CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP029609	Bacillus subtilis subsp. subtilis strain G7 chromosome, complete genome	1 crisprs	csa3,cas3,DEDDh,WYL,DinG	0	1	10	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP029609_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP029609_2

3115121-3115228

Orphan

Consensus_repeat	Method
TGATGGGAATCGAACCCACGACAT	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP029609_2

>merge|CP029609|2|3115121-3115228|CRISPRCasFinder
TGATGGGAATCGAACCCACGACATCAGCTTGGAAGGCTGAGGTTTTACCACTAAACTACACCCGCAATTTTTATTTGGGGCGATTGATGGGAATCGAACCCACGAATG

>CP029609|2|2|3115121-3115228|CRISPRCasFinder
TGATGGGAATCGAACCCACGACAT	CAGCTTGGAAGGCTGAGGTTTTACCACTAAACTACACCCGCAATTTTTATTTGGGGCGAT
TGATGGGAATCGAACCCACGAATG

Protein	Signature genes	Signature genes Name	Protein_function
CP029609.1\|QBJ83482.1\|3108983_3110438_-\|glycogen-synthase-GlgA	unknown	unknown	gnl\|CDD\|234809
CP029609.1\|QBJ83487.1\|3122788_3123310_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|224168
CP029609.1\|QBJ83492.1\|3129625_3130168_+\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|224427
CP029609.1\|QBJ83489.1\|3125569_3126058_+\|DinB-family-protein	unknown	unknown	gnl\|CDD\|378981
CP029609.1\|QBJ83488.1\|3123327_3124857_-\|flotillin-family-protein	unknown	unknown	gnl\|CDD\|225177
CP029609.1\|QBJ83485.1\|3112628_3114512_-\|1,4-alpha-glucan-branching-enzyme	unknown	unknown	gnl\|CDD\|273667
CP029609.1\|QBJ83493.1\|3130365_3130911_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379999
CP029609.1\|QBJ83486.1\|3122168_3122747_+\|thiamine-transporter-ThiT	unknown	unknown	gnl\|CDD\|226377
CP029609.1\|QBJ84686.1\|3126729_3127938_-\|alcohol-dehydrogenase-EutG	unknown	unknown	gnl\|CDD\|341481
CP029609.1\|QBJ83481.1\|3106600_3108997_-\|glycogen-phosphorylase	unknown	unknown	gnl\|CDD\|273967
CP029609.1\|QBJ83484.1\|3111489_3112632_-\|glucose-1-phosphate-adenylyltransferase	unknown	unknown	gnl\|CDD\|179997
CP029609.1\|QBJ83477.1\|3102197_3102554_-\|hypothetical-protein	unknown	unknown	unknown
CP029609.1\|QBJ83480.1\|3104948_3106022_+\|CotS-family-spore-coat-protein	unknown	unknown	gnl\|CDD\|131952
CP029609.1\|QBJ83478.1\|3102555_3103611_-\|spore-coat-protein-S	unknown	unknown	gnl\|CDD\|131952
CP029609.1\|QBJ83491.1\|3127954_3129427_-\|betaine-aldehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143437
CP029609.1\|QBJ83483.1\|3110434_3111466_-\|glucose-1-phosphate-adenylyltransferase	unknown	unknown	gnl\|CDD\|273966
CP029609.1\|QBJ83490.1\|3126063_3126642_-\|MOSC-domain-containing-protein	unknown	unknown	gnl\|CDD\|377051
CP029609.1\|QBJ83476.1\|3100900_3102124_+\|glycosyl-transferase	unknown	unknown	gnl\|CDD\|340831
CP029609.1\|QBJ83479.1\|3103625_3104759_-\|glycosyl-transferase	unknown	unknown	gnl\|CDD\|340831
CP029609.1\|QBJ84685.1\|3124877_3125402_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|376684

Protein	Function_ID	Function_description	E-value
CP029609.1\|QBJ83482.1\|3108983_3110438_-\|glycogen-synthase-GlgA	gnl\|CDD\|234809	PRK00654, glgA, glycogen synthase GlgA.	0
CP029609.1\|QBJ83487.1\|3122788_3123310_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|224168	COG1247, COG1247, Sortase and related acyltransferases [Cell envelope biogenesis, outer membrane].	3.72753e-10
CP029609.1\|QBJ83492.1\|3129625_3130168_+\|transcriptional-regulator	gnl\|CDD\|224427	COG1510, COG1510, Predicted transcriptional regulators [Transcription].	1.21185e-72
CP029609.1\|QBJ83489.1\|3125569_3126058_+\|DinB-family-protein	gnl\|CDD\|378981	pfam12867, DinB_2, DinB superfamily. The DinB family are an uncharacterized family of potential enzymes. The structure of these proteins is composed of a four helix bundle.	3.20062e-17
CP029609.1\|QBJ83488.1\|3123327_3124857_-\|flotillin-family-protein	gnl\|CDD\|225177	COG2268, COG2268, Uncharacterized protein conserved in bacteria [Function unknown].	5.60281e-123
CP029609.1\|QBJ83485.1\|3112628_3114512_-\|1,4-alpha-glucan-branching-enzyme	gnl\|CDD\|273667	TIGR01515, branching_enzym, alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase. This model describes the glycogen branching enzymes which are responsible for the transfer of chains of approx. 7 alpha(1--4)-linked glucosyl residues to other similar chains (in new alpha(1--6) linkages) in the biosynthesis of glycogen. This enzyme is a member of the broader amylase family of starch hydrolases which fold as (beta/alpha)8 barrels, the so-called TIM-barrel structure. All of the sequences comprising the seed of this model have been experimentally characterized. This model encompasses both bacterial and eukaryotic species. No archaea have this enzyme, although Aquifex aolicus does. Two species, Bacillus thuringiensis and Clostridium perfringens have two sequences each which are annotated as amylases. These annotations are aparrently in error. GP\|18143720 from C. perfringens, for instance, contains the note "674 aa, similar to gp:A14658_1 amylase (1,4-alpha-glucan branching enzyme (EC 2.4.1.18) ) from Bacillus thuringiensis (648 aa); 51.1% identity in 632 aa overlap." A branching enzyme from Porphyromonas gingivales, OMNI\|PG1793, appears to be more closely related to the eukaryotic species (across a deep phylogenetic split) and may represent an instance of lateral transfer from this species' host. A sequence from Arabidopsis thaliana, GP\|9294564, scores just above trusted, but appears either to contain corrupt sequence or, more likely, to be a pseudogene as some of the conserved catalytic residues common to the alpha amylase family are not conserved here. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0
CP029609.1\|QBJ83493.1\|3130365_3130911_+\|hypothetical-protein	gnl\|CDD\|379999	pfam17735, BslA, Biofilm surface layer A. This family includes members such as BslA (previously called YuaB). Secreted BslA from Bacillus subtillis has been shown to form surface layers around the biofilm self-assembling at interfaces of B. subtilis biofilms, forming an elastic film. structural analysis revealed that BslA consists of an Ig-type fold with the addition of an unusual, extremely hydrophobic cap region. The hydrophobic cap exhibits physiochemical properties similar to the hydrophobic surface found in fungal hydrophobins; thus, BslA is defined as member of a class of bacterially produced hydrophobins.	5.35887e-46
CP029609.1\|QBJ83486.1\|3122168_3122747_+\|thiamine-transporter-ThiT	gnl\|CDD\|226377	COG3859, COG3859, Predicted membrane protein [Function unknown].	1.328e-72
CP029609.1\|QBJ84686.1\|3126729_3127938_-\|alcohol-dehydrogenase-EutG	gnl\|CDD\|341481	cd08551, Fe-ADH, iron-containing alcohol dehydrogenases (Fe-ADH)-like. This family contains large metal-containing alcohol dehydrogenases (ADH), known as iron-containing alcohol dehydrogenases. They contain a dehydroquinate synthase-like protein structural fold and mostly contain iron. They are distinct from other alcohol dehydrogenases which contains different protein domains. There are several distinct families of alcohol dehydrogenases: Zinc-containing long-chain alcohol dehydrogenases, insect-type, or short-chain alcohol dehydrogenases, iron-containing alcohol dehydrogenases, among others. The iron-containing family has a Rossmann fold-like topology that resembles the fold of the zinc-dependent alcohol dehydrogenases, but lacks sequence homology, and differs in strand arrangement. ADH catalyzes the reversible oxidation of alcohol to acetaldehyde with the simultaneous reduction of NAD(P)+ to NAD(P)H.	1.69004e-175
CP029609.1\|QBJ83481.1\|3106600_3108997_-\|glycogen-phosphorylase	gnl\|CDD\|273967	TIGR02093, Glycogen_phosphorylase, glycogen/starch/alpha-glucan phosphorylases. This family consists of phosphorylases. Members use phosphate to break alpha 1,4 linkages between pairs of glucose residues at the end of long glucose polymers, releasing alpha-D-glucose 1-phosphate. The nomenclature convention is to preface the name according to the natural substrate, as in glycogen phosphorylase, starch phosphorylase, maltodextrin phosphorylase, etc. Name differences among these substrates reflect differences in patterns of branching with alpha 1,6 linkages. Members include allosterically regulated and unregulated forms. A related family, TIGR02094, contains examples known to act well on particularly small alpha 1,4 glucans, as may be found after import from exogenous sources. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0
CP029609.1\|QBJ83484.1\|3111489_3112632_-\|glucose-1-phosphate-adenylyltransferase	gnl\|CDD\|179997	PRK05293, glgC, glucose-1-phosphate adenylyltransferase; Provisional.	0
CP029609.1\|QBJ83480.1\|3104948_3106022_+\|CotS-family-spore-coat-protein	gnl\|CDD\|131952	TIGR02906, Spore_coat_protein_S, spore coat protein, CotS family. Members of this family include the spore coat proteins CotS and YtaA from Bacillus subtilis and, from other endospore-forming bacteria, homologs that are more closely related to these two than to the spore coat proteins YutH and YsxE. The CotS family is more broadly distributed than YutH or YsxE, but still is not universal among spore-formers. [Cellular processes, Sporulation and germination].	1.21478e-131
CP029609.1\|QBJ83478.1\|3102555_3103611_-\|spore-coat-protein-S	gnl\|CDD\|131952	TIGR02906, Spore_coat_protein_S, spore coat protein, CotS family. Members of this family include the spore coat proteins CotS and YtaA from Bacillus subtilis and, from other endospore-forming bacteria, homologs that are more closely related to these two than to the spore coat proteins YutH and YsxE. The CotS family is more broadly distributed than YutH or YsxE, but still is not universal among spore-formers. [Cellular processes, Sporulation and germination].	3.56293e-130
CP029609.1\|QBJ83491.1\|3127954_3129427_-\|betaine-aldehyde-dehydrogenase	gnl\|CDD\|143437	cd07119, ALDH_BADH-GbsA, Bacillus subtilis NAD+-dependent betaine aldehyde dehydrogenase-like. Included in this CD is the NAD+-dependent, betaine aldehyde dehydrogenase (BADH, GbsA, EC=1.2.1.8) of Bacillus subtilis involved in the synthesis of the osmoprotectant glycine betaine from choline or glycine betaine aldehyde.	0
CP029609.1\|QBJ83483.1\|3110434_3111466_-\|glucose-1-phosphate-adenylyltransferase	gnl\|CDD\|273966	TIGR02092, Glycogen_biosynthesis_protein_GlgD, glucose-1-phosphate adenylyltransferase, GlgD subunit. This family is GlgD, an apparent regulatory protein that appears in an alpha2/beta2 heterotetramer with GlgC (glucose-1-phosphate adenylyltransferase, TIGR02091) in a subset of bacteria that use GlgC for glycogen biosynthesis. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0
CP029609.1\|QBJ83490.1\|3126063_3126642_-\|MOSC-domain-containing-protein	gnl\|CDD\|377051	pfam03473, MOSC, MOSC domain. The MOSC (MOCO sulfurase C-terminal) domain is a superfamily of beta-strand-rich domains identified in the molybdenum cofactor sulfurase and several other proteins from both prokaryotes and eukaryotes. These MOSC domains contain an absolutely conserved cysteine and occur either as stand-alone forms or fused to other domains such as NifS-like catalytic domain in Molybdenum cofactor sulfurase. The MOSC domain is predicted to be a sulfur-carrier domain that receives sulfur abstracted by the pyridoxal phosphate-dependent NifS-like enzymes, on its conserved cysteine, and delivers it for the formation of diverse sulfur-metal clusters.	1.47597e-05
CP029609.1\|QBJ83476.1\|3100900_3102124_+\|glycosyl-transferase	gnl\|CDD\|340831	cd03801, GT4_PimA-like, phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.	9.28369e-75
CP029609.1\|QBJ83479.1\|3103625_3104759_-\|glycosyl-transferase	gnl\|CDD\|340831	cd03801, GT4_PimA-like, phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.	1.34988e-73
CP029609.1\|QBJ84685.1\|3124877_3125402_-\|hypothetical-protein	gnl\|CDD\|376684	pfam01957, NfeD, NfeD-like C-terminal, partner-binding. NfeD-like proteins are widely distributed throughout prokaryotes and are frequently associated with genes encoding stomatin-like proteins (slipins). There appear to be three major groups: an ancestral group with only an N-terminal serine protease domain and this C-terminal beta sheet-rich domain which is structurally very similar to the OB-fold domain, associated with its neighboring slipin cluster; a second major group with an additional middle, membrane-spanning domain, associated in some species with eoslipin and in others with yqfA; a final 'artificial' group which unites truncated forms lacking the protease region and associated with their ancestral gene partner, either yqfA or eoslipin. This NefD, C-terminal, domain appears to be the major one for relating to the associated protein. NfeD homologs are clearly reliant on their conserved gene neighbor which is assumed to be necessary for function, either through direct physical interaction or by functioning in the same pathway, possibly involve with lipid-rafts.	0.000207094

>CP029609.1|QBJ83485.1|3112628_3114512_-|1,4-alpha-glucan-branching-enzyme
MAAASPTAHDVYLFHEGSLFKSYQLFGSHYRELNGKSGYEFCVWAPHASEVRVAGDFNSWSGEEHVMHRVNDNGIWTLFIPGIGEKERYKYEIVTNNGEIRLKADPYAIYSEVRPNTASLTYNLEGYSWQDQKWQNKQKAKTLYEKPVFIYELHLGSWKKHSDGRHYSYKELSQTLIPYIKEHGFTHIELLPVYEHPYDRSWGYQGTGYYSPTSRFGPPHDLMKFVDECHQQNIGVILDWVPGHFCKDAHGLYMFDGEPLYEYKEERDRENWLWGTANFDLEKPEVHSFLISNALYWAEFYHIDGFRVDAVANILYWPNQDERHTNPYAVDFLKKLNQTMREAYPHVMMIAEDSTEWPQVTGAVEEGGLGFHYKWNMGWMNDVLKYMETPPEERRHCHQLISFSLLYAFSEHFVLPFSHDEVVYGKKSLLNKMPGDYWQKFAQYRLLLGYMTVHPGKKLIFMGSEFAQFDEWKDTEQLDWFLDSFPMHQKASVFTQDLLRFYQKSKILYEHDHRAQSFEWIDVHNDEQSIFSFIRYGKKHGEALVIICNFTPVVYHQYDVGVPFFTQYIEVLNSDSETYGGSGQINKKPLSAKKGALHHKPCYITMTIPPYGISILRAVKKRGEIKR
>CP029609.1|QBJ83484.1|3111489_3112632_-|glucose-1-phosphate-adenylyltransferase
MKKQCVAMLLAGGKGSRLSGLTKNMAKPAVSFGGKYRIIDFTLSNCSNSGIDTVGILTQYQPLELNSYIGIGSAWDLDRYNGGVTVLPPYAESSEVKWYKGTASAIYENLNYLNQYDPEYVLILSGDHIYKMDYGKMLDYHIEKKADVTISVIEVGWEEASRFGIMKANPDGTITHFDEKPKFPKSNLASMGIYIFNWPLLKQYLEMDDQNPYSSHDFGKDIIPLLLEEKKKLSAYPFKGYWKDVGTVQSLWEANMDLLKEDSELKLFERKWKIYSVNPNQPPQFISSDAQVQDSLVNEGCVVYGNVSHSVLFQGVTVGKHATVTSSVIMPDVTIGEHVVIENAIVPNGMVLPDGAVIRSEKDIEEVLLVSEEFVEKELI
>CP029609.1|QBJ83483.1|3110434_3111466_-|glucose-1-phosphate-adenylyltransferase
MFNNQMLGVIDETTYKHSLQDLTAQRSLGAIPFAGRYRLIDFMLSNMVNADIRSVAIFPKYRYRSLMDHLGAGKEWDLHRKKDGLFFFPSPHLHHEYDEFGSFRQFSDHLDYFHRSTQQYAVISNSHTVCNIQFQYVLKRHQEVGCDVTEVFQDGQSLQIYIMSTTLLKDLIYGHSEKGYKTIQEAVEKESSALTICPYEYSGYAAVIDSVEKYYTHSMELIQPRFWQQVFLPQQPIYTKVKDEPPTKYGKHSTVKNSLVANGCVLEGEVENCILFRAVHVGKGTKLKNCIIMQKTQIGEDCLLEQVISDKDVKIGKATEAAGTAEQPLVLRKGLVQGELMNS
>CP029609.1|QBJ83482.1|3108983_3110438_-|glycogen-synthase-GlgA
MKILFAVSECTPFVKSGGLADVAGALPKALARLGNEVAVMLPKYSQIPEPWKKRMKKQAECTVAVGWRQQYCGIEHMAKDDVNYYFIDNEYYFNRDSLYGHYDDGERFAFFSRAVLEAAKVVNVPADIVHTHDWHTAMVNYLLKEEYRKHPFYERMKSVLTIHNLQFQGIFPPDVTHDLLGLEMDHFHYERLECNGFVNFMKAGIIAADHVTTVSPTYRNEILTPYYGEQLEQVLQYRENDVTGILNGIDDTFYQPKSDPYIEVQYDSGDLACKLENKTKLQRRMGLPEKNDIPLISMVTRFTKQKGLDLVRRIMHELLEEQDIQLVVLGTGEREFEDYFRYAEFAFHEKCRAYIGFDEPLAHHIYAGSDMFLMPSKFEPCGLGQLIALQYGAIPIVRETGGLYDTVRAYQEEEGTGNGFTFSAFNAHDLKFTIERALSFYRQQDVWKSIVKTAMNADYSWGKSAKEYQRIFEQVTRSGRDVLE
>CP029609.1|QBJ83481.1|3106600_3108997_-|glycogen-phosphorylase
MFSSKERFADLFLKRLEMTCGKSFKDSAKLDQYKTLGNMVREYISADWIETNEKSRSNSGKQTYYLSIEFLLGQLLEQNLMNLGVRDVVEAGLKEIGINLEEILQIENDAGLGNGGLGRLAACFLDSLASLNLPGHGMGIRYKHGLFEQKIVDGHQVELPEQWLKNGNVWEVRNADQAVDVPFWGEVHMTEKSGRLHFRHEQATIVTAVPYDIPIIGYETGTVNTLRLWNAEPYAHYHGGNILSYKRETEAVSEFLYPDDTHDEGKILRLKQQYFLVCASLKSIVNNYRKTHKSLSGLHKKVSIHINDTHPALAVPELMRILLDEENMSWEEAWHITVHTISYTNHTTLSEALEKWPIHLFKPLLPRMYMIIEEINERFCRAVWEKYPGDWKRIEDMAITAHGVVKMAHLAIIGSYSVNGVAKIHSDILKEREMRDFHLLFPNRFNNKTNGIAHRRWLLKANPGLSAIITEAIGDEWVKQPESLIRLEPYAADPAFIEKFQNNKSKKKQELADLIFCTAGVVVNPESIFDVQVKRLHAYKRQLLNVLHIMYLYNRLKEDSGFSIYPQTFIFGAKASPSYYYAKKIIKLIHSVAEKVNYDPAVKQLIKVVFLENYRVSMAERIFPASDVSEQISTASKEASGTGNMKFMMNGALTIGTHDGANIEILERVGPDCIYTFGLKADEVLSYQENGGYRSREYYQHDRRIRQVADQLINGFFEGEADEFESIFDSLLPHNDEYFVLKDFSSYADAQERIQADYRERRKWSERSIVNIAHSGYFSSDRTIREYAKDIWGIKPMM
>CP029609.1|QBJ83480.1|3104948_3106022_+|CotS-family-spore-coat-protein
MCPLMAENHEVIEEGNSSELPLSAEDAKKLTELAENVLQGWDVQAEKIDVIQGNQMALVWKVHTDSGAVCLKRIHRPEKKALFSIFAQDYLAKKGMNVPGILPNKKGSLYSKHGSFLFVVYDWIEGRPFELTVKQDLEFIMKGLADFHTASVGYQPPNGVPVFTKLGRWPNHYTKRCKQMETWKLMAEAEKEDPFSQFYLQEIDGFIEDGLRIKDQLLQSTYVPWTEQLKKSPNLCHQDYGTGNTLLGENEQIWVIDLDTVSFDLPIRDLRKMIIPLLDTTGVWDEETFHVMLNAYESRAPLTEEQKQVMFIDMLFPYELYDVIREKYVRKSALPKEELESAFEYERIKANALRQLI
>CP029609.1|QBJ83479.1|3103625_3104759_-|glycosyl-transferase
MKIALIATEKLPVPSVRGGAIQIYLEAVAPLIAKKHEVTVFSIKDPNLADREKVDGVHYVHLDEDRYEEAVGAELKKSRFDLVHVCNRPSWVPKLKKQAPDAVFILSVHNEMFAYDKISQAEGEICIDSVAQIVTVSDYIGQTITSRFPSARSKTKTVYSGVDLKTYHPRWTNEGQRAREEMRSELGLHGKKIVLFVGRLSKVKGPHILLQALPDIIEEHPDVMMVFIGSKWFGDNELNNYVKHLHTLGAMQKDHVTFIQFVKPKDIPRLYTMSDVFVCSSQWQEPLARVHYEAMAAGLPIITSNRGGNPEVIEEGKNGYIIHDFENPKQYAERINDLLSSSEKREGLGKYSRREAESNFGWQRVAENLLSVYEKNR
>CP029609.1|QBJ83478.1|3102555_3103611_-|spore-coat-protein-S
MYQKEHEEQIVSEILSYYPFHIDHVALKSNKSGRKIWEVETDHGPKLLKEAQMKPERMLFITQAHAHLQEKGLPIAPIHQTKNGGSCLGTDQVSYSLYDKVTGKEMIYYDAEQMKKVMSFAGHFHHASKGYVCTDESKKRSRLGKWHKLYRWKLQELEGNMQIAASYPDDVFSQTFLKHADKMLARGKEALRALDDSEYETWTKETLEHGGFCFQDFTLARLTEIEGEPFLKELHSITYDLPSRDLRILLNKVMVKLSVWDTDFMVALLAAYDAVYPLTEKQYEVLWIDLAFPHLFCAIGHKYYLKQKKTWSDEKYNWALQNMISVEESKDSFLDKLPELYKKIKAYREAN
>CP029609.1|QBJ83477.1|3102197_3102554_-|hypothetical-protein
MRSSRQKASISKLDLDQFVFTPPGPMGWQAHDSISAEKEEEEKHLDVGSIRELPHINAPKEYQKETKEKETDHKIVDDEEEDEDEEPDLAEEAKVEIIILPSESKPAPWFSQTVKRKA
>CP029609.1|QBJ83476.1|3100900_3102124_+|glycosyl-transferase
MKLAFICTEKLPAPAVRGGAIQMMIDGVTPYFSSRYDLTIFSIEDPSLPKRETKDGVHYIHLPKEHYREAVAEELRASSFDLIHVFNRPLNVSLYKKASPNSKIVLSLHNEMFSEKKMTFAQGKEVLDNVSMITTVSEFIKQTVIERFPEAEDITKVVYSGVDLNSYPPVWTMKGSAVRKTYRKKYGIEDKKVILFAGRLSPTKGPHLLIHSMRRILQQHPDAVLVIAGGKWFSDDSENQYVTYLRTLALPYRDHIIFTKFIPADDIPNLFLMADVFVCSSQWNEPLARVNYEAMAAGTPLITTNRGGNGEVVKHEVTGLVIDSYNKPSSFAKAIDRAFTDQELMNKMTKNARKHVEALFTFTHAAKRLNTVYQSVLTPKNKQFPPPFLTQNFDLSSINQLFVKAKT
>CP029609.1|QBJ83486.1|3122168_3122747_+|thiamine-transporter-ThiT
MNQSKQLVRLIEIAIMTAAAVILDIVSGMFLSMPQGGSVSIMMIPIFLISFRWGVKAGLTTGLLTGLVQIAIGNLFAQHPVQLLLDYIVAFAAIGISGCFASSVRKAAVSKTKGKLIVSVVSAVFIGSLLRYAAHVISGAVFFGSFAPKGTPVWIYSLTYNATYMVPSFIICAIVLCLLFMTAPRLLKSDKA
>CP029609.1|QBJ83487.1|3122788_3123310_-|GNAT-family-N-acetyltransferase
MVTVREAKLEDIKGIAKVHVDSWRTTYHEIIPIDYLNSLNYKEFEDKWKSRSLKGVFVAQDEMDSVFGFASFGPIRSEQEGYDGELYAIYLLEERQRQGAGRALLAKGAEFLLQHGFSSMFVWVIEQNPSIIFYQAYSPERVAEDNFEIAGVRLKEVGLGWPDLSALKTLLNR
>CP029609.1|QBJ83488.1|3123327_3124857_-|flotillin-family-protein
MTMPIIMIIGVVFFLLIALIAVFITKYRTAGPDEALIVTGSYLGNKNVHVDEGGNRIKIVRGGGTFVLPVFQQAEPLSLLSSKLDVSTPEVYTEQGVPVMADGTAIIKIGGSIGEIATAAEQFLGKSKDDREQEAREVLEGHLRSILGSMTVEEIYKNREKFSQEVQRVASQDLAKMGLVIVSFTIKDVRDKNGYLESLGKPRIAQVKRDADIATAEADKETRIKRAEADKDAKKSELERATEIAEAEKINQLKMAEFRREQDTAKANADQAYDLETARARQQVTEQEMQVKIIERQKQIELEEKEILRRERQYDSEVKKKADADRYSVEQSAAAEKAKQLAEADAKKYSIEAMAKAEAEKVRIDGLAKAEAEKAKGETEAEVIRLKGLAEAEAKEKIAAAFEQYGQAAIFDMIVKMLPEYAKQAAAPLSNIDKITVVDTGGSGESSGANKVTSYATNLMSSLQESLKASSGIDVKEMLENFSGKGNVKQSINELTNEIKEAKTVQKSE
>CP029609.1|QBJ84685.1|3124877_3125402_-|hypothetical-protein
MELFGVPIQTIYLYMLIIAGSLTLLFLFFGDVFAGLPEGIPFLNPTLVLSFFTCFSAGGYIGELVLPLSSLLIALLSCILSIMLVVLLHIFVLVPLSSAEESLAYREDDLRGRLGKVITAVPVDGFGEVVIEGIGGTISKSAVSFDNQQISYGTTVLVVDINNGVLSVTPHEPI
>CP029609.1|QBJ83489.1|3125569_3126058_+|DinB-family-protein
MSIFNEARLETWNELKGLSDEKLNQKPSAEEWSIREVLDHLKKIDMTAQKMLKERVKDAPIKEIEEKPLEVAQDRNNKRKAPSHLEPAHDFISGSQMKRELDVVREQLTAAIASLKEEDFERVLPHPVFQELTVRQWIDFIGHHEKRHLSQMKEIKEKIERA
>CP029609.1|QBJ83490.1|3126063_3126642_-|MOSC-domain-containing-protein
MWKRMTAKAEGLYIADTESFVTKQMDKLDFDYGGIPGDLHFGLTKKAGAREPMFSRGTEIFNRRQISIVSIEECNEIALKMGVPRILPEWLGANVAVSGMPDLTSLKEGSRIIFPSGAALLCEGENDPCIQPGEVIQSYYPDQPKLASAFVRHALGIRGIVCIVERPGAVYTGDEIEVHSYQRKVKRKAERV
>CP029609.1|QBJ84686.1|3126729_3127938_-|alcohol-dehydrogenase-EutG
MTLNMKVESMQKFHTFEIPTVIKHGIGAIKHTGEEVAALGVSKALLVTDPGIYKAGVADPVIESLKEAGIEVVLFNKVEPNPPVRLVNEGSELYKKENCNGLVAVGGGSSMDTAKAIGVEATHEGSVLDYEAADGKKPLENRIPPLTTIPTTAGTGSEVTQWAVITDEEREFKFNTGGPLIAAHLTIIDPELHVSMPPHVTAMTGIDALAHAIECYTMKFAQPITDAVALMAIEYAAHYIKRAFADGEDLEARYGMAQAAMLAGLSYGSESAGAAHAMSQTLGGIIPVAHGQCVAAMMGPVMEYNWKGYPEKFARIAKAFGIDTSKMTTEEAAKASVNWMYDLVEDLEVPTLEEQGVSPDMIERLSKEAMKDPQTFGNPRDLNEKAYNWIYKRCFNLTPKTV
>CP029609.1|QBJ83491.1|3127954_3129427_-|betaine-aldehyde-dehydrogenase
MSQTLFIDGEWISAEKEQIRSIINPFNQEEIATVSEGGREDAIKAIAAARRAFDKGEWSSLSGLERGKIVLKIAELIRRDLEELAELESLDTGKTLEESKADMDDIANVFQYYAGLADKDGGEIISSPIPDSESKIIREPIGVCGQITPWNYPLLQASWKIAPALAAGNTIVMKPSEITPLTTIKVFKLMEEADVPKGVANLVLGPGATVGDELAVNKDVDLISFTGGIETGKKIMRAASGNVKKIALELGGKNPNIVFKDADLEVAVDQALNAVFFHAGQVCSAGSRLLVEDAIHDQFLAELVKRAKRIKLGNGFHAETESGPLISAEHRAKVEKYVEIGIEEGAKLETGGKRPEDPELQNGFFYEPTIFSNCNSDMRIVQEEVFGPVLTVETFNSEEEVIELANDTIYGLAGAVWSKDIEKCERVAARLRMGTVWINDFHPYFAQAPWGGYKQSGFGRELGKIGLEEYTEVKHVYRNTKPAAVNWFNS
>CP029609.1|QBJ83492.1|3129625_3130168_+|transcriptional-regulator
MDENPEFAAIEQARDLVIDSIAETMDLYGITRSVGILYGTMYMRDEMTLDEMREELQMSKPSMSTGVKKLQDLNVVKKTFHRGIRKHTFVAEKDFFKFFTNFFPPKWEREVQVNVAAIEEAQADLQKVLCKEDLDEDIKNEALQLYDQLESSKAYYDWLKRLAESVQTGEIFKFIPIETK
>CP029609.1|QBJ83493.1|3130365_3130911_+|hypothetical-protein
MKRKLLSSLAISALSLGLLVSAPTASFAAESTSTKAHTESTMRTQSTASLFATITGASKTEWSFSDIELTYRPNTLLSLGVMEFTLPSGFTANTKDTLNGNALRTTQILNNGKTVRVPLALDLLGAGEFKLKLNNKTLPAAGTYTFRAENKSLSIGNKFYAEASIDVAKRSTPPTQPCGCN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP029609_2	2.1\|3115145\|60\|CP029609\|CRISPRCasFinder	3115145-3115204	60	NZ_CP024037	Bacillus aryabhattai strain K13 plasmid unnamed2	10417-10476	7	0.883
CP029609_2	2.1\|3115145\|60\|CP029609\|CRISPRCasFinder	3115145-3115204	60	NZ_CP026740	Bacillus megaterium strain YC4-R4 plasmid unnamed4	70764-70823	7	0.883
CP029609_2	2.1\|3115145\|60\|CP029609\|CRISPRCasFinder	3115145-3115204	60	NC_017139	Bacillus megaterium WSH-002 plasmid WSH-002_p1, complete sequence	1318-1377	7	0.883
CP029609_2	2.1\|3115145\|60\|CP029609\|CRISPRCasFinder	3115145-3115204	60	NZ_CP010587	Bacillus megaterium Q3 plasmid p1, complete sequence	838-897	7	0.883
CP029609_2	2.1\|3115145\|60\|CP029609\|CRISPRCasFinder	3115145-3115204	60	NZ_CP023319	Bacillus megaterium strain A plasmid p2, complete sequence	75825-75884	7	0.883
CP029609_2	2.1\|3115145\|60\|CP029609\|CRISPRCasFinder	3115145-3115204	60	NC_020451	Vibrio coralliilyticus strain ATCC BAA-450 plasmid, complete sequence	1960-2019	9	0.85
CP029609_2	2.1\|3115145\|60\|CP029609\|CRISPRCasFinder	3115145-3115204	60	NZ_CP015440	Anoxybacillus amylolyticus strain DSM 15939 plasmid pDSM15939_2, complete sequence	64773-64832	12	0.8
CP029609_2	2.1\|3115145\|60\|CP029609\|CRISPRCasFinder	3115145-3115204	60	NZ_CP033045	Bacillus foraminis strain Bac44 plasmid unnamed, complete sequence	483791-483850	13	0.783
CP029609_2	2.1\|3115145\|60\|CP029609\|CRISPRCasFinder	3115145-3115204	60	NZ_LR134399	Listeria monocytogenes strain NCTC7974 plasmid 2, complete sequence	57361-57420	14	0.767

1. spacer 2.1|3115145|60|CP029609|CRISPRCasFinder matches to NZ_CP024037 (Bacillus aryabhattai strain K13 plasmid unnamed2) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

2. spacer 2.1|3115145|60|CP029609|CRISPRCasFinder matches to NZ_CP026740 (Bacillus megaterium strain YC4-R4 plasmid unnamed4) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

3. spacer 2.1|3115145|60|CP029609|CRISPRCasFinder matches to NC_017139 (Bacillus megaterium WSH-002 plasmid WSH-002_p1, complete sequence) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

4. spacer 2.1|3115145|60|CP029609|CRISPRCasFinder matches to NZ_CP010587 (Bacillus megaterium Q3 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

5. spacer 2.1|3115145|60|CP029609|CRISPRCasFinder matches to NZ_CP023319 (Bacillus megaterium strain A plasmid p2, complete sequence) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

6. spacer 2.1|3115145|60|CP029609|CRISPRCasFinder matches to NC_020451 (Vibrio coralliilyticus strain ATCC BAA-450 plasmid, complete sequence) position: , mismatch: 9, identity: 0.85

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcattttagttatggcccggg	Protospacer
****************************************** ***   * ***  **.

7. spacer 2.1|3115145|60|CP029609|CRISPRCasFinder matches to NZ_CP015440 (Anoxybacillus amylolyticus strain DSM 15939 plasmid pDSM15939_2, complete sequence) position: , mismatch: 12, identity: 0.8

cagcttggaaggctgaggttttaccactaaactacacccgca-------atttttatttg	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcataataatatataccattg	Protospacer
******************************************       ** * .  ***

8. spacer 2.1|3115145|60|CP029609|CRISPRCasFinder matches to NZ_CP033045 (Bacillus foraminis strain Bac44 plasmid unnamed, complete sequence) position: , mismatch: 13, identity: 0.783

cagcttggaaggctgaggttttaccactaaactacacccgc--------aatttttattt	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatggttaaaagttttgcca	Protospacer
*****************************************        ** ****...

9. spacer 2.1|3115145|60|CP029609|CRISPRCasFinder matches to NZ_LR134399 (Listeria monocytogenes strain NCTC7974 plasmid 2, complete sequence) position: , mismatch: 14, identity: 0.767

cagcttggaaggctgaggttttaccactaaactacacccgc---------aatttttatt	CRISPR spacer
cagcttggaaggctgtagttttaccactaaactacacccgcatagtaagtagttcttagt	Protospacer
*************** .************************         *.**.*** *

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

152508 : 217651

Bacillus_phage(44.68%)

portal,terminase,tRNA,tail,capsid,holin,integrase

attL 160373:160432|attR 225001:225089

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QBJ80710.1\|152508_153252_+\|tRNA	tRNA pseudouridine(38-40) synthase TruA	NA	NA	NA	NA
QBJ80711.1\|153413_153851_+	50S ribosomal protein L13	NA	NA	NA	NA
QBJ80712.1\|153871_154264_+	30S ribosomal protein S9	NA	NA	NA	NA
QBJ80713.1\|154724_155492_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
QBJ80714.1\|155677_156121_+	DUF2521 domain-containing protein	NA	NA	NA	NA
QBJ80715.1\|156180_156894_+	N-acetylmuramoyl-L-alanine amidase CwlD	A0A0N6W8I1	Bacillus_phage	8.3e-15	30.0
QBJ80716.1\|156989_158048_+	protein mrp	NA	NA	NA	NA
QBJ80717.1\|158083_158641_-	germination protein GerD	NA	NA	NA	NA
QBJ80718.1\|158750_159347_+	KinB-signaling pathway activation protein	NA	NA	NA	NA
QBJ80719.1\|159347_160112_-	polysaccharide deacetylase family sporulation protein PdaB	NA	NA	NA	NA
160373:160432	attL	NA	NA	NA	NA
QBJ80720.1\|165638_166853_-\|integrase	site-specific integrase	A0A0K2CZ62	Paenibacillus_phage	3.3e-72	39.4
QBJ80721.1\|166845_167373_-	ImmA/IrrE family metallo-endopeptidase	A0A2H4JA43	uncultured_Caudovirales_phage	2.5e-37	50.7
QBJ80722.1\|167453_168059_-	hypothetical protein	O64079	Bacillus_phage	5.1e-58	74.5
QBJ80723.1\|168289_168619_-	XRE family transcriptional regulator	O64078	Bacillus_phage	2.0e-16	45.7
QBJ80724.1\|168779_169013_+	XRE family transcriptional regulator	NA	NA	NA	NA
QBJ80725.1\|169025_169217_+	DNA-binding protein	NA	NA	NA	NA
QBJ80726.1\|169281_169815_+	XRE family transcriptional regulator	NA	NA	NA	NA
QBJ80727.1\|169804_170065_+	hypothetical protein	NA	NA	NA	NA
QBJ80728.1\|170649_170835_+	hypothetical protein	NA	NA	NA	NA
QBJ80729.1\|170831_172805_+	hypothetical protein	A0A1L2K2K3	Aeribacillus_phage	1.5e-151	47.7
QBJ80730.1\|172804_173029_+	hypothetical protein	NA	NA	NA	NA
QBJ80731.1\|173021_173903_+	recombinase RecT	D7RWF9	Brochothrix_phage	7.7e-87	61.0
QBJ80732.1\|173899_174601_+	MBL fold metallo-hydrolase	A0A1L2JY21	Aeribacillus_phage	5.5e-96	70.0
QBJ80733.1\|174805_175564_+	hypothetical protein	U5Q085	Bacillus_phage	1.2e-11	31.9
QBJ80734.1\|175577_175859_+	hypothetical protein	NA	NA	NA	NA
QBJ80735.1\|175833_177132_+	replicative DNA helicase	D2XR44	Bacillus_phage	2.1e-93	42.4
QBJ80736.1\|177150_177345_+	Fur-regulated basic protein FbpA	A0A1L2JY24	Aeribacillus_phage	5.0e-07	46.6
QBJ80737.1\|177444_177936_+	hypothetical protein	A0A0C5AFC9	Paenibacillus_phage	4.0e-37	49.3
QBJ80738.1\|177951_178644_+	hypothetical protein	NA	NA	NA	NA
QBJ80739.1\|178643_178853_+	hypothetical protein	NA	NA	NA	NA
QBJ80740.1\|178770_178950_+	hypothetical protein	M4ZR07	Bacillus_phage	1.6e-07	49.2
QBJ80741.1\|179019_179223_+	hypothetical protein	NA	NA	NA	NA
QBJ80742.1\|179264_179744_+	hypothetical protein	A0A0M3ULE9	Bacillus_phage	5.5e-23	39.5
QBJ80743.1\|179761_180049_+	hypothetical protein	NA	NA	NA	NA
QBJ80744.1\|180045_180318_+	hypothetical protein	NA	NA	NA	NA
QBJ80745.1\|180351_180957_+	hypothetical protein	NA	NA	NA	NA
QBJ80746.1\|180953_181139_+	hypothetical protein	NA	NA	NA	NA
QBJ80747.1\|181135_181534_+	hypothetical protein	M4ZR14	Bacillus_phage	1.8e-59	89.4
QBJ80748.1\|181618_182005_+	ArpU family transcriptional regulator	Q9ZXB9	Bacillus_phage	4.2e-29	56.5
QBJ80749.1\|182071_182446_+	hypothetical protein	NA	NA	NA	NA
QBJ80750.1\|182756_183101_+	structural protein	Q38579	Bacillus_phage	8.2e-29	58.8
QBJ80751.1\|183168_183636_+	hypothetical protein	NA	NA	NA	NA
QBJ80752.1\|183691_184213_+	transcriptional regulator	A0A1B1P7B5	Bacillus_phage	4.6e-55	60.2
QBJ80753.1\|184223_185243_+	DNA (cytosine-5-)-methyltransferase	A0A1B1P7C6	Bacillus_phage	8.5e-130	65.3
QBJ80754.1\|185380_185629_+	hypothetical protein	A8ATN7	Listeria_phage	2.1e-05	36.7
QBJ80755.1\|185676_186567_+\|terminase	terminase	A0A1B1P7C9	Bacillus_phage	4.3e-21	40.9
QBJ84556.1\|186566_187883_+\|terminase	PBSX family phage terminase large subunit	A0A2P1JTW5	Anoxybacillus_phage	8.0e-157	63.6
QBJ80756.1\|187875_189408_+\|portal	phage portal protein	A0A1B1P7C8	Bacillus_phage	2.5e-154	54.6
QBJ80757.1\|189404_190322_+	hypothetical protein	A0A1B1P7D7	Bacillus_phage	2.0e-53	39.8
QBJ80758.1\|190362_191061_+	hypothetical protein	NA	NA	NA	NA
QBJ80759.1\|191093_192266_+\|terminase	terminase	A0A1B1P7E4	Bacillus_phage	1.1e-83	53.7
QBJ80760.1\|192297_193233_+\|capsid	phage major capsid protein	A0A1B1P7E3	Bacillus_phage	4.1e-107	65.0
QBJ80761.1\|193243_193561_+	hypothetical protein	NA	NA	NA	NA
QBJ80762.1\|193566_193959_+	hypothetical protein	A0A1B1P7D6	Bacillus_phage	1.5e-13	36.9
QBJ80763.1\|193955_194318_+	DUF3599 domain-containing protein	A0A249XXE9	Clostridium_phage	1.1e-10	36.4
QBJ80764.1\|194314_194815_+\|portal	phage portal protein	A0A249XXA4	Clostridium_phage	6.8e-40	49.1
QBJ80765.1\|194827_195265_+\|portal	phage portal protein	NA	NA	NA	NA
QBJ80766.1\|195261_195453_+	hypothetical protein	NA	NA	NA	NA
QBJ80767.1\|195453_196854_+\|tail	phage tail sheath protein	S5MNC1	Brevibacillus_phage	9.7e-76	39.6
QBJ80768.1\|196855_197299_+\|portal	phage portal protein	A0A0A7RVP1	Clostridium_phage	4.5e-27	46.5
QBJ80769.1\|197562_197646_-	hydrophobic toxin	NA	NA	NA	NA
QBJ80770.1\|197793_198243_+\|portal	phage portal protein	A0A0A7RTY8	Clostridium_phage	3.5e-11	36.6
QBJ80771.1\|198284_198422_+	hypothetical protein	NA	NA	NA	NA
QBJ80772.1\|198424_203770_+	hypothetical protein	A0A1L2JY60	Aeribacillus_phage	8.3e-43	46.3
QBJ80773.1\|203762_204422_+	LysM peptidoglycan-binding domain-containing protein	A0A090DBR9	Clostridium_phage	5.6e-26	35.2
QBJ80774.1\|204729_205107_+	QacE family quaternary ammonium compound efflux SMR transporter	NA	NA	NA	NA
QBJ80775.1\|205203_206184_+\|portal	phage portal protein	H7BV96	unidentified_phage	8.4e-42	32.9
QBJ80776.1\|206180_206447_+\|portal	phage portal protein	NA	NA	NA	NA
QBJ80777.1\|206459_206885_+\|portal	phage portal protein	A0A0A8WJV8	Clostridium_phage	3.3e-11	34.1
QBJ80778.1\|206877_207924_+\|portal	phage portal protein	S6AVU3	Thermus_phage	2.4e-71	43.8
QBJ80779.1\|207907_208486_+\|portal	phage portal protein	A0A2H4J717	uncultured_Caudovirales_phage	3.0e-15	34.5
QBJ80780.1\|208482_208755_+	hypothetical protein	NA	NA	NA	NA
QBJ80781.1\|208758_210510_+\|terminase	terminase	A0A1P8CWR7	Bacillus_phage	1.8e-26	42.2
QBJ80782.1\|210521_210851_+\|portal	phage portal protein	A0A2H4JCI0	uncultured_Caudovirales_phage	1.0e-15	41.0
QBJ80783.1\|210847_211012_+	XkdX family protein	A0A2H4JAA1	uncultured_Caudovirales_phage	5.5e-15	67.9
QBJ80784.1\|211103_211997_+\|portal	phage portal protein	NA	NA	NA	NA
QBJ80785.1\|212064_212343_+	protein xhlA	A0A2H4JD40	uncultured_Caudovirales_phage	1.5e-25	66.3
QBJ80786.1\|212358_212622_+\|holin	phage holin	A0A2H4J6M0	uncultured_Caudovirales_phage	1.7e-26	71.3
QBJ80787.1\|212677_213652_+	N-acetylmuramoyl-L-alanine amidase	D6QWL5	uncultured_phage	4.5e-64	71.3
QBJ80788.1\|213702_214167_-	SMI1/KNR4 family protein	NA	NA	NA	NA
QBJ80789.1\|214187_215951_-	hypothetical protein	A0A1P8CWI7	Bacillus_phage	1.1e-127	54.5
QBJ80790.1\|216159_217290_+	aspartate phosphatase	A0A1P8CWN8	Bacillus_phage	5.8e-71	40.4
QBJ80791.1\|217435_217651_-	hypothetical protein	A0A2H4J4T3	uncultured_Caudovirales_phage	1.4e-13	63.2
225001:225089	attR	NA	NA	NA	NA

DBSCAN-SWA_2

724476 : 732842

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QBJ81233.1\|724476_725772_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	5.9e-19	25.7
QBJ81234.1\|725845_726571_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0E3G7P8	Synechococcus_phage	1.2e-45	44.1
QBJ81235.1\|726563_726818_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
QBJ81236.1\|726814_727498_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
QBJ81237.1\|727481_729710_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	3.8e-159	40.1
QBJ81238.1\|729685_731116_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.2e-52	32.5
QBJ81239.1\|731217_732258_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	2.8e-64	42.0
QBJ81240.1\|732254_732842_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	2.4e-28	41.0

DBSCAN-SWA_3

760510 : 770235

Catovirus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QBJ81262.1\|760510_761422_+	diacylglycerol kinase	A0A1V0SBJ0	Catovirus	1.2e-21	29.7
QBJ81263.1\|761677_763054_+	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	3.5e-110	45.1
QBJ81264.1\|763302_763896_+	transcriptional regulator	NA	NA	NA	NA
QBJ81265.1\|763913_765431_+	SAM-dependent DNA methyltransferase	A0A2I6PG28	Plesiomonas_phage	6.1e-15	27.3
QBJ81266.1\|765420_766746_+	restriction endonuclease subunit S	A0A2H4PQP5	Staphylococcus_phage	6.0e-27	38.9
QBJ81267.1\|766769_766961_+	hypothetical protein	A0A0C5AEJ6	Paenibacillus_phage	1.4e-17	71.4
QBJ81268.1\|766986_770235_+	DEAD/DEAH box helicase	A0A220A398	Liberibacter_phage	1.0e-64	28.7

DBSCAN-SWA_4

1235314 : 1269217

Planktothrix_phage(20.0%)

coat,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QBJ84599.1\|1235314_1236307_-\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
QBJ81718.1\|1237051_1238689_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
QBJ81719.1\|1238796_1239732_+	peptide ABC transporter permease	NA	NA	NA	NA
QBJ81720.1\|1239735_1240653_+	peptide ABC transporter permease	NA	NA	NA	NA
QBJ81721.1\|1240657_1241734_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.1e-17	30.8
QBJ81722.1\|1241735_1242653_+	oligopeptide transport ATP-binding protein OppF	M1HP82	Acanthocystis_turfacea_Chlorella_virus	1.2e-05	24.6
QBJ81723.1\|1242758_1243976_+	MFS transporter	NA	NA	NA	NA
QBJ81724.1\|1244138_1244717_+	N-acetyltransferase	NA	NA	NA	NA
QBJ81725.1\|1244897_1245293_+	transcriptional regulator Spx	NA	NA	NA	NA
QBJ81726.1\|1245335_1245992_-	hypothetical protein	A0A2R2YAT9	Pseudomonas_phage	1.1e-29	38.0
QBJ81727.1\|1246268_1246925_+	adaptor protein MecA	NA	NA	NA	NA
QBJ81728.1\|1247085_1248237_+	competence protein CoiA	NA	NA	NA	NA
QBJ81729.1\|1248283_1250296_+	oligoendopeptidase F	NA	NA	NA	NA
QBJ81730.1\|1250333_1250501_-	hypothetical protein	NA	NA	NA	NA
QBJ81731.1\|1250596_1250800_-	hypothetical protein	NA	NA	NA	NA
QBJ81732.1\|1250814_1251714_-	DsbA family protein	NA	NA	NA	NA
QBJ81733.1\|1251710_1252109_-	thiol management oxidoreductase	NA	NA	NA	NA
QBJ84600.1\|1252364_1252910_-	lytic transglycosylase domain-containing protein	A0A1P8CWQ1	Bacillus_phage	8.2e-39	60.4
QBJ81734.1\|1253113_1253686_-	CYTH domain-containing protein	NA	NA	NA	NA
QBJ81735.1\|1253810_1254179_+	hypothetical protein	NA	NA	NA	NA
QBJ81736.1\|1254207_1254843_+	GTP pyrophosphokinase YjbM	NA	NA	NA	NA
QBJ81737.1\|1254861_1255662_+	NAD(+) kinase	NA	NA	NA	NA
QBJ84601.1\|1255724_1256576_+	RNA pseudouridine synthase	NA	NA	NA	NA
QBJ81738.1\|1256588_1257323_-	bis(5'-nucleosyl)-tetraphosphatase PrpE	A8E2N0	Enterococcus_phage	2.5e-06	25.2
QBJ81739.1\|1257554_1259399_+	sodium:proton antiporter	NA	NA	NA	NA
QBJ81740.1\|1259647_1260358_+	thiaminase II	NA	NA	NA	NA
QBJ81741.1\|1260332_1260950_+	thiamine phosphate synthase	NA	NA	NA	NA
QBJ81742.1\|1260933_1262043_+	glycine oxidase ThiO	NA	NA	NA	NA
QBJ84602.1\|1262042_1262243_+	thiamine biosynthesis protein ThiS	NA	NA	NA	NA
QBJ81743.1\|1262239_1263010_+	thiazole synthase	NA	NA	NA	NA
QBJ81744.1\|1263006_1264017_+	thiazole biosynthesis adenylyltransferase ThiF	NA	NA	NA	NA
QBJ81745.1\|1264035_1264851_+	bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase	NA	NA	NA	NA
QBJ81746.1\|1264986_1265763_+	enoyl-[acyl-carrier-protein] reductase FabI	NA	NA	NA	NA
QBJ81747.1\|1265863_1266547_+\|coat	spore coat protein	NA	NA	NA	NA
QBJ81748.1\|1266639_1267089_-\|coat	spore coat protein	NA	NA	NA	NA
QBJ81749.1\|1267216_1267705_-\|coat	spore coat protein Y	NA	NA	NA	NA
QBJ81750.1\|1267856_1268372_-\|coat	spore coat protein	NA	NA	NA	NA
QBJ81751.1\|1268465_1268789_-\|coat	spore coat protein	NA	NA	NA	NA
QBJ81752.1\|1268830_1269217_-\|coat	spore coat protein	NA	NA	NA	NA

DBSCAN-SWA_5

1292729 : 1375776

Bacillus_phage(27.5%)

portal,terminase,tRNA,holin,protease,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QBJ81776.1\|1292729_1293209_+\|tRNA	Cys-tRNA(Pro) deacylase	NA	NA	NA	NA
QBJ81777.1\|1293248_1293443_-	DUF4177 domain-containing protein	NA	NA	NA	NA
QBJ81778.1\|1293574_1293904_-	DUF4306 domain-containing protein	NA	NA	NA	NA
QBJ81779.1\|1294310_1294505_+	hypothetical protein	NA	NA	NA	NA
QBJ84605.1\|1294523_1295513_-	protoheme IX farnesyltransferase	NA	NA	NA	NA
QBJ81780.1\|1295635_1295959_-\|coat	spore coat protein	NA	NA	NA	NA
QBJ81781.1\|1296137_1297541_+	peptidoglycan-N-acetylmuramic acid deacetylase PdaC	NA	NA	NA	NA
QBJ81782.1\|1297580_1298054_-	DUF2690 domain-containing protein	NA	NA	NA	NA
QBJ81783.1\|1298182_1298350_-	putative motility protein	NA	NA	NA	NA
QBJ81784.1\|1298476_1299376_+	hypothetical protein	NA	NA	NA	NA
QBJ81785.1\|1299384_1299783_-	DUF2809 domain-containing protein	NA	NA	NA	NA
QBJ81786.1\|1299883_1300459_-	DUF4309 domain-containing protein	NA	NA	NA	NA
QBJ81787.1\|1300604_1303562_+	formate dehydrogenase subunit alpha	NA	NA	NA	NA
QBJ81788.1\|1303554_1304115_+	DUF1641 domain-containing protein	NA	NA	NA	NA
QBJ81789.1\|1304311_1304953_+	lipoprotein	NA	NA	NA	NA
QBJ81790.1\|1305031_1305658_+	NUDIX domain-containing protein	NA	NA	NA	NA
QBJ81791.1\|1305688_1305967_-	hypothetical protein	NA	NA	NA	NA
QBJ81792.1\|1306357_1307548_+	cytochrome P450	NA	NA	NA	NA
QBJ81793.1\|1307570_1308749_+	UDP-glucosyltransferase	Q0IKX4	Leucania_separata_nucleopolyhedrovirus	3.3e-08	28.3
QBJ81794.1\|1308789_1308978_-	hypothetical protein	A0A1P8CWV7	Bacillus_phage	1.5e-21	75.4
QBJ81795.1\|1309151_1309964_+	uroporphyrinogen-III synthase	NA	NA	NA	NA
QBJ81796.1\|1310009_1310762_-	iron export ABC transporter permease subunit FetB	NA	NA	NA	NA
QBJ81797.1\|1310761_1311514_-	phosphate ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.4e-18	31.4
QBJ81798.1\|1311633_1312608_-	multidrug resistance efflux transporter family protein	NA	NA	NA	NA
QBJ81799.1\|1312739_1313237_+	cupin domain-containing protein	NA	NA	NA	NA
QBJ81800.1\|1313625_1314048_+	DUF1641 domain-containing protein	NA	NA	NA	NA
QBJ81801.1\|1314087_1315266_+	NADH dehydrogenase	NA	NA	NA	NA
QBJ81802.1\|1315462_1316884_+	glucuronate isomerase	NA	NA	NA	NA
QBJ81803.1\|1316951_1318331_+	MFS transporter	NA	NA	NA	NA
QBJ81804.1\|1318435_1319449_+	ureidoglycolate dehydrogenase	NA	NA	NA	NA
QBJ81805.1\|1319454_1320474_+	alcohol dehydrogenase	NA	NA	NA	NA
QBJ81806.1\|1320499_1321579_+	mannonate dehydratase	NA	NA	NA	NA
QBJ81807.1\|1321575_1322412_+	D-mannonate oxidoreductase	M1NMS3	Moumouvirus	2.7e-09	30.4
QBJ81808.1\|1322459_1323728_+	MFS transporter	NA	NA	NA	NA
QBJ81809.1\|1323815_1324817_+	LacI family transcriptional regulator	NA	NA	NA	NA
QBJ81810.1\|1324893_1326336_+	tagaturonate reductase	NA	NA	NA	NA
QBJ81811.1\|1326332_1327826_+	altronate hydrolase	NA	NA	NA	NA
QBJ81812.1\|1327866_1328631_-	anion permease	NA	NA	NA	NA
QBJ81813.1\|1328855_1329320_-	hypothetical protein	NA	NA	NA	NA
QBJ81814.1\|1329468_1330740_+	ATPase	A0A1V0SEI6	Indivirus	8.6e-15	37.1
QBJ81815.1\|1330885_1332022_+	tetratricopeptide repeat protein	A0A1P8CWN8	Bacillus_phage	4.9e-94	47.4
QBJ81816.1\|1332011_1332146_+	phosphatase RapA inhibitor	NA	NA	NA	NA
QBJ81817.1\|1332176_1332434_-	hypothetical protein	NA	NA	NA	NA
QBJ81818.1\|1332554_1333508_+	LysM peptidoglycan-binding domain-containing protein	A0A218KC88	Bacillus_phage	1.6e-66	73.5
QBJ81819.1\|1333547_1333925_-	PH domain-containing protein	A5GYQ0	Lactococcus_phage	7.9e-17	42.3
QBJ81820.1\|1334029_1334632_+	hypothetical protein	F8WQ53	Bacillus_phage	3.8e-45	49.2
QBJ81821.1\|1334708_1335545_+	manganese catalase	NA	NA	NA	NA
QBJ81822.1\|1335588_1336185_-	ImmA/IrrE family metallo-endopeptidase	A0A2H4JA43	uncultured_Caudovirales_phage	8.1e-40	51.7
QBJ81823.1\|1336347_1336689_-	transcriptional regulator	A0A2H4J6F9	uncultured_Caudovirales_phage	1.3e-18	45.8
QBJ81824.1\|1336866_1337046_+	hypothetical protein	NA	NA	NA	NA
QBJ81825.1\|1337032_1337869_+\|portal	phage portal protein	S6BFM4	Thermus_phage	1.8e-24	28.2
QBJ81826.1\|1337768_1338569_+	hypothetical protein	A6XMI1	Bacillus_virus	1.1e-60	51.7
QBJ81827.1\|1338568_1338736_+	hypothetical protein	NA	NA	NA	NA
QBJ81828.1\|1338820_1339171_+\|portal	phage portal protein	NA	NA	NA	NA
QBJ81829.1\|1339167_1339374_+	phage-like element PBSX protein XtrA	A0A2H4J4M6	uncultured_Caudovirales_phage	1.6e-11	50.0
QBJ81830.1\|1339489_1339999_+	Fis family transcriptional regulator	A0A1L2JY33	Aeribacillus_phage	8.5e-22	39.2
QBJ81831.1\|1340114_1340912_+\|terminase	terminase	A0A0S2MVB6	Bacillus_phage	1.9e-60	50.6
QBJ81832.1\|1340908_1342210_+\|terminase	PBSX family phage terminase large subunit	A0A2P1JTW5	Anoxybacillus_phage	4.1e-153	60.2
QBJ81833.1\|1342213_1343701_+\|portal	phage portal protein	A0A1B1P7C8	Bacillus_phage	2.9e-139	55.5
QBJ81834.1\|1343720_1344548_+	phage-like element PBSX protein XkdF	A0A1B1P7E4	Bacillus_phage	2.1e-54	58.7
QBJ81835.1\|1344573_1345509_+	phage-like element PBSX protein XkdG	A0A1B1P7E3	Bacillus_phage	1.1e-104	63.8
QBJ81836.1\|1345530_1345914_+	DUF3199 domain-containing protein	A0A1B1P7D6	Bacillus_phage	1.4e-13	40.2
QBJ81837.1\|1345910_1346267_+	DUF3599 domain-containing protein	NA	NA	NA	NA
QBJ81838.1\|1346263_1346749_+	HK97 gp10 family phage protein	A0A249XXA4	Clostridium_phage	4.7e-38	47.0
QBJ81839.1\|1346761_1347202_+\|portal	phage portal protein	NA	NA	NA	NA
QBJ81840.1\|1347205_1347424_+	hypothetical protein	NA	NA	NA	NA
QBJ81841.1\|1347420_1348821_+	phage-like element PBSX protein XkdK	A0A0A7S087	Clostridium_phage	2.3e-77	39.3
QBJ81842.1\|1348822_1349266_+	phage-like element PBSX protein XkdM	A0A0K2CNG3	Brevibacillus_phage	8.4e-26	45.2
QBJ81843.1\|1349350_1349797_+\|portal	phage portal protein	A0A0A7RTY8	Clostridium_phage	5.9e-11	37.7
QBJ81844.1\|1349838_1349976_+	hypothetical protein	NA	NA	NA	NA
QBJ81845.1\|1349986_1354285_+	lytic transglycosylase	A0A1L2JY60	Aeribacillus_phage	3.9e-43	44.9
QBJ81846.1\|1354277_1354937_+\|portal	phage portal protein	A0A0A8WJR4	Clostridium_phage	6.2e-25	33.7
QBJ81847.1\|1354952_1355930_+\|portal	phage portal protein	H7BV96	unidentified_phage	3.9e-39	32.3
QBJ81848.1\|1355929_1356196_+	phage-like element PBSX protein XkdR	S6C459	Thermus_phage	1.7e-05	36.4
QBJ81849.1\|1356253_1356679_+	DUF2634 domain-containing protein	A0A2H4J6K5	uncultured_Caudovirales_phage	7.8e-13	38.0
QBJ81850.1\|1356671_1357718_+\|portal	phage portal protein	S6AVU3	Thermus_phage	1.3e-72	44.3
QBJ81851.1\|1357701_1358280_+	DUF2313 domain-containing protein	A0A2H4J717	uncultured_Caudovirales_phage	5.1e-15	33.1
QBJ81852.1\|1358276_1358549_+	hypothetical protein	NA	NA	NA	NA
QBJ81853.1\|1358551_1360666_+\|terminase	terminase	A0A1P8CWR7	Bacillus_phage	1.5e-43	54.8
QBJ81854.1\|1360677_1361007_+\|portal	phage portal protein	A0A2H4JCI0	uncultured_Caudovirales_phage	2.2e-15	41.3
QBJ81855.1\|1361003_1361168_+	XkdX family protein	A0A2H4JAA1	uncultured_Caudovirales_phage	1.4e-15	67.9
QBJ81856.1\|1361211_1362051_+\|portal	phage portal protein	NA	NA	NA	NA
QBJ81857.1\|1362103_1362373_+	protein xhlA	A0A2H4JD40	uncultured_Caudovirales_phage	4.8e-24	64.8
QBJ81858.1\|1362385_1362649_+\|holin	phage holin	A0A2H4J6M0	uncultured_Caudovirales_phage	1.0e-23	63.2
QBJ81859.1\|1362661_1363558_+	N-acetylmuramoyl-L-alanine amidase	Q9ZXD7	Bacillus_phage	5.2e-83	69.2
QBJ81860.1\|1363568_1364726_+	hypothetical protein	NA	NA	NA	NA
QBJ81861.1\|1364960_1365131_-	stage II sporulation protein SB	NA	NA	NA	NA
QBJ81862.1\|1365130_1365877_-	type II toxin-antitoxin system SpoIISA family toxin	NA	NA	NA	NA
QBJ81863.1\|1365986_1366988_-	low-affinity inorganic phosphate transporter	NA	NA	NA	NA
QBJ81864.1\|1367000_1367618_-	DUF47 domain-containing protein	NA	NA	NA	NA
QBJ81865.1\|1367893_1369210_-	amino acid permease	NA	NA	NA	NA
QBJ81866.1\|1369597_1370548_+	ring-cleaving dioxygenase	NA	NA	NA	NA
QBJ81867.1\|1370764_1372915_+	mannosyltransferase	NA	NA	NA	NA
QBJ81868.1\|1372926_1373898_+	glycosyltransferase	A0A2H5BFL1	Salmonella_phage	1.9e-62	41.0
QBJ81869.1\|1374062_1374257_-	hypothetical protein	NA	NA	NA	NA
QBJ81870.1\|1374414_1375776_-\|protease	serine protease	A0A1B1IT49	uncultured_Mediterranean_phage	5.8e-25	33.7

DBSCAN-SWA_6

1914451 : 1921023

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QBJ82305.1\|1914451_1914844_+	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	G3MBF1	Bacillus_virus	2.5e-29	58.3
QBJ82306.1\|1914803_1916906_+	ribonucleotide-diphosphate reductase subunit alpha	U5PY35	Bacillus_phage	0.0e+00	86.8
QBJ82307.1\|1916923_1917913_+	class 1b ribonucleoside-diphosphate reductase subunit beta	F8WQ21	Bacillus_phage	4.3e-155	83.2
QBJ82308.1\|1917962_1918583_+	hypothetical protein	A0A127AYS1	Bacillus_phage	1.6e-46	48.4
QBJ82309.1\|1918646_1919414_-	N-acetylmuramoyl-L-alanine amidase	E5DV68	Deep-sea_thermophilic_phage	9.1e-52	49.5
QBJ82310.1\|1920054_1921023_+	stage V sporulation protein K	G3MAX6	Bacillus_virus	3.9e-52	40.5

DBSCAN-SWA_7

2351013 : 2357109

Staphylococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QBJ82721.1\|2351013_2351607_-	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	2.6e-14	35.4
QBJ84647.1\|2351596_2352352_-	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	1.6e-08	28.8
QBJ82722.1\|2352632_2353157_+	DUF309 domain-containing protein	NA	NA	NA	NA
QBJ82723.1\|2353170_2353545_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
QBJ82724.1\|2353657_2354122_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	5.5e-44	60.0
QBJ82725.1\|2354154_2355351_-	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	5.3e-115	54.9
QBJ82726.1\|2355365_2356013_-	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	5.0e-43	45.9
QBJ82727.1\|2356023_2357109_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase	A0A2H4PQS8	Staphylococcus_phage	1.3e-56	36.4

DBSCAN-SWA_8

2732902 : 2829003

103

Bacillus_phage(65.22%)

portal,terminase,head,tail,holin,tRNA,protease,capsid,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QBJ83118.1\|2732902_2734048_-\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	3.4e-87	44.0
QBJ83119.1\|2734074_2735103_-\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
QBJ83120.1\|2735132_2735333_-	DUF2905 domain-containing protein	NA	NA	NA	NA
QBJ83121.1\|2735325_2736330_-	Holliday junction branch migration DNA helicase RuvB	B3GAM6	uncultured_virus	1.1e-07	30.8
QBJ83122.1\|2736340_2736946_-	Holliday junction branch migration protein RuvA	NA	NA	NA	NA
QBJ83123.1\|2737084_2737597_-	protein BofC	NA	NA	NA	NA
QBJ83124.1\|2737644_2738952_-	MFS transporter	NA	NA	NA	NA
QBJ83125.1\|2739022_2740048_-	inositol 2-dehydrogenase	NA	NA	NA	NA
QBJ83126.1\|2740285_2740933_+	serine/threonine protein kinase	A0A2R3ZQF2	Marseillevirus	4.1e-05	26.3
QBJ84670.1\|2741500_2741632_+	hypothetical protein	NA	NA	NA	NA
QBJ83127.1\|2741638_2741779_+	hypothetical protein	NA	NA	NA	NA
QBJ83128.1\|2741942_2743397_+	alanine:cation symporter family protein	NA	NA	NA	NA
QBJ84671.1\|2743437_2744160_-	YebC/PmpR family DNA-binding transcriptional regulator	NA	NA	NA	NA
QBJ83129.1\|2744262_2744859_-	sporulation cortex protein CoxA	NA	NA	NA	NA
QBJ83130.1\|2745006_2746170_-	peptigoglycan-binding protein LysM	NA	NA	NA	NA
QBJ83131.1\|2746286_2747393_-	quinolinate synthase	NA	NA	NA	NA
QBJ83132.1\|2747379_2748249_-	carboxylating nicotinate-nucleotide diphosphorylase	NA	NA	NA	NA
QBJ83133.1\|2748202_2749798_-	L-aspartate oxidase	NA	NA	NA	NA
QBJ83134.1\|2749900_2751088_+	IscS subfamily cysteine desulfurase	A0A141ZJV0	Faustovirus	2.3e-33	27.4
QBJ83135.1\|2751047_2751590_+	transcription repressor NadR	NA	NA	NA	NA
QBJ83136.1\|2751613_2752471_-	prephenate dehydratase	NA	NA	NA	NA
QBJ83137.1\|2752487_2752931_-	ACT domain-containing protein	NA	NA	NA	NA
QBJ83138.1\|2752991_2754278_-	GTPase ObgE	NA	NA	NA	NA
QBJ83139.1\|2754311_2754890_-	sporulation initiation phosphotransferase B	NA	NA	NA	NA
QBJ83140.1\|2755210_2755495_-	50S ribosomal protein L27	NA	NA	NA	NA
QBJ83141.1\|2755507_2755846_-\|protease	ribosomal-processing cysteine protease Prp	NA	NA	NA	NA
QBJ83142.1\|2755848_2756157_-	50S ribosomal protein L21	NA	NA	NA	NA
QBJ83143.1\|2756303_2757170_-	stage IV sporulation protein FB	NA	NA	NA	NA
QBJ83144.1\|2757162_2757957_-	stage IV sporulation protein FA	NA	NA	NA	NA
QBJ83145.1\|2758105_2758912_-	septum site-determining protein MinD	NA	NA	NA	NA
QBJ83146.1\|2758913_2759594_-	septum site-determining protein MinC	NA	NA	NA	NA
QBJ83147.1\|2759646_2760165_-	rod shape-determining protein MreD	NA	NA	NA	NA
QBJ83148.1\|2760161_2761034_-	cell shape-determining protein MreC	NA	NA	NA	NA
QBJ83149.1\|2761064_2762078_-	rod shape-determining protein	NA	NA	NA	NA
QBJ83150.1\|2762757_2763012_-	hypothetical protein	NA	NA	NA	NA
QBJ83151.1\|2763229_2763919_+	hypothetical protein	NA	NA	NA	NA
QBJ83152.1\|2764240_2764786_+	hypothetical protein	NA	NA	NA	NA
QBJ83153.1\|2764835_2765024_+	hypothetical protein	A0A2H4J4T3	uncultured_Caudovirales_phage	7.7e-13	55.0
QBJ83154.1\|2765188_2766307_-	aspartate phosphatase	D6R410	Bacillus_phage	1.2e-137	66.9
QBJ83155.1\|2766654_2768427_+	hypothetical protein	A0A1P8CWI7	Bacillus_phage	2.2e-125	56.4
QBJ83156.1\|2768439_2768901_+	SMI1/KNR4 family protein	NA	NA	NA	NA
QBJ83157.1\|2768948_2769917_-	N-acetylmuramoyl-L-alanine amidase	A0A218KC88	Bacillus_phage	9.1e-65	66.8
QBJ83158.1\|2769960_2770383_-\|holin	holin	D6R405	Bacillus_phage	1.8e-54	82.7
QBJ84672.1\|2770448_2770700_-	hypothetical protein	NA	NA	NA	NA
QBJ83159.1\|2770849_2771023_-	XkdX family protein	Q9ZXD9	Bacillus_phage	1.5e-18	77.2
QBJ83160.1\|2771022_2771394_-	hypothetical protein	Q9ZXE0	Bacillus_phage	6.2e-22	49.2
QBJ83161.1\|2771406_2773128_-	hypothetical protein	M4ZRP1	Bacillus_phage	4.0e-55	43.8
QBJ83162.1\|2773310_2773619_-	hypothetical protein	NA	NA	NA	NA
QBJ83163.1\|2773634_2775533_-	teichoic acid biosynthesis protein	A0A185AMX0	Staphylococcus_phage	7.3e-42	32.5
QBJ83164.1\|2775584_2777288_-	alkaline phosphatase	D6R400	Bacillus_phage	1.4e-177	55.3
QBJ83165.1\|2777302_2778142_-\|tail	phage tail family protein	D6R3Z9	Bacillus_phage	1.2e-92	59.0
QBJ83166.1\|2778135_2782623_-\|tail	phage tail tape measure protein	A6M961	Geobacillus_virus	1.5e-66	41.5
QBJ83167.1\|2782822_2783200_-	hypothetical protein	NA	NA	NA	NA
QBJ83168.1\|2783266_2783878_-\|tail	phage tail protein	J7KKC8	Streptococcus_phage	3.6e-11	35.1
QBJ83169.1\|2783892_2784285_-	DUF3168 domain-containing protein	NA	NA	NA	NA
QBJ83170.1\|2784281_2784680_-	hypothetical protein	NA	NA	NA	NA
QBJ83171.1\|2784679_2784994_-\|head,tail	head-tail adaptor protein	A0A2H4JCB1	uncultured_Caudovirales_phage	2.9e-12	36.3
QBJ83172.1\|2784983_2785286_-\|head,tail	phage gp6-like head-tail connector protein	A0A0S2GLH6	Bacillus_phage	2.1e-12	46.3
QBJ83173.1\|2785303_2785765_-	collagen-like protein	D6R3Z0	Bacillus_phage	1.8e-10	58.9
QBJ83174.1\|2785788_2787084_-\|capsid	phage major capsid protein	A0A0A7RTL2	Clostridium_phage	5.2e-92	48.3
QBJ83175.1\|2787122_2787749_-\|head,protease	HK97 family phage prohead protease	Q9ZXF7	Bacillus_phage	7.6e-81	75.8
QBJ83176.1\|2787711_2788992_-\|portal	phage portal protein	D6R3Y6	Bacillus_phage	4.7e-154	64.0
QBJ83177.1\|2789180_2790890_-\|terminase	terminase large subunit	A0A0S2GLF0	Bacillus_phage	1.1e-206	62.6
QBJ83178.1\|2790886_2791402_-\|terminase	phage terminase small subunit P27 family	A6M947	Geobacillus_virus	2.2e-33	43.4
QBJ83179.1\|2791630_2791996_-	HNH endonuclease	A0A1U7Q1S7	Geobacillus_virus	2.1e-30	54.2
QBJ83180.1\|2791985_2792330_-	hypothetical protein	NA	NA	NA	NA
QBJ83181.1\|2792850_2793039_-	hypothetical protein	NA	NA	NA	NA
QBJ83182.1\|2793188_2793371_+	addiction module toxin, HicA family	D6R431	Bacillus_phage	6.1e-23	80.0
QBJ83183.1\|2793440_2793857_+	pilus assembly protein HicB	D6R430	Bacillus_phage	1.9e-67	87.6
QBJ83184.1\|2794289_2794664_-	ArpU family transcriptional regulator	Q9ZXB9	Bacillus_phage	8.1e-46	86.1
QBJ83185.1\|2795124_2795640_-	hypothetical protein	D6R425	Bacillus_phage	1.2e-95	97.7
QBJ83186.1\|2795673_2796213_-	nuclease	Q9ZXC2	Bacillus_phage	1.8e-94	96.1
QBJ83187.1\|2796209_2796647_-	hypothetical protein	Q9ZXC3	Bacillus_phage	4.8e-74	91.7
QBJ83188.1\|2796846_2799264_-	DNA primase	D6R422	Bacillus_phage	0.0e+00	88.8
QBJ83189.1\|2799324_2799762_-	DUF669 domain-containing protein	Q9ZXC5	Bacillus_phage	1.3e-79	97.2
QBJ83190.1\|2799785_2799983_-	hypothetical protein	Q9ZXC6	Bacillus_phage	1.1e-17	87.5
QBJ83191.1\|2799972_2800911_-	hypothetical protein	Q9ZXC7	Bacillus_phage	2.4e-163	92.3
QBJ83192.1\|2800914_2801469_-	hypothetical protein	Q9ZXC8	Bacillus_phage	6.9e-94	96.2
QBJ83193.1\|2801662_2801938_-	hypothetical protein	Q9ZXC9	Bacillus_phage	1.3e-21	49.4
QBJ83194.1\|2802158_2802431_-	XRE family transcriptional regulator	D6R414	Bacillus_phage	1.4e-39	94.4
QBJ83195.1\|2802710_2803148_+	immunity repressor protein	Q786F1	Bacillus_phage	5.9e-64	91.0
QBJ83196.1\|2803161_2803608_+	ImmA/IrrE family metallo-endopeptidase	Q9T201	Bacillus_phage	3.5e-72	88.5
QBJ83197.1\|2803647_2805075_+	recombinase family protein	Q9T200	Bacillus_phage	1.0e-229	85.1
QBJ83198.1\|2805078_2805495_-	DNA repair protein RadC	NA	NA	NA	NA
QBJ83199.1\|2805531_2806101_-	septum formation inhibitor Maf	NA	NA	NA	NA
QBJ83200.1\|2806253_2807252_-	SPOR domain-containing protein	NA	NA	NA	NA
QBJ83201.1\|2807385_2808132_-	prepilin peptidase	NA	NA	NA	NA
QBJ83202.1\|2808271_2809564_-	bifunctional folylpolyglutamate synthase/dihydrofolate synthase	NA	NA	NA	NA
QBJ83203.1\|2809623_2812266_-\|tRNA	valine--tRNA ligase	A0A1V0S951	Catovirus	3.7e-161	42.6
QBJ83204.1\|2812713_2812905_+	hypothetical protein	NA	NA	NA	NA
QBJ83205.1\|2812923_2813949_-\|coat	spore coat protein YsxE	NA	NA	NA	NA
QBJ83206.1\|2813981_2815709_-	stage VI sporulation protein D	NA	NA	NA	NA
QBJ83207.1\|2815839_2817132_-	glutamate-1-semialdehyde-2,1-aminomutase	NA	NA	NA	NA
QBJ83208.1\|2817161_2818136_-	porphobilinogen synthase	NA	NA	NA	NA
QBJ83209.1\|2818132_2818921_-	uroporphyrinogen-III synthase	NA	NA	NA	NA
QBJ83210.1\|2818910_2819855_-	hydroxymethylbilane synthase	NA	NA	NA	NA
QBJ83211.1\|2819887_2820718_-	protein HemX	NA	NA	NA	NA
QBJ83212.1\|2820725_2822093_-\|tRNA	glutamyl-tRNA reductase	NA	NA	NA	NA
QBJ83213.1\|2822322_2822820_+	hypothetical protein	NA	NA	NA	NA
QBJ83214.1\|2822841_2823429_-	GTP-binding protein	NA	NA	NA	NA
QBJ83215.1\|2823425_2825750_-	endopeptidase La	A0A0R6PGP8	Moraxella_phage	4.4e-182	43.5
QBJ83216.1\|2825930_2827589_-\|protease	ATP-dependent protease LonB	A0A1V0SHJ7	Hokovirus	8.1e-05	33.7
QBJ83217.1\|2827740_2829003_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.3e-148	64.9

DBSCAN-SWA_9

3102555 : 3179526

uncultured_Caudovirales_phage(46.15%)

portal,terminase,head,tail,holin,capsid,coat,integrase

attL 3137317:3137376|attR 3179605:3179680

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QBJ83478.1\|3102555_3103611_-\|coat	spore coat protein S	NA	NA	NA	NA
QBJ83479.1\|3103625_3104759_-	glycosyl transferase	NA	NA	NA	NA
QBJ83480.1\|3104948_3106022_+\|coat	CotS family spore coat protein	NA	NA	NA	NA
QBJ83481.1\|3106600_3108997_-	glycogen phosphorylase	Q8B3H5	Iris_mild_mosaic_virus	3.4e-12	40.2
QBJ83482.1\|3108983_3110438_-	glycogen synthase GlgA	NA	NA	NA	NA
QBJ83483.1\|3110434_3111466_-	glucose-1-phosphate adenylyltransferase	NA	NA	NA	NA
QBJ83484.1\|3111489_3112632_-	glucose-1-phosphate adenylyltransferase	NA	NA	NA	NA
QBJ83485.1\|3112628_3114512_-	1,4-alpha-glucan branching enzyme	NA	NA	NA	NA
QBJ83486.1\|3122168_3122747_+	thiamine transporter ThiT	NA	NA	NA	NA
QBJ83487.1\|3122788_3123310_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
QBJ83488.1\|3123327_3124857_-	flotillin family protein	A0A2I2L4B2	Orpheovirus	2.7e-07	27.9
QBJ84685.1\|3124877_3125402_-	hypothetical protein	NA	NA	NA	NA
QBJ83489.1\|3125569_3126058_+	DinB family protein	NA	NA	NA	NA
QBJ83490.1\|3126063_3126642_-	MOSC domain-containing protein	NA	NA	NA	NA
QBJ84686.1\|3126729_3127938_-	alcohol dehydrogenase EutG	NA	NA	NA	NA
QBJ83491.1\|3127954_3129427_-	betaine-aldehyde dehydrogenase	NA	NA	NA	NA
QBJ83492.1\|3129625_3130168_+	transcriptional regulator	NA	NA	NA	NA
QBJ83493.1\|3130365_3130911_+	hypothetical protein	NA	NA	NA	NA
QBJ83494.1\|3131276_3131945_+	TrkA family potassium uptake protein	NA	NA	NA	NA
QBJ83495.1\|3131951_3133289_+	Ktr system potassium transporter B	NA	NA	NA	NA
QBJ83496.1\|3133324_3133588_-	hypothetical protein	NA	NA	NA	NA
QBJ83497.1\|3133696_3134545_-	exo-glucosaminidase LytG	A0A0K2CP65	Brevibacillus_phage	1.0e-24	41.1
QBJ83498.1\|3134705_3136241_-	MFS transporter	NA	NA	NA	NA
QBJ83499.1\|3136758_3137244_+	cysteine dioxygenase	NA	NA	NA	NA
3137317:3137376	attL	NA	NA	NA	NA
QBJ83500.1\|3137598_3137787_+	hypothetical protein	A0A2H4J4T3	uncultured_Caudovirales_phage	1.8e-14	59.0
QBJ83501.1\|3137810_3138416_-	hypothetical protein	NA	NA	NA	NA
QBJ83502.1\|3138434_3138959_-	hypothetical protein	NA	NA	NA	NA
QBJ83503.1\|3138955_3139372_-	hypothetical protein	NA	NA	NA	NA
QBJ83504.1\|3139573_3139819_-	DNA-binding protein	A0A2H4JDR0	uncultured_Caudovirales_phage	6.5e-20	58.8
QBJ83505.1\|3140302_3140692_+	hypothetical protein	NA	NA	NA	NA
QBJ83506.1\|3140747_3141569_-	N-acetylmuramoyl-L-alanine amidase	A0A218KC88	Bacillus_phage	5.0e-64	72.7
QBJ83507.1\|3141621_3141885_-\|holin	phage holin	A0A2H4J6M0	uncultured_Caudovirales_phage	3.2e-25	69.0
QBJ84687.1\|3141900_3142170_-	protein xhlA	A0A2H4JD40	uncultured_Caudovirales_phage	1.0e-26	71.9
QBJ83508.1\|3142256_3142514_-	hypothetical protein	NA	NA	NA	NA
QBJ83509.1\|3142525_3142696_-	XkdX family protein	NA	NA	NA	NA
QBJ83510.1\|3142856_3143261_-	hypothetical protein	NA	NA	NA	NA
QBJ83511.1\|3143275_3146698_-	hypothetical protein	Q5YA57	Bacillus_phage	5.0e-134	46.4
QBJ83512.1\|3146710_3147475_-\|tail	phage tail protein	NA	NA	NA	NA
QBJ83513.1\|3147471_3152187_-	hypothetical protein	A0A1W6JQL3	Staphylococcus_phage	3.1e-33	29.3
QBJ84688.1\|3152191_3152500_-	hypothetical protein	NA	NA	NA	NA
QBJ83514.1\|3152547_3153060_-	hypothetical protein	NA	NA	NA	NA
QBJ83515.1\|3153114_3153354_-	fibronectin type III domain-containing protein	NA	NA	NA	NA
QBJ84689.1\|3153373_3153589_-	alpha-mannosidase	Q0PDK9	Bacillus_phage	1.3e-19	74.2
QBJ83516.1\|3153629_3154154_-\|tail	phage major tail protein, TP901-1 family	Q0PDK9	Bacillus_phage	6.2e-28	42.2
QBJ83517.1\|3154167_3154566_-	DUF3168 domain-containing protein	W8EK61	Geobacillus_phage	8.4e-25	44.6
QBJ83518.1\|3154584_3155001_-	HK97 gp10 family phage protein	O48447	Bacillus_phage	1.1e-32	52.9
QBJ83519.1\|3154987_3155332_-\|head,tail	phage head-tail adapter protein	NA	NA	NA	NA
QBJ83520.1\|3155328_3155628_-	hypothetical protein	NA	NA	NA	NA
QBJ83521.1\|3155636_3155888_-	hypothetical protein	NA	NA	NA	NA
QBJ83522.1\|3155889_3156225_-	hypothetical protein	NA	NA	NA	NA
QBJ83523.1\|3156229_3157147_-\|capsid	phage major capsid protein	A0A2H4JCG0	uncultured_Caudovirales_phage	7.2e-112	66.3
QBJ83524.1\|3157161_3157743_-	hypothetical protein	A0A2H4J4P4	uncultured_Caudovirales_phage	5.1e-55	57.4
QBJ83525.1\|3157840_3158080_-	hypothetical protein	NA	NA	NA	NA
QBJ83526.1\|3158485_3159409_-\|head	phage head morphogenesis protein	A0A1Q1PVS0	Bacillus_phage	4.6e-66	44.5
QBJ83527.1\|3159395_3160799_-\|portal	phage portal protein	A0A2H4J4Q7	uncultured_Caudovirales_phage	2.6e-153	59.8
QBJ83528.1\|3160795_3162070_-\|terminase	PBSX family phage terminase large subunit	M4ZRM5	Bacillus_phage	6.0e-157	63.1
QBJ83529.1\|3162069_3162774_-	hypothetical protein	A0A2P1JTW4	Anoxybacillus_phage	6.4e-68	60.9
QBJ83530.1\|3162931_3163159_-	hypothetical protein	NA	NA	NA	NA
QBJ83531.1\|3163422_3163893_-	hypothetical protein	A0A2H4J4R7	uncultured_Caudovirales_phage	2.0e-25	51.2
QBJ83532.1\|3164114_3164246_-	hypothetical protein	NA	NA	NA	NA
QBJ83533.1\|3164547_3164751_-	hypothetical protein	NA	NA	NA	NA
QBJ83534.1\|3164934_3165156_-	hypothetical protein	NA	NA	NA	NA
QBJ83535.1\|3165171_3165369_-	hypothetical protein	A0A1P8CWX9	Bacillus_phage	2.3e-20	81.2
QBJ83536.1\|3165365_3165578_-	hypothetical protein	NA	NA	NA	NA
QBJ83537.1\|3165574_3165760_-	hypothetical protein	NA	NA	NA	NA
QBJ83538.1\|3165752_3165947_-	hypothetical protein	NA	NA	NA	NA
QBJ83539.1\|3165943_3166324_-	hypothetical protein	A0A2I6UHP7	Bacillus_phage	6.3e-22	46.2
QBJ83540.1\|3166323_3166881_-	dUTPase	R9TQ23	Paenibacillus_phage	2.1e-42	54.2
QBJ83541.1\|3167006_3167255_-	hypothetical protein	NA	NA	NA	NA
QBJ83542.1\|3167251_3167479_-	hypothetical protein	NA	NA	NA	NA
QBJ83543.1\|3167475_3167760_-	hypothetical protein	NA	NA	NA	NA
QBJ83544.1\|3167792_3167999_-	hypothetical protein	A0A2H4J4M6	uncultured_Caudovirales_phage	1.6e-19	75.4
QBJ83545.1\|3168203_3168413_-	hypothetical protein	NA	NA	NA	NA
QBJ83546.1\|3168366_3168825_-	hypothetical protein	A0A2H4J891	uncultured_Caudovirales_phage	4.1e-60	80.7
QBJ83547.1\|3168960_3169362_-	hypothetical protein	R4JMS5	Bacillus_phage	3.0e-14	40.9
QBJ83548.1\|3169591_3170407_-	hypothetical protein	A6XMI1	Bacillus_virus	5.1e-61	48.5
QBJ83549.1\|3170327_3171041_-	DnaD domain protein	A0A1L2JY26	Aeribacillus_phage	8.3e-07	50.0
QBJ83550.1\|3171198_3172041_-	recombinase RecT	A0A2H4JCY8	uncultured_Caudovirales_phage	3.5e-129	85.5
QBJ83551.1\|3172043_3172994_-	hypothetical protein	A0A2H4JA52	uncultured_Caudovirales_phage	2.2e-132	71.1
QBJ83552.1\|3172993_3173182_-	hypothetical protein	NA	NA	NA	NA
QBJ83553.1\|3173174_3173408_-	hypothetical protein	NA	NA	NA	NA
QBJ83554.1\|3173508_3173706_-	hypothetical protein	NA	NA	NA	NA
QBJ83555.1\|3173653_3173884_-	hypothetical protein	NA	NA	NA	NA
QBJ83556.1\|3173880_3174138_-	hypothetical protein	A0A2H4J4M9	uncultured_Caudovirales_phage	1.7e-10	42.2
QBJ83557.1\|3174134_3174704_-	transcriptional regulator	A0A2H4J884	uncultured_Caudovirales_phage	4.2e-62	58.0
QBJ83558.1\|3174760_3175504_-	phage regulatory protein	A0A2H4J4N4	uncultured_Caudovirales_phage	1.2e-109	78.8
QBJ83559.1\|3175505_3175697_-	DNA-binding protein	NA	NA	NA	NA
QBJ83560.1\|3175708_3175936_-	XRE family transcriptional regulator	A0A2H4J4N8	uncultured_Caudovirales_phage	2.8e-17	63.0
QBJ83561.1\|3176099_3176483_+	transcriptional regulator	A0A2H4J6F9	uncultured_Caudovirales_phage	9.5e-34	67.8
QBJ83562.1\|3176750_3177704_+	hypothetical protein	A0A1S5S992	Streptococcus_phage	7.7e-16	44.7
QBJ83563.1\|3177775_3178279_+\|portal	phage portal protein	A0A2H4JA43	uncultured_Caudovirales_phage	7.8e-60	66.5
QBJ83564.1\|3178299_3179526_+\|integrase	site-specific integrase	A0A0K2CZ62	Paenibacillus_phage	2.3e-105	48.3
3179605:3179680	attR	NA	NA	NA	NA

DBSCAN-SWA_10

3826308 : 3890452

Staphylococcus_phage(15.38%)

coat,bacteriocin,tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QBJ84172.1\|3826308_3827979_-\|tRNA	arginine--tRNA ligase	NA	NA	NA	NA
QBJ84173.1\|3827975_3828404_-	DUF1934 domain-containing protein	NA	NA	NA	NA
QBJ84174.1\|3828716_3828848_+\|bacteriocin	subtilosin A family bacteriocin	NA	NA	NA	NA
QBJ84175.1\|3828804_3828957_+\|bacteriocin	bacteriocin-like protein SboX	NA	NA	NA	NA
QBJ84176.1\|3828981_3830328_+	subtilosin maturase AlbA	NA	NA	NA	NA
QBJ84177.1\|3830340_3830502_+\|bacteriocin	bacteriocin biosynthesis protein AlbB	NA	NA	NA	NA
QBJ84178.1\|3830498_3831218_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	7.3e-19	27.2
QBJ84179.1\|3831210_3832521_+\|bacteriocin	bacteriocin biosynthesis protein AlbD	NA	NA	NA	NA
QBJ84722.1\|3832510_3833671_+	insulinase family protein	NA	NA	NA	NA
QBJ84180.1\|3833675_3834956_+	insulinase family protein	NA	NA	NA	NA
QBJ84181.1\|3834952_3835654_+\|bacteriocin	bacteriocin biosynthesis protein AlbG	NA	NA	NA	NA
QBJ84182.1\|3835659_3837036_-	hypothetical protein	NA	NA	NA	NA
QBJ84183.1\|3837075_3838431_-	hypothetical protein	NA	NA	NA	NA
QBJ84184.1\|3838427_3838658_-	hypothetical protein	NA	NA	NA	NA
QBJ84185.1\|3838660_3839806_+	tetratricopeptide repeat protein	A0A1P8CWN8	Bacillus_phage	5.0e-78	43.0
QBJ84186.1\|3839789_3839909_+	phosphatase RapF inhibitor	NA	NA	NA	NA
QBJ84187.1\|3840161_3840641_+	hypothetical protein	NA	NA	NA	NA
QBJ84188.1\|3840789_3841578_+	hypothetical protein	NA	NA	NA	NA
QBJ84189.1\|3841564_3842239_+	hypothetical protein	NA	NA	NA	NA
QBJ84190.1\|3842239_3843046_+	hypothetical protein	NA	NA	NA	NA
QBJ84191.1\|3843048_3843696_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	7.7e-28	40.0
QBJ84192.1\|3843688_3844249_+	hypothetical protein	NA	NA	NA	NA
QBJ84193.1\|3844297_3845170_-	agmatinase	NA	NA	NA	NA
QBJ84194.1\|3845230_3846061_-	polyamine aminopropyltransferase	NA	NA	NA	NA
QBJ84195.1\|3846262_3848338_+	penicillin-binding protein	NA	NA	NA	NA
QBJ84196.1\|3848630_3849149_-	hypothetical protein	NA	NA	NA	NA
QBJ84197.1\|3849162_3849822_-\|protease	site-2 protease family protein	NA	NA	NA	NA
QBJ84198.1\|3849930_3850119_+	2-hydroxymuconate tautomerase	NA	NA	NA	NA
QBJ84199.1\|3850161_3850581_-	MarR family transcriptional regulator	NA	NA	NA	NA
QBJ84200.1\|3850700_3852617_-\|tRNA	threonine--tRNA ligase	A0A2K9L297	Tupanvirus	3.7e-142	42.7
QBJ84201.1\|3853461_3854862_-	MFS transporter	NA	NA	NA	NA
QBJ84202.1\|3854861_3855332_-	Rrf2 family transcriptional regulator	NA	NA	NA	NA
QBJ84203.1\|3855443_3855944_-	YwgA family protein	NA	NA	NA	NA
QBJ84204.1\|3855979_3857281_-	hypothetical protein	E3T4P8	Cafeteria_roenbergensis_virus	3.2e-25	28.9
QBJ84205.1\|3857442_3857667_-	DUF1450 domain-containing protein	NA	NA	NA	NA
QBJ84206.1\|3857881_3858658_+	prespore-specific transcriptional regulator RsfA	A0A1D6X8E5	Bacillus_phage	7.6e-06	50.0
QBJ84207.1\|3858823_3859714_-	EamA family transporter	NA	NA	NA	NA
QBJ84208.1\|3859881_3860727_-	octanoyl-[GcvH]:protein N-octanoyltransferase	NA	NA	NA	NA
QBJ84209.1\|3860775_3861675_-	LysR family transcriptional regulator	A0A2H4J8I9	uncultured_Caudovirales_phage	3.6e-07	42.5
QBJ84210.1\|3861820_3862792_-	phosphate acetyltransferase	NA	NA	NA	NA
QBJ84723.1\|3863076_3863826_+	heme-dependent peroxidase	NA	NA	NA	NA
QBJ84211.1\|3863958_3864738_+	SDR family oxidoreductase	NA	NA	NA	NA
QBJ84212.1\|3864752_3865952_-	aspartate aminotransferase	NA	NA	NA	NA
QBJ84213.1\|3865952_3867137_-	MFS transporter	NA	NA	NA	NA
QBJ84214.1\|3867133_3868552_-	carboxylate--amine ligase	NA	NA	NA	NA
QBJ84215.1\|3868570_3869338_-	dihydroanticapsin 7-dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	2.2e-21	30.9
QBJ84216.1\|3869334_3870042_-	bacilysin biosynthesis protein BacB	NA	NA	NA	NA
QBJ84217.1\|3870031_3870646_-	bacilysin biosynthesis protein BacA	NA	NA	NA	NA
QBJ84218.1\|3870797_3872036_-	MFS transporter	NA	NA	NA	NA
QBJ84219.1\|3872245_3873658_-	amino acid permease	NA	NA	NA	NA
QBJ84220.1\|3873705_3875358_-	peptidase M20	NA	NA	NA	NA
QBJ84221.1\|3875431_3876979_-	L-glutamate gamma-semialdehyde dehydrogenase	NA	NA	NA	NA
QBJ84222.1\|3877205_3878480_-	catabolic NAD-specific glutamate dehydrogenase RocG	NA	NA	NA	NA
QBJ84223.1\|3878656_3879121_-	hypothetical protein	NA	NA	NA	NA
QBJ84224.1\|3879445_3879901_-\|coat	spore coat protein	NA	NA	NA	NA
QBJ84225.1\|3879893_3880745_-	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	3.7e-38	39.3
QBJ84226.1\|3880758_3881706_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	9.8e-72	43.8
QBJ84227.1\|3881705_3882446_-	glucose-1-phosphate thymidylyltransferase	I7I009	Enterobacteria_phage	4.5e-48	41.9
QBJ84228.1\|3882470_3883490_-\|coat	spore coat protein	NA	NA	NA	NA
QBJ84229.1\|3883492_3884215_-\|coat	spore coat protein	NA	NA	NA	NA
QBJ84230.1\|3884207_3885329_-\|coat	spore coat protein	NA	NA	NA	NA
QBJ84231.1\|3885328_3886198_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
QBJ84232.1\|3886198_3887368_-	UDP-4-amino-4, 6-dideoxy-N-acetyl-beta-L-altrosamine transaminase	A0A1D8KU11	Synechococcus_phage	3.2e-16	26.9
QBJ84233.1\|3887388_3888813_-\|coat	spore coat protein	NA	NA	NA	NA
QBJ84234.1\|3888817_3889588_-	glycosyltransferase family 2 protein	A0A0F7L2F7	uncultured_marine_virus	2.6e-06	28.6
QBJ84235.1\|3889906_3890452_+\|coat	spore coat protein GerQ	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage