP035403.1\|QAW09573.1\|3020747_3022202_-\|glycogen-synthase-GlgA	unknown	unknown	gnl\|CDD\|234809
CP035403.1\|QAW10689.1\|3038498_3039707_-\|iron-containing-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|341481
CP035403.1\|QAW09574.1\|3022198_3023230_-\|glucose-1-phosphate-adenylyltransferase-subunit-GlgD	unknown	unknown	gnl\|CDD\|273966
CP035403.1\|QAW09578.1\|3034557_3035079_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|224168
CP035403.1\|QAW09580.1\|3036646_3037171_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|376684
CP035403.1\|QAW09583.1\|3039723_3041196_-\|betaine-aldehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143437
CP035403.1\|QAW09571.1\|3017866_3018334_+\|tryptophan-rich-sensory-protein	unknown	unknown	gnl\|CDD\|226007
CP035403.1\|QAW09575.1\|3023253_3024396_-\|glucose-1-phosphate-adenylyltransferase	unknown	unknown	gnl\|CDD\|179997
CP035403.1\|QAW09582.1\|3037832_3038411_-\|MOSC-domain-containing-protein	unknown	unknown	gnl\|CDD\|377051
CP035403.1\|QAW09584.1\|3041394_3041937_+\|GbsR/MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224427
CP035403.1\|QAW09581.1\|3037338_3037827_+\|DinB-family-protein	unknown	unknown	gnl\|CDD\|378981
CP035403.1\|QAW09569.1\|3015390_3016524_-\|glycosyltransferase-family-1-protein	unknown	unknown	gnl\|CDD\|340831
CP035403.1\|QAW09585.1\|3042134_3042680_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379999
CP035403.1\|QAW09577.1\|3033937_3034516_+\|energy-coupled-thiamine-transporter-ThiT	unknown	unknown	gnl\|CDD\|226377
CP035403.1\|QAW09572.1\|3018364_3020761_-\|glycogen/starch/alpha-glucan-phosphorylase	unknown	unknown	gnl\|CDD\|273967
CP035403.1\|QAW09567.1\|3013887_3014319_-\|hypothetical-protein	unknown	unknown	unknown
CP035403.1\|QAW09579.1\|3035096_3036626_-\|flotillin-family-protein	unknown	unknown	gnl\|CDD\|225177
CP035403.1\|QAW09576.1\|3024392_3026276_-\|1,4-alpha-glucan-branching-enzyme	unknown	unknown	gnl\|CDD\|273667
CP035403.1\|QAW09568.1\|3014320_3015376_-\|CotS-family-spore-coat-protein	unknown	unknown	gnl\|CDD\|131952

Protein	Function_ID	Function_description	E-value
CP035403.1\|QAW09570.1\|3016713_3017787_+\|CotS-family-spore-coat-protein	gnl\|CDD\|131952	TIGR02906, Spore_coat_protein_S, spore coat protein, CotS family. Members of this family include the spore coat proteins CotS and YtaA from Bacillus subtilis and, from other endospore-forming bacteria, homologs that are more closely related to these two than to the spore coat proteins YutH and YsxE. The CotS family is more broadly distributed than YutH or YsxE, but still is not universal among spore-formers. [Cellular processes, Sporulation and germination].	7.37273e-131
CP035403.1\|QAW09573.1\|3020747_3022202_-\|glycogen-synthase-GlgA	gnl\|CDD\|234809	PRK00654, glgA, glycogen synthase GlgA.	0
CP035403.1\|QAW10689.1\|3038498_3039707_-\|iron-containing-alcohol-dehydrogenase	gnl\|CDD\|341481	cd08551, Fe-ADH, iron-containing alcohol dehydrogenases (Fe-ADH)-like. This family contains large metal-containing alcohol dehydrogenases (ADH), known as iron-containing alcohol dehydrogenases. They contain a dehydroquinate synthase-like protein structural fold and mostly contain iron. They are distinct from other alcohol dehydrogenases which contains different protein domains. There are several distinct families of alcohol dehydrogenases: Zinc-containing long-chain alcohol dehydrogenases, insect-type, or short-chain alcohol dehydrogenases, iron-containing alcohol dehydrogenases, among others. The iron-containing family has a Rossmann fold-like topology that resembles the fold of the zinc-dependent alcohol dehydrogenases, but lacks sequence homology, and differs in strand arrangement. ADH catalyzes the reversible oxidation of alcohol to acetaldehyde with the simultaneous reduction of NAD(P)+ to NAD(P)H.	1.69004e-175
CP035403.1\|QAW09574.1\|3022198_3023230_-\|glucose-1-phosphate-adenylyltransferase-subunit-GlgD	gnl\|CDD\|273966	TIGR02092, Glycogen_biosynthesis_protein_GlgD, glucose-1-phosphate adenylyltransferase, GlgD subunit. This family is GlgD, an apparent regulatory protein that appears in an alpha2/beta2 heterotetramer with GlgC (glucose-1-phosphate adenylyltransferase, TIGR02091) in a subset of bacteria that use GlgC for glycogen biosynthesis. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0
CP035403.1\|QAW09578.1\|3034557_3035079_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|224168	COG1247, COG1247, Sortase and related acyltransferases [Cell envelope biogenesis, outer membrane].	4.15425e-10
CP035403.1\|QAW09580.1\|3036646_3037171_-\|hypothetical-protein	gnl\|CDD\|376684	pfam01957, NfeD, NfeD-like C-terminal, partner-binding. NfeD-like proteins are widely distributed throughout prokaryotes and are frequently associated with genes encoding stomatin-like proteins (slipins). There appear to be three major groups: an ancestral group with only an N-terminal serine protease domain and this C-terminal beta sheet-rich domain which is structurally very similar to the OB-fold domain, associated with its neighboring slipin cluster; a second major group with an additional middle, membrane-spanning domain, associated in some species with eoslipin and in others with yqfA; a final 'artificial' group which unites truncated forms lacking the protease region and associated with their ancestral gene partner, either yqfA or eoslipin. This NefD, C-terminal, domain appears to be the major one for relating to the associated protein. NfeD homologs are clearly reliant on their conserved gene neighbor which is assumed to be necessary for function, either through direct physical interaction or by functioning in the same pathway, possibly involve with lipid-rafts.	0.000174975
CP035403.1\|QAW09583.1\|3039723_3041196_-\|betaine-aldehyde-dehydrogenase	gnl\|CDD\|143437	cd07119, ALDH_BADH-GbsA, Bacillus subtilis NAD+-dependent betaine aldehyde dehydrogenase-like. Included in this CD is the NAD+-dependent, betaine aldehyde dehydrogenase (BADH, GbsA, EC=1.2.1.8) of Bacillus subtilis involved in the synthesis of the osmoprotectant glycine betaine from choline or glycine betaine aldehyde.	0
CP035403.1\|QAW09571.1\|3017866_3018334_+\|tryptophan-rich-sensory-protein	gnl\|CDD\|226007	COG3476, COG3476, Tryptophan-rich sensory protein (mitochondrial benzodiazepine receptor homolog) [Signal transduction mechanisms].	1.0961e-40
CP035403.1\|QAW09575.1\|3023253_3024396_-\|glucose-1-phosphate-adenylyltransferase	gnl\|CDD\|179997	PRK05293, glgC, glucose-1-phosphate adenylyltransferase; Provisional.	0
CP035403.1\|QAW09582.1\|3037832_3038411_-\|MOSC-domain-containing-protein	gnl\|CDD\|377051	pfam03473, MOSC, MOSC domain. The MOSC (MOCO sulfurase C-terminal) domain is a superfamily of beta-strand-rich domains identified in the molybdenum cofactor sulfurase and several other proteins from both prokaryotes and eukaryotes. These MOSC domains contain an absolutely conserved cysteine and occur either as stand-alone forms or fused to other domains such as NifS-like catalytic domain in Molybdenum cofactor sulfurase. The MOSC domain is predicted to be a sulfur-carrier domain that receives sulfur abstracted by the pyridoxal phosphate-dependent NifS-like enzymes, on its conserved cysteine, and delivers it for the formation of diverse sulfur-metal clusters.	9.40942e-06
CP035403.1\|QAW09584.1\|3041394_3041937_+\|GbsR/MarR-family-transcriptional-regulator	gnl\|CDD\|224427	COG1510, COG1510, Predicted transcriptional regulators [Transcription].	1.21185e-72
CP035403.1\|QAW09581.1\|3037338_3037827_+\|DinB-family-protein	gnl\|CDD\|378981	pfam12867, DinB_2, DinB superfamily. The DinB family are an uncharacterized family of potential enzymes. The structure of these proteins is composed of a four helix bundle.	3.20062e-17
CP035403.1\|QAW09569.1\|3015390_3016524_-\|glycosyltransferase-family-1-protein	gnl\|CDD\|340831	cd03801, GT4_PimA-like, phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.	7.48932e-75
CP035403.1\|QAW09585.1\|3042134_3042680_+\|hypothetical-protein	gnl\|CDD\|379999	pfam17735, BslA, Biofilm surface layer A. This family includes members such as BslA (previously called YuaB). Secreted BslA from Bacillus subtillis has been shown to form surface layers around the biofilm self-assembling at interfaces of B. subtilis biofilms, forming an elastic film. structural analysis revealed that BslA consists of an Ig-type fold with the addition of an unusual, extremely hydrophobic cap region. The hydrophobic cap exhibits physiochemical properties similar to the hydrophobic surface found in fungal hydrophobins; thus, BslA is defined as member of a class of bacterially produced hydrophobins.	5.35887e-46
CP035403.1\|QAW09577.1\|3033937_3034516_+\|energy-coupled-thiamine-transporter-ThiT	gnl\|CDD\|226377	COG3859, COG3859, Predicted membrane protein [Function unknown].	1.64974e-72
CP035403.1\|QAW09572.1\|3018364_3020761_-\|glycogen/starch/alpha-glucan-phosphorylase	gnl\|CDD\|273967	TIGR02093, Glycogen_phosphorylase, glycogen/starch/alpha-glucan phosphorylases. This family consists of phosphorylases. Members use phosphate to break alpha 1,4 linkages between pairs of glucose residues at the end of long glucose polymers, releasing alpha-D-glucose 1-phosphate. The nomenclature convention is to preface the name according to the natural substrate, as in glycogen phosphorylase, starch phosphorylase, maltodextrin phosphorylase, etc. Name differences among these substrates reflect differences in patterns of branching with alpha 1,6 linkages. Members include allosterically regulated and unregulated forms. A related family, TIGR02094, contains examples known to act well on particularly small alpha 1,4 glucans, as may be found after import from exogenous sources. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0
CP035403.1\|QAW09579.1\|3035096_3036626_-\|flotillin-family-protein	gnl\|CDD\|225177	COG2268, COG2268, Uncharacterized protein conserved in bacteria [Function unknown].	1.62319e-122
CP035403.1\|QAW09576.1\|3024392_3026276_-\|1,4-alpha-glucan-branching-enzyme	gnl\|CDD\|273667	TIGR01515, branching_enzym, alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase. This model describes the glycogen branching enzymes which are responsible for the transfer of chains of approx. 7 alpha(1--4)-linked glucosyl residues to other similar chains (in new alpha(1--6) linkages) in the biosynthesis of glycogen. This enzyme is a member of the broader amylase family of starch hydrolases which fold as (beta/alpha)8 barrels, the so-called TIM-barrel structure. All of the sequences comprising the seed of this model have been experimentally characterized. This model encompasses both bacterial and eukaryotic species. No archaea have this enzyme, although Aquifex aolicus does. Two species, Bacillus thuringiensis and Clostridium perfringens have two sequences each which are annotated as amylases. These annotations are aparrently in error. GP\|18143720 from C. perfringens, for instance, contains the note "674 aa, similar to gp:A14658_1 amylase (1,4-alpha-glucan branching enzyme (EC 2.4.1.18) ) from Bacillus thuringiensis (648 aa); 51.1% identity in 632 aa overlap." A branching enzyme from Porphyromonas gingivales, OMNI\|PG1793, appears to be more closely related to the eukaryotic species (across a deep phylogenetic split) and may represent an instance of lateral transfer from this species' host. A sequence from Arabidopsis thaliana, GP\|9294564, scores just above trusted, but appears either to contain corrupt sequence or, more likely, to be a pseudogene as some of the conserved catalytic residues common to the alpha amylase family are not conserved here. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0
CP035403.1\|QAW09568.1\|3014320_3015376_-\|CotS-family-spore-coat-protein	gnl\|CDD\|131952	TIGR02906, Spore_coat_protein_S, spore coat protein, CotS family. Members of this family include the spore coat proteins CotS and YtaA from Bacillus subtilis and, from other endospore-forming bacteria, homologs that are more closely related to these two than to the spore coat proteins YutH and YsxE. The CotS family is more broadly distributed than YutH or YsxE, but still is not universal among spore-formers. [Cellular processes, Sporulation and germination].	7.34474e-130

>CP035403.1|QAW09576.1|3024392_3026276_-|1,4-alpha-glucan-branching-enzyme
MAAASPTAHDVYLFHEGSLFKSYQLFGSHYCELNGKSGYEFCVWAPHASEVRVAGDFNSWSGEEHVMHRVNDNGIWTLFIPGIGEKERYKYEIVTNNGEIRLKADPYAIYSEVRPNTASLTYNLEGYSWQDQKWQKKQKAKTLYEKPVFIYELHLGSWKKHSDGRHYSYKEISQTLIPYIKEHGFTHIELLPVYEHPYDRSWGYQGTGYYSPTSRFGTPHDLMKFVDECHQQNIGVILDWVPGHFCKDAHGLYMFDGEPLYEYKEERDRENWLWGTANFDLGKPEVHSFLISNALYWAEFYHIDGFRVDAVANILYWPNQDERHTNPYAVDFLKKLNQTMRETYPHVMMIAEDSTEWPQVTGAVEEGGLGFHYKWNMGWMNDVLKYMETPPEERRHCHQLISFSLLYAFSEHFVLPFSHDEVVYGKKSLLNKMPGDYWQKFAQYRLLLGYMTVHPGKKLIFMGSEFAQFDEWKDTEQLDWFLDSFPMHQKASVFTQDLLRFYQKSKILYEHDHRAQSFEWIDVHNDEQSIFSFIRYGKKHGEALVIICNFTPVVYHQYDVGVPFFTQYIEVLNSDSETYGGSGQINKKPLSAKKGALHHKPCYITMTIPPYGISILRAVKKRGEIKR
>CP035403.1|QAW09575.1|3023253_3024396_-|glucose-1-phosphate-adenylyltransferase
MKKQCVAMLLAGGKGSRLSGLTKNMAKPAVSFGGKYRIIDFTLSNCSNSGIDTVGILTQYQPLELNSYIGIGSAWDLDRYNGGVTVLPPYAESSEVKWYKGTASAIYENLNYLNQYDPEYVLILSGDHIYKMDYGKMLDYHIEKKADVTISVIEVGWEEASRFGIMKANPDGTITHFDEKPKFPKSNLASMGIYIFNWPLLKQYLEMDDQNPYSSHDFGKDIIPLLLEEKKKLSAYPFKGYWKDVGTVQSLWEANMDLLKEDSELKLFERKWKIYSVNPNQPPQFISSDAQVQDSLVNEGCVVYGNVSHSVLFQGVTVGKHTTVTSSVIMPDVTIGEHVVIENAIVPNGMVLPDGAVIRSEKDIEEVLLVSEEFVEKELI
>CP035403.1|QAW09574.1|3022198_3023230_-|glucose-1-phosphate-adenylyltransferase-subunit-GlgD
MFNNQMLGVIDETTYKHSLQDLTAQRSLGAIPFAGRYRLIDFMLSNMVNADIRSVAIFPKYRYRSLMDHLGAGKEWDLHRKKDGLFFFPSPHLHHEYDEFGSFRQFSDHLDYFHRSTQQYAVISNSHTVCNIQFQYVLKRHQEVGCDVTEVFQDGQSLQIYIMSTTLLKDLIYGHSEKGYKTIQEAVEKESSALTICPYEYSGYAAVIDSVEKYYTHSMELIQPRFWQQVFLPQQPIYTKVKDEPPTKYGKHSTVKNSLVANGCVLEGEVENCILFRAVHVGKGTKLKNCIIMQKTQIGEDCLLEQVISDKDVKIGKATEAVGTAEQPLVLRKGLVQGELMNS
>CP035403.1|QAW09573.1|3020747_3022202_-|glycogen-synthase-GlgA
MKILFAVSECTPFVKSGGLADVAGALPKALARLGNEVAVMLPKYSQIPEPWKKRMKKQAECTVAVGWRQQYCGIEHMAEDDVNYYFIDNEYYFNRDSLYGHYDDGERFAFFSRAVLEAAKVVNVPADIVHTHDWHTAMVNYLLKEEYRKHPFYERMKSVLTIHNLQFQGIFPPDVTHDLLGLEMDHFRYERLECNGFVNFMKAGIIAADHVTTVSPTYRNEIMTPYYGEQLEQVLQYREDDVTGILNGIDDTFYQPKSDPYIEAQYDSEHLACKLENKTKLQRRMGLPEKNDIPLISMVTRLTKQKGLDLVRRIMHELLEEQDIQLVVLGTGEREFEDYFRYAEFAFHEKCRAYIGFDEQLAHQIYAGSDMFLMPSKFEPCGLGQLIALQYGAIPIVRETGGLYDTVRAYQEEEGTGNGFTFSAFNAHDLKFTIERALSFYCQQDVWKSIVKTAMNADYSWGKSAKEYQRIFEQVTRSGRDVLE
>CP035403.1|QAW09572.1|3018364_3020761_-|glycogen/starch/alpha-glucan-phosphorylase
MFSSKERFADLFLKRLEMTCGKSFKDSAKLDQYKTLGNMVREYISADWIETNEKSRSNSGKQTYYLSIEFLLGQLLEQNLMNLGVRDVVEAGLKEIGINLEEILQIENDAGLGNGGLGRLAACFLDSLASLNLPGHGMGIRYKHGLFEQKIVDGHQVELPEQWLKNGNVWEVRNADQAVDVPFWGEVHMTEKSGRLHFRHEQATIVTAVPYDIPVIGYETGTVNTLRLWNAEPYAHYHGGNILSYKRETEAVSEFLYPDDTHDEGKILRLKQQYFLVCASLKSIVNNYRKTHKSLSGLHKKVSIHINDTHPALAVPELMRILLDEENMSWEEAWHITVHTISYTNHTTLSEALEKWPIHLFKPLLPRMYMIIEEINERFCRAVWEKYPGDWKRIEDMAITAHGVVKMAHLAIVGSYSVNGVAKIHSDILMEREMRDFHLLFPNRFNNKTNGIAHRRWLLKANPGLSAIITEAIGDEWVKQPESLIRLEPYATDPAFIEQFQNNKSKKKQELADLIFCTAGVVVNPDSIFDVQVKRLHAYKRQLLNVLHIMYLYNRLKEDAGFSIYPQTFIFGAKASPSYYYAKKIIKLIHSVAEKLNYDPAVKQLIKVVFLENYRVSMAERIFPASDVSEQISTASKEASGTGNMKFMMNGALTIGTHDGANIEILERVGPDCIYTFGLKADEVLSYQENGGYRSREYYQHDRRIRQVADQLINGFFEGEADEFESIFDSLLPHNDEYFVLKDFSSYADAQERIQADYRERRKWSERSIVNIAHSGYFSSDRTIREYAKDIWGIKPMM
>CP035403.1|QAW09571.1|3017866_3018334_+|tryptophan-rich-sensory-protein
MKKIVGALAVFVITYALFSAAGYLFPVDQEWYNSLKKPDWTPSGTAIGIIWAILFALISLSAAIVYAAFSFKGAKSFWFTLLINYVLNQAFSYFQFTQKNLLAASLDCLLVAITAIVLLIIAKKYSRAASYLLLPYFLWSAFATFLSFTINSMNL
>CP035403.1|QAW09570.1|3016713_3017787_+|CotS-family-spore-coat-protein
MCPLMAENHEVIEEGNSSELPLSAEDAKKLTELAENVLQGWDVQAEKIDVIQGNQMALVWKVHTDSGAVCLKRIHRPEKKALFSIFAQDYLAKKGMNVPGILPNKKGSLYSKHGSFLFVVYDWIEGRPFELTVKQDLEFIMKGLADFHTASVGYQPPNGVPVFTKLGRWPNHYTKRCKQMETWKLMAEAEKEDPFSQFYLQEIDGFIEDGLRIKDQLLQSTYVPWTEQLKKSPNLCHQDYGTGNTLLGENEQIWVIDLDTVSFDLPIRDLRKMIIPFLDTTGVWDEETFHVMLNAYESRAPLTEEQKQVMFIDMLFPYELYDVIREKYVRKSALPKEELESAFEYERIKANALRQLI
>CP035403.1|QAW09569.1|3015390_3016524_-|glycosyltransferase-family-1-protein
MKIALIATEKLPVPSVRGGAIQIYLEAVAPLIAKKHEVTVFSIKDPNLADREKVDGVHYVHLDKDRYEEAVGAELKKSRFDLVHVCNRPSWVPKLKKQAPDAVFILSVHNEMFAYDKISQAEGEICIDSVAQIVTVSDYIGQTITSRFPSARSKTKTVYSGVDLKTYNPRWTNEGQRAREEMRSELGLHGKKIVLFVGRLSKVKGPHILLQALPDIIEEHPDVMMVFIGSKWFGDNELNNYVKHLHTLGAMQKDHVTFIQFVKPKDIPRLYTMSDVFVCSSQWQEPLARVHYEAMAAGLPIITSNRGGNPEVIEEGKNGYIIHDFENPKQYAERINDLLSSSEKRERLGKYSRREAESNFGWQRVAENLLSVYEKNR
>CP035403.1|QAW09568.1|3014320_3015376_-|CotS-family-spore-coat-protein
MYQKEHEEQIVSEILSYYPFHIDHVALKSNKSGRKIWEVETDHGPKLLKEAQMKPERMLFITQAHAHLQEKGLPIAPIHQTKNGGSCLGTDQVSYSLYDKVTGKEMIYYDAEQMKKVMSFAGHFHHASKGYVCTDESKKRSRLGKWHKLYRWKLQELEGNMQIAASYPDDVFSQTFLKHADKMLARGKEALQALDDSEYETWTKETLEHGGFCFQDFTLARLTEIEGEPFLKELHSITYDLPSRDLRILLNKVMVKLSVWDTDFMVALLASYDAVYPLTEKQYEVLWIDLAFPHLFCAIGHKYYLKQKKTWSDEKYNWALQNMISVEESKDSFLDKLPELYKKIKAYREAN
>CP035403.1|QAW09567.1|3013887_3014319_-|hypothetical-protein
MRSSRQKASISKLDLDQFVFTPPGPMGWQAHDSMSAEKEEEEKHLDVGSIRELPHINVPKEYKEETKEKETDHKIVDDEEETKFETILEPEEERDSKRSAPPYEEEDEDEEPDLAEEAKVEIIILPSESKPAPWFSQTVKRKA
>CP035403.1|QAW09577.1|3033937_3034516_+|energy-coupled-thiamine-transporter-ThiT
MNQSKQLVRLIEIAIMTAAAVILDIISGMFLSMPQGGSVSIMMIPIFLISFRWGVKAGLTTGLLTGLVQIAIGNLFAQHPVQLLLDYIVAFAAIGISGCFASSVRKAAVSKTKGKLIVSVVSAVFIGSLLRYAAHVISGAVFFGSFAPKGTPVWIYSLTYNATYMVPSFIICAIVLCLLFMTAPRLLKSDKA
>CP035403.1|QAW09578.1|3034557_3035079_-|GNAT-family-N-acetyltransferase
MVTVREAKLEDIKDIAKVHVDSWRTTYHEIIPIDYLNSLNYKEFEDKWKSRSLKGVFVAQDEKGSVFGFASFGPIRSEQEGYDGELYAIYLLEERQRQGAGRALLAKGAEFLLQHGFSSMFVWVIEQNPSIIFYQAYSPERVAEDNFEIAGVRLKEVGLGWPDLSALKTLLNR
>CP035403.1|QAW09579.1|3035096_3036626_-|flotillin-family-protein
MTMPIIMIIGVVFFLLIALIAVFITKYRTAGPDEALIVTGSYLGNKNVHVDEGGNRIKIVRGGGTFVLPVFQQAEPLSLLSSKLDVSTPEVYTEQGVPVMADGTAIIKIGGSIGEIATAAEQFLGKSKDDREQEAREVLEGHLRSILGSMTVEEIYKNREKFSQEVQRVASQDLAKMGLVIVSFTIKDVRDKNGYLESLGKPRIAQVKRDADIATAEADKETRIKRAEADKDAKKSELERATEIAEAEKINQLKMAEFRREQDTAKANADQAYDLETARARQQVTEQEMQVKIIERQKQIELEEKEILRRERQYDSEVKKKADADRYSVEQSAAAEKAKQLAEADANKYSIEAMAKAEAEKVRIDGLAKAEAEKAKGETEAEVIRLKGLAEAEAKEKIAAAFEQYGQAAIFDMIVKMLPEYAKQAAAPLSNIDKITVVDTGGSGESSGANKVTSYATNLMSSLQESLKASSGIDVKEMLENFSGKGNVKQSINELTNEIKEAKTIQKSE
>CP035403.1|QAW09580.1|3036646_3037171_-|hypothetical-protein
MELFGVPIQTMYLYTLIIAGSLTLLFLFFGDVFAGLPEGIPFLNPTLVLSFFTCFSAGGYIGELVLPLSSLLIALLSCILSIMLVVLLHIFVLVPLSSAEESLAYREDDLRGRLGKVITAVPVDGFGEVVIEGIGGTISKSAVSFDNQQISYGTTVLVVDINNGVLSVTPHEPI
>CP035403.1|QAW09581.1|3037338_3037827_+|DinB-family-protein
MSIFNEARLETWNELKGLSDEKLNQKPSAEEWSIREVLDHLKKIDMTAQKMLKERVKDAPIKEIEEKPLEVAQDRNNKRKAPSHLEPAHDFISGSQMKRELDVVREQLTAAIASLKEEDFERVLPHPVFQELTVRQWIDFIGHHEKRHLSQMKEIKEKIERA
>CP035403.1|QAW09582.1|3037832_3038411_-|MOSC-domain-containing-protein
MWKRMTAKAEGLYIADTDSFVTKQMDKLDFDYGGIPGDLHFGLTKKAGAREPMFSRGTEIFNRRQISIVSIEECNEIALKMGVPRILPEWLGANVAVSGMPNLTSLKEGSRIIFPSGAALLCEGENDPCIQPGEVIQSYYPDQPKLAPAFVRHALGIRGIVCIVERPGAVYTGDEIEVHSYQRKVKRKAERV
>CP035403.1|QAW10689.1|3038498_3039707_-|iron-containing-alcohol-dehydrogenase
MTLNMKVESMQKFHTFEIPTVIKHGIGAIKHTGEEVAALGVSKALLVTDPGIYKAGVADPVIESLKEAGIEVVLFNKVEPNPPVRLVNEGSELYKKENCNGLVAVGGGSSMDTAKAIGVEATHEGSVLDYEAADGKKPLENRIPPLTTIPTTAGTGSEVTQWAVITDEEREFKFNTGGPLIAAHLTIIDPELHVSMPPHVTAMTGIDALAHAIECYTMKFAQPITDAVALMAIEYAAHYIKRAFADGEDLEARYGMAQAAMLAGLSYGSESAGAAHAMSQTLGGIIPVAHGQCVAAMMGPVMEYNWKGYPEKFARIAKAFGIDTSKMTTEEAAKASVNWMYDLVEDLEVPTLEEQGVSPDMIERLSKEAMKDPQTFGNPRDLNEKAYNWIYKRCFNLTPKTV
>CP035403.1|QAW09583.1|3039723_3041196_-|betaine-aldehyde-dehydrogenase
MSQTLFIDGEWISAEKEQIRSIINPFNQEEIATVSEGGREDAIKAIAAARRAFDKGEWSSLSGLERGKIVLKIAELIRRDLEELAELESLDTGKTLEESKADMDDIANVFQYYAGLADKDGGEIISSPIPDSESKIIREPIGVCGQITPWNYPLLQASWKIAPALAAGNTIVMKPSEITPLTTIKVFKLMEEAGVPKGVANLVLGPGDTVGDELAVNKDVDLISFTGGIETGKKIMRAASGNVKKIALELGGKNPNIVFKDADLEVAVDQALNAVFFHAGQVCSAGSRLLVEDAIHDQFLAELVKRAKRIKLGNGFHAETESGPLISAEHRAKVEKYVEIGIEEGAKLETGGKRPEDPALQNGFFYEPTIFSNCNSDMRIVQEEVFGPVLTVETFSSEEEVIELANDTIYGLAGAVWSKDIEKCERVAARLRMGTVWINDFHPYFAQAPWGGYKQSGFGRELGKIGLEEYTEVKHVYRNTKPAAVNWFNS
>CP035403.1|QAW09584.1|3041394_3041937_+|GbsR/MarR-family-transcriptional-regulator
MDENPEFAAIEQARDLVIDSIAETMDLYGITRSVGILYGTMYMRDEMTLDEMREELQMSKPSMSTGVKKLQDLNVVKKTFHRGIRKHTFVAEKDFFKFFTNFFPPKWEREVQVNVAAIEEAQADLQKVLCKEDLDEDIKNEALQLYDQLESSKAYYDWLKRLAESVQTGEIFKFIPIETK
>CP035403.1|QAW09585.1|3042134_3042680_+|hypothetical-protein
MKRKLLSSLAISALSLGLLVSAPTASFAAESTSTKAHTESTMRTQSTASLFATITGASKTEWSFSDIELTYRPNTLLSLGVMEFTLPSGFTANTKDTLNGNALRTTQILNNGKTVRVPLALDLLGAGEFKLKLNNKTLPAAGTYTFRAENKSLSIGNKFYAEASIDVAKRSTPPTQPCGCN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP035403_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP035403_3

3583683-3583896

Orphan

Consensus_repeat	Method
GATGATTGATAATCTGATGATCTTGGCGATCGTTTAGATGATTTTGATGAAC	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP035403_3

>merge|CP035403|3|3583683-3583896|CRISPRCasFinder
GATGATTGATAATCTGAAGATCTTGGTGATCGTTTAGATGATTTTGATGAACTCTTTGAACCTGATGAGCTGTATGATTTTGATGATTGATAATCTGATGATCTTGGCGATCGTTTAGATGATTTTGATGAACACTTTGAACCTGATGAGCTGTATGATTTGGATGATTGATAATCTGATGATCTTGGTGATCGTTTAGATGATTTTGATGAAC

>CP035403|3|3|3583683-3583896|CRISPRCasFinder
GATGATTGATAATCTGAAGATCTTGGTGATCGTTTAGATGATTTTGATGAAC	TCTTTGAACCTGATGAGCTGTATGATTTTGATGATTGATAATCTGATGATCTTGGCGATCGTTTAGATGATTTTGATGAACACTTTGAACCTGATGAGCTGTATGATTTG
GATGATTGATAATCTGATGATCTTGGTGATCGTTTAGATGATTTTGATGAAC

Protein	Signature genes	Signature genes Name	Protein_function
CP035403.1\|QAW10065.1\|3577638_3578406_-\|acetolactate-decarboxylase	unknown	unknown	gnl\|CDD\|273524
CP035403.1\|QAW10071.1\|3586788_3587406_+\|flavin-reductase-family-protein	unknown	unknown	gnl\|CDD\|224766
CP035403.1\|QAW10061.1\|3574985_3575903_+\|ribose-ABC-transporter-substrate-binding-protein-RbsB	unknown	unknown	gnl\|CDD\|380546
CP035403.1\|QAW10075.1\|3590203_3590797_+\|chromate-transporter	unknown	unknown	gnl\|CDD\|224970
CP035403.1\|QAW10073.1\|3587922_3589500_-\|gamma-glutamyltransferase	unknown	unknown	gnl\|CDD\|129176
CP035403.1\|QAW10064.1\|3577012_3577540_-\|flavodoxin-family-protein	unknown	unknown	gnl\|CDD\|225158
CP035403.1\|QAW10074.1\|3589713_3590190_+\|Lrp/AsnC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|214628
CP035403.1\|QAW10072.1\|3587582_3587918_+\|DUF4181-domain-containing-protein	unknown	unknown	gnl\|CDD\|372726
CP035403.1\|QAW10068.1\|3582833_3583511_-\|DUF2642-domain-containing-protein	unknown	unknown	unknown
CP035403.1\|QAW10063.1\|3576676_3576973_+\|DUF3892-domain-containing-protein	unknown	unknown	gnl\|CDD\|379026
CP035403.1\|QAW10060.1\|3574004_3574973_+\|ribose-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|181922
CP035403.1\|QAW10077.1\|3591356_3591578_-\|hypothetical-protein	unknown	unknown	unknown
CP035403.1\|QAW10066.1\|3578467_3580180_-\|acetolactate-synthase-AlsS	unknown	unknown	gnl\|CDD\|236312
CP035403.1\|QAW10062.1\|3575984_3576521_+\|cell-wall-binding-protein	unknown	unknown	gnl\|CDD\|214600
CP035403.1\|QAW10067.1\|3580337_3581246_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176143
CP035403.1\|QAW10059.1\|3572521_3574003_+\|ribose-ABC-transporter-ATP-binding-protein-RbsA	unknown	unknown	gnl\|CDD\|224053
CP035403.1\|QAW10076.1\|3590793_3591330_+\|chromate-transporter	unknown	unknown	gnl\|CDD\|224970
CP035403.1\|QAW10078.1\|3592243_3593125_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223656
CP035403.1\|QAW10070.1\|3586106_3586616_+\|spore-gernimation-protein-GerQ	unknown	unknown	unknown
CP035403.1\|QAW10069.1\|3584876_3585965_-\|spore-coat-protein-CotH	unknown	unknown	gnl\|CDD\|227642

Protein	Function_ID	Function_description	E-value
CP035403.1\|QAW10065.1\|3577638_3578406_-\|acetolactate-decarboxylase	gnl\|CDD\|273524	TIGR01252, Alpha-acetolactate_decarboxylase, alpha-acetolactate decarboxylase. Puruvate can be fermented to 2,3-butanediol. It is first converted to alpha-acetolactate by alpha-acetolactate synthase, then decarboxylated to acetoin by this enzyme. Acetoin can be reduced in some species to 2,3-butanediol by acetoin reductase. [Energy metabolism, Fermentation].	1.94409e-135
CP035403.1\|QAW10071.1\|3586788_3587406_+\|flavin-reductase-family-protein	gnl\|CDD\|224766	COG1853, COG1853, Conserved protein/domain typically associated with flavoprotein oxygenases, DIM6/NTAB family [General function prediction only].	3.74651e-45
CP035403.1\|QAW10061.1\|3574985_3575903_+\|ribose-ABC-transporter-substrate-binding-protein-RbsB	gnl\|CDD\|380546	cd06323, PBP1_ribose_binding, periplasmic sugar-binding domain of the thermophilic Thermoanaerobacter tengcongensis ribose binding protein (ttRBP) and its mesophilic homologs. Periplasmic sugar-binding domain of the thermophilic Thermoanaerobacter tengcongensis D-ribose binding protein (ttRBP) and its mesophilic homologs. Members of this group belong to the type 1 periplasmic binding protein superfamily, whose members are involved in chemotaxis, ATP-binding cassette transport, and intercellular communication in central nervous system. The thermophilic and mesophilic ribose-binding proteins are structurally very similar, but differ substantially in thermal stability.	1.78313e-138
CP035403.1\|QAW10075.1\|3590203_3590797_+\|chromate-transporter	gnl\|CDD\|224970	COG2059, ChrA, Chromate transport protein ChrA [Inorganic ion transport and metabolism].	1.83621e-54
CP035403.1\|QAW10073.1\|3587922_3589500_-\|gamma-glutamyltransferase	gnl\|CDD\|129176	TIGR00066, Contains:_Gamma-glutamyltranspeptidase_large_chain, gamma-glutamyltranspeptidase. Also called gamma-glutamyltranspeptidase (ggt). Some members of this family have antibiotic synthesis or resistance activities. In the case of a cephalosporin acylase from Pseudomonas sp., the enzyme was shown to retain some gamma-glutamyltranspeptidase activity. Other, more distantly related proteins have ggt-related activities and score below the trusted cutoff. [Biosynthesis of cofactors, prosthetic groups, and carriers, Glutathione and analogs].	0
CP035403.1\|QAW10064.1\|3577012_3577540_-\|flavodoxin-family-protein	gnl\|CDD\|225158	COG2249, MdaB, Putative NADPH-quinone reductase (modulator of drug activity B) [General function prediction only].	8.4359e-57
CP035403.1\|QAW10074.1\|3589713_3590190_+\|Lrp/AsnC-family-transcriptional-regulator	gnl\|CDD\|214628	smart00344, HTH_ASNC, helix_turn_helix ASNC type. AsnC: an autogenously regulated activator of asparagine synthetase A transcription in Escherichia coli).	5.17676e-37
CP035403.1\|QAW10072.1\|3587582_3587918_+\|DUF4181-domain-containing-protein	gnl\|CDD\|372726	pfam13789, DUF4181, Domain of unknown function (DUF4181).	0.00120866
CP035403.1\|QAW10067.1\|3580337_3581246_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176143	cd08452, PBP2_AlsR, The C-terminal substrate binding domain of LysR-type trnascriptional regulator AlsR, which regulates acetoin formation under stationary phase growth conditions; contains the type 2 periplasmic binding fold. AlsR is responsible for activating the expression of the acetoin operon (alsSD) in response to inducing signals such as glucose and acetate. Like many other LysR family proteins, AlsR is transcribed divergently from the alsSD operon. The alsS gene encodes acetolactate synthase, an enzyme involved in the production of acetoin in cells of stationary-phase. AlsS catalyzes the conversion of two pyruvate molecules to acetolactate and carbon dioxide. Acetolactate is then converted to acetoin at low pH by acetolactate decarboxylase which encoded by the alsD gene. Acetoin is an important physiological metabolite excreted by many microorganisms grown on glucose or other fermentable carbon sources. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	3.7247e-130
CP035403.1\|QAW10063.1\|3576676_3576973_+\|DUF3892-domain-containing-protein	gnl\|CDD\|379026	pfam13031, DUF3892, Protein of unknown function (DUF3892). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria and archaea. Proteins in this family are typically between 87 and 104 amino acids in length.	5.94758e-16
CP035403.1\|QAW10060.1\|3574004_3574973_+\|ribose-ABC-transporter-permease	gnl\|CDD\|181922	PRK09512, rbsC, ribose ABC transporter permease protein; Reviewed.	7.16358e-116
CP035403.1\|QAW10066.1\|3578467_3580180_-\|acetolactate-synthase-AlsS	gnl\|CDD\|236312	PRK08617, PRK08617, acetolactate synthase AlsS.	0
CP035403.1\|QAW10062.1\|3575984_3576521_+\|cell-wall-binding-protein	gnl\|CDD\|214600	smart00287, SH3b, Bacterial SH3 domain homologues.	2.21428e-10
CP035403.1\|QAW10059.1\|3572521_3574003_+\|ribose-ABC-transporter-ATP-binding-protein-RbsA	gnl\|CDD\|224053	COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism].	0
CP035403.1\|QAW10076.1\|3590793_3591330_+\|chromate-transporter	gnl\|CDD\|224970	COG2059, ChrA, Chromate transport protein ChrA [Inorganic ion transport and metabolism].	9.02658e-49
CP035403.1\|QAW10078.1\|3592243_3593125_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|223656	COG0583, LysR, Transcriptional regulator [Transcription].	3.39059e-66
CP035403.1\|QAW10069.1\|3584876_3585965_-\|spore-coat-protein-CotH	gnl\|CDD\|227642	COG5337, CotH, Spore coat assembly protein [Cell envelope biogenesis, outer membrane].	1.71251e-179

>CP035403.1|QAW10068.1|3582833_3583511_-|DUF2642-domain-containing-protein
MKGLNQFLNTDVEVVISGDTRFVGTLIDIGQDIFVIFDGCNYLYIPLLHLHQINKAKIMTSTEKPFLINPEDPMIEAETQAFSYRNTLNKVKGQFIEVYVTGGRSIHGYVTNVLNDYIVFFSPVFKILFISMHHLKWFTPYSTEQTPYTLDNSQLPVVPSKVPLVRNFEEQIKKNIGELVIFDMGEVPEKVGLLKDVSNNIIELINASGEPVIWKLNHLKTMHLP
>CP035403.1|QAW10067.1|3580337_3581246_+|LysR-family-transcriptional-regulator
MELRHLQYFIAVAEELHFGKAARRLNMTQPPLSQQIKQLEEEVGVTLLKRTKRFVELTAAGEIFLNHCRMALMQIGQGIELAQRTARGEQGLLVIGFVGSATYEFLPPIVREYRKKFPSVKIELREISSSRQQEELLKGNIDIGILHPPLQHTALHIETAQSSPCVLALPKQHPLTSKESITIEDLRDEPIITVAKEAWPTLYMDFIQFCEQAGFRPNIVQEATEYQMVIGLVSAGIGMTFVPSSAKKLFNLDVTYRKMDQIQLNAEWVIAYRKDNHNPLIKHFIHISNCQQTRTKESDAGT
>CP035403.1|QAW10066.1|3578467_3580180_-|acetolactate-synthase-AlsS
MTKATKEQKSLVKNRGAELVVDCLVEQGVTHVFGIPGAKIDAVFDALQDKGPEIIVARHEQNAAFMAQAVGRLTGKPGVVLVTSGPGASNLATGLLTANTEGDPVVALAGNVIRADRLKRTHQSLDNAALFQPITKYSVEVQDVKNIPEAVTNAFRIASAGQAGAAFVSFPQDVVNEVTNTKNVRAVAAPKLGPAADDAISAAIAKIQTAKLPVILVGMKGGRPEAIKAVRKLLKKVQLPFVETYQAAGTLSRDLEDQYFGRIGLFRNQPGDLLLEQADVVLTIGYDPIEYDPKFWNVNGDRTIIHLDEIIADIDHAYQPDLELIGDIPSTINHIEHDAVKVEFAEREQKILSDLKQYMHKDEQVPADWKSDRAHPLEIVKELRNAVDDHVTVTCDIGSHAIWMSRYFRSYEPLTLMISNGMQTLGVALPWAIGASLVKPGEKVVSVSGDGGFLFSAMELETAVRLKAPIVHIVWNDSTYDMVAFQQLKKYNRTSAVDFGNIDIVKYAESFGATGLRVESPDQLADVLRQGMNAEGPVIIDVPVDYSDNINLASDKLPKEFGELMKTKAL
>CP035403.1|QAW10065.1|3577638_3578406_-|acetolactate-decarboxylase
MKRESNIQVLSRGQKDQPVSQIYQVSTMTSLLDGVYDGDFELSEIPKYGDFGIGTFNKLDGELIGFDGEFYRLRSDGTATPVQKGDRSPFCSFTFFTPDMTHKIDVKMTREDFEKEINSMLPSRNLFYAIRIDGLFKKVQTRTVELQEKPYVPMVEAVKTQPIFNFDNVRGTIVGFLTPAYANGIAVSGYHLHFIDEGRNSGGHVFDYVLEDCTVTISQKMNMNLRLPNTADFFNANLDNPDFAKDIETTEGSPE
>CP035403.1|QAW10064.1|3577012_3577540_-|flavodoxin-family-protein
MKILVLAVHPHMETSVVNKAWAEELSKHDNITVRDLYKEYPDEEIDVAKEQQLCEEYDRIVFQFPLYWYSSPPLLKKWQDLVLTYGWAFGSEGNALHGKELMLAVSTGSEAEKYQAGGANHYSISELLKPFQATSNLIGMKYLPPYVFYGVNYAAAGDISHSAKRLAEYIQQPFV
>CP035403.1|QAW10063.1|3576676_3576973_+|DUF3892-domain-containing-protein
MDQFEAAYESYKARQTTVDQENVPSGKEEIIAVRRNEEDNIIAVKTNTGRELDYPTALSEAKSGKLAHVDVFHKYGRDILRSEPDGIKENNLSELPDF
>CP035403.1|QAW10062.1|3575984_3576521_+|cell-wall-binding-protein
MNKPTKLFSTLALAAGMTAAAAGGAGTIHAQQPETTVSIDDLYSYPIDSYLVSAEALNVRTKASASSQKADTLHLGDSLKLISFSNADWAKVQYKNGKIGFVSTHYIVKAATTVKTKTKTKVYTSADGKSIKTLPADTSVSFLGWSKTNKGGFDFDWVFVDYGGATGYMKTKDLHMTK
>CP035403.1|QAW10061.1|3574985_3575903_+|ribose-ABC-transporter-substrate-binding-protein-RbsB
MKKAVSVILTLSLFLLTACSLEPPQWAKPSNSGNKKEFTIGLSVSTLNNPFFVSLKKGIEKEAKKRGMKVIIVDAQNDSSKQTSDVEDLIQQGVDALLINPTDSSAISTAVESANAVGVPVVTIDRSAEQGKVETLVASDNVKGGEMAATFIADKLGKGAKVAELEGVPGASATRERGSGFHNIADQKLQVVTKQSADFDRTKGLTVMENLLQGHPDIQAVFAHNDEMALGALEAINSSGKDILVIGFDGNKDALASIKNGKLSATVAQQPELIGKLATEAADDILHGKKVQKTISAPLKLETQK
>CP035403.1|QAW10060.1|3574004_3574973_+|ribose-ABC-transporter-permease
MKTEQLQTEQKRIHFDGVMQKLGPFLGLFILVIIVSILNPSFLEPLNILNLLRQVAINGLIAFGMTFVILTGGIDLSVGAILALSSALVAGMIVSGVDPVLAIILGCIIGAVLGMINGLLITKGKMAPFIATLATMTVFRGLTLVYTDGNPITGLGTNYAFQMFGRGYFLGIPVPAITMVLAFVILWVLLHKTPFGRRTYAIGGNEKAALISGIKVTRVKVMIYSLAGLLSALGGAILTSRLHSAQPTAGESYELDAIAAVVLGGTSLSGGRGRIVGTLIGVLIIGTLNNGLNLLGVSSFYQLVVKGIVILIAVLLDRKKSA
>CP035403.1|QAW10059.1|3572521_3574003_+|ribose-ABC-transporter-ATP-binding-protein-RbsA
MQIKMKDIHKAFGKNLVLSGVSFQLMPGEVHALMGENGAGKSTLMNILTGLHKADKGQISINGNETYFSNPKEAEQHGIAFIHQELNIWPEMTVLENLFIGKEISSKLCVLQTRKMKALAKEQFDKLSVSLSLDQEAGECSVGQQQMIEIAKALMTNAEVIIMDEPTAALTEREISKLFEVITALKKNGVSIVYISHRMEEIFAICDRITIMRDGKTVDTTNISETDFDEVVKKMVGRELTERYPKRTPSLGDKVFEVKNASVKGSFEDVSFYVRSGEIVGVSGLMGAGRTEMMRALFGVDRLDTGEIWIAGKKTAIKNPQEAVKKGLGFITENRKDEGLLLDTSIRENIALPNLSSFSPKGLIDHKREAEFVDLLIKRLTIKTASPETHARHLSGGNQQKVVIAKWIGIGPKVLILDEPTRGVDVGAKREIYTLMNELTERGVAIIMVSSELPEILGMSDRIIVVHEGRISGEIHARGATQERIMTLATGGR
>CP035403.1|QAW10069.1|3584876_3585965_-|spore-coat-protein-CotH
MKNQSNLPLYQLFVHPKDLRELKKDIWDDDPVPAVMKVNQKRLDIDIAYRGSHIRDFKKKSYHIAFYQPKTFRGAREIHLNAEYKDPSLMRNKLSLDFFSELGTLSPKAEFVFVKVNGKNEGVYLELESVDEYYLAKRKLADGAIFYAVDDDANFSLMSDLEKETKTSLELGYEKKTGTVEDDFYLQDMIFKINTVPKAQFKSEVTKHVDVDKYLRWLAGIVFTSNYDGFVHNYALYRSGETGLFEVIPWDYDATWGRDIHGDRMAADYVRIQGFNTLTARILDESEFRKSYKRLLEKTLQSLFTIEYMEPKIMAMYERIRPFVLMDPYKKNDVERFDREPDVICEYIKNRSQYLKNNLSIL
>CP035403.1|QAW10070.1|3586106_3586616_+|spore-gernimation-protein-GerQ
MGHYSHSDIKEAVKSAKKEGLKDYLYQEPHGKKRSHKKSHRTHKKSRSHKKSYCSHKKSRSHKKSYRSHKKSRSYKKSYRSYKKSRSYKKSCRSYKKSRSYKKSYCSHKKKSRSYKKSCRTHKKSYRSHKKYYKKPYHHCDDYKRHDDYDSKKEYWKDGNCWVVKKKYK
>CP035403.1|QAW10071.1|3586788_3587406_+|flavin-reductase-family-protein
MYIFQADQLSAKDTYKLLSGTVIPRPIAFVTTLSSEGAVNAAPYSFYNVVSSDPPLLSISVNRTEGRQKDTARNAVENGEFVVHVSDEATIEDINETAASLRPDESELTRTSLHPVESKAVSVPGIKEARVRFECKLERHITFDNDQGVTTADLLIGRVVCFHLDEKVYDAEKGYILTDELKPASRLAGNHYAKLGEEFTLIRPS
>CP035403.1|QAW10072.1|3587582_3587918_+|DUF4181-domain-containing-protein
MTNFWILMLIAITISLASQFFIKKIYGIDKSGWRYKHVSNTHKWIEITLLILFVVSLSFFPVEYLLLLFFIVIDSIRIFMEWHYRPEDKQYMYHIVEVSLMFMLLIYICTL
>CP035403.1|QAW10073.1|3587922_3589500_-|gamma-glutamyltransferase
MNKSVIGTKQMVVSPHYLASQAGNRILDKGGNAFDAAVAVSACLAVVYPHMTGLGGDSFWLTFHQETKAVKVYNGSGRSGKNVTRDVYKGKRAIPLRGIDSAITVPGMVDSWDAVLKEYGCLSLADVLEPARDYAQNGFPVSADQCHHTEKNIELLASTPYTADIFTRRGKAPVPGERFVQKELADSLNLIAEKGRSAFYEGDLAQRIVSHLQNNGSYMTIDDFKAHRGEWVAPVSSDYRGYSVYQAPPNSQGFTGLLTLNILENYDFTQIEHGSFEYYHVLVEALKKSFVDRNAFLTDPAFADIPLERLLDKNYAKRLAGEIGYLAELAESRPVGSDTAYAAVIDADGNAVSFIQSLYFEFGSAVTAGDTGILLQNRGSFFSLDENHVNTLEPRKRTFHTLMPAMVCKGGKPKILYGTQGGEGQPQTQTAIITRMLDYEMHPQQAISEPRWVWGRTWGEEYEGLRVEGRFTDKTIQKLKDSGHLVEVVGDYDPLMGHAAAIKVDEEGFLQGGADPRGDGAAVGI
>CP035403.1|QAW10074.1|3589713_3590190_+|Lrp/AsnC-family-transcriptional-regulator
MSHEYQIPNLVLDETDKQILTILHEEGRISYTDLGKRVDLSRVAVQARINQLIEAGVIEKFTAVINPAKIGIHVSVFFNVEVEPQFLEEVALKLEEEPAVTSLYHMTGPSKLHMHGIFANDQEMEEFLTKRLYPLRGVVSVDCQMLIKRYKSRMGMKL
>CP035403.1|QAW10075.1|3590203_3590797_+|chromate-transporter
MKNHPYRDMTAAMVRTGILGFGGGPSVIPLIRHEAVNKYKWIDDDEFGEILAIANALPGPIATKMAAYLGFKLKGTLGAVVATLAHILPTCLAMVGLFAAVNVLSHSAIVAGMIGAVTPVIAVMLGIMAYEFGQKALKGFGWVTGILFFIIAFIGLQTLQINPGLVIIIFLAYGAFHFKLKDKITNKHSKDKGMSAS
>CP035403.1|QAW10076.1|3590793_3591330_+|chromate-transporter
MISIYLFMAFFIANLLGYGGGPASIPLMFEEVVNRYSWLSNDQFSNMLALANALPGPIATKIAAYVGYSAGGWPGFLIALIATVVPSALALIVLLRIIQRFRQSPVIKGMTLSVQPVIAVMMLILTWQIGADGIKAIGWIQSIVIAGISLLAMTKFKMHPAFLIIAAFLYGGLVIPHL
>CP035403.1|QAW10077.1|3591356_3591578_-|hypothetical-protein
MKFLLSVIAGLLILAFFLFWKVQPPVWIHVETNSPELKQYVRMAGTTLQVKHIIKSDAGEETAVISNGISGPK
>CP035403.1|QAW10078.1|3592243_3593125_+|LysR-family-transcriptional-regulator
MELKQLITFITAAEHVNFTLTAKMLNYAQSSVTSQIKSLEEEIGTPLFERLGKRLILTEAGKTFKSYAQKIIALTEEAKMATNQVRETTGTLKIGATESQCTYRLPPIIKEFKQAFPQVKLIFKPYISNEQAKEHLLQGQLDITFILDVNRMEDALHVESLIQDEIKMVAANDHPFPADLPVTLKDLQNETLLLTEDGCSYRTLFENNLHDSGVYPNKLEFVSIEAIKQCVMAGLGIGILPEMTVKDDIAAGRMKELNWQSDCPVFTQLAWHKDKWMSAPLKAFIDLTRKTFK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP035403_2	2.1\|3026911\|60\|CP035403\|CRISPRCasFinder	3026911-3026970	60	NZ_CP024037	Bacillus aryabhattai strain K13 plasmid unnamed2	10417-10476	7	0.883
CP035403_2	2.1\|3026911\|60\|CP035403\|CRISPRCasFinder	3026911-3026970	60	NZ_CP026740	Bacillus megaterium strain YC4-R4 plasmid unnamed4	70764-70823	7	0.883
CP035403_2	2.1\|3026911\|60\|CP035403\|CRISPRCasFinder	3026911-3026970	60	NC_017139	Bacillus megaterium WSH-002 plasmid WSH-002_p1, complete sequence	1318-1377	7	0.883
CP035403_2	2.1\|3026911\|60\|CP035403\|CRISPRCasFinder	3026911-3026970	60	NZ_CP010587	Bacillus megaterium Q3 plasmid p1, complete sequence	838-897	7	0.883
CP035403_2	2.1\|3026911\|60\|CP035403\|CRISPRCasFinder	3026911-3026970	60	NZ_CP023319	Bacillus megaterium strain A plasmid p2, complete sequence	75825-75884	7	0.883
CP035403_2	2.1\|3026911\|60\|CP035403\|CRISPRCasFinder	3026911-3026970	60	NC_020451	Vibrio coralliilyticus strain ATCC BAA-450 plasmid, complete sequence	1960-2019	9	0.85
CP035403_2	2.1\|3026911\|60\|CP035403\|CRISPRCasFinder	3026911-3026970	60	NZ_CP015440	Anoxybacillus amylolyticus strain DSM 15939 plasmid pDSM15939_2, complete sequence	64773-64832	12	0.8
CP035403_2	2.1\|3026911\|60\|CP035403\|CRISPRCasFinder	3026911-3026970	60	NZ_CP033045	Bacillus foraminis strain Bac44 plasmid unnamed, complete sequence	483791-483850	13	0.783
CP035403_2	2.1\|3026911\|60\|CP035403\|CRISPRCasFinder	3026911-3026970	60	NZ_LR134399	Listeria monocytogenes strain NCTC7974 plasmid 2, complete sequence	57361-57420	14	0.767

1. spacer 2.1|3026911|60|CP035403|CRISPRCasFinder matches to NZ_CP024037 (Bacillus aryabhattai strain K13 plasmid unnamed2) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

2. spacer 2.1|3026911|60|CP035403|CRISPRCasFinder matches to NZ_CP026740 (Bacillus megaterium strain YC4-R4 plasmid unnamed4) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

3. spacer 2.1|3026911|60|CP035403|CRISPRCasFinder matches to NC_017139 (Bacillus megaterium WSH-002 plasmid WSH-002_p1, complete sequence) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

4. spacer 2.1|3026911|60|CP035403|CRISPRCasFinder matches to NZ_CP010587 (Bacillus megaterium Q3 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

5. spacer 2.1|3026911|60|CP035403|CRISPRCasFinder matches to NZ_CP023319 (Bacillus megaterium strain A plasmid p2, complete sequence) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

6. spacer 2.1|3026911|60|CP035403|CRISPRCasFinder matches to NC_020451 (Vibrio coralliilyticus strain ATCC BAA-450 plasmid, complete sequence) position: , mismatch: 9, identity: 0.85

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcattttagttatggcccggg	Protospacer
****************************************** ***   * ***  **.

7. spacer 2.1|3026911|60|CP035403|CRISPRCasFinder matches to NZ_CP015440 (Anoxybacillus amylolyticus strain DSM 15939 plasmid pDSM15939_2, complete sequence) position: , mismatch: 12, identity: 0.8

cagcttggaaggctgaggttttaccactaaactacacccgca-------atttttatttg	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcataataatatataccattg	Protospacer
******************************************       ** * .  ***

8. spacer 2.1|3026911|60|CP035403|CRISPRCasFinder matches to NZ_CP033045 (Bacillus foraminis strain Bac44 plasmid unnamed, complete sequence) position: , mismatch: 13, identity: 0.783

cagcttggaaggctgaggttttaccactaaactacacccgc--------aatttttattt	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatggttaaaagttttgcca	Protospacer
*****************************************        ** ****...

9. spacer 2.1|3026911|60|CP035403|CRISPRCasFinder matches to NZ_LR134399 (Listeria monocytogenes strain NCTC7974 plasmid 2, complete sequence) position: , mismatch: 14, identity: 0.767

cagcttggaaggctgaggttttaccactaaactacacccgc---------aatttttatt	CRISPR spacer
cagcttggaaggctgtagttttaccactaaactacacccgcatagtaagtagttcttagt	Protospacer
*************** .************************         *.**.*** *

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

571080 : 578371

Staphylococcus_phage(33.33%)

integrase

attL 572848:572863|attR 579362:579377

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAW07181.1\|571080_572379_+	arsenic transporter	A0A2H4PQU3	Staphylococcus_phage	2.3e-164	70.4
QAW07182.1\|572400_572820_+	arsenate reductase (thioredoxin)	A0A2H4PQT9	Staphylococcus_phage	1.4e-46	65.7
572848:572863	attL	NA	NA	NA	NA
QAW07183.1\|572886_573993_-\|integrase	site-specific integrase	A0A0A8WF08	Clostridium_phage	2.0e-39	34.5
QAW07184.1\|574005_574518_-	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
QAW07185.1\|574514_574898_-	XRE family transcriptional regulator	A0A0B5CYL9	Listeria_phage	2.4e-13	38.5
QAW07186.1\|575171_575366_+	ICEBs1 excisionase	NA	NA	NA	NA
QAW10608.1\|575362_575623_+	hypothetical protein	NA	NA	NA	NA
QAW07187.1\|575676_575937_+	hypothetical protein	NA	NA	NA	NA
QAW07188.1\|576142_576271_+	hypothetical protein	NA	NA	NA	NA
QAW07189.1\|576305_576680_+	DUF961 domain-containing protein	A0A1S5SF96	Streptococcus_phage	3.3e-15	47.2
QAW10609.1\|576928_578371_+	DNA translocase FtsK	A0A1S5SFB5	Streptococcus_phage	1.5e-119	51.0
579362:579377	attR	NA	NA	NA	NA

DBSCAN-SWA_2

685187 : 757878

uncultured_Caudovirales_phage(30.61%)

capsid,tail,portal,holin,tRNA,transposase,integrase,protease,terminase

attL 696749:696769|attR 735298:735318

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAW07281.1\|685187_685664_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE	NA	NA	NA	NA
QAW07282.1\|685644_686334_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
QAW07283.1\|686343_686799_+	ribosomal-protein-alanine N-acetyltransferase	NA	NA	NA	NA
QAW07284.1\|686791_687832_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	8.8e-66	43.9
QAW07285.1\|688146_689394_+\|transposase	IS256-like element ISBsu2 family transposase	A0A220NQR7	Corynebacterium_phage	2.6e-24	22.6
QAW07286.1\|689439_691368_-	ABC transporter ATP-binding protein	A0A2K9L3Z8	Tupanvirus	8.1e-57	29.7
QAW07287.1\|691493_692006_+	cyclic pyranopterin monophosphate synthase MoaC	NA	NA	NA	NA
QAW07288.1\|692002_692650_+	redox-sensing transcriptional repressor Rex	NA	NA	NA	NA
QAW07289.1\|692670_692844_+	twin-arginine translocase TatA/TatE family subunit	NA	NA	NA	NA
QAW07290.1\|692850_693615_+	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	1.5e-22	30.8
QAW07291.1\|693651_693843_-	DUF4305 domain-containing protein	NA	NA	NA	NA
QAW07292.1\|693839_694574_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
QAW07293.1\|694812_695097_+	co-chaperone GroES	A0A221S3C8	uncultured_virus	2.2e-19	51.6
QAW07294.1\|695143_696766_+	chaperonin GroEL	A0A219YK78	uncultured_virus	1.6e-159	57.5
696749:696769	attL	NA	NA	NA	NA
QAW07295.1\|696855_698055_-\|integrase	site-specific integrase	S6C485	Thermus_phage	1.2e-82	46.3
QAW07296.1\|698071_698578_-	ImmA/IrrE family metallo-endopeptidase	A0A2H4JA43	uncultured_Caudovirales_phage	2.0e-63	69.9
QAW07297.1\|698646_699045_-	hypothetical protein	NA	NA	NA	NA
QAW07298.1\|699282_699642_-	XRE family transcriptional regulator	A0A2H4J6F9	uncultured_Caudovirales_phage	7.8e-22	47.8
QAW07299.1\|699776_700013_+	XRE family transcriptional regulator	NA	NA	NA	NA
QAW07300.1\|700025_700340_+	hypothetical protein	A0A2H4JDL0	uncultured_Caudovirales_phage	2.7e-10	44.2
QAW07301.1\|700336_701062_+	phage regulatory protein	A0A2H4J4N4	uncultured_Caudovirales_phage	2.7e-77	59.6
QAW07302.1\|701118_701688_+	XRE family transcriptional regulator	A0A2H4J884	uncultured_Caudovirales_phage	1.1e-62	58.0
QAW07303.1\|701684_701942_+	hypothetical protein	NA	NA	NA	NA
QAW07304.1\|702071_702266_+	hypothetical protein	NA	NA	NA	NA
QAW07305.1\|702367_702718_+	hypothetical protein	NA	NA	NA	NA
QAW07306.1\|702717_702906_+	hypothetical protein	NA	NA	NA	NA
QAW07307.1\|702905_703856_+	hypothetical protein	A0A2H4JA52	uncultured_Caudovirales_phage	1.3e-132	71.7
QAW07308.1\|703858_704701_+	recombinase RecT	A0A2H4JCY8	uncultured_Caudovirales_phage	7.7e-129	85.5
QAW07309.1\|704867_705560_+	DnaD domain protein	A0A1L2JY26	Aeribacillus_phage	6.2e-07	50.0
QAW07310.1\|705444_706296_+	ATP-binding protein	A6XMI1	Bacillus_virus	4.8e-62	49.3
QAW10614.1\|706570_706960_+	hypothetical protein	E5DV92	Deep-sea_thermophilic_phage	1.7e-14	41.9
QAW07311.1\|706946_707405_+	DUF1064 domain-containing protein	A0A2H4J891	uncultured_Caudovirales_phage	1.9e-60	81.3
QAW07312.1\|707301_707568_+	hypothetical protein	NA	NA	NA	NA
QAW07313.1\|707773_707980_+	hypothetical protein	A0A2H4J4M6	uncultured_Caudovirales_phage	8.4e-21	78.9
QAW07314.1\|708011_708329_+	VWA domain-containing protein	NA	NA	NA	NA
QAW07315.1\|708564_708813_+	hypothetical protein	A0A2H4JA61	uncultured_Caudovirales_phage	7.8e-05	42.3
QAW07316.1\|708937_709156_+	hypothetical protein	NA	NA	NA	NA
QAW07317.1\|709152_709710_+	dUTPase	R9TQ23	Paenibacillus_phage	3.1e-41	51.5
QAW07318.1\|709709_710189_+	hypothetical protein	F8WQ59	Bacillus_phage	2.3e-21	51.6
QAW07319.1\|710185_710569_+	hypothetical protein	A0A1P8CWX0	Bacillus_phage	8.6e-35	57.5
QAW07320.1\|710699_710921_+	hypothetical protein	NA	NA	NA	NA
QAW07321.1\|711395_711527_+	hypothetical protein	NA	NA	NA	NA
QAW07322.1\|711747_712209_+	sigma-70 family RNA polymerase sigma factor	A0A2H4J4R7	uncultured_Caudovirales_phage	3.1e-23	46.7
QAW07323.1\|712332_712674_+	structural protein	Q38579	Bacillus_phage	3.9e-31	61.9
QAW07324.1\|712837_713569_+	hypothetical protein	A0A2P1JTW4	Anoxybacillus_phage	1.9e-62	59.8
QAW07325.1\|713549_714851_+\|terminase	PBSX family phage terminase large subunit	B5LPR0	Bacillus_virus	2.1e-205	78.4
QAW07326.1\|714863_716393_+\|portal	phage portal protein	A0A1B1P863	Bacillus_phage	1.5e-162	63.0
QAW10615.1\|716434_717496_+\|capsid	minor capsid protein	B5LPR2	Bacillus_virus	1.7e-85	46.2
QAW07327.1\|717547_718207_+	hypothetical protein	M9Q248	Clostridium_phage	1.1e-05	28.7
QAW07328.1\|718206_719091_+	hypothetical protein	A0A1S5SA37	Streptococcus_phage	1.2e-100	62.9
QAW07329.1\|719053_719362_+	fibronectin type III domain-containing protein	Q0PDK9	Bacillus_phage	2.3e-14	55.1
QAW07330.1\|719418_719820_+	hypothetical protein	A0A1B1P889	Bacillus_phage	6.1e-15	37.9
QAW07331.1\|719812_720148_+\|capsid	minor capsid protein	I1TLE5	Bacillus_phage	1.4e-09	37.9
QAW07332.1\|720147_720498_+\|capsid	minor capsid protein	B5LPR8	Bacillus_virus	2.4e-20	50.0
QAW07333.1\|720502_720913_+\|capsid	minor capsid protein	NA	NA	NA	NA
QAW07334.1\|720909_721359_+\|capsid	capsid protein	A0A2I7QIP9	Bacillus_phage	4.2e-25	44.9
QAW10616.1\|721345_721621_+	fibronectin type III domain-containing protein	Q0PDK9	Bacillus_phage	5.4e-15	51.1
QAW07335.1\|721661_722045_+	hypothetical protein	NA	NA	NA	NA
QAW07336.1\|722054_722720_+	hypothetical protein	B5LPS2	Bacillus_virus	3.5e-23	33.2
QAW10617.1\|722781_725574_+	hypothetical protein	A0A0S2SXL7	Bacillus_phage	3.5e-85	55.4
QAW07337.1\|725570_726296_+\|tail	phage tail family protein	A0A1B1P894	Bacillus_phage	1.4e-30	38.9
QAW07338.1\|726308_729602_+	hypothetical protein	Q5YA57	Bacillus_phage	1.2e-113	42.4
QAW07339.1\|729616_730021_+	hypothetical protein	NA	NA	NA	NA
QAW07340.1\|730181_730352_+	XkdX family protein	NA	NA	NA	NA
QAW07341.1\|730363_730621_+	hypothetical protein	NA	NA	NA	NA
QAW10618.1\|730707_730977_+	protein xhlA	A0A2H4JD40	uncultured_Caudovirales_phage	3.5e-27	71.9
QAW07342.1\|730992_731256_+\|holin	phage holin	A0A2H4J6M0	uncultured_Caudovirales_phage	1.5e-25	69.0
QAW07343.1\|731313_732249_+	LysM peptidoglycan-binding domain-containing protein	Q9ZXD7	Bacillus_phage	1.6e-90	61.6
QAW07344.1\|732708_732951_+	hypothetical protein	NA	NA	NA	NA
QAW07345.1\|732928_733159_+	DNA-binding protein	A0A2H4JDR0	uncultured_Caudovirales_phage	9.4e-13	48.7
QAW07346.1\|733418_734120_+	hypothetical protein	Q0H269	Geobacillus_phage	4.4e-61	51.8
QAW07347.1\|734125_734875_+	DUF4065 domain-containing protein	Q0H268	Geobacillus_phage	1.8e-92	64.5
QAW07348.1\|734904_735093_-	hypothetical protein	A0A2H4J4T3	uncultured_Caudovirales_phage	4.1e-14	60.0
QAW07349.1\|736472_737492_+	hypothetical protein	NA	NA	NA	NA
735298:735318	attR	NA	NA	NA	NA
QAW07350.1\|738090_739128_+	teicoplanin resistance protein VanZ	NA	NA	NA	NA
QAW07351.1\|739144_740368_+	hypothetical protein	NA	NA	NA	NA
QAW07352.1\|743263_744325_+	NAD(P)-dependent alcohol dehydrogenase	NA	NA	NA	NA
QAW07353.1\|744397_745789_+	MFS transporter	NA	NA	NA	NA
QAW07354.1\|745883_746846_+	carbohydrate kinase	NA	NA	NA	NA
QAW07355.1\|747041_747725_+	PspA/IM30 family protein	NA	NA	NA	NA
QAW07356.1\|747790_748816_+	TFIIB-type zinc ribbon-containing protein	NA	NA	NA	NA
QAW07357.1\|748815_749580_+	YgcG family protein	NA	NA	NA	NA
QAW07358.1\|749610_750582_+	hypothetical protein	NA	NA	NA	NA
QAW07359.1\|752236_753658_+	MFS transporter	NA	NA	NA	NA
QAW07360.1\|753705_754746_-	(R,R)-butanediol dehydrogenase	NA	NA	NA	NA
QAW07361.1\|755183_755555_+	hypothetical protein	NA	NA	NA	NA
QAW07362.1\|755620_756667_+	hypothetical protein	NA	NA	NA	NA
QAW07363.1\|756727_757878_-\|transposase	IS3 family transposase	A0A0N9SIX5	Staphylococcus_phage	1.7e-38	61.2

DBSCAN-SWA_3

778375 : 786741

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAW07384.1\|778375_779671_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	5.9e-19	25.7
QAW07385.1\|779744_780470_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0E3G7P8	Synechococcus_phage	1.2e-45	44.1
QAW07386.1\|780462_780717_+	phosphoribosylformylglycinamidine synthase, purS protein	NA	NA	NA	NA
QAW07387.1\|780713_781397_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
QAW07388.1\|781380_783609_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	3.8e-159	40.1
QAW07389.1\|783584_785015_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.2e-52	32.5
QAW07390.1\|785116_786157_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	2.8e-64	42.0
QAW07391.1\|786153_786741_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	2.4e-28	41.0

DBSCAN-SWA_4

825600 : 888321

Corynebacterium_phage(16.67%)

transposase,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAW07421.1\|825600_826095_+\|coat	spore coat protein	NA	NA	NA	NA
QAW07422.1\|826209_826794_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
QAW07423.1\|827549_827798_+\|coat	spore coat associated protein CotJA	NA	NA	NA	NA
QAW07424.1\|827781_828045_+\|coat	spore coat protein CotJB	NA	NA	NA	NA
QAW07425.1\|828059_828629_+\|coat	spore coat protein CotJC	NA	NA	NA	NA
QAW07426.1\|828753_829296_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
QAW07427.1\|829318_829621_+	hypothetical protein	NA	NA	NA	NA
QAW07428.1\|829735_830365_+	DUF624 domain-containing protein	NA	NA	NA	NA
QAW07429.1\|830361_832095_+	sensor histidine kinase	NA	NA	NA	NA
QAW07430.1\|832094_833198_+	response regulator transcription factor	NA	NA	NA	NA
QAW07431.1\|833302_834586_+	carbohydrate ABC transporter substrate-binding protein	NA	NA	NA	NA
QAW07432.1\|834582_835512_+	sugar ABC transporter permease	NA	NA	NA	NA
QAW07433.1\|835515_836406_+	carbohydrate ABC transporter permease	NA	NA	NA	NA
QAW07434.1\|836421_837456_+	glycoside hydrolase family 105 protein	NA	NA	NA	NA
QAW07435.1\|837478_839764_+	AraC family transcriptional regulator	NA	NA	NA	NA
QAW07436.1\|839777_840476_+	rhamnogalacturonan acetylesterase	NA	NA	NA	NA
QAW07437.1\|840468_841131_+	DUF1961 family protein	NA	NA	NA	NA
QAW07438.1\|841127_841754_+	DUF624 domain-containing protein	NA	NA	NA	NA
QAW07439.1\|841874_843737_+	rhamnogalacturonan lyase	NA	NA	NA	NA
QAW07440.1\|843782_845621_+	rhamnogalacturonan lyase	NA	NA	NA	NA
QAW07441.1\|845779_846433_+	rhamnogalacturonan acetylesterase	NA	NA	NA	NA
QAW07442.1\|851170_852679_+	extracellular solute-binding protein	NA	NA	NA	NA
QAW07443.1\|852733_853690_+	sugar ABC transporter permease	NA	NA	NA	NA
QAW07444.1\|853703_854591_+	carbohydrate ABC transporter permease	NA	NA	NA	NA
QAW07445.1\|854599_855940_+	alpha-glucosidase/alpha-galactosidase	NA	NA	NA	NA
QAW07446.1\|856014_856710_+	DUF421 domain-containing protein	NA	NA	NA	NA
QAW07447.1\|856746_857073_-	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
QAW07448.1\|857176_857539_-	VOC family protein	NA	NA	NA	NA
QAW07449.1\|857634_858222_-	hypothetical protein	NA	NA	NA	NA
QAW07450.1\|858419_859292_+	STAS domain-containing protein	NA	NA	NA	NA
QAW07451.1\|859446_859614_+	DUF2292 domain-containing protein	NA	NA	NA	NA
QAW07452.1\|859722_860367_+	BAX inhibitor (BI)-1/YccA family protein	NA	NA	NA	NA
QAW07453.1\|860485_860773_+	hypothetical protein	NA	NA	NA	NA
QAW07454.1\|862495_863743_+\|transposase	IS256-like element ISBsu2 family transposase	A0A220NQR7	Corynebacterium_phage	2.6e-24	22.6
QAW07455.1\|863868_864942_-	DUF3900 domain-containing protein	NA	NA	NA	NA
QAW07456.1\|865086_868272_+	cytochrome P450	V5UQK0	Mycobacterium_phage	2.3e-80	37.5
QAW10621.1\|868718_870638_+	Lipoteichoic acid synthase 1	W6LM83	Streptococcus_phage	1.0e-128	43.5
QAW07457.1\|870873_871638_+	glucose-1-phosphate cytidylyltransferase	NA	NA	NA	NA
QAW07458.1\|871644_872613_+	NAD-dependent epimerase/dehydratase family protein	A0A2K9L0I7	Tupanvirus	1.1e-30	29.3
QAW07459.1\|872636_873548_+	hypothetical protein	NA	NA	NA	NA
QAW07460.1\|873576_874755_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
QAW07461.1\|874755_875691_+	hypothetical protein	NA	NA	NA	NA
QAW07462.1\|875720_876950_-	MFS transporter	NA	NA	NA	NA
QAW07463.1\|877061_877769_-	noncanonical pyrimidine nucleotidase, YjjG family	NA	NA	NA	NA
QAW07464.1\|877860_879246_-	amino acid permease	NA	NA	NA	NA
QAW07465.1\|879495_880953_+	aldehyde dehydrogenase family protein	NA	NA	NA	NA
QAW07466.1\|880966_881827_+	chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	2.2e-09	41.0
QAW07467.1\|881961_883851_+	ABC transporter ATP-binding protein	A0A1V0SGN0	Hokovirus	6.1e-41	31.9
QAW07468.1\|883973_884420_+	hypothetical protein	NA	NA	NA	NA
QAW07469.1\|884545_884968_+	MerR family transcriptional regulator	NA	NA	NA	NA
QAW07470.1\|885033_886224_+	MFS transporter	NA	NA	NA	NA
QAW07471.1\|886799_887237_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
QAW07472.1\|887292_888321_-\|transposase	IS1595-like element ISBsu3 family transposase	NA	NA	NA	NA

DBSCAN-SWA_5

1292315 : 1326428

Planktothrix_phage(40.0%)

tRNA,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAW07850.1\|1292315_1293308_-\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
QAW07851.1\|1294051_1295689_+	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
QAW07852.1\|1295796_1296732_+	peptide ABC transporter permease	NA	NA	NA	NA
QAW07853.1\|1296735_1297653_+	peptide ABC transporter permease	NA	NA	NA	NA
QAW07854.1\|1297657_1298734_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.1e-17	30.8
QAW07855.1\|1298735_1299653_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	1.6e-23	34.8
QAW07856.1\|1299759_1300977_+	MFS transporter	NA	NA	NA	NA
QAW07857.1\|1301141_1301714_+	N-acetyltransferase	NA	NA	NA	NA
QAW07858.1\|1301899_1302295_+	transcriptional regulator Spx	NA	NA	NA	NA
QAW07859.1\|1302549_1303206_-	TerC family protein	A0A2R2YAT9	Pseudomonas_phage	1.1e-29	38.0
QAW07860.1\|1303375_1303516_+	hypothetical protein	NA	NA	NA	NA
QAW07861.1\|1303482_1304139_+	adaptor protein MecA	NA	NA	NA	NA
QAW07862.1\|1304133_1304256_-	hypothetical protein	NA	NA	NA	NA
QAW07863.1\|1304299_1305451_+	competence protein CoiA	NA	NA	NA	NA
QAW07864.1\|1305497_1307510_+	oligoendopeptidase F	NA	NA	NA	NA
QAW07865.1\|1307547_1307715_-	hypothetical protein	NA	NA	NA	NA
QAW07866.1\|1307810_1308014_-	hypothetical protein	NA	NA	NA	NA
QAW07867.1\|1308028_1308928_-	DsbA family protein	NA	NA	NA	NA
QAW07868.1\|1308924_1309323_-	thiol management oxidoreductase	NA	NA	NA	NA
QAW10634.1\|1309574_1310120_-	lytic transglycosylase domain-containing protein	A0A1P8CWQ1	Bacillus_phage	4.8e-39	61.0
QAW07869.1\|1310323_1310896_-	CYTH domain-containing protein	NA	NA	NA	NA
QAW07870.1\|1311020_1311389_+	hypothetical protein	NA	NA	NA	NA
QAW07871.1\|1311417_1312053_+	GTP pyrophosphokinase YjbM	NA	NA	NA	NA
QAW07872.1\|1312071_1312872_+	NAD(+) kinase	NA	NA	NA	NA
QAW10635.1\|1312934_1313786_+	RluA family pseudouridine synthase	NA	NA	NA	NA
QAW07873.1\|1313798_1314533_-	bis(5'-nucleosyl)-tetraphosphatase PrpE	A8E2N0	Enterococcus_phage	1.9e-06	24.6
QAW07874.1\|1314767_1316612_+	sodium:proton antiporter	NA	NA	NA	NA
QAW07875.1\|1316860_1317571_+	thiaminase II	NA	NA	NA	NA
QAW07876.1\|1317545_1318163_+	thiazole tautomerase TenI	NA	NA	NA	NA
QAW07877.1\|1318146_1319256_+	glycine oxidase ThiO	NA	NA	NA	NA
QAW10636.1\|1319255_1319456_+	sulfur carrier protein ThiS	NA	NA	NA	NA
QAW07878.1\|1319452_1320223_+	thiazole synthase	NA	NA	NA	NA
QAW07879.1\|1320219_1321230_+	thiazole biosynthesis adenylyltransferase ThiF	NA	NA	NA	NA
QAW07880.1\|1321248_1322064_+	bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase	NA	NA	NA	NA
QAW07881.1\|1322199_1322976_+	enoyl-[acyl-carrier-protein] reductase FabI	NA	NA	NA	NA
QAW07882.1\|1323076_1323760_+\|coat	spore coat protein	NA	NA	NA	NA
QAW07883.1\|1323852_1324299_-\|coat	spore coat protein Z	NA	NA	NA	NA
QAW07884.1\|1324426_1324915_-\|coat	spore coat protein Y	NA	NA	NA	NA
QAW07885.1\|1325066_1325585_-\|coat	spore coat protein	NA	NA	NA	NA
QAW07886.1\|1325685_1326000_-\|coat	spore coat protein CotW	NA	NA	NA	NA
QAW07887.1\|1326041_1326428_-\|coat	spore coat protein V	NA	NA	NA	NA

DBSCAN-SWA_6

1359706 : 1467687

114

Bacillus_phage(21.74%)

plate,tail,portal,holin,transposase,coat,protease,terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAW07923.1\|1359706_1359955_-\|coat	spore coat protein CotT	NA	NA	NA	NA
QAW07924.1\|1360208_1361612_+	DUF4163 domain-containing protein	NA	NA	NA	NA
QAW07925.1\|1361651_1362125_-	DUF2690 domain-containing protein	NA	NA	NA	NA
QAW07926.1\|1362253_1362421_-	putative motility protein	NA	NA	NA	NA
QAW07927.1\|1362546_1363446_+	hypothetical protein	NA	NA	NA	NA
QAW07928.1\|1363454_1363853_-	DUF2809 domain-containing protein	NA	NA	NA	NA
QAW07929.1\|1363953_1364529_-	DUF4309 domain-containing protein	NA	NA	NA	NA
QAW10638.1\|1367260_1367821_+	DUF1641 domain-containing protein	NA	NA	NA	NA
QAW07930.1\|1370052_1371243_+	cytochrome P450	NA	NA	NA	NA
QAW07931.1\|1371265_1372444_+	UDP-glucosyltransferase	Q0IKX4	Leucania_separata_nucleopolyhedrovirus	2.1e-07	27.7
QAW07932.1\|1372484_1372673_-	hypothetical protein	A0A1P8CWV7	Bacillus_phage	7.7e-21	77.6
QAW07933.1\|1372846_1373662_+	uroporphyrinogen-III synthase	NA	NA	NA	NA
QAW07934.1\|1373707_1374460_-	iron export ABC transporter permease subunit FetB	NA	NA	NA	NA
QAW07935.1\|1374459_1375212_-	phosphate ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.4e-18	31.4
QAW07936.1\|1375331_1376306_-	multidrug resistance efflux transporter family protein	NA	NA	NA	NA
QAW07937.1\|1376437_1376935_+	cupin domain-containing protein	NA	NA	NA	NA
QAW07938.1\|1377323_1377746_+	DUF1641 domain-containing protein	NA	NA	NA	NA
QAW07939.1\|1377785_1378964_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
QAW07940.1\|1379161_1380583_+	glucuronate isomerase	NA	NA	NA	NA
QAW07941.1\|1380650_1382030_+	MFS transporter	NA	NA	NA	NA
QAW07942.1\|1382134_1383148_+	ureidoglycolate dehydrogenase	NA	NA	NA	NA
QAW07943.1\|1383153_1384173_+	zinc-binding alcohol dehydrogenase family protein	NA	NA	NA	NA
QAW07944.1\|1384197_1385277_+	mannonate dehydratase	NA	NA	NA	NA
QAW07945.1\|1385273_1386110_+	SDR family NAD(P)-dependent oxidoreductase	M1NMS3	Moumouvirus	2.7e-09	30.4
QAW07946.1\|1386157_1387426_+	hexuronate transporter	NA	NA	NA	NA
QAW07947.1\|1387513_1388515_+	LacI family transcriptional regulator	NA	NA	NA	NA
QAW07948.1\|1388589_1390032_+	tagaturonate reductase	NA	NA	NA	NA
QAW07949.1\|1390028_1391522_+	altronate dehydratase	NA	NA	NA	NA
QAW07950.1\|1391560_1392325_-	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
QAW07951.1\|1392549_1393014_-	hypothetical protein	NA	NA	NA	NA
QAW07952.1\|1393162_1394434_+	ATP-dependent metallopeptidase FtsH/Yme1/Tma family protein	A0A1V0SEI6	Indivirus	8.6e-15	37.1
QAW07953.1\|1394579_1395716_+	tetratricopeptide repeat protein	A0A1P8CWN8	Bacillus_phage	8.3e-94	47.4
QAW07954.1\|1395705_1395840_+	phosphatase RapA inhibitor PhrA	NA	NA	NA	NA
QAW07955.1\|1395870_1396128_-	hypothetical protein	NA	NA	NA	NA
QAW07956.1\|1396249_1397203_+	LysM peptidoglycan-binding domain-containing protein	A0A218KC88	Bacillus_phage	7.3e-67	74.4
QAW07957.1\|1397241_1397619_-	PH domain-containing protein	A5GYQ0	Lactococcus_phage	4.7e-17	42.3
QAW07958.1\|1397724_1398327_+	hypothetical protein	F8WQ53	Bacillus_phage	1.7e-45	49.7
QAW07959.1\|1398403_1399240_+	manganese catalase family protein	NA	NA	NA	NA
QAW07960.1\|1399283_1399880_-	ImmA/IrrE family metallo-endopeptidase	A0A2H4JA43	uncultured_Caudovirales_phage	8.1e-40	51.7
QAW07961.1\|1400042_1400384_-	XRE family transcriptional regulator	A0A2H4J6F9	uncultured_Caudovirales_phage	4.5e-19	46.6
QAW07962.1\|1400562_1400742_+	hypothetical protein	NA	NA	NA	NA
QAW07963.1\|1400728_1401565_+	phage-like element PBSX protein XkdB	S6BFM4	Thermus_phage	1.8e-24	28.2
QAW07964.1\|1401464_1402265_+	ATP-binding protein	A6XMI1	Bacillus_virus	1.1e-60	51.7
QAW07965.1\|1402264_1402432_+	hypothetical protein	NA	NA	NA	NA
QAW07966.1\|1402516_1402867_+	phage-like element PBSX protein XkdD	NA	NA	NA	NA
QAW07967.1\|1402863_1403070_+	phage-like element PBSX protein XtrA	A0A2H4J4M6	uncultured_Caudovirales_phage	1.6e-11	50.0
QAW07968.1\|1403185_1403695_+	sigma-70 family RNA polymerase sigma factor	A0A1L2JY33	Aeribacillus_phage	1.1e-21	38.6
QAW07969.1\|1404606_1405908_+\|terminase	PBSX family phage terminase large subunit	A0A2P1JTW5	Anoxybacillus_phage	1.4e-153	60.5
QAW07970.1\|1405911_1407399_+\|portal	phage portal protein	A0A1B1P7C8	Bacillus_phage	1.0e-139	55.7
QAW07971.1\|1407418_1408246_+\|portal	phage portal protein	A0A1B1P7E4	Bacillus_phage	3.6e-54	58.7
QAW07972.1\|1408271_1409207_+	phage-like element PBSX protein XkdG	A0A1B1P7E3	Bacillus_phage	1.1e-104	63.8
QAW07973.1\|1409228_1409612_+	DUF3199 family protein	A0A1B1P7D6	Bacillus_phage	1.4e-13	40.5
QAW07974.1\|1409608_1409965_+	DUF3599 family protein	NA	NA	NA	NA
QAW07975.1\|1409961_1410447_+	HK97 gp10 family phage protein	A0A249XXA4	Clostridium_phage	1.8e-37	46.4
QAW07976.1\|1410459_1410900_+\|portal	phage portal protein	NA	NA	NA	NA
QAW07977.1\|1410903_1411122_+	hypothetical protein	NA	NA	NA	NA
QAW07978.1\|1411118_1412519_+\|tail	phage tail sheath protein	A0A0A7S087	Clostridium_phage	1.8e-77	39.3
QAW07979.1\|1412520_1412964_+	phage-like element PBSX protein XkdM	A0A0K2CNG3	Brevibacillus_phage	1.1e-25	45.2
QAW07980.1\|1413054_1413501_+	phage-like element PBSX protein XkdN	A0A249XXA9	Clostridium_phage	7.5e-14	33.6
QAW07981.1\|1413530_1413680_+	hypothetical protein	NA	NA	NA	NA
QAW07982.1\|1413681_1417680_+	lytic transglycosylase	A0A1L2JY60	Aeribacillus_phage	7.6e-41	43.8
QAW07983.1\|1417672_1418332_+	LysM peptidoglycan-binding domain-containing protein	A0A090DBR9	Clostridium_phage	3.7e-25	34.0
QAW07984.1\|1418347_1419325_+	phage-like element PBSX protein XkdQ	H7BV96	unidentified_phage	1.0e-39	32.6
QAW07985.1\|1419324_1419591_+	DUF2577 domain-containing protein	S6C459	Thermus_phage	1.7e-05	36.4
QAW07986.1\|1419647_1420073_+	DUF2634 domain-containing protein	A0A2H4J6K5	uncultured_Caudovirales_phage	7.8e-13	38.0
QAW07987.1\|1420065_1421112_+\|plate	baseplate J/gp47 family protein	S6AVU3	Thermus_phage	1.3e-72	44.3
QAW07988.1\|1421095_1421674_+	DUF2313 domain-containing protein	A0A2H4J717	uncultured_Caudovirales_phage	3.0e-15	34.2
QAW07989.1\|1421670_1421943_+	hypothetical protein	NA	NA	NA	NA
QAW07990.1\|1421945_1424009_+\|terminase	terminase	A0A2H4J4R1	uncultured_Caudovirales_phage	4.8e-31	37.4
QAW07991.1\|1424020_1424350_+	phage-like element PBSX protein XkdW	A0A2H4JCI0	uncultured_Caudovirales_phage	1.7e-15	41.3
QAW07992.1\|1424346_1424511_+	XkdX family protein	A0A2H4JAA1	uncultured_Caudovirales_phage	5.5e-15	66.0
QAW07993.1\|1425445_1425715_+	protein xhlA	A0A2H4JD40	uncultured_Caudovirales_phage	6.2e-24	64.8
QAW07994.1\|1425727_1425991_+\|holin	holin	A0A2H4J6M0	uncultured_Caudovirales_phage	4.7e-24	65.5
QAW07995.1\|1426003_1426897_+	LysM peptidoglycan-binding domain-containing protein	Q9ZXD7	Bacillus_phage	5.2e-83	69.2
QAW07996.1\|1426934_1427072_-	hypothetical protein	NA	NA	NA	NA
QAW07997.1\|1427157_1427328_-	type II toxin-antitoxin system SpoIISB family antitoxin	NA	NA	NA	NA
QAW07998.1\|1427327_1428074_-	type II toxin-antitoxin system SpoIISA family toxin	NA	NA	NA	NA
QAW07999.1\|1428183_1429185_-	inorganic phosphate transporter	NA	NA	NA	NA
QAW08000.1\|1429197_1429815_-	DUF47 domain-containing protein	NA	NA	NA	NA
QAW08001.1\|1430090_1431407_-	amino acid permease	NA	NA	NA	NA
QAW08002.1\|1431795_1432746_+	ring-cleaving dioxygenase	NA	NA	NA	NA
QAW08003.1\|1432963_1435132_+	glycosyltransferase family 39 protein	NA	NA	NA	NA
QAW08004.1\|1435143_1436115_+	glycosyltransferase	A0A2H5BFL1	Salmonella_phage	1.1e-62	41.0
QAW08005.1\|1436632_1437982_-\|protease	serine protease	A0A1B1IT49	uncultured_Mediterranean_phage	5.7e-25	33.7
QAW08006.1\|1438150_1438969_+	pyrroline-5-carboxylate reductase	NA	NA	NA	NA
QAW08007.1\|1439097_1439922_+	aminopeptidase	NA	NA	NA	NA
QAW08008.1\|1439938_1440865_+	ABC transporter permease	NA	NA	NA	NA
QAW08009.1\|1440870_1441833_+	ABC transporter permease	NA	NA	NA	NA
QAW08010.1\|1441837_1442845_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.8e-16	29.1
QAW10639.1\|1442847_1444497_+	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
QAW08011.1\|1444584_1445544_+	LD-carboxypeptidase	NA	NA	NA	NA
QAW08012.1\|1445540_1446620_+	dipeptide epimerase	NA	NA	NA	NA
QAW08013.1\|1446636_1447527_+	NlpC/P60 family protein	A0A0A8WIF2	Clostridium_phage	3.1e-19	42.7
QAW08014.1\|1447539_1448529_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	3.8e-18	30.6
QAW08015.1\|1448571_1449621_-	6-phosphogluconolactonase	NA	NA	NA	NA
QAW08016.1\|1450713_1451232_+	acyl-CoA thioesterase	NA	NA	NA	NA
QAW08017.1\|1451538_1452663_-\|transposase	IS4-like element IS4Bsu1 family transposase	NA	NA	NA	NA
QAW08018.1\|1452883_1454083_+	NO-inducible flavohemoprotein	NA	NA	NA	NA
QAW08019.1\|1454159_1454369_-	hypothetical protein	NA	NA	NA	NA
QAW08020.1\|1454517_1455249_+	DUF421 domain-containing protein	NA	NA	NA	NA
QAW08021.1\|1455340_1455868_+	DinB family protein	NA	NA	NA	NA
QAW08022.1\|1455857_1456376_+	N-acetyltransferase	NA	NA	NA	NA
QAW08023.1\|1456597_1456936_+	multidrug efflux SMR transporter subunit YkkC	NA	NA	NA	NA
QAW08024.1\|1456935_1457253_+	multidrug efflux SMR transporter subunit YkkD	NA	NA	NA	NA
QAW08025.1\|1457323_1458226_+	formyltetrahydrofolate deformylase	NA	NA	NA	NA
QAW08026.1\|1458576_1459674_+	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	4.3e-71	42.1
QAW08027.1\|1459685_1460933_+	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	5.5e-99	50.1
QAW08028.1\|1461058_1461484_+	organic hydroperoxide resistance protein	NA	NA	NA	NA
QAW08029.1\|1461515_1461959_-	MarR family transcriptional regulator	NA	NA	NA	NA
QAW08030.1\|1462090_1462501_+	organic hydroperoxide resistance protein	NA	NA	NA	NA
QAW08031.1\|1462753_1463224_-	nucleoside deaminase	S4VYZ2	Pandoravirus	1.8e-26	43.0
QAW08032.1\|1463358_1463985_+	histidine phosphatase family protein	NA	NA	NA	NA
QAW08033.1\|1464023_1466312_-	5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase	NA	NA	NA	NA
QAW08034.1\|1466727_1467687_-\|protease	serine protease	A0A127AWU5	Bacillus_phage	1.5e-75	49.8

DBSCAN-SWA_7

1495650 : 1554574

Bacillus_phage(20.0%)

transposase,integrase,protease

attL 1522650:1522709|attR 1554540:1555908

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAW08063.1\|1495650_1496547_+\|protease	protease HtpX	NA	NA	NA	NA
QAW08064.1\|1496720_1498070_+	Ktr system potassium uptake protein D	NA	NA	NA	NA
QAW08065.1\|1498214_1498370_+	hypothetical protein	NA	NA	NA	NA
QAW08066.1\|1498372_1498555_+	hypothetical protein	NA	NA	NA	NA
QAW08067.1\|1498596_1499619_-	acyltransferase family protein	NA	NA	NA	NA
QAW08068.1\|1499871_1502088_+	PAS domain-containing sensor histidine kinase	W8CYF6	Bacillus_phage	8.8e-23	29.8
QAW08069.1\|1502084_1502582_+	methylated-DNA--[protein]-cysteine S-methyltransferase	A0A0G2Y3R2	Acanthamoeba_polyphaga_mimivirus	5.9e-20	50.5
QAW08070.1\|1502671_1502797_+	hypothetical protein	NA	NA	NA	NA
QAW08071.1\|1502830_1503892_-	S-methyl-5-thioribose-1-phosphate isomerase	NA	NA	NA	NA
QAW08072.1\|1503899_1505093_-	S-methyl-5-thioribose kinase	NA	NA	NA	NA
QAW08073.1\|1505425_1506205_-	carbon-nitrogen family hydrolase	NA	NA	NA	NA
QAW08074.1\|1506299_1507496_+	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
QAW08075.1\|1507719_1508937_+	2,3-diketo-5-methylthiopentyl-1-phosphate enolase	NA	NA	NA	NA
QAW08076.1\|1508933_1509641_+	2-hydroxy-3-keto-5-methylthiopentenyl-1- phosphate phosphatase	NA	NA	NA	NA
QAW08077.1\|1509598_1510228_+	methylthioribulose 1-phosphate dehydratase	NA	NA	NA	NA
QAW08078.1\|1510242_1510779_+	cupin domain-containing protein	NA	NA	NA	NA
QAW08079.1\|1510819_1511140_-	DUF1232 domain-containing protein	NA	NA	NA	NA
QAW08080.1\|1511342_1511600_+	aspartyl-phosphate phosphatase Spo0E family protein	NA	NA	NA	NA
QAW08081.1\|1511685_1512117_+	hypothetical protein	NA	NA	NA	NA
QAW08082.1\|1512144_1513665_-	sensor histidine kinase	NA	NA	NA	NA
QAW08083.1\|1513857_1514295_+	MarR family transcriptional regulator	NA	NA	NA	NA
QAW08084.1\|1514334_1515123_-	flagellar motor protein MotB	NA	NA	NA	NA
QAW08085.1\|1515097_1515907_-	flagellar motor protein MotA	NA	NA	NA	NA
QAW08086.1\|1516082_1516319_-	hypothetical protein	NA	NA	NA	NA
QAW08087.1\|1516290_1518390_-\|protease	ATP-dependent Clp protease ATP-binding subunit	H6X3M6	Enterobacteria_phage	1.1e-131	42.9
QAW08088.1\|1518755_1519799_+	hypothetical protein	NA	NA	NA	NA
QAW08089.1\|1520111_1520771_+	7-cyano-7-deazaguanine synthase QueC	A0A2H4J8Q7	uncultured_Caudovirales_phage	1.2e-65	57.5
QAW08090.1\|1520763_1521213_+	6-carboxytetrahydropterin synthase QueD	NA	NA	NA	NA
QAW08091.1\|1521205_1521937_+	7-carboxy-7-deazaguanine synthase QueE	E7DN68	Pneumococcus_phage	4.9e-55	46.8
QAW08092.1\|1521954_1522452_+	NADPH-dependent 7-cyano-7-deazaguanine reductase QueF	E7DN65	Pneumococcus_phage	1.4e-56	74.1
1522650:1522709	attL	NA	NA	NA	NA
QAW08093.1\|1522674_1523922_-\|transposase	IS256-like element ISBsu2 family transposase	A0A220NQR7	Corynebacterium_phage	2.6e-24	22.6
QAW08094.1\|1524063_1524666_-	hypothetical protein	NA	NA	NA	NA
QAW08095.1\|1526005_1526200_+	hypothetical protein	NA	NA	NA	NA
QAW08096.1\|1526604_1527957_-\|transposase	IS1182 family transposase	A0A1X9I5T2	Streptococcus_phage	1.4e-87	41.8
QAW08097.1\|1529395_1529761_-	DUF1433 domain-containing protein	NA	NA	NA	NA
QAW08098.1\|1529936_1530299_-	DUF1433 domain-containing protein	NA	NA	NA	NA
QAW08099.1\|1530349_1531765_+	lipase	NA	NA	NA	NA
QAW08100.1\|1531777_1532083_+	hypothetical protein	NA	NA	NA	NA
QAW08101.1\|1532103_1532328_-	hypothetical protein	NA	NA	NA	NA
QAW08102.1\|1532329_1533208_+\|integrase	site-specific integrase	A0A1B0T6A8	Bacillus_phage	1.6e-28	29.8
QAW08103.1\|1533878_1534169_+	DUF3219 family protein	NA	NA	NA	NA
QAW08104.1\|1534289_1534475_-	DUF2187 domain-containing protein	NA	NA	NA	NA
QAW10640.1\|1534640_1534835_+	hypothetical protein	NA	NA	NA	NA
QAW08105.1\|1535133_1535760_+	cell wall hydrolase	A0A141HRV8	Bacillus_phage	3.1e-26	52.7
QAW08106.1\|1535877_1537215_+	polysaccharide biosynthesis protein	NA	NA	NA	NA
QAW08107.1\|1537265_1537763_+	TlpA family protein disulfide reductase	NA	NA	NA	NA
QAW08108.1\|1537998_1539912_+	cadmium-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	4.8e-118	40.9
QAW08109.1\|1539949_1540153_-	hypothetical protein	NA	NA	NA	NA
QAW08110.1\|1540318_1541413_+	aminopeptidase P family protein	NA	NA	NA	NA
QAW08111.1\|1541694_1542660_+	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	9.8e-19	26.9
QAW08112.1\|1542722_1543589_+	ptsGHI operon transcription antiterminator GlcT	NA	NA	NA	NA
QAW08113.1\|1543816_1545916_+	PTS glucose transporter subunit IICBA	A0A2I7SAJ6	Vibrio_phage	2.0e-08	50.0
QAW08114.1\|1546013_1546280_+	phosphocarrier protein HPr	NA	NA	NA	NA
QAW08115.1\|1546279_1547992_+	phosphoenolpyruvate--protein phosphotransferase	NA	NA	NA	NA
QAW08116.1\|1548082_1548322_+	transcriptional regulator	NA	NA	NA	NA
QAW08117.1\|1548386_1549415_+	spore photoproduct lyase	NA	NA	NA	NA
QAW10641.1\|1549407_1550109_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
QAW08118.1\|1550243_1552211_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.6e-12	33.8
QAW08119.1\|1552348_1553215_+	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
QAW08120.1\|1553326_1554574_+\|transposase	IS256-like element ISBsu2 family transposase	A0A220NQR7	Corynebacterium_phage	2.6e-24	22.6
1554540:1555908	attR	NA	NA	NA	NA

DBSCAN-SWA_8

1880760 : 1887310

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAW08444.1\|1880760_1881153_+	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	G3MBF1	Bacillus_virus	2.5e-29	58.3
QAW08445.1\|1881112_1883215_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	U5PY35	Bacillus_phage	0.0e+00	86.8
QAW08446.1\|1883232_1884222_+	class 1b ribonucleoside-diphosphate reductase subunit beta	F8WQ21	Bacillus_phage	1.9e-155	83.5
QAW08447.1\|1884271_1884892_+	hypothetical protein	A0A127AYS1	Bacillus_phage	1.0e-45	47.4
QAW08448.1\|1884955_1885723_-	N-acetylmuramoyl-L-alanine amidase	E5DV68	Deep-sea_thermophilic_phage	1.6e-51	49.5
QAW10648.1\|1886341_1887310_+	stage V sporulation protein K	G3MAX6	Bacillus_virus	5.2e-52	40.5

DBSCAN-SWA_9

2253981 : 2260276

Staphylococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAW08798.1\|2253981_2254575_-	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	2.0e-14	35.4
QAW08799.1\|2254564_2255320_-	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	9.4e-09	25.8
QAW08800.1\|2255597_2256122_+	DUF309 domain-containing protein	NA	NA	NA	NA
QAW08801.1\|2256337_2256712_-	GNAT family N-acetyltransferase RibT	NA	NA	NA	NA
QAW08802.1\|2256824_2257289_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	5.5e-44	60.0
QAW08803.1\|2257321_2258518_-	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	4.1e-115	54.9
QAW08804.1\|2258532_2259180_-	riboflavin synthase subunit alpha	A0A2H4PQS5	Staphylococcus_phage	5.0e-43	45.9
QAW08805.1\|2259190_2260276_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	4.6e-57	36.6

DBSCAN-SWA_10

2485256 : 2601047

128

Bacillus_phage(27.5%)

capsid,plate,tail,portal,holin,transposase,coat,terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAW09052.1\|2485256_2486285_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
QAW09053.1\|2486427_2487150_+	DUF308 domain-containing protein	NA	NA	NA	NA
QAW10672.1\|2487792_2488191_+	sigma-70 family RNA polymerase sigma factor	A0A0A0RV91	Bacillus_phage	1.1e-08	35.7
QAW09054.1\|2488279_2488750_+	MarR family transcriptional regulator	NA	NA	NA	NA
QAW09055.1\|2488899_2490312_+	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
QAW09056.1\|2490498_2492001_-	recombinase family protein	E5DV73	Deep-sea_thermophilic_phage	4.6e-31	25.3
QAW09057.1\|2491900_2492095_-	hypothetical protein	NA	NA	NA	NA
QAW09058.1\|2492356_2494171_-	ATP-dependent endonuclease	NA	NA	NA	NA
QAW09059.1\|2494637_2498258_-	DEAD/DEAH box helicase	E3T5F3	Cafeteria_roenbergensis_virus	1.1e-09	33.6
QAW09060.1\|2498184_2499096_-	hypothetical protein	NA	NA	NA	NA
QAW09061.1\|2499584_2500712_-	tetratricopeptide repeat protein	A0A1P8CWN8	Bacillus_phage	1.9e-90	48.5
QAW09062.1\|2502547_2502979_+	SMI1/KNR4 family protein	NA	NA	NA	NA
QAW09063.1\|2503070_2503649_+	suppressor of fused domain protein	NA	NA	NA	NA
QAW09064.1\|2503756_2504149_+	hypothetical protein	NA	NA	NA	NA
QAW09065.1\|2504158_2504599_+	SMI1/KNR4 family protein	NA	NA	NA	NA
QAW09066.1\|2504697_2505150_+	SMI1/KNR4 family protein	NA	NA	NA	NA
QAW09067.1\|2505343_2505889_-	SMI1/KNR4 family protein	O64022	Bacillus_phage	2.2e-39	46.2
QAW10673.1\|2505908_2506451_-	HNH endonuclease	NA	NA	NA	NA
QAW09068.1\|2507034_2508003_-	LysM peptidoglycan-binding domain-containing protein	A0A218KC88	Bacillus_phage	2.0e-64	73.8
QAW09069.1\|2508047_2508470_-\|holin	holin family protein	D6R405	Bacillus_phage	3.3e-48	73.7
QAW09070.1\|2508515_2509409_-\|portal	phage portal protein	NA	NA	NA	NA
QAW09071.1\|2509497_2509662_-	XkdX family protein	NA	NA	NA	NA
QAW09072.1\|2509658_2509994_-\|portal	phage portal protein	NA	NA	NA	NA
QAW09073.1\|2510003_2511104_-	hypothetical protein	M4ZRP1	Bacillus_phage	1.7e-19	56.1
QAW09074.1\|2511106_2511379_-	hypothetical protein	NA	NA	NA	NA
QAW09075.1\|2511375_2511954_-	DUF2313 domain-containing protein	A0A0A7RTT8	Clostridium_phage	1.3e-13	27.0
QAW09076.1\|2511937_2512984_-\|plate	baseplate J/gp47 family protein	S6AVU3	Thermus_phage	9.8e-73	44.0
QAW09077.1\|2512976_2513402_-	DUF2634 domain-containing protein	A0A0A8WJV8	Clostridium_phage	1.6e-10	35.6
QAW09078.1\|2513414_2513678_-	DUF2577 domain-containing protein	NA	NA	NA	NA
QAW09079.1\|2513674_2514655_-\|portal	phage portal protein	H7BV96	unidentified_phage	2.3e-39	32.0
QAW09080.1\|2514667_2515327_-	LysM peptidoglycan-binding domain-containing protein	A0A090DBR9	Clostridium_phage	1.3e-25	34.7
QAW09081.1\|2515319_2520077_-	hypothetical protein	A0A1L2JY60	Aeribacillus_phage	8.7e-44	45.3
QAW09082.1\|2520079_2520217_-	hypothetical protein	NA	NA	NA	NA
QAW09083.1\|2520258_2520708_-\|portal	phage portal protein	A0A0A7RTY8	Clostridium_phage	5.9e-11	40.2
QAW10674.1\|2520864_2520951_+\|holin	putative holin-like toxin	NA	NA	NA	NA
QAW09084.1\|2521209_2521653_-\|portal	phage portal protein	A0A0K2CNG3	Brevibacillus_phage	2.5e-25	45.4
QAW09085.1\|2521655_2523056_-\|tail	phage tail sheath protein	S5MNC1	Brevibacillus_phage	4.8e-75	39.3
QAW09086.1\|2523056_2523248_-	hypothetical protein	NA	NA	NA	NA
QAW09087.1\|2523244_2523682_-\|portal	phage portal protein	NA	NA	NA	NA
QAW09088.1\|2523694_2524198_-	HK97 gp10 family phage protein	A0A249XXA4	Clostridium_phage	1.7e-38	47.5
QAW09089.1\|2524194_2524557_-	DUF3599 family protein	NA	NA	NA	NA
QAW09090.1\|2524553_2524949_-	DUF3199 family protein	NA	NA	NA	NA
QAW09091.1\|2524953_2525265_-	hypothetical protein	NA	NA	NA	NA
QAW09092.1\|2525275_2526211_-\|capsid	phage major capsid protein	A0A1B1P7E3	Bacillus_phage	8.6e-105	65.4
QAW09093.1\|2526229_2527204_-\|portal	phage portal protein	A0A1B1P7E4	Bacillus_phage	6.3e-58	56.6
QAW09094.1\|2527360_2528266_-	hypothetical protein	NA	NA	NA	NA
QAW09095.1\|2528310_2529228_-	hypothetical protein	A0A1B1P7D7	Bacillus_phage	5.2e-54	39.6
QAW09096.1\|2529224_2530757_-\|portal	phage portal protein	A0A1B1P7C8	Bacillus_phage	1.0e-147	52.0
QAW09097.1\|2530760_2532056_-\|terminase	PBSX family phage terminase large subunit	A0A2P1JTW5	Anoxybacillus_phage	1.6e-154	63.2
QAW09098.1\|2532048_2532768_-	hypothetical protein	A0A2P1JTW4	Anoxybacillus_phage	1.3e-60	61.3
QAW09099.1\|2532843_2533602_-	DNA-directed RNA polymerase	NA	NA	NA	NA
QAW09100.1\|2533717_2534185_-	hypothetical protein	NA	NA	NA	NA
QAW09101.1\|2534328_2534784_-	sigma-70 family RNA polymerase sigma factor	A0A2H4J4R7	uncultured_Caudovirales_phage	6.3e-61	74.2
QAW09102.1\|2534874_2535573_-	hypothetical protein	NA	NA	NA	NA
QAW09103.1\|2535681_2536929_+\|transposase	IS256-like element ISBsu2 family transposase	A0A220NQR7	Corynebacterium_phage	2.6e-24	22.6
QAW09104.1\|2537219_2537579_+	hypothetical protein	NA	NA	NA	NA
QAW09105.1\|2537726_2537936_-	hypothetical protein	A0A2H4J4M6	uncultured_Caudovirales_phage	2.7e-19	68.7
QAW09106.1\|2538017_2538446_-	RusA family crossover junction endodeoxyribonuclease	S6B1L9	Thermus_phage	1.6e-42	67.2
QAW09107.1\|2538540_2538690_-	hypothetical protein	NA	NA	NA	NA
QAW09108.1\|2538680_2539622_-	ATP-binding protein	A6XMI1	Bacillus_virus	2.1e-58	52.2
QAW10675.1\|2539503_2540181_-	DnaD domain protein	A0A2H4J6G9	uncultured_Caudovirales_phage	1.1e-05	32.2
QAW09109.1\|2541114_2542074_-	hypothetical protein	A0A2H4JA52	uncultured_Caudovirales_phage	1.3e-135	74.2
QAW09110.1\|2542179_2542374_-	hypothetical protein	NA	NA	NA	NA
QAW09111.1\|2542333_2542507_-	hypothetical protein	NA	NA	NA	NA
QAW09112.1\|2542503_2542761_-	hypothetical protein	A0A2H4J4M9	uncultured_Caudovirales_phage	6.4e-10	42.2
QAW09113.1\|2542757_2543327_-	XRE family transcriptional regulator	A0A2H4J884	uncultured_Caudovirales_phage	1.5e-64	61.0
QAW09114.1\|2543400_2543541_-	hypothetical protein	NA	NA	NA	NA
QAW09115.1\|2543573_2543783_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
QAW09116.1\|2543938_2544292_+	helix-turn-helix domain-containing protein	A0A0A7RTK4	Clostridium_phage	8.0e-11	48.6
QAW09117.1\|2544560_2544728_-	hypothetical protein	NA	NA	NA	NA
QAW09118.1\|2545071_2545608_-	hypothetical protein	NA	NA	NA	NA
QAW09119.1\|2545875_2546394_+	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
QAW09120.1\|2547080_2548328_+\|transposase	IS256-like element ISBsu2 family transposase	A0A220NQR7	Corynebacterium_phage	2.6e-24	22.6
QAW09121.1\|2548740_2549421_-	TetR family transcriptional regulator	NA	NA	NA	NA
QAW09122.1\|2551378_2552476_-	beta-mannosidase	NA	NA	NA	NA
QAW09123.1\|2553246_2554026_-	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
QAW09124.1\|2554085_2554313_-	hypothetical protein	NA	NA	NA	NA
QAW09125.1\|2554346_2555474_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
QAW09126.1\|2555816_2556374_-	hypothetical protein	NA	NA	NA	NA
QAW09127.1\|2556559_2557042_-	hypothetical protein	NA	NA	NA	NA
QAW09128.1\|2557190_2557451_-	metal-sensitive transcriptional regulator	NA	NA	NA	NA
QAW09129.1\|2557472_2557790_-	sulfurtransferase	NA	NA	NA	NA
QAW09130.1\|2558181_2558742_-	cupin domain-containing protein	Q2I8C5	Bacillus_phage	3.4e-56	69.1
QAW09131.1\|2558759_2558972_-	NTP pyrophosphohydrolase	NA	NA	NA	NA
QAW10676.1\|2558968_2559112_-	hypothetical protein	NA	NA	NA	NA
QAW09132.1\|2559285_2560107_-	multidrug efflux transcriptional regulator BltR	NA	NA	NA	NA
QAW09133.1\|2561594_2562053_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
QAW09134.1\|2562211_2563516_-	HlyC/CorC family transporter	NA	NA	NA	NA
QAW09135.1\|2563779_2563923_-	YrzO family protein	NA	NA	NA	NA
QAW09136.1\|2564544_2564862_+\|transposase	transposase	NA	NA	NA	NA
QAW09137.1\|2565050_2565485_+	hypothetical protein	NA	NA	NA	NA
QAW09138.1\|2565868_2566735_+	LysR family transcriptional regulator	NA	NA	NA	NA
QAW10677.1\|2567611_2568025_-\|transposase	transposase	NA	NA	NA	NA
QAW09139.1\|2567895_2568327_-	hypothetical protein	NA	NA	NA	NA
QAW09140.1\|2568515_2568833_-\|transposase	transposase	NA	NA	NA	NA
QAW09141.1\|2569384_2570332_-	cation transporter	NA	NA	NA	NA
QAW09142.1\|2572495_2572828_-	branched-chain amino acid transporter AzlD	NA	NA	NA	NA
QAW09143.1\|2572824_2573589_-	azaleucine resistance protein AzlC	NA	NA	NA	NA
QAW09144.1\|2574399_2574675_-	barnase inhibitor	NA	NA	NA	NA
QAW09145.1\|2574944_2576177_-	cytochrome P450	NA	NA	NA	NA
QAW09146.1\|2576226_2576631_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
QAW09147.1\|2576863_2577427_-	cysteine hydrolase	NA	NA	NA	NA
QAW09148.1\|2577655_2578027_-	DUF2568 domain-containing protein	NA	NA	NA	NA
QAW09149.1\|2578839_2579343_-	hypothetical protein	NA	NA	NA	NA
QAW09150.1\|2579455_2580703_+\|transposase	IS256-like element ISBsu2 family transposase	A0A220NQR7	Corynebacterium_phage	2.6e-24	22.6
QAW09151.1\|2580946_2581801_-	aminoglycoside 6-adenylyltransferase AadK	E4ZFP8	Streptococcus_phage	2.2e-94	58.2
QAW09152.1\|2582193_2583237_+	nitronate monooxygenase	NA	NA	NA	NA
QAW09153.1\|2583433_2583628_-	hypothetical protein	NA	NA	NA	NA
QAW09154.1\|2583569_2584367_+	glutamate racemase	NA	NA	NA	NA
QAW09155.1\|2584747_2585455_+	hypothetical protein	NA	NA	NA	NA
QAW10678.1\|2586031_2586109_+	YjcZ family sporulation protein	NA	NA	NA	NA
QAW09156.1\|2586395_2586557_-	hypothetical protein	NA	NA	NA	NA
QAW09157.1\|2587508_2588039_-	RNA polymerase sigma factor SigZ	NA	NA	NA	NA
QAW09158.1\|2588174_2589155_+	aldo/keto reductase	NA	NA	NA	NA
QAW09159.1\|2589430_2590747_-	TRAP transporter large permease subunit	NA	NA	NA	NA
QAW09160.1\|2590861_2591731_-	LysR family transcriptional regulator	NA	NA	NA	NA
QAW09161.1\|2591875_2592979_+	3-methylitaconate isomerase	NA	NA	NA	NA
QAW09162.1\|2593803_2594055_+	hypothetical protein	NA	NA	NA	NA
QAW09163.1\|2594191_2595007_+	alpha/beta hydrolase	NA	NA	NA	NA
QAW09164.1\|2595414_2595771_-	SH3 domain-containing protein	NA	NA	NA	NA
QAW09165.1\|2595823_2596183_-	SH3 domain-containing protein	NA	NA	NA	NA
QAW09166.1\|2596451_2596553_-	hypothetical protein	NA	NA	NA	NA
QAW09167.1\|2596819_2598067_+\|transposase	IS256-like element ISBsu2 family transposase	A0A220NQR7	Corynebacterium_phage	2.6e-24	22.6
QAW09168.1\|2598729_2598975_+	spore gernimation protein GerQ	NA	NA	NA	NA
QAW09169.1\|2598992_2599328_+\|coat	spore coat protein	NA	NA	NA	NA
QAW09170.1\|2599379_2600516_+	glutathione-dependent formaldehyde dehydrogenase	E3SJ82	Synechococcus_phage	2.2e-14	25.1
QAW09171.1\|2600534_2600732_+	hypothetical protein	NA	NA	NA	NA
QAW09172.1\|2600747_2601047_+\|coat	spore coat protein	NA	NA	NA	NA

DBSCAN-SWA_11

2680190 : 2734029

uncultured_Mediterranean_phage(12.5%)

protease,tRNA,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAW09249.1\|2680190_2681336_-\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	3.4e-87	44.0
QAW09250.1\|2681362_2682391_-\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
QAW09251.1\|2682420_2682621_-	DUF2905 domain-containing protein	NA	NA	NA	NA
QAW09252.1\|2682613_2683618_-	Holliday junction branch migration DNA helicase RuvB	B3GAM6	uncultured_virus	6.2e-08	30.8
QAW09253.1\|2683628_2684234_-	Holliday junction branch migration protein RuvA	NA	NA	NA	NA
QAW09254.1\|2684372_2684885_-	protein BofC	NA	NA	NA	NA
QAW09255.1\|2684932_2686240_-	MFS transporter	NA	NA	NA	NA
QAW09256.1\|2686310_2687336_-	inositol 2-dehydrogenase	NA	NA	NA	NA
QAW09257.1\|2687573_2688221_+	serine/threonine protein kinase	A0A2R3ZQF2	Marseillevirus	5.4e-05	26.3
QAW09258.1\|2688266_2688389_-	hypothetical protein	NA	NA	NA	NA
QAW09259.1\|2688473_2688920_+	hypothetical protein	NA	NA	NA	NA
QAW09260.1\|2688926_2689067_+	hypothetical protein	NA	NA	NA	NA
QAW09261.1\|2689230_2690685_+	alanine:cation symporter family protein	NA	NA	NA	NA
QAW09262.1\|2690724_2691447_-	YebC/PmpR family DNA-binding transcriptional regulator	NA	NA	NA	NA
QAW09263.1\|2691550_2692147_-	sporulation protein	NA	NA	NA	NA
QAW09264.1\|2692294_2693458_-\|coat	spore coat assembly protein SafA	NA	NA	NA	NA
QAW09265.1\|2693574_2694681_-	quinolinate synthase NadA	NA	NA	NA	NA
QAW09266.1\|2694667_2695537_-	carboxylating nicotinate-nucleotide diphosphorylase	NA	NA	NA	NA
QAW09267.1\|2695490_2697086_-	L-aspartate oxidase	NA	NA	NA	NA
QAW09268.1\|2697188_2698376_+	aminotransferase class V-fold PLP-dependent enzyme	A0A141ZJV0	Faustovirus	8.6e-33	27.4
QAW09269.1\|2698335_2698878_+	transcription repressor NadR	NA	NA	NA	NA
QAW09270.1\|2698902_2699760_-	prephenate dehydratase	NA	NA	NA	NA
QAW09271.1\|2699776_2700220_-	ACT domain-containing protein	NA	NA	NA	NA
QAW09272.1\|2700280_2701567_-	GTPase ObgE	NA	NA	NA	NA
QAW09273.1\|2701600_2702179_-	sporulation initiation phosphotransferase B	NA	NA	NA	NA
QAW10679.1\|2702234_2702378_+	hypothetical protein	NA	NA	NA	NA
QAW09274.1\|2702498_2702783_-	50S ribosomal protein L27	NA	NA	NA	NA
QAW09275.1\|2702795_2703134_-\|protease	ribosomal-processing cysteine protease Prp	NA	NA	NA	NA
QAW09276.1\|2703136_2703445_-	50S ribosomal protein L21	NA	NA	NA	NA
QAW09277.1\|2703591_2704458_-	stage IV sporulation protein FB	NA	NA	NA	NA
QAW09278.1\|2704450_2705245_-	M23 family metallopeptidase	NA	NA	NA	NA
QAW09279.1\|2705393_2706200_-	septum site-determining protein MinD	NA	NA	NA	NA
QAW09280.1\|2706201_2706882_-	septum site-determining protein MinC	NA	NA	NA	NA
QAW09281.1\|2706934_2707453_-	rod shape-determining protein MreD	NA	NA	NA	NA
QAW09282.1\|2707449_2708322_-	rod shape-determining protein MreC	NA	NA	NA	NA
QAW09283.1\|2708352_2709366_-	rod shape-determining protein MreB	NA	NA	NA	NA
QAW09284.1\|2709457_2710153_-	JAB domain-containing protein	NA	NA	NA	NA
QAW09285.1\|2710189_2710759_-	septum formation inhibitor Maf	NA	NA	NA	NA
QAW09286.1\|2710911_2711910_-	SPOR domain-containing protein	NA	NA	NA	NA
QAW09287.1\|2712043_2712790_-	prepilin peptidase	NA	NA	NA	NA
QAW09288.1\|2712930_2714223_-	bifunctional folylpolyglutamate synthase/dihydrofolate synthase	NA	NA	NA	NA
QAW09289.1\|2714282_2716925_-\|tRNA	valine--tRNA ligase	A0A1V0S951	Catovirus	3.7e-161	42.6
QAW09290.1\|2717372_2717564_+	hypothetical protein	NA	NA	NA	NA
QAW09291.1\|2717582_2718608_-\|coat	spore coat protein YsxE	NA	NA	NA	NA
QAW09292.1\|2718640_2720734_-	LysM peptidoglycan-binding domain-containing protein	NA	NA	NA	NA
QAW09293.1\|2720865_2722158_-	glutamate-1-semialdehyde-2,1-aminomutase	NA	NA	NA	NA
QAW09294.1\|2722187_2723162_-	porphobilinogen synthase	NA	NA	NA	NA
QAW09295.1\|2723158_2723947_-	uroporphyrinogen-III synthase	NA	NA	NA	NA
QAW09296.1\|2723936_2724881_-	hydroxymethylbilane synthase	NA	NA	NA	NA
QAW09297.1\|2724913_2725744_-	protein HemX	NA	NA	NA	NA
QAW09298.1\|2725751_2727119_-\|tRNA	glutamyl-tRNA reductase	NA	NA	NA	NA
QAW09299.1\|2727348_2727846_+	hypothetical protein	NA	NA	NA	NA
QAW09300.1\|2727867_2728455_-	YihA family ribosome biogenesis GTP-binding protein	NA	NA	NA	NA
QAW09301.1\|2728451_2730776_-\|protease	Lon protease 1	A0A0R6PGP8	Moraxella_phage	3.4e-182	43.7
QAW09302.1\|2730956_2732615_-\|protease	ATP-dependent protease LonB	A0A1V0SHJ7	Hokovirus	8.1e-05	33.7
QAW09303.1\|2732766_2734029_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.3e-148	64.9

DBSCAN-SWA_12

3686613 : 3772024

Bacillus_phage(22.22%)

bacteriocin,tRNA,transposase,protease,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAW10182.1\|3686613_3686778_+\|transposase	transposase	NA	NA	NA	NA
QAW10183.1\|3687181_3687628_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	2.2e-18	41.4
QAW10184.1\|3687683_3689291_-	CTP synthase (glutamine hydrolyzing)	A0A1J0FA14	Only_Syngen_Nebraska_virus	1.0e-153	52.1
QAW10185.1\|3689532_3690039_-	DNA-directed RNA polymerase subunit delta	NA	NA	NA	NA
QAW10186.1\|3690221_3691361_-	acyl-CoA dehydrogenase AcdA	NA	NA	NA	NA
QAW10187.1\|3691357_3693475_-	4Fe-4S dicluster domain-containing protein	NA	NA	NA	NA
QAW10188.1\|3693629_3694826_+	cardiolipin synthase	NA	NA	NA	NA
QAW10189.1\|3694838_3695801_+	UV DNA damage repair endonuclease UvsE	A0A127AW32	Bacillus_phage	4.5e-40	34.6
QAW10190.1\|3695881_3696154_+	hypothetical protein	NA	NA	NA	NA
QAW10191.1\|3696195_3696720_-	dihydrofolate reductase	NA	NA	NA	NA
QAW10192.1\|3696729_3698457_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	9.2e-60	31.2
QAW10193.1\|3698545_3700048_-	cardiolipin synthase	NA	NA	NA	NA
QAW10194.1\|3700572_3701244_-	respiratory nitrate reductase subunit gamma	NA	NA	NA	NA
QAW10195.1\|3701240_3701795_-	nitrate reductase molybdenum cofactor assembly chaperone	NA	NA	NA	NA
QAW10196.1\|3701820_3703284_-	nitrate reductase subunit beta	A0A077SL61	Escherichia_phage	3.2e-21	43.6
QAW10197.1\|3703273_3706960_-	nitrate reductase subunit alpha	NA	NA	NA	NA
QAW10198.1\|3707026_3707242_+	hypothetical protein	NA	NA	NA	NA
QAW10199.1\|3707150_3707627_-	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
QAW10200.1\|3707770_3708490_+	hypothetical protein	NA	NA	NA	NA
QAW10201.1\|3708521_3709238_-	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
QAW10202.1\|3709335_3710523_-	nitrate transporter NarK	NA	NA	NA	NA
QAW10203.1\|3710651_3712322_-\|tRNA	arginine--tRNA ligase	NA	NA	NA	NA
QAW10204.1\|3712318_3712747_-	DUF1934 domain-containing protein	NA	NA	NA	NA
QAW10205.1\|3713059_3713191_+\|bacteriocin	subtilosin A family bacteriocin	NA	NA	NA	NA
QAW10206.1\|3713147_3713300_+\|bacteriocin	bacteriocin-like protein SboX	NA	NA	NA	NA
QAW10207.1\|3713324_3714671_+	subtilosin maturase AlbA	NA	NA	NA	NA
QAW10208.1\|3714683_3714845_+\|bacteriocin	antilisterial bacteriocin subtilosin biosynthesis protein AlbB	NA	NA	NA	NA
QAW10209.1\|3714841_3715561_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.8e-17	26.7
QAW10210.1\|3715553_3716864_+\|bacteriocin	antilisterial bacteriocin subtilosin biosynthesis protein AlbD	NA	NA	NA	NA
QAW10717.1\|3716853_3718014_+	insulinase family protein	NA	NA	NA	NA
QAW10211.1\|3718018_3719299_+	insulinase family protein	NA	NA	NA	NA
QAW10212.1\|3719295_3719997_+\|bacteriocin	antilisterial bacteriocin subtilosin biosynthesis protein AlbG	NA	NA	NA	NA
QAW10213.1\|3720002_3721370_-	YncE family protein	NA	NA	NA	NA
QAW10214.1\|3721418_3722774_-	YncE family protein	NA	NA	NA	NA
QAW10215.1\|3722770_3723001_-	hypothetical protein	NA	NA	NA	NA
QAW10216.1\|3723003_3724149_+	tetratricopeptide repeat protein	A0A1P8CWN8	Bacillus_phage	5.1e-83	44.8
QAW10217.1\|3724132_3724252_+	phosphatase	NA	NA	NA	NA
QAW10218.1\|3724847_3725720_-	agmatinase	NA	NA	NA	NA
QAW10219.1\|3725780_3726611_-	spermidine synthase	NA	NA	NA	NA
QAW10220.1\|3726813_3728889_+	penicillin-binding protein	NA	NA	NA	NA
QAW10221.1\|3729180_3729699_-	hypothetical protein	NA	NA	NA	NA
QAW10222.1\|3729712_3730372_-\|protease	site-2 protease family protein	NA	NA	NA	NA
QAW10223.1\|3730480_3730669_+	2-hydroxymuconate tautomerase	NA	NA	NA	NA
QAW10224.1\|3730711_3731131_-	MarR family transcriptional regulator	NA	NA	NA	NA
QAW10225.1\|3731250_3733167_-\|tRNA	threonine--tRNA ligase	A0A2K9L6B6	Tupanvirus	2.4e-141	43.0
QAW10226.1\|3733523_3733679_-	hypothetical protein	NA	NA	NA	NA
QAW10227.1\|3733758_3735159_-	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
QAW10228.1\|3735158_3735629_-	Rrf2 family transcriptional regulator	NA	NA	NA	NA
QAW10229.1\|3735740_3736241_-	YwgA family protein	NA	NA	NA	NA
QAW10230.1\|3736276_3737578_-	HD domain-containing protein	E3T4P8	Cafeteria_roenbergensis_virus	7.2e-25	28.9
QAW10231.1\|3737739_3737964_-	DUF1450 domain-containing protein	NA	NA	NA	NA
QAW10232.1\|3738178_3738958_+	RsfA family transcriptional regulator	A0A1D6X8E5	Bacillus_phage	6.5e-05	28.4
QAW10233.1\|3739101_3739992_-	DMT family transporter	NA	NA	NA	NA
QAW10234.1\|3740159_3741005_-	octanoyl-[GcvH]:protein N-octanoyltransferase	NA	NA	NA	NA
QAW10235.1\|3741053_3741953_-	LysR family transcriptional regulator	A0A2H4J8I9	uncultured_Caudovirales_phage	3.6e-07	42.5
QAW10236.1\|3742098_3743070_-	phosphate acetyltransferase	NA	NA	NA	NA
QAW10237.1\|3743345_3744110_+	heme-dependent peroxidase	NA	NA	NA	NA
QAW10238.1\|3744242_3745022_+	SDR family oxidoreductase	NA	NA	NA	NA
QAW10239.1\|3745037_3746252_-	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
QAW10240.1\|3746252_3747437_-	MFS transporter	NA	NA	NA	NA
QAW10241.1\|3747433_3748852_-	ATP-grasp domain-containing protein	NA	NA	NA	NA
QAW10242.1\|3748870_3749632_-	dihydroanticapsin 7-dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	3.7e-21	30.9
QAW10243.1\|3750316_3750931_-	bacilysin biosynthesis protein BacA	NA	NA	NA	NA
QAW10244.1\|3751082_3752321_-	MFS transporter	NA	NA	NA	NA
QAW10245.1\|3752557_3753708_-\|transposase	IS3 family transposase	A0A0N9SIX5	Staphylococcus_phage	1.7e-38	61.2
QAW10246.1\|3753819_3755232_-	amino acid permease	NA	NA	NA	NA
QAW10247.1\|3755231_3756932_-	M20/M25/M40 family metallo-hydrolase	NA	NA	NA	NA
QAW10248.1\|3757005_3758553_-	L-glutamate gamma-semialdehyde dehydrogenase	NA	NA	NA	NA
QAW10249.1\|3760228_3760693_-	hypothetical protein	NA	NA	NA	NA
QAW10250.1\|3761016_3761472_-\|coat	spore coat protein	NA	NA	NA	NA
QAW10251.1\|3761464_3762316_-	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	1.3e-38	39.3
QAW10252.1\|3762329_3763277_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	4.9e-71	43.5
QAW10253.1\|3763276_3764017_-	glucose-1-phosphate thymidylyltransferase	I7I009	Enterobacteria_phage	7.7e-48	41.4
QAW10254.1\|3764041_3765061_-\|coat	spore coat protein	NA	NA	NA	NA
QAW10255.1\|3765063_3765786_-\|coat	spore coat protein	NA	NA	NA	NA
QAW10256.1\|3765778_3766900_-\|coat	spore coat protein	NA	NA	NA	NA
QAW10257.1\|3766899_3767769_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
QAW10258.1\|3767769_3768939_-	DegT/DnrJ/EryC1/StrS aminotransferase family protein	A0A1D8KU11	Synechococcus_phage	1.9e-16	26.9
QAW10259.1\|3768959_3770384_-	CDP-glycerol glycerophosphotransferase family protein	NA	NA	NA	NA
QAW10260.1\|3770388_3771159_-	glycosyltransferase family 2 protein	A0A0F7L2F7	uncultured_marine_virus	3.4e-06	28.6
QAW10261.1\|3771151_3771331_-	hypothetical protein	NA	NA	NA	NA
QAW10262.1\|3771478_3772024_+\|coat	spore coat protein GerQ	NA	NA	NA	NA

DBSCAN-SWA_13

4093715 : 4100256

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAW10553.1\|4093715_4094774_-	replication initiation factor domain-containing protein	A0A1S5SEX3	Streptococcus_phage	6.4e-64	40.2
QAW10554.1\|4094766_4096209_-	DNA translocase FtsK	A0A1S5SFB5	Streptococcus_phage	9.5e-119	50.9
QAW10555.1\|4096244_4096622_-	DUF961 domain-containing protein	A0A1S5SF96	Streptococcus_phage	8.8e-16	45.2
QAW10556.1\|4096638_4096785_-	hypothetical protein	NA	NA	NA	NA
QAW10557.1\|4096989_4097250_-	hypothetical protein	NA	NA	NA	NA
QAW10558.1\|4097303_4097564_-	hypothetical protein	NA	NA	NA	NA
QAW10559.1\|4097560_4097740_-	ICEBs1 excisionase	Q8SBM7	Clostridium_phage	5.4e-08	51.9
QAW10560.1\|4098036_4098420_+	XRE family transcriptional regulator	A0A2P1JU09	Anoxybacillus_phage	2.1e-20	44.4
QAW10561.1\|4098416_4098947_+	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
QAW10562.1\|4099059_4100256_-	tetratricopeptide repeat protein	A0A1P8CWN8	Bacillus_phage	5.0e-49	32.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP035403

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection