CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
CP035507	Haematobacter massiliensis strain OT1 plasmid pOT1-7, complete sequence	0 crisprs	WYL,cas3	0	0
CP035513	Haematobacter massiliensis strain OT1 plasmid pOT1-3, complete sequence	1 crisprs	NA	2	0
CP035508	Haematobacter massiliensis strain OT1 plasmid pOT1-8, complete sequence	0 crisprs	csa3	0	1
CP035506	Haematobacter massiliensis strain OT1 plasmid pOT1-6, complete sequence	0 crisprs	NA	0	0
CP035510	Haematobacter massiliensis strain OT1 chromosome, complete genome	0 crisprs	csa3,cas3,DEDDh	0	2
CP035509	Haematobacter massiliensis strain OT1 plasmid pOT1-9, complete sequence	0 crisprs	NA	0	0
CP035512	Haematobacter massiliensis strain OT1 plasmid pOT1-2, complete sequence	0 crisprs	DEDDh,WYL,RT	0	0
CP035515	Haematobacter massiliensis strain OT1 plasmid pOT1-5, complete sequence	0 crisprs	WYL,cas3	0	1
CP035511	Haematobacter massiliensis strain OT1 plasmid pOT1-1, complete sequence	0 crisprs	csa3	0	0
CP035514	Haematobacter massiliensis strain OT1 plasmid pOT1-4, complete sequence	0 crisprs	cas3,cas8e,cse2gr11,cas7,cas5,cas6e,cas1,cas2,csa3	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP035513_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP035513_1

277088-277236

Orphan

Consensus_repeat	Method
CCTCCGCCCGCGCGCATGTCGGTGTGGG	CRISPRCasFinder

2 spacers

The CRISPR arrays of CP035513_1

>merge|CP035513|1|277088-277236|CRISPRCasFinder
CCTCCTCCTGCGCGCGTTTCAATCCGGCGCTGGCGCCGATCCACACCCTTCCAAGGCGGGCCTCCGCCCGCGCGCATGTCGGTGTGGGTGATCTGACCGCGACCCGCAATGCGCTCAGGTCCCTCCGCCCGCGCGCATGTCGGTGTGGG

>CP035513|1|1|277088-277236|CRISPRCasFinder
CCTCCTCCTGCGCGCGTTTCAATCCGGC	GCTGGCGCCGATCCACACCCTTCCAAGGCGGG
CCTCCGCCCGCGCGCATGTCGGTGTGGG	TGATCTGACCGCGACCCGCAATGCGCTCAGGTC
CCTCCGCCCGCGCGCATGTCGGTGTGGG

Protein	Signature genes	Signature genes Name	Protein_function
CP035513.1\|QBJ26283.1\|283078_283603_-\|CAP-domain-containing-protein	unknown	unknown	gnl\|CDD\|349398
CP035513.1\|QBJ26273.1\|267869_268298_-\|DedA-family-protein	unknown	unknown	gnl\|CDD\|224159
CP035513.1\|QBJ26277.1\|276334_276877_-\|SRPBCC-family-protein	unknown	unknown	gnl\|CDD\|176863
CP035513.1\|QBJ26306.1\|278415_279306_+\|phosphatidylserine-decarboxylase	unknown	unknown	gnl\|CDD\|235400
CP035513.1\|QBJ26279.1\|279311_280076_+\|phosphatidylcholine/phosphatidylserine-synthase	unknown	unknown	gnl\|CDD\|224104
CP035513.1\|QBJ26270.1\|264484_265366_+\|3-methyl-2-oxobutanoate-hydroxymethyltransferase	unknown	unknown	gnl\|CDD\|234723
CP035513.1\|QBJ26272.1\|266552_266807_-\|hypothetical-protein	unknown	unknown	unknown
CP035513.1\|QBJ26275.1\|270402_273477_+\|efflux-RND-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|223911
CP035513.1\|QBJ26281.1\|281417_282065_+\|riboflavin-synthase	unknown	unknown	gnl\|CDD\|183846
CP035513.1\|QBJ26280.1\|280065_280686_+\|methyltransferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|225136
CP035513.1\|QBJ26282.1\|282086_283049_+\|carbohydrate-kinase	unknown	unknown	gnl\|CDD\|238572
CP035513.1\|QBJ26284.1\|283666_284992_-\|RepB-family-plasmid-replication-initiator-protein	unknown	unknown	gnl\|CDD\|376444
CP035513.1\|QBJ26276.1\|274913_276050_+\|RNA-methyltransferase	unknown	unknown	gnl\|CDD\|223194
CP035513.1\|QBJ26271.1\|265601_266477_+\|pantoate--beta-alanine-ligase	unknown	unknown	gnl\|CDD\|376824
CP035513.1\|QBJ26269.1\|263852_264326_-\|aminoacyl-tRNA-deacylase	unknown	unknown	gnl\|CDD\|237976
CP035513.1\|QBJ26274.1\|269320_270406_+\|efflux-RND-transporter-periplasmic-adaptor-subunit	unknown	unknown	gnl\|CDD\|273776
CP035513.1\|QBJ26268.1\|262524_263664_+\|YeeE/YedE-family-protein	unknown	unknown	gnl\|CDD\|377230

Protein	Function_ID	Function_description	E-value
CP035513.1\|QBJ26283.1\|283078_283603_-\|CAP-domain-containing-protein	gnl\|CDD\|349398	cd05379, CAP_bacterial, Bacterial CAP (cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 proteins) domain proteins. Little is known about bacterial and archaeal members of the CAP (cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 proteins) domain family. The wider family of CAP domain containing proteins includes plant pathogenesis-related protein 1 (PR-1), cysteine-rich secretory proteins (CRISPs), and allergen 5 from vespid venom, among others. Studies of eukaryotic proteins show that CAP domains have several functions, including the binding of cholesterol, lipids and heparan sulfate. This group includes Borrelia burgdorferi outer surface protein BB0689, which does not bind to cholesterol, lipids, or heparan sulfate, and whose function is unknown.	8.44737e-33
CP035513.1\|QBJ26273.1\|267869_268298_-\|DedA-family-protein	gnl\|CDD\|224159	COG1238, COG1238, Predicted membrane protein [Function unknown].	2.82662e-33
CP035513.1\|QBJ26277.1\|276334_276877_-\|SRPBCC-family-protein	gnl\|CDD\|176863	cd07821, PYR_PYL_RCAR_like, Pyrabactin resistance 1 (PYR1), PYR1-like (PYL), regulatory component of abscisic acid receptors (RCARs), and related proteins. The PYR/PYL/RCAR-like family belongs to the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. PYR/PYL/RCAR plant proteins are receptors involved in signal transduction. They bind abscisic acid (ABA) and mediate its signaling. ABA is a vital plant hormone, which regulates plant growth, development, and response to environmental stresses. Upon binding ABA, these plant proteins interact with a type 2C protein phosphatase (PP2C), such as ABI1 and ABI2, and inhibit their activity. When ABA is bound, a loop (designated the gate/CL2 loop) closes over the ligand binding pocket, resulting in the weakening of the inactive PYL dimer and facilitating type 2C protein phosphatase binding. In the ABA:PYL1:ABI1 complex, the gate blocks substrate access to the phosphatase active site. A conserved Trp from PP2C inserts into PYL to lock the receptor in a closed formation. This group also contains Methylobacterium extorquens AM1 MxaD. The mxaD gene is located within the mxaFJGIR(S)ACKLDEHB cluster which encodes proteins involved in methanol oxidation. MxaD may participate in the periplasmic electron transport chain for oxidation of methanol. Mutants lacking MxaD exhibit a reduced growth on methanol, and a lower rate of respiration with methanol.	1.65189e-29
CP035513.1\|QBJ26276.1\|274913_276050_+\|RNA-methyltransferase	gnl\|CDD\|223194	COG0116, COG0116, Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair].	4.32692e-79
CP035513.1\|QBJ26306.1\|278415_279306_+\|phosphatidylserine-decarboxylase	gnl\|CDD\|235400	PRK05305, PRK05305, phosphatidylserine decarboxylase family protein.	2.6219e-120
CP035513.1\|QBJ26270.1\|264484_265366_+\|3-methyl-2-oxobutanoate-hydroxymethyltransferase	gnl\|CDD\|234723	PRK00311, panB, 3-methyl-2-oxobutanoate hydroxymethyltransferase; Reviewed.	3.98557e-159
CP035513.1\|QBJ26275.1\|270402_273477_+\|efflux-RND-transporter-permease-subunit	gnl\|CDD\|223911	COG0841, AcrB, Cation/multidrug efflux pump [Defense mechanisms].	0
CP035513.1\|QBJ26281.1\|281417_282065_+\|riboflavin-synthase	gnl\|CDD\|183846	PRK13020, PRK13020, riboflavin synthase subunit alpha; Provisional.	3.90079e-99
CP035513.1\|QBJ26280.1\|280065_280686_+\|methyltransferase-domain-containing-protein	gnl\|CDD\|225136	COG2226, UbiE, Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism].	4.1686e-26
CP035513.1\|QBJ26282.1\|282086_283049_+\|carbohydrate-kinase	gnl\|CDD\|238572	cd01167, bac_FRK, Fructokinases (FRKs) mainly from bacteria and plants are enzymes with high specificity for fructose, as are all FRKs, but they catalyzes the conversion of fructose to fructose-6-phosphate, which is an entry point into glycolysis via conversion into glucose-6-phosphate. This is in contrast to FRKs [or ketohexokinases (KHKs)] from mammalia and halophilic archaebacteria, which phosphorylate fructose to fructose-1-phosphate.	1.45542e-83
CP035513.1\|QBJ26284.1\|283666_284992_-\|RepB-family-plasmid-replication-initiator-protein	gnl\|CDD\|376444	pfam01051, Rep_3, Initiator Replication protein. This protein is an initiator of plasmid replication. RepB possesses nicking-closing (topoisomerase I) like activity. It is also able to perform a strand transfer reaction on ssDNA that contains its target. This family also includes RepA which is an E.coli protein involved in plasmid replication. The RepA protein binds to DNA repeats that flank the repA gene.	1.2883e-40
CP035513.1\|QBJ26279.1\|279311_280076_+\|phosphatidylcholine/phosphatidylserine-synthase	gnl\|CDD\|224104	COG1183, PssA, Phosphatidylserine synthase [Lipid metabolism].	3.17117e-46
CP035513.1\|QBJ26271.1\|265601_266477_+\|pantoate--beta-alanine-ligase	gnl\|CDD\|376824	pfam02569, Pantoate_ligase, Pantoate-beta-alanine ligase. Pantoate-beta-alanine ligase, also know as pantothenate synthase, (EC:6.3.2.1) catalyzes the formation of pantothenate from pantoate and alanine.	7.38993e-154
CP035513.1\|QBJ26269.1\|263852_264326_-\|aminoacyl-tRNA-deacylase	gnl\|CDD\|237976	cd00002, YbaK_deacylase, This CD includes cysteinyl-tRNA(Pro) deacylases from Haemophilus influenzae and Escherichia coli and other related bacterial proteins. These trans-acting, single-domain proteins are homologs of ProX and also the cis-acting prolyl-tRNA synthetase (ProRS) inserted (INS) editing domain. The bacterial amino acid trans-editing enzyme YbaK is a deacylase that hydrolyzes cysteinyl-tRNA(Pro)'s mischarged by prolyl-tRNA synthetase. YbaK also hydrolyzes glycyl-tRNA's, alanyl-tRNA's, seryl-tRNA's, and prolyl-tRNA's. YbaK is homologous to the INS domain of prolyl-tRNA synthetase (ProRS) as well as the trans-editing enzyme ProX of Aeropyrum pernix which hydrolyzes alanyl-tRNA's and glycyl-tRNA's.	2.60774e-55
CP035513.1\|QBJ26274.1\|269320_270406_+\|efflux-RND-transporter-periplasmic-adaptor-subunit	gnl\|CDD\|273776	TIGR01730, COG0845:_Membrane-fusion_protein, RND family efflux transporter, MFP subunit. This model represents the MFP (membrane fusion protein) component of the RND family of transporters. RND refers to Resistance, Nodulation, and cell Division. It is, in part, a subfamily of pfam00529 (Pfam release 7.5) but hits substantial numbers of proteins missed by that model. The related HlyD secretion protein, for which pfam00529 is named, is outside the scope of this model. Attributed functions imply outward transport. These functions include nodulation, acriflavin resistance, heavy metal efflux, and multidrug resistance proteins. Most members of this family are found in Gram-negative bacteria. The proposed function of MFP proteins is to bring the inner and outer membranes together and enable transport to the outside of the outer membrane. Note, however, that a few members of this family are found in Gram-positive bacteria, where there is no outer membrane. [Transport and binding proteins, Unknown substrate].	5.4469e-67
CP035513.1\|QBJ26268.1\|262524_263664_+\|YeeE/YedE-family-protein	gnl\|CDD\|377230	pfam04143, Sulf_transp, Sulphur transport. This is an integral membrane protein. It is predicted to have a function in the transport of sulphur-containing molecules. It contains several conserved glycines and an invariant cysteine that is probably an important functional residue.	2.15309e-29

>CP035513.1|QBJ26277.1|276334_276877_-|SRPBCC-family-protein
MRKLVMVLTAGAALVFGAGLAEAHGPSRQKVVQEVTLNATPDEVWAVIGKFDDLSWYPRAKSVETVSGAEVKQDEQRTVTWDNGEQTTEELTKWNPERHTYSYRTVTDNIKALAVTNYSGIIAVKDEGGKAKVQWTGAFYRGFPNNDPPPELNDEAAIATVTAAHQMGLDALVEKFGAAN
>CP035513.1|QBJ26276.1|274913_276050_+|RNA-methyltransferase
MTTPFEIFLAAPPGLEPVLAEEAAEAGFPAPRVLEGGVAFDGGWEEVMRANLVLRGATRVLARIGAFRALHLAQLDKRARRFPWGEVLRTDMPVRVDVTSRRSRIYHAGAARERIETALRESAGIPVAAPRDKESEDPPEDAIALKIRIEDDLVTISVDTSGPSLHKRGHKEAVNKAPLRETLAALFLRQCGYTGAEPVVDPMCGSGTFVIEAAEIAAGLLPGRSRRFAFEDLACFDPVRWAALKETAAPRVPAVTFHGSDRDEGAIRMSTANAARAGVTDWTRFTRLPVSEARPPEGTPGLVMVNPPYGARLGNPKLLAGLYGALGQTLKQHFTGWRVGLITSEERLARTTGLRFLPPGPPVPHGSLRIRLYRTDPL
>CP035513.1|QBJ26275.1|270402_273477_+|efflux-RND-transporter-permease-subunit
MMGGFNLSSWALAHRSFVTLILVLAALAGGLSYLRLGRSEDPSFTIKTMVLQANWPGATMEDTLHQVTDRLERKLQELPDLDNLKSLTTPGQTIIYVTLSDETPPERVEDNWYQVRKKVADMGRELPSGVLGPFFNDEFGDTYGIIYAFTADPGFSERELRDVVDAARDRVLRLPGIGKAELIGTQDEKIWIEFSTRRLASLGIDPEAVIAQIQNQNAVVPAGEIVTSTDSTRLEVTGAFGSEAEIDNLTIATQSGVVRLDDIATVRRGPVDPAQPMFRDAGQPAIGLAMSMKEGGDVLALGRQIDTVIAEVKSDLPIGIDVSQVSNQTAVVQHAVSGFTRALAEAVVIVLAVSFVALGFRAGLVVFVSIPLSLMLVFLAMELYGIALQRVSLGALIIALGLLVDDAMITVEMMVSKLEEGMEKAKAAAYAWTSTAFPMLTGTLVTVAGFVPVGFAKSAAGEYANSLFWVIAFALILSWIVAVLASPIVGVWVLPARIKHKHEGEGRYIAAFRRFLTRALHWRWPIVIGTLLLFALSILGAMRLPQQFFPPSDRPELLLDLNLPQSASIERTRQVVTEVEKIVAAEAEVESFSFYVGEGAIRFYLPMDVLPPASYTAQGVLVTTATADRPALTARIQRALEDRFPDVLSRVAPLELGPPVGWPVQIRVSGEDLGAVRDLAWQVADVMGAAPGAVNVNLDWNEPARLIRIRVDQDRARLVGLSSSQLAQALLAVTSGVNITQIRDDIYLVDVVGRGAENERRDVDTLLALQIPLGGGRTVPLISVASFDYATSQPVVWRRDRLPTITVRADVANTTAEAMAAGIAPEIDRLAAANPEMRLETGGVVEESEKGLGSVVAVFPLMLILILVILMAQLQSVQLLVLVLSVVPLGLIGVVAALMITGLPVGFIAVLGIVALIGMIARNSVILVEQIEQHRAAGEDGWSALIDATVSRARPIVLTAAAAILGMIPIAREVFWAPLAFSVIGGLTVATVLTLVFLPALYALWFRLEPPPAASPSSPPSPSA
>CP035513.1|QBJ26274.1|269320_270406_+|efflux-RND-transporter-periplasmic-adaptor-subunit
MMSPARTLTAMLAAALLLLTACREEAAAPVVEGPRPVKTVTVAYTVVNSPGSLVGEVAPQIESDLGFRVGGKLAQRLVDVGDVVTAGEVLARLDIAQAQNTVRQAEANLAAATAQRENAEQTEKRTTDLLARGFATQAAADAATAQANVARANELAAQANVSDARDGLGYTDLVAPEAGVVMARGAEVGQVVAAGQMIVELARTDLKDAQFQAPGAVLGSGAEDAPVTVTLLDDPSIVARGRVREISPAADPVTRTFRVRVRIDNAPAAFRFGSAVRGMLELPGPKAAALPLSALFNTADRPAVWVVDAQGVVELTPVEVLRYEGERILISGGLEEGAKVVAAGVQRLRPGMQVRLPAGDV
>CP035513.1|QBJ26273.1|267869_268298_-|DedA-family-protein
MIAYLGLFAAAFVAATLLPMQSEAVLGALAHRGGHPLLLLWAVATAGNVLGSVVNYGLGRWLAQFEGRRWFPASPGQIRRAEGWYRRWGRWSLLASWLPLVGDPLTVVAGMLRERLSLFLLLVTLAKGGRYVAVIWIATGWN
>CP035513.1|QBJ26272.1|266552_266807_-|hypothetical-protein
MDIEESSPEILDNLASSTGGALVRYNYEATLTEVMGAEAAAEAASDEAARVLREEKKADRKAEREEKWEKTKEKFKSVFHKSDA
>CP035513.1|QBJ26271.1|265601_266477_+|pantoate--beta-alanine-ligase
MTILRHTADLRPRVAGWRRSGETVAVVPTMGALHEGHLSLVRAAKAVCERVIVTIFVNPRQFNSPEDYAKYPRTEEADAALLAPYGVDVVFVPEAEEMYPPGFATTVSITGITEPLEGAHRPGHFDGVATVVTKLLTMTGADRAFFGEKDWQQLLLVRRLVADLNLPVEIVGCPTVREEDALALSSRNLRLSADERRMAAALPEVLAAAILAIESGAPAAPALEDARSRLGAAGFERVEYLDLRDAETLSSARPGIPARLLVAAWAGNVRLIDNMPVNLPVPILERKSLRA
>CP035513.1|QBJ26270.1|264484_265366_+|3-methyl-2-oxobutanoate-hydroxymethyltransferase
MSATPQTPAPKGGARRLTPSDIRARKGGTPVVCLTAYTTPMARLVDKEADLILVGDSVGMVLHGMPSTLGVTMEMMILHGQAVARGVERAALVVDMPFGSYEEDPAQAFRNAARLMAETGAQAVKLEGGLHMAETVAFLTARGIPVMGHVGLTPQSVNAFGGYRVQGRGEDAARVRADAAALSEAGAFAVVLEKVPAALADKITAEIAVPTIGIGASVGCDGQVLVIDDMLGLFGDFRPKFVRRYAELGGAAAEAIAQYAADVQSRRFPGPEHVFASELPGTAGQVSAGKVTS
>CP035513.1|QBJ26269.1|263852_264326_-|aminoacyl-tRNA-deacylase
MSTATPATQALKRAGVAFRTIEYDYVAGQDRIGLHAAEAIGVPPERVLKTLMVEVDGKPACAVIPSDRTLSMKRVAAAFGGKSAHMMPPEKAERLTGFHTGGISPFGQKRRVPVAFEDTAAAAEVVINGGRRGLMVALAYADALRVAEGAARPLIAE
>CP035513.1|QBJ26268.1|262524_263664_+|YeeE/YedE-family-protein
MTTASSQLEGASSPIGEGAKRLLLILAALAAVFAVSLFAGARYGLLLAIGLGFGITLEGLHFGFAGPWRAMILRREPAGLLAQLLAIGLVALVAFPLLQSHPGELGGAEAPVGWAMVGGAFVFGAAMQVILGCGSGTLVNAGSGNAVSLVALPFFCLGSFLGAAHLLWWTDLGALPIIVLRGTSGLLVTLGLLAAVALVVFLIGKPGTRKLPPRLIFAALLLAALAVGNLVVAGQPWGVVYGLGLWAAKGAVALGADLSGNGFWGAPGNAARLQASILTDVTSLTNIGIILGAFLVAAWRRHGLSQPLPKLPARAWGAAIVAGLLLGYSSRLAFGCNVGAFFSGISTGSLHGWAWFAAGFAGSCLGVKLRPLVGLEARK
>CP035513.1|QBJ26306.1|278415_279306_+|phosphatidylserine-decarboxylase
MRSPTTGRSHGPLRGYSALPDTPGREPQSECWHRQTLANHVLGHSPSLRLAIEFRNPIWQTGETRPMRMTDTVLKPMHPEGWRFVGIFAVITALLFWLWEPLGWIGVVLTIWCYYFFRDPVRQVPEGEGLVISPADGMISQIATVLPPPELGMAAEPMTRISVFMSVFNVHVNRSPVSGVLKKMAYTKGKFVNASLDKASEHNERNALLIALPDGREIACVQIAGLVARRILPFVKEGDTLYAGRRFGLIRFGSRVDVYLPPGVTPLVAEGQTMIAGETVMADLTASLPPRPARAE
>CP035513.1|QBJ26279.1|279311_280076_+|phosphatidylcholine/phosphatidylserine-synthase
MARRPRADRVRQLALPQLLPNLLTLGAICAGLTSLRFAIAGRFGEAVGLIILAAILDALDGRMARMMGSESAIGAELDSLADFLNFGVVTGMLIYLSMLSDIANVGWIAVLVYVVGCVLRLARFNVDARSPAPGPSLGGFIGVPSPAGAMLAMLPLFLNEALPAGTKVPDILSAVWLAIVGFLLISRIPTPSLKKLKIRPEHLPYWVILLVAIIAVLFTWPWWTLIAADVAYLCVVGWSALRRLSKQGKSEHEA
>CP035513.1|QBJ26280.1|280065_280686_+|methyltransferase-domain-containing-protein
MRPDAVTSTYRRWAPIYDATFGRVTNAGRQRAAAHVSRRGGEVLEVGVGTGLVLPLYQGGVRVTGIDYSQEMLAKAEEKVTELSLSHVEGLHRMDARSLEFPDASFDTVAAMHVLSVVPEPEKVLCEMARVCRPGGQLVIVNHFTAEAGPLRALERLSTRFEDLLGWQSDFPIERVLGHPELDVAERESLPPFGMMTWLVLDRRGC
>CP035513.1|QBJ26281.1|281417_282065_+|riboflavin-synthase
MYTGIVQAVRPVTEIAAYPGGQSLTLEFTPDLLAELAIGASVSVEGVCLSVTRMEGTRVSFDAMDATLSRTNLSRLAAQGRANVERSAKQGAEVGGHIIAGHIATTAEIVEIETEADQAFLRFRVPAAWAKYIFPRGFLAVNGCSLTVADREDGGPEGDIFRINLIPETLRQTTFRDYRPGDLLNIEVDHATMVMVDTIERTVSRVLPDLLRRAA
>CP035513.1|QBJ26282.1|282086_283049_+|carbohydrate-kinase
MTARILCIGEALIDMVPRDLFGRTAFLPLAGGAVFNTAIAARRLGADVAFCCGLSTDMFGEQLAQALLRDGVDISPCPRSDRPTTLAFVSLTDGQARYSFFDENTAARMIQPTDLPDIGSDIGAVFLGGISLVSEPCATTIETFATRAAEAGRLMMLDPNIRPGFIRDETAYRARLDRLMRKAHVVKLSAEDMVWLLGPVTPAEGAAALHALGPRVVLVTEGAEGGSAHLAGGVTKVLPPEVTVADTVGAGDTFNAGFLASLADAGLLSPEGIAALTAATVAQHLEQAVYASCLSVTRIGANPPSREEMSIFRRGLARPA
>CP035513.1|QBJ26283.1|283078_283603_-|CAP-domain-containing-protein
MTRNILKPALGLAGFLALSACIIPVPLVVPGSSRGPSAPASQVSAPAGQGGDVLRLINAEREREGLHPLSWSDRLAASAADHASWIASTGTFSHTGQGGSSARDRMVARGYRGCDYAENISRGQPDAQAVVRGWMLSPGHRANNLRRSSYEAGAAMVRGSRGPVWVINFGAPCG
>CP035513.1|QBJ26284.1|283666_284992_-|RepB-family-plasmid-replication-initiator-protein
MAASRPEARHTVMQRTLAPRGPDRQSGDTLPSDRLTGALRRQSVKKNVAAIHVSGKLTLLQRKLSNVLLLNAYDTLISRPKHTIDARTLSLMIGYNSNDTATLRDALRGLAETVAEWDMLDEKGRQEWGVSSLLSYAKLKGGICEYAYSPALAEKLHDPKVFALINLNIQKRFTSGHGLALYENCYRFVRTGSTGWWPLETFRRLMGVEESDYYRTFKHLNAKVIRPAVGEVNRTSNIQITPEFHRKGRAVAELRFLIRENPQLGVIDTEEGEEFTHSPVYERLLGQGISDRLARQWIGEHGEDVISEKLAAVAGRSGVRNPAGYLRVALRQPVTVAVEEPSEAARIAAARRATSQAETDAEDEARAAERLARRARFAAVEAAVSRRNPTQRDADRRLFLARLEGELEREDFRRFGWSSALNARAIFAFWEEMAPGLFDDI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP035513_1	1.1\|277116\|32\|CP035513\|CRISPRCasFinder	277116-277147	32	NZ_CP035513	Haematobacter massiliensis strain OT1 plasmid pOT1-3, complete sequence	277116-277147	0	1.0
CP035513_1	1.2\|277176\|33\|CP035513\|CRISPRCasFinder	277176-277208	33	NZ_CP035513	Haematobacter massiliensis strain OT1 plasmid pOT1-3, complete sequence	277176-277208	0	1.0

1. spacer 1.1|277116|32|CP035513|CRISPRCasFinder matches to NZ_CP035513 (Haematobacter massiliensis strain OT1 plasmid pOT1-3, complete sequence) position: , mismatch: 0, identity: 1.0

gctggcgccgatccacacccttccaaggcggg	CRISPR spacer
gctggcgccgatccacacccttccaaggcggg	Protospacer
********************************

2. spacer 1.2|277176|33|CP035513|CRISPRCasFinder matches to NZ_CP035513 (Haematobacter massiliensis strain OT1 plasmid pOT1-3, complete sequence) position: , mismatch: 0, identity: 1.0

tgatctgaccgcgacccgcaatgcgctcaggtc	CRISPR spacer
tgatctgaccgcgacccgcaatgcgctcaggtc	Protospacer
*********************************

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

161870 : 168992

Phage_NCTB(16.67%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QBJ23232.1\|161870_162329_+	NUDIX hydrolase	A0A1C3NEZ8	Phage_NCTB	4.1e-07	33.0
QBJ23233.1\|162350_163820_+	inorganic phosphate transporter	G9E3M1	Emiliania_huxleyi_virus	3.6e-12	30.8
QBJ23234.1\|163822_165115_-	nicotinate phosphoribosyltransferase	A0A2L0UZQ6	Agrobacterium_phage	1.1e-126	52.7
QBJ23235.1\|165116_165725_-	bifunctional nicotinamidase/pyrazinamidase	A0A2K9L6K4	Tupanvirus	2.8e-27	40.1
QBJ23236.1\|165758_167288_-	2-polyprenylphenol 6-hydroxylase	A0A2P0VMP1	Tetraselmis_virus	6.5e-17	23.6
QBJ23237.1\|167288_168038_-	bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase UbiE	NA	NA	NA	NA
QBJ23238.1\|168110_168992_+	bifunctional DNA-formamidopyrimidine glycosylase/DNA-(apurinic or apyrimidinic site) lyase	G3MA33	Bacillus_virus	7.3e-29	30.1

DBSCAN-SWA_2

1069535 : 1137502

Paracoccus_phage(13.33%)

tail,tRNA,head,integrase,protease,capsid,transposase,portal

attL 1069512:1069529|attR 1083972:1083989

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1069512:1069529	attL	NA	NA	NA	NA
QBJ24005.1\|1069535_1070876_+\|integrase	site-specific integrase	A0A088F800	Sulfitobacter_phage	5.6e-81	44.8
QBJ24006.1\|1070872_1071772_+	hypothetical protein	NA	NA	NA	NA
QBJ24007.1\|1071928_1072162_+	AlpA family transcriptional regulator	NA	NA	NA	NA
QBJ24008.1\|1072268_1072544_+	hypothetical protein	NA	NA	NA	NA
QBJ24009.1\|1072540_1072756_+	hypothetical protein	NA	NA	NA	NA
QBJ24010.1\|1072847_1073441_+	hypothetical protein	NA	NA	NA	NA
QBJ24011.1\|1073485_1074379_-	hypothetical protein	U5N3V8	Enterobacteria_phage	1.4e-32	33.7
QBJ25310.1\|1074375_1075893_-\|transposase	IS21 family transposase	NA	NA	NA	NA
QBJ24012.1\|1076064_1076376_+	hypothetical protein	NA	NA	NA	NA
QBJ24013.1\|1076372_1077869_+	DUF3987 domain-containing protein	NA	NA	NA	NA
QBJ24014.1\|1077865_1078276_+	hypothetical protein	NA	NA	NA	NA
QBJ24015.1\|1078272_1079202_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
QBJ24016.1\|1079278_1079554_+	hypothetical protein	NA	NA	NA	NA
QBJ24017.1\|1080473_1080905_-	hypothetical protein	NA	NA	NA	NA
QBJ24018.1\|1080901_1081147_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
QBJ24019.1\|1081248_1081551_+	hypothetical protein	NA	NA	NA	NA
QBJ24020.1\|1081604_1081826_+	hypothetical protein	NA	NA	NA	NA
QBJ24021.1\|1081822_1082278_+	hypothetical protein	NA	NA	NA	NA
QBJ24022.1\|1082274_1082499_+	hypothetical protein	NA	NA	NA	NA
QBJ24023.1\|1082522_1082828_+	hypothetical protein	NA	NA	NA	NA
QBJ24024.1\|1083105_1083579_-	thermonuclease family protein	A0A0R6PHV6	Moraxella_phage	4.2e-07	32.9
QBJ24025.1\|1084125_1084317_-	DNA gyrase inhibitor YacG	NA	NA	NA	NA
1083972:1083989	attR	NA	NA	NA	NA
QBJ24026.1\|1084327_1085374_-	ribonuclease G	NA	NA	NA	NA
QBJ24027.1\|1085370_1085946_-	septum formation inhibitor Maf	NA	NA	NA	NA
QBJ24028.1\|1085945_1086164_-	translation initiation factor IF-1	NA	NA	NA	NA
QBJ24029.1\|1086441_1088931_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
QBJ24030.1\|1089188_1090430_+	MFS transporter	A0A2H4UVM2	Bodo_saltans_virus	1.2e-05	18.9
QBJ24031.1\|1090595_1092413_-	translational GTPase TypA	NA	NA	NA	NA
QBJ24032.1\|1092822_1094745_-	selenocysteine-specific translation elongation factor	A0A2K9KZ60	Tupanvirus	6.3e-17	29.9
QBJ24033.1\|1094741_1096115_-\|tRNA	L-seryl-tRNA(Sec) selenium transferase	NA	NA	NA	NA
QBJ24034.1\|1096124_1097051_-	formate dehydrogenase accessory protein FdhE	NA	NA	NA	NA
QBJ24035.1\|1097091_1097787_-	formate dehydrogenase subunit gamma	NA	NA	NA	NA
QBJ24036.1\|1097863_1098850_-	formate dehydrogenase subunit beta	NA	NA	NA	NA
QBJ24037.1\|1098846_1101942_-	formate dehydrogenase-N subunit alpha	NA	NA	NA	NA
QBJ24038.1\|1102726_1103710_-	aldo/keto reductase	NA	NA	NA	NA
QBJ24039.1\|1103706_1104426_-	purine-nucleoside phosphorylase	NA	NA	NA	NA
QBJ24040.1\|1104592_1105237_-	adenosylcobinamide amidohydrolase	NA	NA	NA	NA
QBJ24041.1\|1105553_1107011_+	amidase	NA	NA	NA	NA
QBJ24042.1\|1108076_1108850_-	heme ABC transporter ATP-binding protein	A0A1V0SE00	Indivirus	3.4e-06	24.9
QBJ24043.1\|1108846_1109920_-	iron ABC transporter permease	NA	NA	NA	NA
QBJ25311.1\|1109921_1110746_-	hemin ABC transporter substrate-binding protein	NA	NA	NA	NA
QBJ24044.1\|1111326_1112364_-	hemin-degrading factor	NA	NA	NA	NA
QBJ24045.1\|1112534_1114643_+	TonB-dependent receptor	NA	NA	NA	NA
QBJ24046.1\|1114835_1115465_+\|protease	ATP-dependent Clp protease proteolytic subunit	A0A223W000	Agrobacterium_phage	1.7e-56	57.6
QBJ24047.1\|1115603_1116869_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	2.4e-134	58.8
QBJ25312.1\|1117421_1117727_-	ArsR family transcriptional regulator	NA	NA	NA	NA
QBJ24048.1\|1117819_1119067_+	DUF4147 domain-containing protein	NA	NA	NA	NA
QBJ24049.1\|1119073_1119559_-	flavin reductase	NA	NA	NA	NA
QBJ24050.1\|1119621_1120557_-	DUF1045 domain-containing protein	NA	NA	NA	NA
QBJ24051.1\|1120519_1121587_-	hypothetical protein	NA	NA	NA	NA
QBJ24052.1\|1121933_1123277_-	ATP-binding protein	A0A1V0DY66	Dinoroseobacter_phage	6.7e-74	38.8
QBJ24053.1\|1123227_1123632_-	hypothetical protein	NA	NA	NA	NA
QBJ24054.1\|1123877_1124978_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
QBJ24055.1\|1125055_1125595_+	TRAP transporter small permease subunit	NA	NA	NA	NA
QBJ24056.1\|1125612_1127103_+	TRAP transporter large permease subunit	NA	NA	NA	NA
QBJ24057.1\|1127243_1127588_+	hypothetical protein	NA	NA	NA	NA
QBJ24058.1\|1128500_1129685_+\|portal	phage portal protein	W8ECU7	Geobacillus_phage	2.4e-59	36.9
QBJ24059.1\|1129689_1129929_+	hypothetical protein	NA	NA	NA	NA
QBJ24060.1\|1129940_1130522_+\|head,protease	HK97 family phage prohead protease	A0A0U2BX10	Paracoccus_phage	8.5e-34	56.5
QBJ24061.1\|1130518_1131676_+\|capsid	phage major capsid protein	B0VK33	Azospirillum_phage	5.4e-64	42.4
QBJ24062.1\|1131899_1132490_+	hypothetical protein	NA	NA	NA	NA
QBJ24063.1\|1132486_1132819_+\|head,tail	head-tail adaptor protein	NA	NA	NA	NA
QBJ24064.1\|1132815_1133232_+	DUF3168 domain-containing protein	NA	NA	NA	NA
QBJ24065.1\|1133569_1133977_+\|tail	phage major tail protein, TP901-1 family	A0A1J0GWA1	Alteromonas_phage	4.4e-05	28.7
QBJ24066.1\|1133976_1134291_+	gene transfer agent family protein	NA	NA	NA	NA
QBJ25313.1\|1134283_1134598_+\|tail	phage tail assembly chaperone	NA	NA	NA	NA
QBJ24067.1\|1134584_1135238_+\|tail	phage tail tape measure protein	A0A0S2SYD9	Pseudomonas_phage	6.6e-11	54.9
QBJ24068.1\|1135248_1135872_+	TIGR02217 family protein	A0A0B5A2K3	Paracoccus_phage	1.4e-58	51.2
QBJ24069.1\|1136473_1137502_-\|transposase	IS110 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. CP035508

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

20588 : 79419

Streptococcus_phage(20.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QBJ22974.1\|20588_21944_-\|transposase	IS1380-like element ISPme1 family transposase	A0A1X9I6F6	Streptococcus_phage	3.8e-45	29.0
QBJ22975.1\|21998_22211_-	hypothetical protein	NA	NA	NA	NA
QBJ22976.1\|22443_22770_-	hypothetical protein	NA	NA	NA	NA
QBJ22977.1\|22987_24598_-	Na/Pi cotransporter family protein	NA	NA	NA	NA
QBJ22978.1\|24599_25805_-	sodium/glutamate symporter	NA	NA	NA	NA
QBJ22979.1\|25892_26657_-	enoyl-[acyl-carrier-protein] reductase FabI	NA	NA	NA	NA
QBJ22980.1\|26653_27823_-	acetate/propionate family kinase	NA	NA	NA	NA
QBJ22981.1\|27819_29214_-	bifunctional enoyl-CoA hydratase/phosphate acetyltransferase	NA	NA	NA	NA
QBJ22982.1\|29218_31027_-	alpha/beta fold hydrolase	NA	NA	NA	NA
QBJ22983.1\|31310_32666_-\|transposase	IS1380-like element ISPme1 family transposase	A0A1X9I6F6	Streptococcus_phage	3.8e-45	29.0
QBJ22984.1\|32720_33137_-	disulfide bond formation protein B	NA	NA	NA	NA
QBJ22985.1\|33129_33612_-	signal peptidase II	NA	NA	NA	NA
QBJ22986.1\|33608_34226_-	isoprenylcysteine carboxylmethyltransferase family protein	NA	NA	NA	NA
QBJ22987.1\|34231_36616_-	cadmium-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	1.7e-125	42.4
QBJ22988.1\|36962_38612_+	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	2.4e-09	22.3
QBJ22989.1\|38608_40327_+	ATP-binding cassette domain-containing protein	A0A2R8FG22	Brazilian_cedratvirus	5.6e-09	29.7
QBJ22990.1\|40316_41921_+	cytochrome bd-I ubiquinol oxidase subunit CydA	NA	NA	NA	NA
QBJ22991.1\|41928_43089_+	cytochrome d ubiquinol oxidase subunit II	NA	NA	NA	NA
QBJ22992.1\|43108_43225_+	cytochrome bd-I oxidase subunit CydX	NA	NA	NA	NA
QBJ22993.1\|43359_44277_+	cation transporter	A0A1V0SED0	Indivirus	2.3e-09	33.9
QBJ22994.1\|44550_44940_-	single-stranded DNA-binding protein	R9TP78	Rhizobium_phage	2.6e-07	31.3
QBJ22995.1\|44948_45974_-	type IV secretion system protein	NA	NA	NA	NA
QBJ22996.1\|45973_46201_-	hypothetical protein	NA	NA	NA	NA
QBJ22997.1\|46401_47406_-	type II secretion system protein E	NA	NA	NA	NA
QBJ22998.1\|47405_48719_-	conjugal transfer protein	NA	NA	NA	NA
QBJ22999.1\|48715_49441_-	conjugal transfer protein TrbG	NA	NA	NA	NA
QBJ23031.1\|49437_50085_-	type IV secretion system protein	NA	NA	NA	NA
QBJ23000.1\|50099_50870_-	conjugal transfer protein TraF	NA	NA	NA	NA
QBJ23001.1\|50866_52024_-	lytic transglycosylase domain-containing protein	A0A1P8CWQ1	Bacillus_phage	5.3e-27	52.7
QBJ23002.1\|52028_52238_-	hypothetical protein	NA	NA	NA	NA
QBJ23032.1\|52909_54427_+\|transposase	IS21 family transposase	NA	NA	NA	NA
QBJ23003.1\|54423_55317_+	hypothetical protein	A0A059NT77	Lactococcus_phage	8.7e-30	34.0
QBJ23004.1\|57270_57549_-	type IV secretion system protein VirB3	NA	NA	NA	NA
QBJ23005.1\|57561_57849_-	VIRB2 type IV secretion	NA	NA	NA	NA
QBJ23006.1\|57848_58571_-	lytic transglycosylase domain-containing protein	A0A0H3V0Q1	Geobacillus_virus	2.1e-18	53.7
QBJ23007.1\|58512_58848_-	hypothetical protein	NA	NA	NA	NA
QBJ23033.1\|59074_59311_+	hypothetical protein	NA	NA	NA	NA
QBJ23008.1\|59413_60085_+	hypothetical protein	NA	NA	NA	NA
QBJ23009.1\|60314_61151_+	hypothetical protein	NA	NA	NA	NA
QBJ23010.1\|61481_62309_+	ArsR family transcriptional regulator	NA	NA	NA	NA
QBJ23011.1\|62319_63330_+	ArsJ-associated glyceraldehyde-3-phosphate dehydrogenase	NA	NA	NA	NA
QBJ23012.1\|63329_64613_+	organoarsenical effux MFS transporter ArsJ	NA	NA	NA	NA
QBJ23013.1\|64829_65159_-	ArsR family transcriptional regulator	NA	NA	NA	NA
QBJ23014.1\|65201_65732_+	hypothetical protein	NA	NA	NA	NA
QBJ23015.1\|65739_66171_+	arsenate reductase (glutaredoxin)	A0A2H4J8T1	uncultured_Caudovirales_phage	1.5e-48	69.3
QBJ23016.1\|66187_67264_+	ACR3 family arsenite efflux transporter	NA	NA	NA	NA
QBJ23017.1\|67260_67968_+	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	1.0e-86	69.4
QBJ23018.1\|67931_69170_+	MFS transporter	NA	NA	NA	NA
QBJ23019.1\|69282_70311_+\|transposase	IS110 family transposase	NA	NA	NA	NA
QBJ23034.1\|70844_72362_+\|transposase	IS21 family transposase	NA	NA	NA	NA
QBJ23020.1\|72358_73252_+	hypothetical protein	A0A059NT77	Lactococcus_phage	8.7e-30	34.0
QBJ23035.1\|73731_74589_-	hypothetical protein	NA	NA	NA	NA
QBJ23021.1\|74591_75671_-	hypothetical protein	NA	NA	NA	NA
QBJ23022.1\|75780_76368_-	recombinase family protein	A0A0A7NPV4	Enterobacteria_phage	8.6e-26	38.5
QBJ23023.1\|76533_79419_+\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	5.4e-182	37.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. CP035515

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

49356 : 177856

108

Bacillus_phage(12.5%)

transposase,protease,integrase

attL 48779:48796|attR 148435:148451

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
48779:48796	attL	NA	NA	NA	NA
QBJ26504.1\|49356_50604_+\|integrase	integrase	A0A1B1P7C7	Bacillus_phage	6.7e-12	27.5
48779:48796	attL	NA	NA	NA	NA
QBJ26505.1\|50600_51557_+\|integrase	integrase	NA	NA	NA	NA
QBJ26506.1\|51543_52539_+\|integrase	integrase	NA	NA	NA	NA
QBJ26507.1\|52590_54306_-	urease subunit alpha	NA	NA	NA	NA
QBJ26508.1\|54316_55072_-	urease subunit beta	NA	NA	NA	NA
QBJ26509.1\|55252_55699_-	nickel-responsive transcriptional regulator NikR	NA	NA	NA	NA
QBJ26608.1\|55802_56858_-	DNA primase	I6S1U6	Salmonella_phage	3.0e-05	28.4
56283:56300	attR	NA	NA	NA	NA
QBJ26510.1\|57026_57827_+	DNA primase	A0A0H5AWB1	Pseudomonas_phage	2.9e-16	34.1
56283:56300	attR	NA	NA	NA	NA
QBJ26511.1\|58307_59336_-\|transposase	IS110 family transposase	NA	NA	NA	NA
QBJ26512.1\|59552_60485_+	DUF2493 domain-containing protein	NA	NA	NA	NA
QBJ26513.1\|60629_60842_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
QBJ26514.1\|60841_61222_+	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
QBJ26515.1\|61785_62367_+\|transposase	transposase	NA	NA	NA	NA
QBJ26516.1\|62353_64687_+	endonuclease	NA	NA	NA	NA
QBJ26609.1\|64695_66684_+	type VI secretion protein	NA	NA	NA	NA
QBJ26517.1\|66837_67911_+	DUF4297 domain-containing protein	NA	NA	NA	NA
QBJ26518.1\|67946_68525_+	hypothetical protein	NA	NA	NA	NA
QBJ26519.1\|68528_69680_+	hypothetical protein	NA	NA	NA	NA
QBJ26520.1\|69844_70921_-	type IV secretion system protein	NA	NA	NA	NA
QBJ26521.1\|70933_71353_-	hypothetical protein	NA	NA	NA	NA
QBJ26522.1\|71349_71544_-	hypothetical protein	NA	NA	NA	NA
QBJ26523.1\|71530_72526_-	type II secretion system protein E	NA	NA	NA	NA
QBJ26524.1\|72530_73910_-	TrbI/VirB10 family protein	NA	NA	NA	NA
QBJ26525.1\|73906_74599_-	conjugal transfer protein TrbG	NA	NA	NA	NA
QBJ26526.1\|74602_75256_-	type IV secretion system protein	NA	NA	NA	NA
QBJ26610.1\|75272_76061_-	conjugal transfer protein TraF	NA	NA	NA	NA
QBJ26611.1\|76081_77170_-	lytic transglycosylase domain-containing protein	A0A1P8CWQ1	Bacillus_phage	1.7e-27	57.7
QBJ26527.1\|77398_79774_-	type IV secretion system protein B4	NA	NA	NA	NA
QBJ26528.1\|79763_80042_-	type IV secretion system protein VirB3	NA	NA	NA	NA
QBJ26529.1\|80034_80328_-	VIRB2 type IV secretion	NA	NA	NA	NA
QBJ26530.1\|80324_80945_-	lytic transglycosylase domain-containing protein	A0A1P8CWQ1	Bacillus_phage	3.7e-19	51.5
QBJ26531.1\|80988_81372_-	hypothetical protein	NA	NA	NA	NA
QBJ26612.1\|81582_81834_+	hypothetical protein	NA	NA	NA	NA
QBJ26532.1\|81958_82216_+	XRE family transcriptional regulator	NA	NA	NA	NA
QBJ26533.1\|82387_82612_+	hypothetical protein	NA	NA	NA	NA
QBJ26613.1\|82719_83070_-	hypothetical protein	NA	NA	NA	NA
QBJ26534.1\|83597_84077_-	thermonuclease family protein	A0A218ML12	uncultured_virus	3.0e-05	33.7
QBJ26535.1\|84346_85207_+	WYL domain-containing transcriptional regulator	NA	NA	NA	NA
QBJ26536.1\|85280_88232_+	DEAD/DEAH box helicase	A0A1B1IUI1	uncultured_Mediterranean_phage	9.9e-46	27.5
QBJ26537.1\|88236_93180_+	class I SAM-dependent DNA methyltransferase	A0A1B1IUC6	uncultured_Mediterranean_phage	5.8e-06	20.4
QBJ26538.1\|93176_94025_+	hypothetical protein	NA	NA	NA	NA
QBJ26539.1\|94051_100453_+	DEAD/DEAH box helicase	A0A1B1IUF6	uncultured_Mediterranean_phage	4.4e-67	23.0
QBJ26540.1\|100449_102621_+	DNA helicase	S5MMD7	Bacillus_phage	9.3e-09	23.7
QBJ26541.1\|102791_103472_+	MerR family transcriptional regulator	NA	NA	NA	NA
QBJ26542.1\|103464_104745_+	VWA domain-containing protein	NA	NA	NA	NA
QBJ26543.1\|104862_105468_+	recombinase family protein	A0A0C4UR34	Shigella_phage	3.9e-42	53.1
QBJ26544.1\|105553_106165_-	recombinase family protein	A0A0A7NPV4	Enterobacteria_phage	1.6e-35	50.5
QBJ26545.1\|106285_109168_+\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	1.3e-178	37.6
QBJ26546.1\|109205_112154_+\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	8.3e-186	39.2
QBJ26547.1\|112160_112937_-	phosphonate metabolism transcriptional regulator PhnF	NA	NA	NA	NA
QBJ26548.1\|112950_114117_-	alpha-D-ribose 1-methylphosphonate 5-triphosphate diphosphatase	NA	NA	NA	NA
QBJ26549.1\|114235_115093_+	phosphonate-binding protein	NA	NA	NA	NA
QBJ26550.1\|115172_115919_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	7.5e-27	36.7
QBJ26551.1\|115911_116703_+	phosphonate ABC transporter, permease protein PhnE	NA	NA	NA	NA
QBJ26552.1\|117102_117777_-	chloramphenicol acetyltransferase	M1GXE1	Acanthocystis_turfacea_Chlorella_virus	7.8e-07	52.2
QBJ26553.1\|117773_118634_-	phosphonate ABC transporter, permease protein PhnE	NA	NA	NA	NA
QBJ26554.1\|118633_119560_-	phosphonate ABC transporter, permease protein PhnE	NA	NA	NA	NA
QBJ26555.1\|120548_121355_-	phosphonate ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.0e-21	34.6
QBJ26556.1\|121418_121814_+	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
QBJ26557.1\|121810_122158_+	IS66 family insertion sequence hypothetical protein	A0A0P0ZDM8	Stx2-converting_phage	6.4e-37	61.7
QBJ26558.1\|122216_123716_+\|transposase	IS66 family transposase	A0A0P0ZBS5	Stx2-converting_phage	2.6e-111	44.3
QBJ26559.1\|123908_125078_-	alpha-D-ribose 1-methylphosphonate 5-triphosphate diphosphatase	NA	NA	NA	NA
QBJ26560.1\|125064_125772_-	ATP-binding cassette domain-containing protein	A0A1J0FA64	Only_Syngen_Nebraska_virus	7.4e-08	32.6
QBJ26561.1\|125779_126595_-	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	5.0e-08	23.8
QBJ26562.1\|126591_127506_-	carbon-phosphorus lyase complex subunit PhnJ	NA	NA	NA	NA
QBJ26563.1\|127502_128588_-	phosphonate metabolism protein PhnI	NA	NA	NA	NA
QBJ26564.1\|128587_129145_-	phosphonate C-P lyase system protein PhnH	NA	NA	NA	NA
QBJ26565.1\|129144_129600_-	phosphonate C-P lyase system protein PhnG	NA	NA	NA	NA
QBJ26566.1\|129596_130343_-	phosphonate metabolism transcriptional regulator PhnF	NA	NA	NA	NA
QBJ26614.1\|130698_131844_-\|integrase	site-specific integrase	NA	NA	NA	NA
QBJ26567.1\|131833_132253_-	PIN domain-containing protein	NA	NA	NA	NA
QBJ26568.1\|132252_132492_-	type II toxin-antitoxin system prevent-host-death family antitoxin	NA	NA	NA	NA
QBJ26569.1\|132752_133037_-	hypothetical protein	NA	NA	NA	NA
QBJ26570.1\|133434_133857_-	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
QBJ26571.1\|133853_134120_-	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
QBJ26615.1\|134208_135342_-\|integrase	site-specific integrase	NA	NA	NA	NA
QBJ26572.1\|135467_136421_+	DUF1403 family protein	NA	NA	NA	NA
QBJ26573.1\|136423_137134_+	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	7.2e-19	30.5
QBJ26574.1\|137143_137776_-	hypothetical protein	NA	NA	NA	NA
QBJ26575.1\|139112_140612_+\|transposase	IS21 family transposase	A0A2L1IVA1	Escherichia_phage	1.8e-19	28.6
QBJ26576.1\|140613_141348_+\|transposase	transposase	A0A059NT77	Lactococcus_phage	5.9e-32	32.9
QBJ26616.1\|141460_141907_+\|transposase	transposase	Q88285	Snakehead_retrovirus	4.8e-05	32.9
QBJ26577.1\|141980_142265_+	hypothetical protein	NA	NA	NA	NA
QBJ26617.1\|142567_143329_-	phosphonate metabolism transcriptional regulator PhnF	NA	NA	NA	NA
QBJ26578.1\|143461_143977_+	phosphonate C-P lyase system protein PhnG	NA	NA	NA	NA
QBJ26579.1\|143976_144588_+	phosphonate C-P lyase system protein PhnH	NA	NA	NA	NA
QBJ26580.1\|144591_145761_+	carbon-phosphorus lyase complex subunit PhnI	NA	NA	NA	NA
QBJ26581.1\|145757_146651_+	carbon-phosphorus lyase	NA	NA	NA	NA
QBJ26618.1\|146659_147436_+	phosphonate C-P lyase system protein PhnK	A0A2H4PQG7	Staphylococcus_phage	2.6e-14	28.2
QBJ26582.1\|147503_148223_+	phosphonate C-P lyase system protein PhnL	A0A2R8FG22	Brazilian_cedratvirus	1.4e-09	27.8
QBJ26583.1\|148219_148876_+	acetyltransferase	NA	NA	NA	NA
QBJ26584.1\|148868_150008_+	alpha-D-ribose 1-methylphosphonate 5-triphosphate diphosphatase	NA	NA	NA	NA
QBJ26619.1\|150013_150592_+	phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN	NA	NA	NA	NA
QBJ26585.1\|151176_154152_-\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	1.6e-192	38.1
QBJ26586.1\|154307_154901_+	recombinase family protein	A0A219Y912	Aeromonas_phage	9.9e-22	34.6
QBJ26587.1\|154941_155610_-	acetyltransferase	M1GXE1	Acanthocystis_turfacea_Chlorella_virus	3.1e-08	43.6
QBJ26588.1\|155686_156589_-	phosphotransferase	NA	NA	NA	NA
QBJ26589.1\|156603_157722_-	ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	3.2e-21	52.1
QBJ26590.1\|157739_158564_-	ABC transporter permease subunit	NA	NA	NA	NA
QBJ26591.1\|158560_159457_-	ABC transporter permease subunit	NA	NA	NA	NA
QBJ26592.1\|159443_160580_-	extracellular solute-binding protein	NA	NA	NA	NA
QBJ26593.1\|160834_167146_-	hypothetical protein	NA	NA	NA	NA
QBJ26594.1\|167376_171594_-	hypothetical protein	NA	NA	NA	NA
QBJ26595.1\|171688_174961_-	TM0106 family RecB-like putative nuclease	A0A1L3KIW1	Beihai_Nido-like_virus	5.5e-05	24.7
QBJ26596.1\|175118_175388_-	hypothetical protein	NA	NA	NA	NA
QBJ26597.1\|175527_176502_+	WYL domain-containing protein	NA	NA	NA	NA
QBJ26620.1\|176598_177192_+	hypothetical protein	NA	NA	NA	NA
QBJ26598.1\|177274_177856_-\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP035513

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. CP035510

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. CP035508

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. CP035515

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection