CRISPRimmunity

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
LR130759	Mycobacterium sp. DSM 104308 isolate 901379 genome assembly, chromosome: I	6 crisprs	cas3,csa3,WYL,cas4,DEDDh,DinG,casR	21	32	2	0

1. LR130759

CRISPR-Cas detection and classification

Crispr_ID: LR130759_5

• CRISPR_ID: LR130759_5
• CRISPR_location: 1423947-1424027
• CRISPR_type: Orphan
• Repeat_type: NA
• Spacer_info: 1 spacers

Consensus repeat of LR130759_5

Consensus_repeat	Method
AGCCCTGCGACGATGCCGCCCGCG	CRISPRCasFinder

spacers of LR130759_5

>5.1|1423971|33|LR130759|CRISPRCasFinder
TGGCGGGCGGTGAGGAGCTGGGCGATGTGGTCG

CRISPR arrays and Neighbor proteins around LR130759_5

CRISPR arrays

The CRISPR arrays of LR130759_5

>merge|LR130759|5|1423947-1424027|CRISPRCasFinder
AGCCCTGCGACGATGCCGCCCGCGTGGCGGGCGGTGAGGAGCTGGGCGATGTGGTCGAGCCCTGCGACGATGCCGCCCGCG

>LR130759|5|4|1423947-1424027|CRISPRCasFinder
AGCCCTGCGACGATGCCGCCCGCG	TGGCGGGCGGTGAGGAGCTGGGCGATGTGGTCG
AGCCCTGCGACGATGCCGCCCGCG

Neighbor Proteins Overview

Protein	Signature genes	Signature genes Name	Protein_function
LR130759.1|VDM87703.1|1424082_1426176_+|ATP-dependent-DNA-helicase-UvrD2	unknown	unknown	gnl|CDD|223288
LR130759.1|VDM87707.1|1429079_1429445_+|hypothetical-protein	unknown	unknown	unknown
LR130759.1|VDM87694.1|1411813_1412599_-|Lipase-3-precursor	unknown	unknown	gnl|CDD|223669
LR130759.1|VDM87706.1|1426964_1428431_-|Aminoglycoside-acetyltransferase-regulator	unknown	unknown	gnl|CDD|223733
LR130759.1|VDM87702.1|1423678_1423933_-|Putative-glutaredoxin.1/MT3292	unknown	unknown	gnl|CDD|131255
LR130759.1|VDM87709.1|1431403_1431856_-|hypothetical-protein	unknown	unknown	gnl|CDD|223021
LR130759.1|VDM87693.1|1411502_1411811_-|putative-methylated-DNA-protein-cysteine-methyltransferase	unknown	unknown	gnl|CDD|226219
LR130759.1|VDM87705.1|1426522_1426876_+|putative-transcriptional-regulator-WhiB7	unknown	unknown	gnl|CDD|376791
LR130759.1|VDM87699.1|1420678_1421749_+|Voltage-gated-potassium-channel-Kch	unknown	unknown	gnl|CDD|367001
LR130759.1|VDM87701.1|1422807_1423539_-|hypothetical-protein	unknown	unknown	gnl|CDD|372884
LR130759.1|VDM87696.1|1413189_1414035_+|hypothetical-protein	unknown	unknown	unknown
LR130759.1|VDM87697.1|1414153_1417315_+|DNA-helicase-II	unknown	unknown	gnl|CDD|223288
LR130759.1|VDM87712.1|1433916_1434804_-|bacteriocin-biosynthesis-cyclodehydratase-domain-protein	unknown	unknown	gnl|CDD|274832
LR130759.1|VDM87708.1|1429276_1431376_-|hypothetical-protein	unknown	unknown	gnl|CDD|223021
LR130759.1|VDM87711.1|1433723_1433897_+|hypothetical-protein	unknown	unknown	unknown
LR130759.1|VDM87700.1|1421867_1422791_+|NADH-pyrophosphatase	unknown	unknown	gnl|CDD|234699
LR130759.1|VDM87704.1|1426305_1426464_+|hypothetical-protein	unknown	unknown	unknown
LR130759.1|VDM87695.1|1412655_1412865_-|hypothetical-protein	unknown	unknown	unknown
LR130759.1|VDM87710.1|1431880_1433545_+|hypothetical-protein	unknown	unknown	unknown
LR130759.1|VDM87698.1|1417326_1420617_+|ATP-dependent-DNA-helicase-UvrD1	unknown	unknown	gnl|CDD|223288

rpsblast for functional proteins

Protein	Function_ID	Function_description	E-value
LR130759.1|VDM87703.1|1424082_1426176_+|ATP-dependent-DNA-helicase-UvrD2	gnl|CDD|223288	COG0210, UvrD, Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair].	7.35751e-115
LR130759.1|VDM87694.1|1411813_1412599_-|Lipase-3-precursor	gnl|CDD|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	1.11858e-18
LR130759.1|VDM87706.1|1426964_1428431_-|Aminoglycoside-acetyltransferase-regulator	gnl|CDD|223733	COG0661, AarF, Predicted unusual protein kinase [General function prediction only].	3.31254e-130
LR130759.1|VDM87702.1|1423678_1423933_-|Putative-glutaredoxin.1/MT3292	gnl|CDD|131255	TIGR02200, conserved_hypothetical_protein, Glutaredoxin-like protein. This family of glutaredoxin-like proteins is limited to the Actinobacteria and contains the conserved CxxC motif.	9.69181e-34
LR130759.1|VDM87709.1|1431403_1431856_-|hypothetical-protein	gnl|CDD|223021	PHA03247, PHA03247, large tegument protein UL36; Provisional.	0.007708
LR130759.1|VDM87699.1|1420678_1421749_+|Voltage-gated-potassium-channel-Kch	gnl|CDD|367001	pfam02254, TrkA_N, TrkA-N domain. This domain is found in a wide variety of proteins. These protein include potassium channels, phosphoesterases, and various other transporters. This domain binds to NAD.	1.43862e-21
LR130759.1|VDM87705.1|1426522_1426876_+|putative-transcriptional-regulator-WhiB7	gnl|CDD|376791	pfam02467, Whib, Transcription factor WhiB. WhiB is a putative transcription factor in Actinobacteria, required for differentiation and sporulation.	1.64177e-14
LR130759.1|VDM87701.1|1422807_1423539_-|hypothetical-protein	gnl|CDD|372884	pfam14032, PknH_C, PknH-like extracellular domain. This domain is functionally uncharacterized. It is found as the periplasmic domain of the bacterial protein kinase PknH. The domain is also found in isolation in numerous proteins, for example the lipoproteins lpqQ, lprH, lppH and lpqA from M. tuberculosis. This family of proteins is found in bacteria. Proteins in this family are typically between 214 and 268 amino acids in length. There are two completely conserved C residues that are likely to form a disulphide bond. A second pair of cysteines are less well conserved probably form a second disulphide bond. It seems likely that this domain functions to bind some as yet unknown ligand.	1.81187e-10
LR130759.1|VDM87693.1|1411502_1411811_-|putative-methylated-DNA-protein-cysteine-methyltransferase	gnl|CDD|226219	COG3695, COG3695, Predicted methylated DNA-protein cysteine methyltransferase [DNA replication, recombination, and repair].	7.46945e-30
LR130759.1|VDM87697.1|1414153_1417315_+|DNA-helicase-II	gnl|CDD|223288	COG0210, UvrD, Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair].	3.94265e-70
LR130759.1|VDM87712.1|1433916_1434804_-|bacteriocin-biosynthesis-cyclodehydratase-domain-protein	gnl|CDD|274832	TIGR03882, hypothetical_protein, bacteriocin biosynthesis cyclodehydratase domain. This model describes a ThiF-like domain of a fusion protein found in clusters associated with the production of TOMMs (thiazole/oxazole-modified microcins), small bacteriocins with characteristic heterocycle modifications. This domain is presumed to act as a cyclodehydratase, as do members of the SagC family modeled by TIGR03603.	0.000376427
LR130759.1|VDM87708.1|1429276_1431376_-|hypothetical-protein	gnl|CDD|223021	PHA03247, PHA03247, large tegument protein UL36; Provisional.	2.27653e-07
LR130759.1|VDM87700.1|1421867_1422791_+|NADH-pyrophosphatase	gnl|CDD|234699	PRK00241, nudC, NAD(+) diphosphatase.	2.05916e-119
LR130759.1|VDM87698.1|1417326_1420617_+|ATP-dependent-DNA-helicase-UvrD1	gnl|CDD|223288	COG0210, UvrD, Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair].	2.59574e-104

Protein sequences

>LR130759.1|VDM87702.1|1423678_1423933_-|Putative-glutaredoxin.1/MT3292
MTNAALTIYTTSWCGYCLRLKTALNAEGISYHEVDIERDPAAGEFVSSVNRGNKTVPTVKFGDGSTLTNPSVGEVKAKMTQHSG
>LR130759.1|VDM87701.1|1422807_1423539_-|hypothetical-protein
MGPRGAKHEIGRSATSWFKRRPVIIGTTFVGAIRSVVVVCAALAAIAACSHHGTSAKPSTTTTQPKGVDALIVSVEEVRRIADFEELTAHERADVRNPPPGDLSAPGPCRAAGTSDLTFASGWLEFRSAGYSGVTDDIAPGGRALVDSVSQAVAIYPDTHAARNALDQLGNSLKACMALQDPAYNFKVDRPDATTLRITDEGWSHLYRAQDAVLISVGVLGIEPAERIATTVLDIITDRIKQQ
>LR130759.1|VDM87700.1|1421867_1422791_+|NADH-pyrophosphatase
MDFQLRDVPLLSRVGADRADHLRTDIEAAARGWADAALLRVDSRNQVLVANGQVVLGAAAALADAPPPEAVFLGRIASGRHVWAIRDALVPPADPSVHAEVVDLRRLGRIIDDTSSQLVASAMALLNWHDSSRFSPLDGSPTKPARSGWSRVNVLTGHEEFPRIDAAVIVLVHDGGDRAVLARQAVWPDGMFSLLAGFVEAGESFEVCVAREIREEIGLTVRDVRYLGSQPWPFPRSLMVGFHALGDPDQAFSFNDGEIAEAAWFTRGEVRAALDAGDWTTASKSKLLLPGSVSIARVIIESWAARC
>LR130759.1|VDM87699.1|1420678_1421749_+|Voltage-gated-potassium-channel-Kch
MARGSWRRARRLDERLTVQPSYALVGVLRIPQGQASPARIISRRVAIALVALLAGAITVYVDRDGYHDSQGDSLSFLDCVYYSAVTLSTTGYGDITPVSEAARAANVLIITPLRIAFLILLVGTTLEVVTETSRQALKIQRWRSRVRNHTVVIGYGTKGKTAISAMLGDEVVPGEIVVVDTEQAALERAAAAGLVTVHGDATKSDVLRLAGAQHAASIIVAASRDDTAALVTLTAREISPKAQIVASIREAENQHLLEQSGADSVVVSSETAGRLLGLATTTPSVVQMIEDLLTPDAGLAIAEREVEPSEIGGSPRHLRDIVLGVVRGGQLLRIGAPEVDAIEANDRLLYIRNTGH
>LR130759.1|VDM87698.1|1417326_1420617_+|ATP-dependent-DNA-helicase-UvrD1
MRYSPAELACALGVLPPTDEQAAVIAAPPGPLVVIAGAGAGKTETMAARVVWLIANGYAAPGQVLGLTFTRKAAGQLLRRVRSRLSRLSGLDPDPAARDAAGSPVISTYHAFAGSLLRDYGLLLPVEPDTRLLGETELWQLAFDVVTGYRGDLHIEKTPAAVTSMVLRLWGQLAEHLVDTRQLRDTHVELERLVHALPAGPYQRDRGPSQWLLRMLATQTERAELVPLLDALRERMRADKVMDFGMQMSAAARLAATCPQVGQDLRNHYRVVLLDEYQDTGHSQRVALSSLFGGGVDDGLALTAVGDPIQSIYGWRGASATNLPRFSTDFALADGTPAPVLELRTSWRNPPRALHVANAISAPARRRSVAVHALRSRPDAAPGTVRCALLADVGAEREWIADQLRGHYRQAQVDGVSPPTAAVLVRRNADAAPIADALRSRGVPVEVVGLAGLLFVPEVADVVAMLRLVVDPTAGAAAMRVLTGPRWRLGARDLAALWRRALDLAVGSRSSESLSPEVVAMAAGPDVDTACLADAICDPGPAEGYSETGYGRISALSAELNLLRGHLDHSLPDLIAEVRRVLGVDCEARATWGAGGEWLGAEHLDAFSDVVAGYAERATASSSLTEMSTKASVAGLLAYLDTAADVENGLAPAQLTVARDRVQVLTVHAAKGLEWQVVAVAHLSGGVFPSSGSKGTWLTDPGELPPLLRGDRAAVGALGVPVLDISAVTNRKQLSDKISEHRGQLDQRRVDEERRLLYVGVTRAEDTLLVSGHHWGVTGIKPRGPSEFLCEIKDIIDRSAESGDPCGIVEHWAPAPAEGELNPLRDHAVEANWPDDPLAARRCDVERGAALVAEAMSAESTALAGLAANGEEWVADVDALLAERALADQPLVRKLPRQLSVSGLVELARDPAGATPRLVHRLPTRPDPHALLGNAFHSWVQQFYGAELLFDLGDLPGAVDSDVGNAAELAELQAAFTGSPWAARTPIAVEVPFEMPIGDTVVRGRIDAIFADSDGGVTVVDWKTGEAPRGSEAMRQAAVQLAIYRLAWAALSGCPESAVRTAFYYVRNGTTIVPDELPDTAELAALMADSGRPGTT
>LR130759.1|VDM87697.1|1414153_1417315_+|DNA-helicase-II
MSLSWDAQARGVLAPGLRGLVRVLGGPGTGKSSLLVDAAVAHIAAGADPGSVLLLTGSGRMGMDARSALTSVLLRSSATGSSRAAVREPLVRTVHGYAYAVLRRAAERAGGAPPRLLTGAEQDAIIRELLAGDLADASAERSAWPLHLRPALSTAGFANELRSLMARCAERGVDPYELERLGRRCARPEWIAAGRFAQQYEQVMLLRAAVGTATPQATAPALSAAELVGAALEAFAVDPELLAAERARIRVLLVDDAQQLDPQAARLIRMLAAGTHLALVAGDPNQAVFGFRGGESAGLLGGPLDTDPSVTLTVSYRCAAAVASAISGVASRLPGGSAGRRIEGSGSDDGSVSVRLAASTHAESAMIADALRRAHLIDGVPWSQMAVIVRSIPRAAARLPRALAAAGVPVAMPAIGGSLCEERATRALLTVLAATADGLDGDQALSLLTGPIGRVDPVSLRQLRRTLLRGAIDRSSKSFADLLVAVLSPERPRGGGSQLPGPKAGAVRRVRAVLDAAARCHREGQDPRYTLWAAWHRSGLQTRWLAASERNGPAGVQATRDLAAVTALFDITDQYVSHTPGASLRGLIDHVAALRLPRVSSDPAVPTEQVKVLSAHAALGHEWDLVVIAGLQDGLWPNTIPRGGVLATQRLLDELDGVAADTSVRAPLLAEERRLLIAAMGRARRRLLVTAVDSDGAAGGQEVELPSAFFYELSQWADGDAGPDAAQPVSVPRVLSAAAVVGRLRGVVCAPDGVVCDADRACAATQLARLAKAGVPGADPAGWHGLIPVSTSDRLYGPDDVVTLTPSTLQTLNDCPLRWLAERHGGTNPRELRSTVGSVLHALFAETGKTESQLLAELDRLWQHLPFDADWYSTNELVRHRSMIQTFVEWRTQTRAELTEVGVEVDIDGVLEISRDDGGAIRLRGRVDRLERDAAGRLVIVDIKTGKTPVSKDDSQQHAQLALYQLAVAEGMVDTGSGPGGARLVYPGKNGITGAAQREQDPLTPAVGDHWRNLVRQAAHAAAGPQFIARRNDGCSHCPIRPFCPAHAEGTTP
>LR130759.1|VDM87696.1|1413189_1414035_+|hypothetical-protein
MGSIKRGWALTGQSWRVLKSDLSPLMIFPLLSTVFAILATAAIWAPTLIVRGVFDGQQVDSRDPIFYIAGLATAYLSTFIAIFFNVALAACAVRSMRGEDTKVSEGVIAAMHRLGPILGWTFVATTVGLILRALEERLPLLGKIAVWLTGAAWAIATFFVVPVVALEGTGPIASLKRSAAVVKARWGESATGAATITVVIWLVSIAIVVAGAGGAIGFLAIGQPVLAAVVVAITVAAIIIVSLISSALGQIFRVAVYQYAVSGQAPVGFDGQLLQAAFQRR
>LR130759.1|VDM87695.1|1412655_1412865_-|hypothetical-protein
MGNAEVAGPHDAVPEADAADQRLEAGFDDEAGLDTTYLSNARERDANEADVIDQAYIVPPQDDDLDIDR
>LR130759.1|VDM87694.1|1411813_1412599_-|Lipase-3-precursor
MTPDLNVHAYGPAGPAQVLTIHGVTEHGQAWEFLSGHLPEVSIAAPDLLGHGRSSWAAPWSIDANVSALAAFLDHQSNGPVVVVGHSFGGAIALHLAARRPDLVGALILLDPAVGLDGARVREVVDAMVAFPDYPDPSEARAEKATGAWADVDPTVLDTELEEHLIELPNGRYGWRISLPAMVCYWSELARDIVLPPAGTRTTLVRAVHADPQYVSDELIAALRERLGTEFDLRDFECGHMVPQAKPTEVAALIRAHLNRS
>LR130759.1|VDM87693.1|1411502_1411811_-|putative-methylated-DNA-protein-cysteine-methyltransferase
MAPVTDDQVERVRSLVAAIPSGRVATYGDIASVAGLSSPRIVGWIMRTDSMDLPWHRVITASGRPARHLTTRQLELLRAEGILSIDGKIALARVRYQFPPGA
>LR130759.1|VDM87703.1|1424082_1426176_+|ATP-dependent-DNA-helicase-UvrD2
MVADSMTAKLDDEQREAVLAARGPVCVLAGAGTGKTRTITHRIAQLVAGGHVAAGQVLAVTFTQRAAGEMRSRLRALDAAAQTGSGVGSVQALTFHAAAHRQLRYFWPRVVGDIGWQLLDSKFAIVARAASRARMNASTDDVRDLAGEIEWAKASLIGPEEYPTAVAAAGRDTPLDAGRIAVVYSEYESLKVRDESVTLLDFDDLLLHTAAAIENDAAVAEEFRDRYRCFVVDEYQDVTPLQQRVLSAWLGDRDDLTVVGDANQTIYSFTGASPRFLLDFSRRFPDATVVRLERDYRSTPQVVSLANRVIAAARGRVAGSKLQLSGQREPGPAPSFHEYPDEAAEAAAAAASIARLTESGVSPSEIAILYRVNAQSEVYEEALTEAGIAYQVRGGEGFFNRQEIKQAVVALQRAADRGVEGAVPDVVRAILEPLGLTAEEPVGTRARERWEGLTALAELVDDEVAQRPQLQLPGLLAELRTRADARHPPVVQGVTLASLHAAKGLEWDAVFLVGLVDGTLPISHALAHGPQSEPVEEERRLLYVGITRARVHLTLSWALARAAGGRQSRKPSRFLNGIAPQTRVDPGPSKPRRNRVATRCRVCNKELTTPAAVMLRRCETCAGDVNEGLLLQLKSWRLNVAKEQNVPAYIVFSDNTLIAIAELLPDDESALIAIPGIGARKLEQYGADVLELVRQAR
>LR130759.1|VDM87704.1|1426305_1426464_+|hypothetical-protein
MKNMNAFGVGVADPVLTAGTPPAARTAPSAAAGKHRVAAAAATYASVDRSPT
>LR130759.1|VDM87705.1|1426522_1426876_+|putative-transcriptional-regulator-WhiB7
MAKFLGLPPRNLVRITFKGQSQTRKQVRKDMSALTVPRQKLPVLPCHVGNPDLWFADTPADLERAKTLCANCPIRRQCLAAALERAEPWGVWGGEIFERGEVVSRKRPRGRPRKVAA
>LR130759.1|VDM87706.1|1426964_1428431_-|Aminoglycoside-acetyltransferase-regulator
MHTAQTPTSTITDAANPAHPHPHGSPSTQLWPDRHPDNSTVMDDGYVSEIKRGRAARNAKLASIPVGFAGRAALGFGKRLTGKSKDEVNAELMEKAANQLFTVLGELKGGAMKVGQALSVMEAAIPEQFGEPYREALTKLQKDAPPLPAAKVHRVLDAQLGTKWRERFSSFDDTPIASASIGQVHKAVWSDGREVAVKIQYPGADEALRADLKTMQRMVGVLKQLSPGADVQGVVDELIERTEMELDYRLEAQNQRLFAKAYAGHPRLLVPHVVASSPKVVIQEWIDGVPMAHIIRHGTQEQRDLIGTLLLELTFDAPRRVEMLHGDAHPGNFMLLPDDRMAVIDFGAVAPLPGGYPIELGMTIRLARDKNYDLLLPTMEKAGFIQRGQQVSVLEIDEMLRQYVEPIEVDVFHYTRKWLQRMTVSQFDRSVAQIKTARQMDLPPKLAIPMRVIASVAAILCQLDAHVPIKALSEELIPGFAEPDTAAV
>LR130759.1|VDM87707.1|1429079_1429445_+|hypothetical-protein
MGLGARVGWALRAVLGVLGGGCSVMGVRAVRVGSAEMVGLVGMRGGLVMAVWGVLGVSVGLVVRVCQVWLRGVRVLRVRLVGMRAMVGLGGVAGWCAVAVGSVVRVVWVVLVVMVGPVLAD
>LR130759.1|VDM87708.1|1429276_1431376_-|hypothetical-protein
MTGATGAAITAGAALTAGPAITVEGAAVATFTAVTTCRTITAGAAVITRIWPSRPVGAGSAMTTITPGPTIAVEPTIAAVTAMTPGHTRREAIRAIPAGPTIAPAGRSGAASALPPGPRSTDSAGPATTTGTPITAIAAITTGALVHTETALPTSPPIASNPAAPTSTANATHTMSGVPAGTANPAPTAVTTIPAIGPRRRHTASTGPTFSPSPAVTAVPTITGVDPTRSAVPTGPAITAVNPVPTHAPRHGITTGHPGHAAPAIPTTPTITDTPAISTTPTSPTSATRGGGIRTRPTTTAITATGRTTALSTMGTRGGARTTSPARTPRTGITASPAGPAGPKTRPRIDQHVAVPTGAPITGHPASTTLTASPTSALTTPDIPRRQRRTALAAITTVTARPARSAVTPMPTNPTSNMRQRTVGAVTAITPVAARPPSPTSPTVTGLDPTRAAVPAVPASPTAGTALTISTRGDTRLTVGPGQTVTAVPTTTTITEAPAIPTTPTSPTIAACGDGVRAHAASTAVPTTTVNTTSPGRPRNRPEPPSATNPAYPGITALTTSPASTKPAPRDRANRHITVPTITTITSKPTSPARTTGPAHPRNTSTTKHAARRTTSTTITPSTTSRPGPAVTTRTPTATRHTRRQSASTGPTITTSTTHTTRTTDPTATAHHPATPPSPTMARIPTSRTRSTRTPRNQT
>LR130759.1|VDM87709.1|1431403_1431856_-|hypothetical-protein
MTAVTPVTAIAAVPAATTRNTVKTRGAPGSDGIGAAPPVTAVTTAVWAKTVAAGLTGSGTATALPAGSTKTGVTAVTTIPAFTAVDGHLASRAVPTVTSDPAGTTVAAIPTDTRGAGLTASDGVSTAPSPTVTTDPTGPTATTVPTGAAI
>LR130759.1|VDM87710.1|1431880_1433545_+|hypothetical-protein
MGSDNAQVGGVGGTGGTGGVGGAGGASGLLGGDGGNGGDGGKGGTGGTSGAGAAGANGADGTRTDSADTARGESGGNGANGVTGGAGGNGGNGGAAGSARSPGGHNGTMGAGGDGGNGGHGGNGGDGGDGGNGIHLVAGLTGDGGNGGDGGHAGAGGAGGHGGTGSSTGKTGDTGTITGTGGNGGNGGNGGDGGDRDGDVLTGFRGDGGRGGNGGNGAIGGAGGNGGTGGNAGHIDSGAGFDGGAGGYGGNGGNGGHGTIADGAAGNGGNGGNGGKGDYGEDGTGTAGGNGGSGGNGGDAGHSSLGDGAAGTGGNGGKGGDGGDGQVDGFTGGNGGNGGSGGLGGHSGAGDGAAGLGGAGGNGGNGGDGNWGNPGGYGGNGGSGGPGSTGGVGGVGGNGGNGGGAAFTGAAGAGGPGGAGGNGGTSIGQGIAGGAGGAGGNGGIGGPGYALGGDGGFGGHGGNGGNGGDAALGNGGTGGSGGNGGSGGTGSIGSGGTGGTGGTGGTGGKGSNGISTKLGGAGGLGQAGSPSTVGSGGGSGGSGGSGGPGGVPSP
>LR130759.1|VDM87711.1|1433723_1433897_+|hypothetical-protein
MAAKQTQHDAADALFRAIIETLDKHRKEGSLTEGVLDDLARAYASISTNVPEQGRLG
>LR130759.1|VDM87712.1|1433916_1434804_-|bacteriocin-biosynthesis-cyclodehydratase-domain-protein
MSTPGVAHSQVMPQTALTLFSLDPAMPVLLRPDGAVQVGWAPGRAVLVHPPNGLAATALAALLRSMRSPMALTELQRHAADRGLADGSKVAGLIRQLLSAGVATRECRPAKGRTPSIRVHGRGPLSDLLVQALRCSGARVRQSSQLHAGATPAAADLVVLSDYLVADPRLVRDLQGEGVPHLPVRVRDGTGLVGPLVIPGVTSCLGCADLHRTDRDAAWPAIAAQLRDAVGVADRGTLLATTALALSQVNGVIAAVRGQQTPPEPPSALNATLEFDLKAGSIVARHWTRHPLCSC

Crispr_ID: LR130759_10

• CRISPR_ID: LR130759_10
• CRISPR_location: 4230310-4230919
• CRISPR_type: Orphan
• Repeat_type: NA
• Spacer_info: 8 spacers

Consensus repeat of LR130759_10

Consensus_repeat	Method
CGGCACCGGCGGCGCCGGCGGNANC	CRT

spacers of LR130759_10

>10.1|4230335|20|LR130759|CRT
GGTGGTGCCGCCGGGCTCAT
>10.2|4230380|50|LR130759|CRT
AGCGGCACCGGCGCCCACGCAGGGGCAGGCGGCAACGGCGGATGGCTTTA
>10.3|4230455|47|LR130759|CRT
GTCGGTACCGGCGGCATCGCCGGCAACGGCGGAGCCGCAGGACTCAT
>10.4|4230527|50|LR130759|CRT
AGCGGCACCGGCGCCCACGCAGGGGCGGGCGGCCACGGCGGATGGCTTTA
>10.5|4230602|47|LR130759|CRT
GTCGGTACCGGCGGCATCGCCGGCAACGGCGGAGCCGCAGGACTCAT
>10.6|4230674|50|LR130759|CRT
GGTACCGGAAGCGGAGTCGCCGGCAATGGCGGCCACGGCGGATGGCTCTA
>10.7|4230749|53|LR130759|CRT
AATGCCGGGCAGGCTGGTGGCGATGGCGGCACGGGCGGGGCGGCGGGGCTATT
>10.8|4230827|68|LR130759|CRT
GGCGCTGGCGGTGCGCCGGGGCAAGCCGGAGGGGATGGAGGCGCCGGCGGCGCGGGTGGATGGCTCGG

CRISPR arrays and Neighbor proteins around LR130759_10

CRISPR arrays

The CRISPR arrays of LR130759_10

>merge|LR130759|10|4230310-4230919|CRT
CGGAGCCGGCCGCGCCGGAGGTAACGGTGGTGCCGCCGGGCTCATCGGCACCGGCGGCGCCGGCGGCAACAGCGGCACCGGCGCCCACGCAGGGGCAGGCGGCAACGGCGGATGGCTTTACGGCACCGGCGGCGCCGGCGGCAACGTCGGTACCGGCGGCATCGCCGGCAACGGCGGAGCCGCAGGACTCATCGGCACCGGCGGCGCCGGCGGCAACAGCGGCACCGGCGCCCACGCAGGGGCGGGCGGCCACGGCGGATGGCTTTACGGCACCGGCGGCGCCGGCGGCAACGTCGGTACCGGCGGCATCGCCGGCAACGGCGGAGCCGCAGGACTCATCGGCACCGGCGGCGCGGGCGGCACCGGTACCGGAAGCGGAGTCGCCGGCAATGGCGGCCACGGCGGATGGCTCTATGGCACGGGCGGCGCCGGCGGCTCGAATGCCGGGCAGGCTGGTGGCGATGGCGGCACGGGCGGGGCGGCGGGGCTATTTGGCCACGGCGGTCCCGGCGGAACCGGCGCTGGCGGTGCGCCGGGGCAAGCCGGAGGGGATGGAGGCGCCGGCGGCGCGGGTGGATGGCTCGGCGGCAACGGCGGGACGGGCGGTAGC

>LR130759|10|4|4230310-4230919|CRT
CGGAGCCGGCCGCGCCGGAGGTAAC	GGTGGTGCCGCCGGGCTCAT
CGGCACCGGCGGCGCCGGCGGCAAC	AGCGGCACCGGCGCCCACGCAGGGGCAGGCGGCAACGGCGGATGGCTTTA
CGGCACCGGCGGCGCCGGCGGCAAC	GTCGGTACCGGCGGCATCGCCGGCAACGGCGGAGCCGCAGGACTCAT
CGGCACCGGCGGCGCCGGCGGCAAC	AGCGGCACCGGCGCCCACGCAGGGGCGGGCGGCCACGGCGGATGGCTTTA
CGGCACCGGCGGCGCCGGCGGCAAC	GTCGGTACCGGCGGCATCGCCGGCAACGGCGGAGCCGCAGGACTCAT
CGGCACCGGCGGCGCGGGCGGCACC	GGTACCGGAAGCGGAGTCGCCGGCAATGGCGGCCACGGCGGATGGCTCTA
TGGCACGGGCGGCGCCGGCGGCTCG	AATGCCGGGCAGGCTGGTGGCGATGGCGGCACGGGCGGGGCGGCGGGGCTATT
TGGCCACGGCGGTCCCGGCGGAACC	GGCGCTGGCGGTGCGCCGGGGCAAGCCGGAGGGGATGGAGGCGCCGGCGGCGCGGGTGGATGGCTCGG
CGGCAACGGCGGGACGGGCGGTAGC

Neighbor Proteins Overview

Protein	Signature genes	Signature genes Name	Protein_function
LR130759.1|VDM90089.1|4234802_4235750_+|Daunorubicin/doxorubicin-resistance-ATP-binding-protein-DrrA	unknown	unknown	gnl|CDD|224054
LR130759.1|VDM90086.1|4226308_4228981_-|putative-ATPase	unknown	unknown	gnl|CDD|197715
LR130759.1|VDM90088.1|4234174_4234813_+|putative-DNA-binding-transcriptional-regulator	unknown	unknown	gnl|CDD|375436
LR130759.1|VDM90095.1|4241953_4243117_+|Capsular-glucan-synthase	unknown	unknown	gnl|CDD|273997
LR130759.1|VDM90092.1|4238172_4239861_+|Cocaine-esterase	unknown	unknown	gnl|CDD|273375
LR130759.1|VDM90090.1|4235746_4237393_+|ABC-2-family-transporter-protein	unknown	unknown	gnl|CDD|226089
LR130759.1|VDM90091.1|4237442_4238117_+|Putative-protein-S-isoprenylcysteine-methyltransferase	unknown	unknown	gnl|CDD|224931
LR130759.1|VDM90093.1|4239902_4240337_+|hypothetical-protein	unknown	unknown	gnl|CDD|237537
LR130759.1|VDM90084.1|4224410_4225202_-|Sigma-E-factor	unknown	unknown	gnl|CDD|236606
LR130759.1|VDM90085.1|4225447_4226122_+|Putative-O-methyltransferase/MSMEI_4947	unknown	unknown	gnl|CDD|226607
LR130759.1|VDM90083.1|4223832_4224237_-|putative-transmembrane-transcriptional-regulator-(anti-sigma-factor)	unknown	unknown	unknown
LR130759.1|VDM90094.1|4240530_4241745_-|Glucose-1-phosphate-adenylyltransferase	unknown	unknown	gnl|CDD|234846
LR130759.1|VDM90082.1|4222147_4223662_-|putative-periplasmic-serine-endoprotease-DegP-like-precursor	unknown	unknown	gnl|CDD|273938
LR130759.1|VDM90080.1|4220573_4221722_+|Flagellum-site-determining-protein-YlxH	unknown	unknown	gnl|CDD|378455
LR130759.1|VDM90097.1|4243484_4244066_-|DNA-3-methyladenine-glycosylase-1	unknown	unknown	gnl|CDD|129711
LR130759.1|VDM90081.1|4221729_4222137_-|Sec-independent-protein-translocase-protein-TatB	unknown	unknown	gnl|CDD|179538
LR130759.1|VDM90078.1|4218492_4219035_+|putative-membrane-protein	unknown	unknown	gnl|CDD|226844
LR130759.1|VDM90087.1|4229290_4229533_+|hypothetical-protein	unknown	unknown	unknown
LR130759.1|VDM90096.1|4243141_4243309_-|hypothetical-protein	unknown	unknown	gnl|CDD|371461
LR130759.1|VDM90079.1|4219151_4220522_+|lytic-murein-transglycosylase-B	unknown	unknown	gnl|CDD|225501

rpsblast for functional proteins

Protein	Function_ID	Function_description	E-value
LR130759.1|VDM90089.1|4234802_4235750_+|Daunorubicin/doxorubicin-resistance-ATP-binding-protein-DrrA	gnl|CDD|224054	COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms].	1.00787e-86
LR130759.1|VDM90088.1|4234174_4234813_+|putative-DNA-binding-transcriptional-regulator	gnl|CDD|375436	pfam17933, TetR_C_25, Tetracyclin repressor-like, C-terminal domain. TetR family regulators are involved in the transcriptional control of multidrug efflux pumps, pathways for the biosynthesis of antibiotics, response to osmotic stress and toxic chemicals, control of catabolic pathways, differentiation processes, and pathogenicity. The TetR proteins identified in overm ultiple genera of bacteria and archaea share a common helix-turn-helix (HTH) structure in their DNA-binding domain. However, TetR proteins can work in different ways: they can bind a target operator directly to exert their effect (e.g. TetR binds Tet(A) gene to repress it in the absence of tetracycline), or they can be involved in complex regulatory cascades in which the TetR protein can either be modulated by another regulator or TetR can trigger the cellular response. TetR regulates the expression of the membrane-associated tetracycline resistance protein, TetA, which exports the tetracycline antibiotic out of the cell before it can attach to the ribosomes and inhibit protein synthesis. TetR blocks transcription from the genes encoding both TetA and TetR in the absence of antibiotic. The C-terminal domain is multi-helical and is interlocked in the homodimer with the helix-turn-helix (HTH) DNA-binding domain. This entry represents the C-terminal domain present in Rv1219c of Mycobacterium tuberculosis. Structural studies indicate that the helix alpha 10 of the C-terminal end of Rv1219c forms a long arm feature, a feature which is unique in Rv1219c compared to some other members of the TetR family. Furthermore, it has been shown that substrate binding occurs in the C-terminal regulatory domain of Rv1219c.	2.78355e-56
LR130759.1|VDM90095.1|4241953_4243117_+|Capsular-glucan-synthase	gnl|CDD|273997	TIGR02149, glgA_Coryne, glycogen synthase, Corynebacterium family. This model describes Corynebacterium glutamicum GlgA and closely related proteins in several other species. This enzyme is required for glycogen biosynthesis and appears to replace the distantly related TIGR02095 family of ADP-glucose type glycogen synthase in Corynebacterium glutamicum, Mycobacterium tuberculosis, Bifidobacterium longum, and Streptomyces coelicolor. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0
LR130759.1|VDM90092.1|4238172_4239861_+|Cocaine-esterase	gnl|CDD|273375	TIGR00976, Hypothetical_protein_Rv1835c/MT1883/Mb1866c., putative hydrolase, CocE/NonD family. This model represents a protein subfamily that includes the cocaine esterase CocE, several glutaryl-7-ACA acylases, and the putative diester hydrolase NonD of Streptomyces griseus (all hydrolases). This family shows extensive, low-level similarity to a family of xaa-pro dipeptidyl-peptidases, and local similarity by PSI-BLAST to many other hydrolases. [Unknown function, Enzymes of unknown specificity].	1.81659e-132
LR130759.1|VDM90090.1|4235746_4237393_+|ABC-2-family-transporter-protein	gnl|CDD|226089	COG3559, TnrB3, Putative exporter of polyketide antibiotics [Cell envelope biogenesis, outer membrane].	0
LR130759.1|VDM90091.1|4237442_4238117_+|Putative-protein-S-isoprenylcysteine-methyltransferase	gnl|CDD|224931	COG2020, STE14, Putative protein-S-isoprenylcysteine methyltransferase [Posttranslational modification, protein turnover, chaperones].	1.146e-24
LR130759.1|VDM90093.1|4239902_4240337_+|hypothetical-protein	gnl|CDD|237537	PRK13875, PRK13875, conjugal transfer protein TrbL; Provisional.	0.00483781
LR130759.1|VDM90084.1|4224410_4225202_-|Sigma-E-factor	gnl|CDD|236606	PRK09647, PRK09647, RNA polymerase sigma factor SigE; Reviewed.	4.21276e-138
LR130759.1|VDM90085.1|4225447_4226122_+|Putative-O-methyltransferase/MSMEI_4947	gnl|CDD|226607	COG4122, COG4122, Predicted O-methyltransferase [General function prediction only].	1.74382e-66
LR130759.1|VDM90094.1|4240530_4241745_-|Glucose-1-phosphate-adenylyltransferase	gnl|CDD|234846	PRK00844, glgC, glucose-1-phosphate adenylyltransferase; Provisional.	0
LR130759.1|VDM90082.1|4222147_4223662_-|putative-periplasmic-serine-endoprotease-DegP-like-precursor	gnl|CDD|273938	TIGR02037, Probable_periplasmic_serine_protease_do/HhoA-like, periplasmic serine protease, Do/DeqQ family. This family consists of a set proteins various designated DegP, heat shock protein HtrA, and protease DO. The ortholog in Pseudomonas aeruginosa is designated MucD and is found in an operon that controls mucoid phenotype. This family also includes the DegQ (HhoA) paralog in E. coli which can rescue a DegP mutant, but not the smaller DegS paralog, which cannot. Members of this family are located in the periplasm and have separable functions as both protease and chaperone. Members have a trypsin domain and two copies of a PDZ domain. This protein protects bacteria from thermal and other stresses and may be important for the survival of bacterial pathogens.// The chaperone function is dominant at low temperatures, whereas the proteolytic activity is turned on at elevated temperatures. [Protein fate, Protein folding and stabilization, Protein fate, Degradation of proteins, peptides, and glycopeptides].	6.69522e-85
LR130759.1|VDM90080.1|4220573_4221722_+|Flagellum-site-determining-protein-YlxH	gnl|CDD|378455	pfam10609, ParA, NUBPL iron-transfer P-loop NTPase. This family contains ATPases involved in plasmid partitioning. It also contains the cytosolic Fe-S cluster assembling factor NBP35 which is required for biogenesis and export of both ribosomal subunits.	7.80629e-126
LR130759.1|VDM90097.1|4243484_4244066_-|DNA-3-methyladenine-glycosylase-1	gnl|CDD|129711	TIGR00624, DNA-3-methyladenine_glycosylase_1, DNA-3-methyladenine glycosylase I. All proteins in this family are alkylation DNA glycosylases that function in base excision repair This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). [DNA metabolism, DNA replication, recombination, and repair].	2.53446e-103
LR130759.1|VDM90081.1|4221729_4222137_-|Sec-independent-protein-translocase-protein-TatB	gnl|CDD|179538	PRK03100, PRK03100, Sec-independent protein translocase subunit TatB.	9.81133e-78
LR130759.1|VDM90078.1|4218492_4219035_+|putative-membrane-protein	gnl|CDD|226844	COG4420, COG4420, Predicted membrane protein [Function unknown].	1.18399e-46
LR130759.1|VDM90086.1|4226308_4228981_-|putative-ATPase	gnl|CDD|197715	smart00421, HTH_LUXR, helix_turn_helix, Lux Regulon. lux regulon (activates the bioluminescence operon.	8.75066e-13
LR130759.1|VDM90096.1|4243141_4243309_-|hypothetical-protein	gnl|CDD|371461	pfam11314, DUF3117, Protein of unknown function (DUF3117). This family of proteins with unknown function appears to be restricted to Actinobacteria.	1.34803e-23
LR130759.1|VDM90079.1|4219151_4220522_+|lytic-murein-transglycosylase-B	gnl|CDD|225501	COG2951, MltB, Membrane-bound lytic murein transglycosylase B [Cell envelope biogenesis, outer membrane].	7.9268e-56

Protein sequences

>LR130759.1|VDM90087.1|4229290_4229533_+|hypothetical-protein
MASFVTAGVGVRAPAAADLGGIEAIGSATAATAPATQVIAAGGSAGTGSPGITPGAGGSPAGNPRGIPAEGADGVGGHTS
>LR130759.1|VDM90086.1|4226308_4228981_-|putative-ATPase
MGRKCGPERRAGIDNRIYIHYVVVRGPLIGRGKELRVIAEALGMDDSRGVLIFGDPGVGKTRLAEEAAAASEAQGWVVHRVTASITAQSIALGAFTTWSTGSHANPHDAAQQLVSAMTAASASAPVLISIDDAHLLDNLSAFVVYSLLQQRQAKVLITVRAGAPVLDAVMTPWKEGVLYRVDLPPLSESESSDLLRSSLGGQVSDDCTERLWDFTRGNPAYLAHVIEQERAIGNLVQDRGMWVLRAPPTVSPSLRDLVRMQFGALTESVQEVVDLVAVAGSVGRSVLTSLTDHEASAQAERLGLIRADDSAPDVILLAHPMHSAISLAQCGPLRQSRLRGRLAAAMTSPDNTAPVDPAQLGLLWLESDLPPDAGVLSAAAAAALGQLDIEFAHRCSRAAVDAGGGIGAKLQLAYCLFLLGRVGDAHDELGRIRPDELRGTDFLDDFSLMTMNLLFGFAQPEEALRLIERALQGSTGIRAHQLNTLRGFHLGFTANPTQAIAALYAADPAQLDPYGAVICLGMRTLAHGECGHLSQARREAARSWRILDDARDGFNVANLAKLHTHVLVLAGDLAGATEVARQAYRRCLGMAPVARTLCSATIGAVALASGDLAVARRRLHPGQLKLGQFGLIMGHTYRYQVHYTAALARSGCVQDAVCALETAAEVRRPHLLYIEATYLLAQAWVAAAQGQMERARDIASRAATFAREHGQLASEVFCLQTSAQFHDTTVADRLAELATVVEGPRAPIAARYAKALSDDAAAELEAVAADFEMMGDLLAAADAAAHASSAYRVAGRRGSALTAGARAEGLSKRCGGAASPALAGAKIAFPFSHRQREIALLVSKGLTNRAIAEILSLSVRTVEGHIYRATFKAGIASRAELAKLVQEFDD
>LR130759.1|VDM90085.1|4225447_4226122_+|Putative-O-methyltransferase/MSMEI_4947
MDGTDNSAVTPGRQAPSRAELLSAHAEGSISEDAILAQARDRAVDIGVGAITPAVGALLSMLAKLSGGKAVAEVGTGAGVSGLWLLSGMSDDGVLTTIDIEPEHLRVAKRAFTEAGIGPSRSRLIGGRAQEVLTRLADESYDLVFVDADPIDQPDYVVEGVRLLRSGGVIVVHRAALGGRAGDPAARDAEVTAVREAARLIAEDERLTPALVPLGDGVLAAVRD
>LR130759.1|VDM90084.1|4224410_4225202_-|Sigma-E-factor
MGNTDWQLRVAAGDELWRLEGRENPEEVNITTSGATTATTATTATTATTATKMSHPQLVRDDEWVEPSEGLLGTAVFDATGDKATMPSWDELVRQHADRVYRLAYRLSGNQHDAEDLTQETFIRVFRSVQNYQPGTFEGWLHRITTNLFLDMVRRRARIRMEALPDDYDRVPADDPNPEQIYHDSRLGPDLQAALDSLPPEFRAAVVLCDIEGLSYEEIGATLGVKLGTVRSRIHRGRQALRDYLAAHPEHSELGSRPVGTAS
>LR130759.1|VDM90083.1|4223832_4224237_-|putative-transmembrane-transcriptional-regulator-(anti-sigma-factor)
MADRGHVFRRAFSWLPAQFASQSDAPVGAPRRFRSTEHLSLEAIAAFVDGELRMNAHLRAAHHLSLCPQCAAEVDDHSRARAALRDSHPIRIPSTLLGALSEIPHCPASEPTQDTSPLADPFAEREARGQRKHP
>LR130759.1|VDM90082.1|4222147_4223662_-|putative-periplasmic-serine-endoprotease-DegP-like-precursor
MISDQGNNSGQDGGPRLAPRPISRPPVDPASRQAFGRPSGLQGSFVAERVRPEKYRDQSDFSPHDQPADPVLEEAFSRPIGGVDSLQRHPIDAGALADEKSDGQLEDADDPWRDPAAGAALGTPAIAPPPPPSGLGQTGKLGVRDVLFGGKVSYVALSILLSIALVIGAIGGVIGRKTAEVVEAFTTSKVTLSTSGNAEEPAGRFTKVAAAVADSVVTIESKSDQEGMQGSGVIVDGRGYIVTNNHVISEAANNPSQFKTTVVFNDGKEVPASLVGRDPKTDLAVVKVDNVDNLTVARLGNSDKVRVGDEVLAVGAPLGLRSTVTQGIVSALHRPVPLSGEGSDTDTVIDAIQTDASINHGNSGGPLIDMDAQVIGINTAGKSLSDSASGLGFAIPVNEMKFVAETLIKDGKIVHPTIGITTRSVSNAIASGAQVANVKAGSPAQKGGILENDVIVKIGNRTVADSDEFVVAVRQLTIGQDAPVEVVRDGRHVTLIVKPDPDTT
>LR130759.1|VDM90081.1|4221729_4222137_-|Sec-independent-protein-translocase-protein-TatB
MFANIGWGEMLVLVVVGLVVLGPERLPGAIRWTAGALRQARDYLSGVTSQLREDMGPEFDDLRGQLGELQKLRGMTPRAALTKHLLDGDDSIFTGNFDTPAAASAAQPVEQAAGTPEAQHGADEPARPPFDSDAT
>LR130759.1|VDM90080.1|4220573_4221722_+|Flagellum-site-determining-protein-YlxH
MSATRDDADLTATIRAALAKVIDPELRRPITDLGMVKSVDVSPDGAVHVEIYLTTAACPKKSEISDRVAQAVGDVPGTGAVRVSLDVMNDEQRTELRKQLRGDAREPVIPFAQPSSLTRVYAVASGKGGVGKSTVTVNLAAAMAARGLSVGVLDADIHGHSIPRMMGTTDRPTQVESMILPPIAHEVRVISIAQFTQDNTPVVWRGPMLHRALQQFLADVYWGDLDVLLLDLPPGTGDVAISVAQLIPNAEILVVTTPQLAAAEVAERAGSIALQTRQRIVGVVENMSGLTLPDGTTLQVFGEGGGQQVSERLTRAVGADVPLLGQIPLDPALVNAGDSGTPLVLSAPDSAVGKELLNIADRLAARRRGLAGMSLGLDPTRH
>LR130759.1|VDM90079.1|4219151_4220522_+|lytic-murein-transglycosylase-B
MRIGGRWGARPAVALVRQGALCVVRSPVFGIAMIAPLVFAGAVGAAAPASRAKIPRVQAAVTPVAAVAPTPVVDLSGPAVIAVERPPTSFHFAETTGSAPPPAMVVNSPGALGIPVMALTAYRNAEQKMAVAAPGCGISWNLLAGIGRIESMHANGGAVDERGTAVSPIYGPALDGTLPGNEIIIQSKVGNRVTYARAMGPMQFLPGTWARYAVDGDNDGVPDPQNIFDSTLAAARYLCSGGLNLRDPAQVMAAILRYNNSMPYAQNVLGWAAAYATGVLPVDLPPITGPPPPIGDAHLEQSEGLGPNLPLNANGLGINDPAGHMPLINFGPPPVPVAPPPMFPWLQPTPQPQAPQPGCTLICITPQSPPEPPPVGGPMPFGIMPPPPPPAPPAAPPADPLAPLGGPAPANPAPAPPNPAPGASAPANPAPKPAGPPPAPTPNPPAPGGPVLTPIS
>LR130759.1|VDM90078.1|4218492_4219035_+|putative-membrane-protein
MSKSPATRRLYTPRTSRRFTPRMDPEAVGQITESIARFFGTGRYLLLQTGLVLTWIALNLFAAHWRWDPYPFILLNLAFSTQAAYAAPLILLAQNRQENRDRVALEEDRRRAAQTKADTEYLARELAALRLAIGEVPTRDYLRHELENLRTLVEELQPARPEADPAQAPDGTERRTKKSV
>LR130759.1|VDM90088.1|4234174_4234813_+|putative-DNA-binding-transcriptional-regulator
MRSADLTATARIRDAAIEQFGQHGFGVGIRAIAEAAAVSPALVIHHFASKEGLRKACDDYVAEQIRTSKSETLQSHDPATWFAQLAEIESYAPLMAYLVRSMQDGGELARMLWRKMIDNAEEYMEEGVRAGTIRPSRDPRARSRYLAMTGGGGFLLYLQMHETPTDLRTVLRDYSRDMVLPALEVFTEGLLVDRTMYEAFLAEGNQGESHAS
>LR130759.1|VDM90089.1|4234802_4235750_+|Daunorubicin/doxorubicin-resistance-ATP-binding-protein-DrrA
MPASSHQAPIEIRGLTKNFGAVRALDGLDLTVREGEVHGFLGPNGAGKSTTLRILLGLVKADSGSVRLLGGDPWSNAVQLHRQIAYVPGDVTLWPSLTGGEIIDLLARMRGGIDNARRAELIDRFDLDPHKKARTYSKGNRQKVSLISAFSSRAGLLLLDEPSSGLDPLMENVFQQCVAEASKRGVTVLLSSHILAETEALCERVTIIRAGRTVESGSLESMRHLSRTSIKAEMVGDPGDLTRIKGVEDVSIDGSTLRAQVDGESLGELIRALGDAGVRSLVSQPPTLEDLFLRHYRIGPDVEAGDRDETGVAAV
>LR130759.1|VDM90090.1|4235746_4237393_+|ABC-2-family-transporter-protein
MNTTVLDRPSPGAHHAPQRGSSFAGTLGLVRLYLRRDRLGLPLWVLLLSVPLATVYIGSIETVYPTQTDRAGLAASIMASPAQRALYGQVYNDSLGAVGIWKAGMFHTLLAIAVILTTIRHTRADEETGRGELIDSTAVGRYANLTAALLLSFGASVATGVIGAAGLLTANVAPAGSLAFGAALTGSGLVFTAVAAVAAQLSPSARVSRGWAFAALSTAFVLRAVGDAGSGALSWLSPLGWSLQVRPYAGDRWWVLLLHLAATALLTVLAYRLRARRDVGAGLIAERAGPGSAAPSLGNVFGLAWRLDRGALLLWTVGLCLYGLLMGSVAHGIGDQLGDNAAVREIVTRMGGTNTLEQAFLALAFTMIGMVAAAFAISLTLRVHQEESAQRAEPTLAGAVSRIRWLFSHLGAALIGSAIALLVAGAAAGLLYGISTGDIGNKLSTVVGSAAAQLPAVWLLAAVTAALFGLAPRFTSLAWGVLVGFIALYLIGSLAGFPQWLLDLEPFAHVPRVGGGDFTVVPLLWLLGIDAALIILGAMAFRRRDLRC
>LR130759.1|VDM90091.1|4237442_4238117_+|Putative-protein-S-isoprenylcysteine-methyltransferase
MHLALRALFSGVFGFFLLALVLFIPAGTFDYWQAWVFIAVFVVATLVPTSYLARTNPEALRRRMRAGPRAESRIVQKFIIIAAFVVLFAMMVFSAVDYRLGWSSVPAPVCLLGDALVATGLGVAMLVVVQNPYAAATVTVEGGQPVVSSGLYRFVRHPMYTGNVLMMLGMPLALGSYWGLLFLIPGIGVLIYRIADEEKLLIQELAGYREYLERVRYRLIPYAW
>LR130759.1|VDM90092.1|4238172_4239861_+|Cocaine-esterase
MTRNPAPFLDRPWRRPGAARYALGRVRSIVKPPIRVTEPPADVVVDRDVDVIVRDGTVLRVNVFRPANDTPRPVIVSVHPYGKDKLPSRRLRRWTFSPQFRVLRQSQPVTFSALTGWEAPDPAWWTTHGFNVVNADARGCGHSNGTGKLLSHQEAEDTYDLVQWAAEQPWSDGRVVMLGVSYLALTQYAVAALQPPALRAICPWEGFTDAYRDWTMPGGIRESGFARFWSRVLKHRTRQTYVFEPMQEAHPLRDEFWRSLVPDLAAIKVPMLVCGSFSDNNLHSRGSFRAFTHGGSGHARLYTHRGGKWATFYSEPALAEQLQFFRAALDGAPATRSVRIEVREDRDTVVAVREESQWPLARTQWRHIYLAAPGVLSSEAPPKAGSITFETHSRAASFSWTIPEDIELTGPMTARLWVQLDGCADANLFVGVEKWREEQFVPFEGSYGWGRDRVTTGWQRVSLRELDPKHSQPWEPVPAYERPLPVAAGQVVPVDVALGPSATLFRAGEQLRLVVGGRWLSPRNPLFGQFPAAYADPPRGLVTLRWGPRYDAHLLIPEIPVS
>LR130759.1|VDM90093.1|4239902_4240337_+|hypothetical-protein
MLYGNGGSGGTSTTAGVAGGAGGAAGLIDNGGAGGNGGAGAVGGTGGAGGRLFGNGLDSNAPWPTASIRPSMTAATAATVEPPAMAGCCSAMAATAAAWVAAAETVCPRQESAGRAVSAATAVSVDQAFKTGPAATPAAAAMPD
>LR130759.1|VDM90094.1|4240530_4241745_-|Glucose-1-phosphate-adenylyltransferase
MREIPHVLGVVLAGGEGKRLYPLTADRAKPAVPFGGAYRLIDFVLSNLVNARYLRICVLTQYKSHSLDRHISQNWRLSGLAGEYITPVPAQQRLGPRWYTGSADAIYQSLNLIYDEDPDYIVVFGADHVYRMDPEQMVRFHIDSGAGATVAGIRVPRTDASSFGCIDADDSGAIRSFVEKPLEPPGTPDDPAATFVSMGNYVFTTKVLIDAIRADADDDHSDHDMGGDIIPRLVADGMAAVYDFSDNEVPGATDRDRAYWRDVGTLDAFYDAHMDLVSVHPVFNLYNKRWPIRGESENLAPAKFVNGGSAQESVVGAGSIISAASVRNSVLSSNVVVDDGAIVEGSVIMPGTRVGRGAVVRHAILDKNVVVGPGEMVGVDLDKDRERFAISAGGVVAVGKGVWV
>LR130759.1|VDM90095.1|4241953_4243117_+|Capsular-glucan-synthase
MRVAMLTREYPPDVYGGAGVHVTELVSQLRRLCAVDVHCMGASRPGAIAHQPDPRLHNANAALSTLSADLVMANAVNAATVVHSHTWYTGLAGHLAALLYDIPHVLTAHSLEPMRPWKAEQLGGGYQISSWVEKSAVLAADAVIAVSSGMREDILRVYPALDPGVVHVIRNGIDTEVWYPAGPVRTGSVLEELGVDRNRPIVAFVGRITRQKGVPHLVAAAHQFSPDIQLVLCAGAPDTAEIADEVRSAVAQLARTRTGVFWVRDILPIGKLREILSAATVFACASIYEPLGIVNLEAMACATAVVASDVGGIPEVVTDGVTGSLVHYDPNDPNGYQARLAETVNAIVADPATAERYGQAGRQRCIEEFSWAHIAEQTLDIYREVCQ
>LR130759.1|VDM90096.1|4243141_4243309_-|hypothetical-protein
MAAMKPRTGDGPLEATKEGRGIVMRVPLEGGGRLVVELTPDEAAALGDELKGVTS
>LR130759.1|VDM90097.1|4243484_4244066_-|DNA-3-methyladenine-glycosylase-1
MSDQDLVRCGWAEVRPGPDAEMYRNYHDQEWGRPLRGEVALFERMSLEAFQSGLSWLIILRKRENFRRAFSGFDIEKVANYTDTDVQRLLVDQGIVRNRAKIEATIANARAVADLGSEEELSELLWSFAPPPRPRPASLSEIPSATAESTAMARELKRRGFRFVGPTTAYALMQATGMVDDHVAACWVPREPR

Crispr_ID: LR130759_12

• CRISPR_ID: LR130759_12
• CRISPR_location: 4362287-4362780
• CRISPR_type: Orphan
• Repeat_type: NA
• Spacer_info: 7 spacers

Consensus repeat of LR130759_12

Consensus_repeat	Method
GGNGCCGGCGGGGCCGGCGGNNC	CRT
CGCCGGCCCCGCCGGCTCCGCC	PILER-CR

spacers of LR130759_12

>12.1|4362310|73|LR130759|CRT
AGCCGGTGGGGCCGGTGGGGCCGGCGGGTTCGGCGGTTCCGGCGGGGCCGGCGGGTTGCTGGGCGGTTTCGGT
>12.2|4362406|49|LR130759|CRT
CGGCGGGATCGGAGCGGCCGGCATCAATGCTGGGCACGGCGGGGAGGGC
>12.3|4362478|37|LR130759|CRT
TCTGATGGGCTGGGCTGGCGGAGCCGGCGGGACAGGT
>12.4|4362538|52|LR130759|CRT
GGGAGCCGCGAGCGTGGCGCCCGGTGGGGTTGGCGGTCAAGGCGGGGCTGGC
>12.5|4362613|43|LR130759|CRT
CGGAGGCGCGCACGCGGGGCTGTTCGGGTTGGGAGGATTGTTC
>12.6|4362679|22|LR130759|CRT
GGGCGGCATGGGCGGCGACGGC
>12.7|4362724|34|LR130759|CRT
CGGCACGGGCTTTGGCCTAGCCGGCGGCGATGGT
>12.8|4362327|62|LR130759|PILER-CR
GGGCCGGCGGGTTCGGCGGTTCCGGCGGGGCCGGCGGGTTGCTGGGCGGTTTCGGTGGGGCC
>12.9|4362411|41|LR130759|PILER-CR
GGATCGGAGCGGCCGGCATCAATGCTGGGCACGGCGGGGAG
>12.10|4362474|45|LR130759|PILER-CR
ATCGCCCGGGCTCTGATGGGCTGGGCTGGCGGAGCCGGCGGGACA
>12.11|4362541|53|LR130759|PILER-CR
TCTCGGGAGCCGCGAGCGTGGCGCCCGGTGGGGTTGGCGGTCAAGGCGGGGCT

CRISPR arrays and Neighbor proteins around LR130759_12

CRISPR arrays

The CRISPR arrays of LR130759_12

>merge|LR130759|12|4362287-4362780|CRT,PILER-CR
GGGGCCGGTGGGGCCGGTGGCGCAGCCGGTGGGGCCGGTGGGGCCGGCGGGTTCGGCGGTTCCGGCGGGGCCGGCGGGTTGCTGGGCGGTTTCGGTGGGGCCGGCGGAGCCGGCGGGGCCGGCGGGATCGGAGCGGCCGGCATCAATGCTGGGCACGGCGGGGAGGGCGGAGCCGGCGGGATCGCCCGGGCTCTGATGGGCTGGGCTGGCGGAGCCGGCGGGACAGGTGGAGCCGGCGGGGCCGGCGTCTCGGGAGCCGCGAGCGTGGCGCCCGGTGGGGTTGGCGGTCAAGGCGGGGCTGGCGGAGCCGGCGGGGCCGGCGGGGCCGGAGGCGCGCACGCGGGGCTGTTCGGGTTGGGAGGATTGTTCGGTTCCGGCGGGGCCGGGGGCGCGGGCGGCATGGGCGGCGACGGCGGCAACGGCGGGGCCGGCGGCACCGGCACGGGCTTTGGCCTAGCCGGCGGCGATGGTGGCGCCGGCGGGGCCGGCGGCAA

>LR130759|12|5|4362287-4362780|CRT
GGGGCCGGTGGGGCCGGTGGCGC	AGCCGGTGGGGCCGGTGGGGCCGGCGGGTTCGGCGGTTCCGGCGGGGCCGGCGGGTTGCTGGGCGGTTTCGGT
GGGGCCGGCGGAGCCGGCGGGGC	CGGCGGGATCGGAGCGGCCGGCATCAATGCTGGGCACGGCGGGGAGGGC
GGAGCCGGCGGGATCGCCCGGGC	TCTGATGGGCTGGGCTGGCGGAGCCGGCGGGACAGGT
GGAGCCGGCGGGGCCGGCGTCTC	GGGAGCCGCGAGCGTGGCGCCCGGTGGGGTTGGCGGTCAAGGCGGGGCTGGC
GGAGCCGGCGGGGCCGGCGGGGC	CGGAGGCGCGCACGCGGGGCTGTTCGGGTTGGGAGGATTGTTC
GGTTCCGGCGGGGCCGGGGGCGC	GGGCGGCATGGGCGGCGACGGC
GGCAACGGCGGGGCCGGCGGCAC	CGGCACGGGCTTTGGCCTAGCCGGCGGCGATGGT
GGCGCCGGCGGGGCCGGCGGCAA

>LR130759|12|2|4362305-4362608|PILER-CR
GGCGCAGCCGGTGGGGCCGGTG	GGGCCGGCGGGTTCGGCGGTTCCGGCGGGGCCGGCGGGTTGCTGGGCGGTTTCGGTGGGGCC
GGCGGAGCCGGCGGGGCCGGCG	GGATCGGAGCGGCCGGCATCAATGCTGGGCACGGCGGGGAG
GGCGGAGCCGGCGGGATCGCCC	GGGCTCTGATGGGCTGGGCTGGCGGAGCCGGCGGGACAGGTGGAG
CCGGCGGGGCCGGCGTCTCGGG	AGCCGCGAGCGTGGCGCCCGGTGGGGTTGGCGGTCAAGGCGGGGCTGGCGGAG
CCGGCGGGGCCGGCG

Neighbor Proteins Overview

Protein	Signature genes	Signature genes Name	Protein_function
LR130759.1|VDM90202.1|4370500_4371736_-|acyltransferase,-WS/DGAT/MGAT	unknown	unknown	gnl|CDD|274360
LR130759.1|VDM90188.1|4347792_4348917_-|hypothetical-protein	unknown	unknown	gnl|CDD|379943
LR130759.1|VDM90194.1|4355877_4356720_+|3-alpha-hydroxysteroid-dehydrogenase/carbonyl-reductase	unknown	unknown	gnl|CDD|237099
LR130759.1|VDM90191.1|4350967_4352728_-|Nitric-oxide-reductase-activation-protein	unknown	unknown	gnl|CDD|226921
LR130759.1|VDM90193.1|4354482_4355790_+|HTH-type-transcriptional-repressor-KstR2	unknown	unknown	gnl|CDD|366102
LR130759.1|VDM90199.1|4367165_4367675_-|Putative-oxidoreductase-MhqP	unknown	unknown	gnl|CDD|225168
LR130759.1|VDM90196.1|4357421_4359713_+|5-methyltetrahydropteroyltriglutamate---homocysteine-methyltransferase	unknown	unknown	gnl|CDD|235367
LR130759.1|VDM90192.1|4352951_4354106_-|putative-PPE-family-protein-PPE42	unknown	unknown	gnl|CDD|366325
LR130759.1|VDM90190.1|4350125_4350971_-|Denitrification-regulatory-protein-NirQ	unknown	unknown	gnl|CDD|336785
LR130759.1|VDM90203.1|4371954_4372860_-|short-chain-dehydrogenase	unknown	unknown	gnl|CDD|235628
LR130759.1|VDM90197.1|4359793_4361515_-|hypothetical-protein	unknown	unknown	gnl|CDD|371888
LR130759.1|VDM90206.1|4374388_4375255_+|Lipase-1-precursor	unknown	unknown	gnl|CDD|366166
LR130759.1|VDM90205.1|4373798_4374275_-|3-demethylubiquinone-9-3-methyltransferase	unknown	unknown	gnl|CDD|369157
LR130759.1|VDM90200.1|4368172_4369861_+|Pyruvate,-phosphate-dikinase	unknown	unknown	gnl|CDD|235635
LR130759.1|VDM90195.1|4356716_4356971_-|hypothetical-protein	unknown	unknown	unknown
LR130759.1|VDM90198.1|4365721_4367089_+|Putrescine-oxidase	unknown	unknown	gnl|CDD|366721
LR130759.1|VDM90204.1|4373190_4373796_+|Potential-acrAB-operon-repressor	unknown	unknown	gnl|CDD|366102
LR130759.1|VDM90207.1|4375265_4376288_-|6-phosphogluconate-dehydrogenase,-NADP(+)-dependent,-decarboxylating	unknown	unknown	gnl|CDD|236582
LR130759.1|VDM90201.1|4369857_4370463_+|hypothetical-protein	unknown	unknown	unknown
LR130759.1|VDM90189.1|4348923_4350033_-|hypothetical-protein	unknown	unknown	gnl|CDD|379197

rpsblast for functional proteins

Protein	Function_ID	Function_description	E-value
LR130759.1|VDM90204.1|4373190_4373796_+|Potential-acrAB-operon-repressor	gnl|CDD|366102	pfam00440, TetR_N, Bacterial regulatory proteins, tetR family.	1.5028e-12
LR130759.1|VDM90188.1|4347792_4348917_-|hypothetical-protein	gnl|CDD|379943	pfam17198, AveC_like, Spirocyclase AveC-like. AveC catalyzes the stereospecific spiroketalization of a dihydroxy-ketone polyketide intermediate in the biosynthetic pathway of Avermectin, a potent antiparasitic agent. Additionally, it has a unique dehydration activity that serves to determine the regiospecific saturation pattern for spiroketal diversity. MeiC, the counterpart in the biosynthesis of AVE-like meilingmycin, also has spirocyclase activity, but lacks the dehydratase activity.	2.14466e-88
LR130759.1|VDM90194.1|4355877_4356720_+|3-alpha-hydroxysteroid-dehydrogenase/carbonyl-reductase	gnl|CDD|237099	PRK12428, PRK12428, coniferyl-alcohol dehydrogenase.	3.94717e-50
LR130759.1|VDM90191.1|4350967_4352728_-|Nitric-oxide-reductase-activation-protein	gnl|CDD|226921	COG4548, NorD, Nitric oxide reductase activation protein [Inorganic ion transport and metabolism].	9.49839e-31
LR130759.1|VDM90193.1|4354482_4355790_+|HTH-type-transcriptional-repressor-KstR2	gnl|CDD|366102	pfam00440, TetR_N, Bacterial regulatory proteins, tetR family.	4.12908e-12
LR130759.1|VDM90199.1|4367165_4367675_-|Putative-oxidoreductase-MhqP	gnl|CDD|225168	COG2259, COG2259, Predicted membrane protein [Function unknown].	7.71286e-21
LR130759.1|VDM90196.1|4357421_4359713_+|5-methyltetrahydropteroyltriglutamate---homocysteine-methyltransferase	gnl|CDD|235367	PRK05222, PRK05222, 5-methyltetrahydropteroyltriglutamate--homocysteine S-methyltransferase; Provisional.	0
LR130759.1|VDM90192.1|4352951_4354106_-|putative-PPE-family-protein-PPE42	gnl|CDD|366325	pfam00823, PPE, PPE family. This family named after a PPE motif near to the amino terminus of the domain. The PPE family of proteins all contain an amino-terminal region of about 180 amino acids. The carboxyl terminus of this family are variable, and on the basis of this region fall into at least three groups. The MPTR subgroup has tandem copies of a motif NXGXGNXG. The second subgroup contains a conserved motif at about position 350. The third group are only related in the amino terminal region. The function of these proteins is uncertain but it has been suggested that they may be related to antigenic variation of Mycobacterium tuberculosis.	4.57566e-51
LR130759.1|VDM90190.1|4350125_4350971_-|Denitrification-regulatory-protein-NirQ	gnl|CDD|336785	pfam07728, AAA_5, AAA domain (dynein-related subfamily). This Pfam entry includes some of the AAA proteins not detected by the pfam00004 model.	5.0761e-37
LR130759.1|VDM90203.1|4371954_4372860_-|short-chain-dehydrogenase	gnl|CDD|235628	PRK05855, PRK05855, SDR family oxidoreductase.	5.633e-20
LR130759.1|VDM90197.1|4359793_4361515_-|hypothetical-protein	gnl|CDD|371888	pfam12077, DUF3556, Transmembrane protein of unknown function (DUF3556). This family of transmembrane proteins is functionally uncharacterized. This protein is found in bacteria. Proteins in this family are typically between 576 to 592 amino acids in length.	0
LR130759.1|VDM90206.1|4374388_4375255_+|Lipase-1-precursor	gnl|CDD|366166	pfam00561, Abhydrolase_1, alpha/beta hydrolase fold. This catalytic domain is found in a very wide range of enzymes.	4.79832e-27
LR130759.1|VDM90205.1|4373798_4374275_-|3-demethylubiquinone-9-3-methyltransferase	gnl|CDD|369157	pfam06983, 3-dmu-9_3-mt, 3-demethylubiquinone-9 3-methyltransferase. This family represents a conserved region approximately 100 residues long within a number of bacterial and archaeal 3-demethylubiquinone-9 3-methyltransferases (EC:2.1.1.64). Note that some family members contain more than one copy of this region, and that many members are hypothetical proteins.	1.48738e-63
LR130759.1|VDM90200.1|4368172_4369861_+|Pyruvate,-phosphate-dikinase	gnl|CDD|235635	PRK05878, PRK05878, pyruvate phosphate dikinase; Provisional.	0
LR130759.1|VDM90198.1|4365721_4367089_+|Putrescine-oxidase	gnl|CDD|366721	pfam01593, Amino_oxidase, Flavin containing amine oxidoreductase. This family consists of various amine oxidases, including maze polyamine oxidase (PAO) and various flavin containing monoamine oxidases (MAO). The aligned region includes the flavin binding site of these enzymes. The family also contains phytoene dehydrogenases and related enzymes. In vertebrates MAO plays an important role regulating the intracellular levels of amines via there oxidation; these include various neurotransmitters, neurotoxins and trace amines. In lower eukaryotes such as aspergillus and in bacteria the main role of amine oxidases is to provide a source of ammonium. PAOs in plants, bacteria and protozoa oxidase spermidine and spermine to an aminobutyral, diaminopropane and hydrogen peroxide and are involved in the catabolism of polyamines. Other members of this family include tryptophan 2-monooxygenase, putrescine oxidase, corticosteroid binding proteins and antibacterial glycoproteins.	1.61367e-74
LR130759.1|VDM90207.1|4375265_4376288_-|6-phosphogluconate-dehydrogenase,-NADP(+)-dependent,-decarboxylating	gnl|CDD|236582	PRK09599, PRK09599, NADP-dependent phosphogluconate dehydrogenase.	0
LR130759.1|VDM90202.1|4370500_4371736_-|acyltransferase,-WS/DGAT/MGAT	gnl|CDD|274360	TIGR02946, Putative_diacyglycerol_O-acyltransferase_Mb3115, acyltransferase, WS/DGAT/MGAT. This bacteria-specific protein family includes a characterized, homodimeric, broad specificity acyltransferase from Acinetobacter sp. strain ADP1, active as wax ester synthase, as acyl coenzyme A:diacylglycerol acyltransferase, and as acyl-CoA:monoacylglycerol acyltransferase. [Unknown function, Enzymes of unknown specificity].	1.1344e-19
LR130759.1|VDM90189.1|4348923_4350033_-|hypothetical-protein	gnl|CDD|379197	pfam13458, Peripla_BP_6, Periplasmic binding protein. This family includes a diverse range of periplasmic binding proteins.	7.28512e-16

Protein sequences

>LR130759.1|VDM90197.1|4359793_4361515_-|hypothetical-protein
MGFLKPQLPDIDIAEWSKGTRSEKIRPMARHWAEVGFGTPVVLHLFYVVKILLYILFAWLIVFSTKGIEGFTDVTSWYAEPIVFQKVVLYTMLFEVIGLGCGFGPLNNRFLPPMGSVLYWMRFGTIRLPPWPDRVPWTKGTKRVPIDVALYALLLLLLLAALFTDGSGPVPQLGTEIGLLPTWQVVVILVLLAVLGLRDKVIFLAARGEVYATLTVTFLFGGADMIVAAKLVFLVIWMGAATSKLNKHFPFVISTMMSNNPLFRPRFLKRMFFEKFPDDLRPGLLSRLLAHVSTAIEMFVPVALFFSHGGWPTTVAAIAMVCFHLGILTAIPMGVPLEWNVFMIFGVLSLFVGHANLGLADVKNPVPVAILFALVVGTVILGNMFPRKISFLPGMRYYAGNWDTTLWCIKPSADDKIRRGIVAIASMPAAQLERYYGKERAQIPMYLGYAFRAMNTHGRALFTLAHRAMAGHNEDDYVITDGERICSTALGWNFGDGHMHNEQLVAAMQQRCRFEPGEVRIVLLDAQPIHRQTQHYRLVDAATGEFERGYVRVADMVTRQPWDDEVPVQVSSD
>LR130759.1|VDM90196.1|4357421_4359713_+|5-methyltetrahydropteroyltriglutamate---homocysteine-methyltransferase
MTQFVSQTPFTATITGSPRIGPRRELKRATEGYWSGRTSRSDLESVAASLRRDTWTQLAEAGLDSVPVNTFSYYDQMLDTAVLLGALPARVNGISDELDRYFAAARGNADIAPLEMTKWFDTNYHYLVPEIGPSTQFTLNPDKVLSEFKEAQQLGIPARPVVIGPVTFLLLSKAVDGGPAPIDRLEDLVPIYSELLSLLADNGARWVQFDEPALVTDICPDAPALAERMYTALGSLRNRPALHVATYFGDPGAALAALARTPVEAIGVDLVAGAPGAVAAIVGAPELAGKTLVAGIVDGRNVWRTDLEAALGRLATLLGSVAAVAVSTSCSTLHVPYSLQPESDLDDNLRSWLAFGAEKVAEVVVLARALRDGRDAVADEIAASNAAAASRKKDPRLHNGQVRARIDSIVASGAHRGDAATRRASQDARLHLPPLPTTTIGSYPQTSAIRKARQQLRAGEIDQAEYVSRMKQEIADVIGLQERLDLDVLVHGEPERNDMVQYFAEQLQGFFATQNGWVQSYGSRCVRPPILYGDVSRTNPMTVDWITYAQSLTDKPIKGMLTGPVTILAWSFVRDDQPLADTANQVALGIRDETVDLQSAGIAVIQVDEPALRELLPLRHAEQDQYLRWAVAAFRLATSGVADSTQIHTHLCYSEFGEVIAAIADLDADVTSIEAARSHMEVLDDLNAAGFANSVGPGVYDIHSPRVPSTEEMAESLQAALKAVPASRLWVNPDCGLKTRNVDEVTTSLQHMVAAAKQVRAGI
>LR130759.1|VDM90195.1|4356716_4356971_-|hypothetical-protein
MGTSPLLKSTVESAASAAARTSATSRPRSRTCAIAAPAAATSSEWLGLPKIEPTWSPPGEDAGQLQSDLSVAAYDDDARHGLRR
>LR130759.1|VDM90194.1|4355877_4356720_+|3-alpha-hydroxysteroid-dehydrogenase/carbonyl-reductase
MTVLDRLRYDGKRALVVGGATGMGAAAAKSAAELGAEVIVLDYAPVNYDVGRAVQVDLRDPASIDSAVEQLGGPVHAVFSAAGVADGPDLMKINFIGHRHLIERLLANDQLPSGSAICFISSVAGMGWENDLPRLMEFLATPDYAAAQDWVFAHEAEGIIHYGFSKKAINAYVATQAFSLLKKGIRINAICPGPTDTPLAQANADLWLTFAQDYRDEIGSKVHTPEQMGDVMAFLNSAAAFGISGITLLVDYGHTMSSLTGAYPPGKPLIDLIMGRVSMP
>LR130759.1|VDM90193.1|4354482_4355790_+|HTH-type-transcriptional-repressor-KstR2
MAKADVLGPGRRTAARGNHAGTDSGTRRTEILQTAASLIASSGLRTSLQEIADAAGILPGSLYHHFESKEAILIELIRRYQQDLERIGHGWQEKLDQPDSRPVSEKINELGTAIAHCAVQHRAALQMSFYEGPSADPELMQLTRQRPLAIQEAMLQTLRAARWSGYIKPQIDLPTLADRICQTMLQVGLDVMRRNASTEQVSGLMCRIILEGLATREPLDGQLDPSPALAAANKVIETWTEDQQAEPGDKAAHVLAIARMEFGRRGYEATTIRDIASAAGLGTGTVYRVIGSKDELLASIMRSFGQKVEAGWVSVLRSTGTPIEKLDALSWVNINALDQFSDEFRIQLAWMRQSPPDTPNPGWLYSARLRQMKSLLSEGLQSDDIRIEPPSITMLARCIIGLQWIPENILHAIGTRPALLHARDTVLRGAAVRSD
>LR130759.1|VDM90192.1|4352951_4354106_-|putative-PPE-family-protein-PPE42
MVLGYAWLPPEINSARIFSGAGSGPLFTAASAWDGLATDLYASASSFESVITGLAAGPWSGPASVSMAAAAAPYMTWLGVAAGQAESAANQARAAATAFEAALSATVHPAAVTANRMSLTSLVATNFLGQNTPAIAANEFDYLEMWAQDVAAMVGYHGGATSVAAALTPFSGPPLDLAGWASQVGAQVVGAATTASAALSTPAQSLVAAVPTAMSALQSLPLSSLSPLMYPLSMAISPLTNMMSNAMRTSTAGLASATTELPASAAKAADASLAAIKPLGGAGLGSAVAAGLGQARMVGAVSVPPTWEGSMPTRMASSALSGLGGAGLPAGADTAGAMRPAMMPMPMGGAGGGAGMPAGMLGRGGASPNPAQSRPSVVPRTGIG
>LR130759.1|VDM90191.1|4350967_4352728_-|Nitric-oxide-reductase-activation-protein
MFETGLYSGTDIWSFKTGALTSEQQSPERLPRWGVLASAIAGRGLHVALSAPGEPSWTDGDTIFVATGMPAGLQLQSLAVQASLLAAGSLERDVLRALRWRTSLARRYLAVEGQRALAVTDEWLPPRLRAMIDVRVVACSDSPTTSLAVALSRRPIADPPRSFGAIRPRKMLAQLAKRTRGDTQPAIGDLVERGHQAGTQLDDDTADRAAGADIVSSPIGGGGALGRLLRRMLGPAGRLGVGGQPGADAPTHRTRAGSRGFGALWSSPPVRLPEDRAALGAVATPVFSYPEWDVYRRRYRSNWCTVREISPIVEDALSPDGLGGYGLRRSLARIGLAPDWFRRQPQGEDIDIDAAIEAHVAVAAGSPPGEAIYVDRLRRRRDLAALLLVDSSGSVGQTGAWGKTVHEQQLAAAVALAVALRDLGDRLALYAFYSQGRAAVQLMPLKRFGEALDAPALRRIGGLVPGAYSRLGAAIRHGAAMLESQGGTTRRMLVVLSDGLAYDHGYERDYGAADARRALAEARGRGIGCVCLTVGASTDPQELQRVFGSAALATVGRPEQLRQVVGPLFRVALRSAEVRKPEVVPG
>LR130759.1|VDM90190.1|4350125_4350971_-|Denitrification-regulatory-protein-NirQ
MSQISVPHYAGAMSSDGVLPAAVRPFYVSVGNEERVFKAAFRQGLSVLLKGPTGCGKTRFLEAMAHDVQRPLITVACHDDLTAADLVGRFLLRGGDTEWVDGPLTRAAREGAICYLDEVVEARQDTTVVLHPLADHRRQLPIERLGVTLDVAPGFCLVVSYNPGYQSVLKDLKDSTRQRMIAIEFGFPTADIEQDIVAHEAGVALEAAAQLVRLARAIRRLQDGGLREVASTRVLIATGQMASEGLTLREAAIAAIAGPLTDDNHAVNGLLEMIDIYLPGP
>LR130759.1|VDM90189.1|4348923_4350033_-|hypothetical-protein
MSYLGTAQPIKIGYLFDFLLPEGYPREMRDDLTRPFDVVFADGMRQRVIDRPVEIVYREVEGLPKGAVKAVIDAYGELVDEGCLVVFGPHITENAVPTKEAIEERFRVPAVNVCGSDDWLGEWTFAFPQGSMTDEPIFWADLLAKGGHNDVGVLVEQSLVGQSYLGNFRKAAQSSGIRIVAEAQIAQTAQDTGQAVRSLSEAKPSALVHCGFGFGIVFVNPALTELGWDPPRFTSTAFQNAWINPAMWQAFMGWTGIDQYDEGNDVGQAFLDRYESEYGRRPQYCVPVVNRDVAATLLHAFSDAHPLSPRGVKEALERVKMLPAAAGAPGTRISLGKWTRRAWMGAGYLVARTLDPDGVTSHLVGRFGE
>LR130759.1|VDM90188.1|4347792_4348917_-|hypothetical-protein
MATQTVGATAKVARGSARVSIWVTVWVAVVVVALVVIAYYARQGAVSTRIRNPDVAGAPRPVQPLFGYDHWLALFQIFTIISMTLIVVVYVVAWRRYPAHPVLLMGIVTTLIVWQDPIMNWSPYAVYNPQLWHWPEDWPLVSLSPTVEPFLVIGYIMFYLGPYFPAIWILRKIQARRPVDSFAWRRPLISLAAIILPLGIIIDAMLEMTLVRTGFYIYSQVIPFGSAFAGQTYQFPFIWETVMVTFVMIPAGVLLYRDDTGRTVAERLAQRARILRGRPALATFVVMFAAINLAYFAYGTGFAIVKWTRTATSVACPWPYPEAKAYDPQGFYERNGQSGPYSVGIWSTWMSAQPHGRPDVAAPPDGGRCGPQHG
>LR130759.1|VDM90198.1|4365721_4367089_+|Putrescine-oxidase
MTEVDYCVVGAGFAGLTAALRLKQAGHSVSVLEARDRIGGRTFTVTRDDGVWIDRGGAWIGPGQDRVYALMNEFGVAEYKQHNDGDAMMIVDGKKHRYGGKLPWTMSPWAVANLGIVLLTVEKMCKSLPREAPWEAKRAAEWDRTSLGDWLETNVMSKPAREMLDMALAGPYTCAAAEVSLLWVLLQMGSAGGPNFVISGKGGAQDARPVGGMGAIYRPMAAQLGDALQLSQPVHQISQDADGVTVRSDYLAVRAQRVVVAIPMALADSIRYEPALPVDRAFLNQRMPSGAVVKISVVYDEPFWRADGLSGQSAAPGSPATLTIDACTDTAIPGIMCVITEGPAARKLAQVDDAERRALVISELVDRFGNKASAPVEFHEQNWTHDRYSGGGMISHTPTGVLTEFGYTLRPPSGRIHWAGTESSATMCGWVDGAIRSGERAAAEVMAAHTAAAVT
>LR130759.1|VDM90199.1|4367165_4367675_-|Putative-oxidoreductase-MhqP
MTAYDVGLLILRLVLGLTLAAHGFNKFFGGGRIPGTARWFESIGMKPGTFHAAIAASTEVAAGLGLAAGLLTPIPAAGFVSLMVVAAWTVHRPNGFFIVKEGWEYNLVLAVSAIAVATVGAGKLSLDWLIFGRNWLDGWAGLLVAVALGLAGAVGQLLIFYRPPAKQAR
>LR130759.1|VDM90200.1|4368172_4369861_+|Pyruvate,-phosphate-dikinase
MTRVARVDSARTSTASRSGRTRNSPGVLLLNGNARCSPEVLGNKGCGIDLMRRQSLPVPSAFGIGAEVGARYLAEPGPTMDAIWDDVLDGMRWLEVETSSTFGRGAHPLLVSVRSGAAQSMPGMMDTLLNLGINDAVEAALAATSSPEFAADTHRRFTRMYRHVVAGELANGRHGTAPMPVPTDPYEQLRAGIEAVFASWHSPRAVAYRAHHRLDERSGTAVIVQAMVFGNRGTNSGAGVLCSRNPITGSAEPFGEWLPGGQGDDVVSGLVNVQPIGALRDTQPAAYAQLMAAAGRLERLAADIQEIEFTVEDGTLWLLQTRAAERSAQAAVRLALQLRREGLINDVETLRRVNPAHVEALTMPSLQPETRLTAPLLATGLAACPGVVSGRAYTDVDEALRAAERGEEVILVRGHTRPDDILGMVAARGVVTEVGGASSHAAVVSRELGRVAVVGCGNGAAAALAGKQITVDGTEGEVRAGTLKLSAWSESDTPELRELAAIARRVSPLRAHSAGEYPRLESSSDTEVRNALAAGHTDVVSGAPLVTMLTAMRAAGRDAPTR
>LR130759.1|VDM90201.1|4369857_4370463_+|hypothetical-protein
MSELAVLQAVRLKGQVTAANLATTLGLSPADVADTVERLSAAGLLIKNTTLRISSSGRLRLDALLTEERDGVDSAALAAVHDDFRAVNTDFKTLVTDWQLRNGRPNAHDDAEYDAAILARLQAVHQRVTPIIAAAALQVPRLSGYARKLSHALDRLNAGETAWLTRPLMDSYHTVWFELHEELLLAAGLTREQEARAGEAH
>LR130759.1|VDM90202.1|4370500_4371736_-|acyltransferase,-WS/DGAT/MGAT
MSRMAAVDAQFYWMSAKVPNDQFLLYAFAGEPKDLEGAIDEVCNRARGCPDLAMRVEDGGALSYPRWVAAAVESTQVVRHEPAEQSWRGCLDAVAALADSQLDIRQMPWRLHIFTAIRGIPGCAGGGVVAVLQVAHALADGTRASALAAWLFGREVWVPRVDVPSPGCLLRRAADAARTHHRLVCDTRAGLLSPAASPRPPVATNVRPDGARTLRTVVRKRTEMPGATVTVGALAAVSTALFELLDGSADALGAEVPIAKPGVRQAHNHFGNVVVGLYPQLAVDARMERIAADLAHGRRRFQHPAAFSADRAFAAVPAPLLRWGVAHFDPTVRPVLVAGNTVLSSVYRGAGDLHFGGAPVVLTAGYPALSPSMGLTHGVHGIGDTIAISVHAAASAVADVDAYVRCLDSVL
>LR130759.1|VDM90203.1|4371954_4372860_-|short-chain-dehydrogenase
MSEPRWLNVSGSGGELKALTWGRPGAPIALCLHGFPDTPYGWRKIASRLVDGGWRLVAPFMRGYAPSSIPTDGSYHIGALMDDALKVRAAAGGTEHDVVIGHDWGAMAAAGLAAMPDSPFDKAVIMSVPPAAAFRPLGRVADRGRLARELPHQLLRSWYLLYFQLPWLPEHSASWVVPLLWRRWSPAYRADEDLRHVDAAIGTPEGWRAALGPYRAMVRNSRPPVRYAELHRHWMEAPKLPTLYLHGRDDGCAAPAFAHWTQRVLPAGSSLAIIDHAGHFLQLEQPYEVAESVLAFVGSPG
>LR130759.1|VDM90204.1|4373190_4373796_+|Potential-acrAB-operon-repressor
MHAARSAGQGRASPARRWSKTDATQQRILDAATGVFATSGFNAATMADIVTSSGASIGSIYHHFGGKNELFLAIFERMASTVEQRIEAANQRAGDEADRHRALNVRAYLEAIWENRRVARLLSSGDRPTEFGAARRERLTALFQDWMTVLGLDSSLRGRLLGRALLAIMEESSKMVIACDDPNDVEPIIDATIEWIGRLTE
>LR130759.1|VDM90205.1|4373798_4374275_-|3-demethylubiquinone-9-3-methyltransferase
MPSITPSLWFDHNLEEAARFYTSVFPNSQIEGFNRYTEAGPGEPGTVASGSFVLDGTRFIGINGGPVFQFTEAVSFAVTCKDQDEVDYYWDRLTDGGAESQCGWCTDRYGLSWQVVPERLYELIADPDPARAAAATTAMLGMGKIVIAELEKAVDVSV
>LR130759.1|VDM90206.1|4374388_4375255_+|Lipase-1-precursor
MSSASKGPQTVALSGADGLTLAADEWNRNTDDASRRPTILLLHGGGQNRFSWKKTGQLLADEGFHVVAVDSRGHGDSDRAPDADYAVESLTADVLRVLETIGRPVVLIGASMGGLTGILAADAAGPTKVTALVLVDVVPRYEKDGSARIRDFMLTNLHGFATLAEAADAVAAYLPHRTKPRSPEGLKKNLRLRDGRWYWHWDPAMMTAPGDDPELRTENFEQAAENLTIPILLIRGKLSDVVSPEGVQDFLTKVPHAKFVELSNAGHTAAGDDNDAFTDAVVAFVKRG
>LR130759.1|VDM90207.1|4375265_4376288_-|6-phosphogluconate-dehydrogenase,-NADP(+)-dependent,-decarboxylating
MQLGMIGLGRMGANIVRRLVKGGHECVVYDHDPDAVKAMSGEDKTTGVSSLSELRDKLSAPRVVWVMVPAGNITSGVIEELARTLDSGDIVIDGGNTYYRDDIKHSKLLSNKGIHLLDCGTSGGVWGLERGYCLMIGGDADAVAHAEPIFATVAPGLDAAPRTPGRDGEVAQSERGYLYCGQSGAGHFVKMVHNGIEYGMMASLAEGLNILRNADIGTRVQAGDAETAPLSNPECYQYDIDIPEVAEVWRRGSVIGSWLLDLTAIALHESPELKEFSGRVSDSGEGRWTSIAAIDEGVPTPVLTTALQSRFASRDLDDFANKALSAMRKQFGGHAEKPAN

Crispr_ID: LR130759_18

• CRISPR_ID: LR130759_18
• CRISPR_location: 5329552-5329883
• CRISPR_type: Orphan
• Repeat_type: NA
• Spacer_info: 5 spacers

Consensus repeat of LR130759_18

Consensus_repeat	Method
CGGCNNNGGCGGCACCGGCGGCACCGGCGGCA	CRT

spacers of LR130759_18

>18.1|5329584|31|LR130759|CRT
CCAACGGCTCCGGCGGCGCGGGCGGGACCGG
>18.2|5329647|19|LR130759|CRT
CCGGCAAAGACAGCGCCGC
>18.3|5329698|31|LR130759|CRT
CCGGCGGCCAAGCAGGCGCCGGCGGAGCAGG
>18.4|5329761|22|LR130759|CRT
GCACGGGCGCCGTCGGCGATGC
>18.5|5329815|37|LR130759|CRT
AGGGAGGCCAGGGCGGTCAGGGCGCGGCCGGAGCCGA

CRISPR arrays and Neighbor proteins around LR130759_18

CRISPR arrays

The CRISPR arrays of LR130759_18

>merge|LR130759|18|5329552-5329883|CRT
CGGCCAAGGCGGAGACACCGGCGCCGGCGGCACCAACGGCTCCGGCGGCGCGGGCGGGACCGGCGGCACCGGCGGCACCGGCGGCACCGGCGGCACCGGCAAAGACAGCGCCGCCGGCATCGGCGGCACCGGCGGCACCGGCGGCACCGGCGGCCAAGCAGGCGCCGGCGGAGCAGGCGGCGCCGCCGGCACCGGCGGCACCGGCGGCAGCACGGGCGCCGTCGGCGATGCGGGTACCGGCGGCACCGGCGGCACCGGCGGTCAGGGAGGCCAGGGCGGTCAGGGCGCGGCCGGAGCCGACGGCACGGGCGGCACCGGCGAAATCGGGTTCA

>LR130759|18|8|5329552-5329883|CRT
CGGCCAAGGCGGAGACACCGGCGCCGGCGGCA	CCAACGGCTCCGGCGGCGCGGGCGGGACCGG
CGGCACCGGCGGCACCGGCGGCACCGGCGGCA	CCGGCAAAGACAGCGCCGC
CGGCATCGGCGGCACCGGCGGCACCGGCGGCA	CCGGCGGCCAAGCAGGCGCCGGCGGAGCAGG
CGGCGCCGCCGGCACCGGCGGCACCGGCGGCA	GCACGGGCGCCGTCGGCGATGC
GGGTACCGGCGGCACCGGCGGCACCGGCGGTC	AGGGAGGCCAGGGCGGTCAGGGCGCGGCCGGAGCCGA
CGGCACGGGCGGCACCGGCGAAATCGGGTTCA

Neighbor Proteins Overview

Protein	Signature genes	Signature genes Name	Protein_function
LR130759.1|VDM91064.1|5337471_5338146_+|Cutinase	unknown	unknown	gnl|CDD|366455
LR130759.1|VDM91060.1|5323019_5326955_+|PE-family-protein	unknown	unknown	gnl|CDD|376422
LR130759.1|VDM91066.1|5339196_5339343_-|hypothetical-protein	unknown	unknown	unknown
LR130759.1|VDM91057.1|5307825_5307939_-|hypothetical-protein	unknown	unknown	unknown
LR130759.1|VDM91056.1|5305602_5307075_+|PE-family-protein	unknown	unknown	gnl|CDD|376422
LR130759.1|VDM91052.1|5300765_5302199_-|Putrescine-oxidase	unknown	unknown	gnl|CDD|366721
LR130759.1|VDM91055.1|5304775_5305603_+|hypothetical-protein	unknown	unknown	unknown
LR130759.1|VDM91054.1|5304648_5304774_+|hypothetical-protein	unknown	unknown	unknown
LR130759.1|VDM91063.1|5337257_5337431_+|CsbD-like-protein	unknown	unknown	gnl|CDD|283241
LR130759.1|VDM91053.1|5302861_5304544_-|PE-family-protein	unknown	unknown	gnl|CDD|376422
LR130759.1|VDM91069.1|5341036_5341309_-|putative-transmembrane-sensor-domain-protein	unknown	unknown	gnl|CDD|143636
LR130759.1|VDM91051.1|5300252_5300591_-|Sensor-protein-FixL	unknown	unknown	gnl|CDD|272971
LR130759.1|VDM91070.1|5341373_5341784_-|hypothetical-protein	unknown	unknown	unknown
LR130759.1|VDM91067.1|5339371_5339755_-|PPOX-class-probable-F420-dependent-enzyme,-family	unknown	unknown	gnl|CDD|274712
LR130759.1|VDM91062.1|5336425_5336950_-|hypothetical-protein	unknown	unknown	unknown
LR130759.1|VDM91058.1|5307942_5314032_+|PE-family-protein	unknown	unknown	gnl|CDD|376422
LR130759.1|VDM91068.1|5339895_5341050_+|L-idonate-5-dehydrogenase	unknown	unknown	gnl|CDD|176223
LR130759.1|VDM91059.1|5314200_5321979_+|PE-family-protein	unknown	unknown	gnl|CDD|376422
LR130759.1|VDM91061.1|5335370_5336429_+|dihydrodipicolinate-reductase	unknown	unknown	gnl|CDD|226326
LR130759.1|VDM91065.1|5338202_5339180_+|UDP-N-acetylglucosamine-4,6-dehydratase-(inverting)	unknown	unknown	gnl|CDD|187539

rpsblast for functional proteins

Protein	Function_ID	Function_description	E-value
LR130759.1|VDM91064.1|5337471_5338146_+|Cutinase	gnl|CDD|366455	pfam01083, Cutinase, Cutinase.	4.82419e-47
LR130759.1|VDM91060.1|5323019_5326955_+|PE-family-protein	gnl|CDD|376422	pfam00934, PE, PE family. This family named after a PE motif near to the amino terminus of the domain. The PE family of proteins all contain an amino-terminal region of about 110 amino acids. The carboxyl terminus of this family are variable and fall into several classes. The largest class of PE proteins is the highly repetitive PGRS class which have a high glycine content. The function of these proteins is uncertain but it has been suggested that they may be related to antigenic variation of Mycobacterium tuberculosis.	1.60272e-26
LR130759.1|VDM91068.1|5339895_5341050_+|L-idonate-5-dehydrogenase	gnl|CDD|176223	cd08262, Zn_ADH8, Alcohol dehydrogenases of the MDR family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines.	9.63219e-157
LR130759.1|VDM91065.1|5338202_5339180_+|UDP-N-acetylglucosamine-4,6-dehydratase-(inverting)	gnl|CDD|187539	cd05228, AR_FR_like_1_SDR_e, uncharacterized subgroup of aldehyde reductase and flavonoid reductase related proteins, extended (e) SDRs. This subgroup contains proteins of unknown function related to aldehyde reductase and flavonoid reductase of the extended SDR-type. Aldehyde reductase I (aka carbonyl reductase) is an NADP-binding SDR; it has an NADP-binding motif consensus that is slightly different from the canonical SDR form and lacks the Asn of the extended SDR active site tetrad. Aldehyde reductase I catalyzes the NADP-dependent reduction of ethyl 4-chloro-3-oxobutanoate to ethyl (R)-4-chloro-3-hydroxybutanoate. The related flavonoid reductases act in the NADP-dependent reduction of flavonoids, ketone-containing plant secondary metabolites. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	3.69419e-46
LR130759.1|VDM91056.1|5305602_5307075_+|PE-family-protein	gnl|CDD|376422	pfam00934, PE, PE family. This family named after a PE motif near to the amino terminus of the domain. The PE family of proteins all contain an amino-terminal region of about 110 amino acids. The carboxyl terminus of this family are variable and fall into several classes. The largest class of PE proteins is the highly repetitive PGRS class which have a high glycine content. The function of these proteins is uncertain but it has been suggested that they may be related to antigenic variation of Mycobacterium tuberculosis.	2.55512e-14
LR130759.1|VDM91052.1|5300765_5302199_-|Putrescine-oxidase	gnl|CDD|366721	pfam01593, Amino_oxidase, Flavin containing amine oxidoreductase. This family consists of various amine oxidases, including maze polyamine oxidase (PAO) and various flavin containing monoamine oxidases (MAO). The aligned region includes the flavin binding site of these enzymes. The family also contains phytoene dehydrogenases and related enzymes. In vertebrates MAO plays an important role regulating the intracellular levels of amines via there oxidation; these include various neurotransmitters, neurotoxins and trace amines. In lower eukaryotes such as aspergillus and in bacteria the main role of amine oxidases is to provide a source of ammonium. PAOs in plants, bacteria and protozoa oxidase spermidine and spermine to an aminobutyral, diaminopropane and hydrogen peroxide and are involved in the catabolism of polyamines. Other members of this family include tryptophan 2-monooxygenase, putrescine oxidase, corticosteroid binding proteins and antibacterial glycoproteins.	5.58701e-50
LR130759.1|VDM91053.1|5302861_5304544_-|PE-family-protein	gnl|CDD|376422	pfam00934, PE, PE family. This family named after a PE motif near to the amino terminus of the domain. The PE family of proteins all contain an amino-terminal region of about 110 amino acids. The carboxyl terminus of this family are variable and fall into several classes. The largest class of PE proteins is the highly repetitive PGRS class which have a high glycine content. The function of these proteins is uncertain but it has been suggested that they may be related to antigenic variation of Mycobacterium tuberculosis.	8.96053e-35
LR130759.1|VDM91069.1|5341036_5341309_-|putative-transmembrane-sensor-domain-protein	gnl|CDD|143636	cd07302, CHD, cyclase homology domain. Catalytic domains of the mononucleotidyl cyclases (MNC's), also called cyclase homology domains (CHDs), are part of the class III nucleotidyl cyclases. This class includes eukaryotic and prokaryotic adenylate cyclases (AC's) and guanylate cyclases (GC's). They seem to share a common catalytic mechanism in their requirement for two magnesium ions to bind the polyphosphate moiety of the nucleotide.	2.11058e-18
LR130759.1|VDM91051.1|5300252_5300591_-|Sensor-protein-FixL	gnl|CDD|272971	TIGR00229, Sensor_protein_FixL, PAS domain S-box. The PAS domain was previously described. This sensory box, or S-box domain occupies the central portion of the PAS domain but is more widely distributed. It is often tandemly repeated. Known prosthetic groups bound in the S-box domain include heme in the oxygen sensor FixL, FAD in the redox potential sensor NifL, and a 4-hydroxycinnamyl chromophore in photoactive yellow protein. Proteins containing the domain often contain other regulatory domains such as response regulator or sensor histidine kinase domains. Other S-box proteins include phytochromes and the aryl hydrocarbon receptor nuclear translocator. [Regulatory functions, Small molecule interactions].	4.30792e-10
LR130759.1|VDM91063.1|5337257_5337431_+|CsbD-like-protein	gnl|CDD|283241	pfam05532, CsbD, CsbD-like. CsbD is a bacterial general stress response protein. It's expression is mediated by sigma-B, an alternative sigma factor. The role of CsbD in stress response is unclear.	1.26425e-05
LR130759.1|VDM91058.1|5307942_5314032_+|PE-family-protein	gnl|CDD|376422	pfam00934, PE, PE family. This family named after a PE motif near to the amino terminus of the domain. The PE family of proteins all contain an amino-terminal region of about 110 amino acids. The carboxyl terminus of this family are variable and fall into several classes. The largest class of PE proteins is the highly repetitive PGRS class which have a high glycine content. The function of these proteins is uncertain but it has been suggested that they may be related to antigenic variation of Mycobacterium tuberculosis.	7.2357e-27
LR130759.1|VDM91059.1|5314200_5321979_+|PE-family-protein	gnl|CDD|376422	pfam00934, PE, PE family. This family named after a PE motif near to the amino terminus of the domain. The PE family of proteins all contain an amino-terminal region of about 110 amino acids. The carboxyl terminus of this family are variable and fall into several classes. The largest class of PE proteins is the highly repetitive PGRS class which have a high glycine content. The function of these proteins is uncertain but it has been suggested that they may be related to antigenic variation of Mycobacterium tuberculosis.	4.13656e-28
LR130759.1|VDM91061.1|5335370_5336429_+|dihydrodipicolinate-reductase	gnl|CDD|226326	COG3804, COG3804, Uncharacterized conserved protein related to dihydrodipicolinate reductase [Function unknown].	5.13709e-54
LR130759.1|VDM91067.1|5339371_5339755_-|PPOX-class-probable-F420-dependent-enzyme,-family	gnl|CDD|274712	TIGR03666, Rv2061_F420, PPOX class probable F420-dependent enzyme, Rv2061 family. A Genome Properties metabolic reconstruction for F420 biosynthesis shows that slightly over 10 percent of all prokaryotes with fully sequenced genomes, including about two thirds of the Actinomycetales, make F420. A variant of the Partial Phylogenetic Profiling algorithm, SIMBAL, shows that this protein likely binds F420 in a cleft similar to that in which the homologous enzyme pyridoxamine phosphate oxidase (PPOX) binds FMN. [Unknown function, Enzymes of unknown specificity].	4.84452e-53

Protein sequences

>LR130759.1|VDM91060.1|5323019_5326955_+|PE-family-protein
MASFVVVMPEALLAASESLTGLGSTIEAANAAAAASTIQLVAAGQDEVSAAIARLFGSYAQEYQALSTQMGQFHAQFVQALAGSQNVYGAAEAANASPLQILERHLLAIINAPTNALLARPLIGNGANGVDGTGANGGAGGILYGNGGNGGSGAPGQAGGAGGAAGLIGNGGHGGAGGIGAPGQSGGNGGPGGAGGLLSGSGGAGGAGGAGGAGAVGQVGGSGGTGGAGGPGLIGGAGGAGGAGGAGGAGAPGAPAGGAGATGMAGGNGGAGGSGGAASGLPGLFSVGGAGGDGGAGGLGGDGGAGGSGVGYQTTGGTGGAGGTGGNAGAGGAGGAGSPFGLSGVNGSGGTGGGGGTGGDGGIGDTGAFMGGSGGQGGTGGAAGAAGSGGRGGSIGAGGIGGGGGAGGTGGTGTTGGSSQSPTIGGQGGQGGSGGQGGTGGSGIGGVGGGTGGTGGVGGTGGDGGTGGTNTGTSGGAGADGGAGGTGGTAGAAGHGTDGGAIGLIGHGGNGGNGGNGGIGGTGTPGTDATTPSQGSQGGQGGGGGAGGAGGAGIDGLNGGNGGHGGTGGAGGTGGHGGANTGTGGGDGAAGGQGGTGGGAGAAGSGTDGGSNGQHGTGGTGGTGGDGGTGGDGAAGVDDPDSPTAGTQGGQGGAGGAGGTGGAGIGGFGGGTGGTGGTGGAGGTGGVGGTNTGTTGGAGANGGQGGTGGTAGAAGHGTDGGAIGLIGHGGHGGDGGSGGTGATGTEGTNSTSPTAGGTGGQGGTGGTGGDGGAGIDGLNGGNGGTGGTGGQGGTGGQGGTVLGGIGGGNGADGGQGGIGGTAGSAGSGTDGGANGANGTGGQGGTGGAGGAGQIGTQGVSDPTPTPGGTGGSGGAGGAGGSGGAGINGQGGGAGGAGGNGGTGGVGGTGGTNTGSSGDGAAGGQGGAGGAAGAAGSGTDGGAVGNIGTGGTGGAGGTGGTGSTGAIGTSSDTPTPGSQGGQGGAGGTGGAGGIGIGGVGGGQGGNGGNGGTGGTGGTGGTNTDTTGGAGASGGQGGAGGAAGAAGSGTDGAADGINGTGGTGGTGGRGGQGGTGSAGGLSAPGPGGMGGEGGAGGVGGAGIDGLGGGDGGTGGIGGTGGTGGASGTANDGVGGAGGEAGAGGTGGSGTDGGSGGAGGAGGAGGVGATGKDDDAAQGGAGGIGGQGGAGGTGGNAGGGNGTGGVGGQGGMGGQGGGGGAGKGLGGGDGGQGGMGGHGGTGGTGSGSGLGGFGGDGGDGGTGGHGGTGLHGPGQPGAAGQDGGPGGGPSGNDGGAGGGGSIGGGGGPGGPGNT
>LR130759.1|VDM91059.1|5314200_5321979_+|PE-family-protein
MSSFVVVSPEVLVSASGSLAGIGSAISEANAAAARATTQVLAAGGDEVSVAIAQLFGGYAQQYQLLSVRAGQFHARFVESLIGSGQGYGLAEAAGVGPLQAFEQQVLGVVNAPAYALWGRGLIGDGANGAPGSGQPGGAGGLLIGNGGAGGSGAPGQAGGAGGAAGLIGNGGVGGAGGAGEVGGAGGRGGWWVGNGGAGGVGGVGAQGGVGGAAGLIGNGGVGGAGGTGAGGGVGGAGGWLWGDGGAGGGGGAGGLGQAGGTGGGGGAGGLMGGFGGAGGAGGEGGAGAAGQAGGDGGAGGAGGLTRALFGWAGGDGGAGGQGGAGAIGEAGLGGGSGGAGSTGGHGGVGGAGGAATGWLGMGGLFSAGGAGGGGGAGGAGGGGGAGGSGIGLGMAGGAGGEGAAGGAGGSGGAGGSAGLLGLSGVNGSGGIGGGGGAGGTGGHGDTGALSGGAGGQGGAGGAAGVAGTGGRAGANGVGGLGGHGGHGGQGGAGQAGLTDPNTPTAGDTGGTGGAGGQGGAGGAGIGGVGGGAGGTGGTGGTGGIGGSGGTNTGDSGGTGAAGGQGGTGGAAGAAGQGTDGATNGANGTGGHGGTGGTGGAGGFGAVGASTPTPTAGGQGGHGGAGGAGGTGGAGIGGVGGGAGGAGGVGGAGGVGGYGGDNTGTAGGAGAAGGVGGTGGTAGAGGVGTDGATNGTHGTGGVGGQGGIGGNGATGTIGTSSSTPTAGGQGGHGGAGGQGGTGGAGIDGIGGGAGGAGGIGGTGGTGGTGGTNNATSGGGDGAAGGQGGTGGTAGAGGVGTDGATNGTHGTGGAGGQGGNGGTGATGTTGTSSSTPTAGGTGGHGGNGGAGGTGGAGIDGIGGGAGGQGGTGGTGGQGGVGGTNTNTSGGTGAAGGQGGTGGTAGAGGAGTDGATNGTHGTGGIGGRGGTGGNGGAGMDGSNDPLAPVAGAQGGQGGTGGQGGNGGAGIDGIGGGAGGAGGTGGTGGTGGTGGSNTGANGGTGAAGGQGGTGGTAGAAGLGTDGATNGTHGTGGQGGTGGNGGHGATGTTGTSGSTPTPGGTGGQGGTGGTGGNGGAGINGIGGGAGGAGGTGGTGGTGGTGGTAANGGDGANGGQGGTGGTAGAGGAGTDGATNGTHGTGGQGGTGGNGGHGATGTTGTSGSTPTPGGTGGHGGGGGQGGNGGAGINGIGGGAGGQGGNGGTGGTGGTGGTGTSANNGANGGDGANGGQGGTGGTAGAGGAGTDGATNGTHGTGGVGGQGGTGGHGATGTTGTDGTPTAPPTPGGTGGHGGGGGQGGNGGAGINGIGGGAGGQGGTGGTGGDGGTGGTGTSANNGANGGDGANGGQGGQGGTAGTPGSGTDGGANGTNGTGGQGGNGGTGGTGGQGGTGIDDPNSPTSGTQGGQGGTGGAGGAGGAGIGGVGGGAGGNGGTGGDGGTGGTGGTNTGTTGGAGADGGAGGTGGTAGAAGHGTDGGVIGLIGNGGTGGNGGQGGNGGVGTTGTDDPSVPAPAHLGGQGGNGGQGGTGGTGGAGIDGINGGQGGNGGQGGNGGQGGNGGTGGDGGHGSSGGTGAGGGQGGAGGTGGSAGHGTDGGAHGTGGGGGDGGTGGTGGTGGTGTSSSSPTAGGTGGTGGTGGAGGAGIAASGGGAGGQGGSGGTGGHGGTGGQGQFAADGAVGGAGGQGGAAGTGGTGTDGNHNGTNGTGGQGGTGGSGGDGGHGADGADDPNSPTSGTQGGQGGTGGAGGAGGTGIDATGGGDGGQGGTGGNGGDGGAGGSNTGTTGGKGADGGHGGTGGAAGAAGSGTDGGAGGANGAGGNGGNGGNGGNGGNGTPGDSGISPETGGQGGQGGIGGAGGAGGAGINGIGGGNGGQGGAGGNGGIAGPGGTNTGSTGGNGGDGGDGGAGGTGGTAGSGTDGGTHGNGGQGGNGGTGGTGGAGPAGADGLTPGVGGTGGNGGTGGQGGQGGTGINGIAGGAGGNGGTGGTAGNGGTGGNNTGSTGSTGANGGAGGTGGNGGTLGTGTDGGTNGTGGTGGTGGTGGHGGTGPLGANGLTPGNGGTGGNGGPGGQGGQGGTGINGIGGGNGGQGGNGGTGGTGGHGGNNTGGDGEDGATGGDGGTGGNAGLGGSGTDGGTNGNNGTGGTGGQGGTGGDGAFGESGSISQPAQSGGNGGNGGQGGAGGAGIAGNGGGTGGQGGAGGQGGQGGAAGDAPLGSGTGGVGGTGGAGGNGTDGGSGGDGGTGGAAGTGGIATDVSDGGNGGQGGEGGTGGQGSGIGIGGNGGQGGAGGSGSDAGTKVGYAGSGGNGGQGGSGGNSETGDAGNGGNGGQGGEGGTGGNRDENPTPGGPGGDGGNGGTGGTSGGNGTAGQGGQGGLGGNGGQGGLGVPGLTGGAGGSGGVGGNGGQGGASSGQGPAGDGGAGGQGGAGGIGGNGGSNLGNGNGGDGGQGGNGGDGGQGGAGKGAIGGGNGGLAGTGGAGGSGGNGVGSGTGGSGGSGGTGGIGGTGGNGPGGQGLPGAPGDGGSQGSPPSGQAGGAGAPGGQGGSGGNGGPGTASGSLFSPPPMLPVAATVPPSETDQFEGLATGAGGLGTLTSIFRRG
>LR130759.1|VDM91058.1|5307942_5314032_+|PE-family-protein
MSFTLPCFESTHTLLVIWSVEMSSFVVVSPEVLVSASGSLAGIGSAISEANAAAARATTQVLAAGGDEVSVAIAQLFGGYAQQYQLLSVRAGQFHARFVESLIGSGQGYGLAEAAGVGPLQAFEQQVLGVVNAPAYALWGRGLIGDGANGAPGSGQPGGAGGLLIGNGGAGGSGAPGQAGGAGGAAGLIGNGGVGGAGGAGEVGGAGGRGGWWVGNGGAGGVGGVGAQGGVGGAAGLIGNGGVGGAGGTGAGGGVGGAGGWLWGDGGAGGGGGAGGLGQAGGTGGGGGAGGLMGGFGGAGGAGGEGGAGAAGQAGGDGGAGGAGGLTRALFGWAGGDGGAGGQGGAGAIGEAGLGGGSGGAGSTGGHGGVGGAGGAATGWLGMGGLFSAGGAGGGGGAGGAGGGGGAGGSGIGLGMAGGAGGEGAAGGAGGSGGAGGSAGLLGLSGVNGSGGIGGGGGAGGTGGHGDTGALSGGAGGQGGAGGAAGVAGTGGRAGANGVGGLGGHGGHGGQGGAGQAGLTDPNTPTAGDTGGTGGAGGQGGAGGAGIGGVGGGAGGTGGTGGTGGIGGSGGTNTGDSGGTGAAGGQGGTGGAAGAAGQGTDGATNGANGTGGHGGTGGTGGAGGFGAVGASTPTPTAGGQGGHGGAGGAGGTGGAGIGGVGGGAGGAGGVGGAGGVGGYGGDNTGTAGGAGAAGGVGGTGGTAGAGGVGTDGATNGTHGTGGVGGQGGIGGNGATGTIGTSSSTPTAGGQGGHGGAGGQGGTGGAGIDGIGGGAGGAGGIGGTGGTGGTGGTNNATSGGGDGAAGGQGGTGGTAGAGGVGTDGATNGTHGTGGAGGQGGNGGTGATGTTGTSSSTPTAGGTGGHGGNGGQGGNGGAGIDGIGGGAGGAGGTGGTGGQGGVGGTNTNTSGGTGAAGGQGGTGGTAGAGGAGTDGATNGTHGTGGIGGRGGTGGNGGAGMDGSNDPLAPVAGAQGGQGGTGGQGGNGGAGIDGIGGGAGGAGGTGGTGGTGGTGGSNTGANGGTGAAGGQGGTGGTAGAAGLGTDGATNGTHGTGGQGGTGGNGGHGATGTTGTDGTPTAPPTPGGTGGHGGTGGTGGNGGAGINGIGGGAGGQGGNGGNGGTGGTGGTAANGGDGANGGQGGTGGTAGAGGAGTDGATNGTHGTGGVGGQGGTGGHGATGTTGTDGTPTAPPTPGGTGGHGGGGGQGGNGGAGINGIGGGAGGQGGTGGTGGDGGTGGTGTSANNGANGGDGANGGQGGQGGTAGTPGSGTDGGANGTNGTGGQGGNGGTGGTGGQGGTGTGTGNTGGTGGRGGQGGAGGAGGAGSALLVGGGAGGNGGTGGDGGTGGTGSLVTGAGGAGGMGGAGGTAGTGTDGGANGTGGDGGTGGSGGTGGTGGIGSNDPNSPQTGSQGGQGGAGGAGGTGGSGFGGIGGGNGGSGGTGGQGGQGGFGGDNTGTTGGNGADGGQGGAGGAAGVAGTGTDGGTSGANGTGGEGGQGGTGGSGGTGTTGSDGVTPTTGGQGGQGGAGGAGGAGGAGIGGIGGGAGGTGGTGGSGGTGGTGGTNNGISGGAGADGGQGGTGGTAGAGGAGTDGGVSGSNGTGGSGGTGGTGGTGGTGTTGTASHSSLPGGNGGIGGQGGAGGQGGNGGAGLDGIGGGQGGTGGTGGTGGTGGTGGANIGANAGNGGAGGQGGAGGTAGVSGTGTDGGANGSHGSGGSGGSGGAGGQGGRGLDGSTFVTPAPGTQGGQGGAGGQGGSGGAGFGGVGGGAGGQGGTGGQGGTGGNGTTGADGDGTAGGQGGTGGAAGTGGTGTDGGANGGNGSGGVGGIGGIGGTGGTGAAGSAGNNPTPGGSGGAGGTGGTGGLGGSGIGGVGGGAGGTGGTGGTGGTGGLGGTGVSNDGAAGGEGGVGGQGGDGGSGTDGGAGGTGGQGGSAGGGGAGGNGNGANHTGGSGGKGGTGGTGGTGGTGTGGGVGGQGGAGGTGGTGGTGSLGNPGQSGTPGDVGDPGGAPIGNDGGTGGPGGNGGDGGTGGP
>LR130759.1|VDM91057.1|5307825_5307939_-|hypothetical-protein
MRSAKGKTNIAEFFQTNAAVFLTRYARWPSAELIKCY
>LR130759.1|VDM91056.1|5305602_5307075_+|PE-family-protein
MWPRRRRPLWWWPPVPISAAIAALLSAHGQAYQALSAQAAAFHAQFIEALRAGADAYAAAEAANVEQVLLGVINGPTEALLGRPLIGDGVNGADGTGQAGGAGGILVGNGGNGGSGGVGQDGGAGGAAGLFGHGGSGGAGGDNGAGNAGAGGAGGAGGLVWGNGGAGGVGGNAAFPGPGSGGNGGAGGSAGLIGNGGTGANGGFSSGSFGAQSGAGGAGGDGGWLYGNGGNGGNDRSGSALGGDGGDAYLFGDGGNGGGGGVGGVAGRAGLLIGDGGNGGSSQPGANGGLLWGNGGDGGGSLSSFRTPGVGGNAGLFGNGGAGGDGLPQAGADGGAGGLIFGNGGAGGNGGSSADGGAGGTAGLLGSGGAGGTGGNASPIAVAGNGGAGGNGGALFGNGGAGGAGGAGLVTNPNGGTGGDGGMGGLIGNGGRGGNAGISTGLGSGIGGNGGNARLIGNGGDGGSGTGGGPGGVGGTGGQLLGAKGTNGAP
>LR130759.1|VDM91055.1|5304775_5305603_+|hypothetical-protein
MECISVAETGRYRLAMTQAPMHVSQKPFTRRLAPAAMGGIRASEPVQYQSSRIVLHKARFTLDRAHGMCSPVPPLSWRRRCGVWPEWNRLSARRIRPRRVGGGNTEAGRNRNGANGGTGGTGWLGWGGIAGSHLRAKAAAALGALADMAVPQATAAPSAVAGAQGFPPLPVARNTRHQANKSILVNSQTVSCILTLLFTQYRLRLLRDSAKLIELLVRMCYIPLWFGSWPLGTTWVGPVAVEVGGDSDVVCDCRAAGGGVCGHRFGWYRLVDQCG
>LR130759.1|VDM91054.1|5304648_5304774_+|hypothetical-protein
MSLAESLGKRKRYCATKGKRVIDNQLVIYYFPEASHQTAGT
>LR130759.1|VDM91053.1|5302861_5304544_-|PE-family-protein
MSFVIAAPQVVVSAATDLAGIGSSISAANVAAASSTTVVVAAGADEVSAAIAALLSAHGQAYQALSAQAAAFHAQFIEALRAGADAYAAAEAANVEQVLLGVINGPTEALLGRPLIGDGVNGADGTGQAGGAGGILVGNGGNGGSGGVGQDGGAGGAAGLFGHGGSGGAGGDNGAGNAGAGGAGGAGGLVWGNGGAGGVGGNAAFPGPGSGGNGGAGGSAGLIGNGGTGANGGFSSGSFGAQSGAGGAGGDGGWLYGNGGNGGNDRSGSALGGDGGDAYLFGDGGNGGGGGVGGVAGRAGLLIGDGGNGGSSQPGANGGLLWGNGGDGGGSLSSFRTPGVGGNAGLFGNGGAGGDGLPQAGADGGAGGLIFGNGGAGGAARGLSDGDGFAGGNGGNAGLWGIGGTGGSGGFGASGGAGGVGGTGGRGGMLFGAGGTGGTGGIGYEAAGFGVGTGAAGGNGGDAGLFGTGGAGGTGGTGVFGGSGGTGGTGGAGGLVFGDGGRGGDAGTSSGSGSGTGGNGGSAEWIGNGGNGGNGTGGGPGGSGGPGGKLAGKNGTDGTP
>LR130759.1|VDM91052.1|5300765_5302199_-|Putrescine-oxidase
MVDRRFEVLRDGLIPRPGRHRSVVVVGAGISGVVCARLLHDAGYEVQVLEARDRAGGRLWAVDGVGGQYYELGGMRFSESNQLAMEVFRQAGVTVSPFPLQHKSFFFGGRHFHPDGFLPSSAGFDIPPEDDRPLTELLDRVMAPVNAIYERQDNDEEEAFFECLDRFDRYSIQTWLTERGLSPGAVNCLSLVNNIEGRLNFSFSEWAEYVRVDAFGPNLLYVEEGTTELMRRLVEPIAHLVRFGVQATRIEQSLSTATVHWRAGGREGSIRADEVILAVPPIVLRHIPIEGMSTAKDAALRRTYCGRAAKVFLRFNRRWWDDIVGDKGGLAVTDLPVRNVLFTVAGQGDDPSRGAIIGSYTWESDSMVFANLPVEERIERVLSDVELMYPEAVGSFEGGVAHDWGSDRWAGGVGGLFRPTEMSGDHYRDLIEPLGRVWFAGETYDRRSRRWVEGALKSAVKNCMALHDNARDNLPLD
>LR130759.1|VDM91051.1|5300252_5300591_-|Sensor-protein-FixL
MEIYADDKGSILAVTEPELLGYTSEELIGKKVEIIVPYKYREAHRRGLKRWSESGEAKVMGTWLLIEARHRDGDLVRMELVLTQRMDNTGRRVVTANIKPVSDDDMFRLAPI
>LR130759.1|VDM91061.1|5335370_5336429_+|dihydrodipicolinate-reductase
MPNNYRVVQWTTGNVGKSSLQAIAAHPALQLVGCYAWSPQKVGRDAGDLCGIAPLGVTASNDTDALLALKPDCVVYNPMWIDVDELVRILSAGVNVVTTAAFITGHNLGPGRDRILDACHQGGSTIFGSGVSPGFAELLAIVSTMVCNRVDKVTVNEAADTTFYDSPATERPVGFGQPIDHPELQAMTAVGTAIFGEAVRLIADALGLELDDVHCEAEYAQTTAELNLGSWSIPAGCVAGVAASWQGVLGHRTLVELNVRWRKGQTLEPDWRIDQDGWVIKVDGRPTVTTTVSFLPPPYFEAETIADFMMLGHIMTAMPTINSIPAVVAAQPGIVTYNDLPLTVPRGVVPRR
>LR130759.1|VDM91062.1|5336425_5336950_-|hypothetical-protein
MPQSKLANPIFNVIAPRVAGLAFSGGFGAMYFPGVKSLVQGDTSFQDGEVPGANGVVTGRGLAKMYAALANDGHLGYHESPVPGLLNGFGHVGLGGTLGWADPETASSFGYVHNRLLTPLLFDMGSFAGLVRPLRNAIRAARRHGFFEVPEFGANYPKPARQQVVSEHAAVGDG
>LR130759.1|VDM91063.1|5337257_5337431_+|CsbD-like-protein
MSAEDKVKNKIEDLGGRAKEAIGHATGDKNTKDEGRLDQAKASLKDAGEKVKDALRK
>LR130759.1|VDM91064.1|5337471_5338146_+|Cutinase
MAVSAVVAMLVSVSAMLGMPAPPAAAEPCPDVEVLFARGTGEPPGVGGIGGSFVEALRSQIGSRSLAVYPINYPASTDFSNPDFPQTVIAGIRDASSHIEATAANCPNTKEVLGGYSQGAAVAGYVTSAAVPPGVPAAAVPEPMPPEIASHVAAVTLFGTPSDDFLNQYGAPPIVIGPLYQPKTIELCADGDGICGAGNNPAAHAAYVVNGMTSQGADFAASHL
>LR130759.1|VDM91065.1|5338202_5339180_+|UDP-N-acetylglucosamine-4,6-dehydratase-(inverting)
MRVLVTGGTGFVGGWTARAIADEGHSVRFLVRNPAKLDTSVAELGVDVSDFVVGDIKDRDSVREALTGCDAVVHSAALVATDPRQTPRMQSTNMEGARNVLGQAVQLGLDPIVHVSSFTALFHPDLERLTADLPVVGGTDGYGTSKAQVEIYARGLQDAGAPVNITYPGMVLGPPVGNQFGEAGEGVKAALQIHTIPGRRAAWLVIDVRDVAAVHAALLEPGMGPRRYMVGGHRIPVAELAKMLEQVANTPMLTFPVPDTVLRVAGSLLDLAGPYLPFENPFTAAGMQYYTQMPESDDSPSEKELGIIYRDPRVTLSDTVAALRR
>LR130759.1|VDM91066.1|5339196_5339343_-|hypothetical-protein
MDRVTSAIVATLALLGIGIVTNELLRLRRWLKNSPAEGDDAEPPDEPT
>LR130759.1|VDM91067.1|5339371_5339755_-|PPOX-class-probable-F420-dependent-enzyme,-family
MAANFRDVIKSKYLLLTTFTKDGRPKPTAIWGVPDGDRLLVITDDGSWKVKRIRNTPRVTLAKSGALGKPKGEPVEAVARVLPKSETKRVYNAVLKRYWYHAWWFYPHSLVRGGIDKVHIGLEVKSA
>LR130759.1|VDM91068.1|5339895_5341050_+|L-idonate-5-dehydrogenase
MRAVTCTNAKLEVVDQPTPTPAKGQLLVEVLRCGICGSDLHARKHCDELADVMAESGYDAFMRSGQQVVFGHEFCGEVVDHGPRTRKTPRPGTPVVALPLLRRGDEVHGIGLSTLAPGAYAEQLLVEQALAFPVPNGLAPEIAALTEPMAVGWHAVRRGEVGKGDVAIVIGCGPIGLAVICMLKTHGVRMVIASDFSAGRRALATACGADVVVDPTRDSPYEHGKGHVHSIIDAFDLALGTVEKLHRLRLPWWHVWRAAEAVGAAAPKHPIIFECVGVPGVIDTIMASAPLFSRVVVVGVCMGADHIRPAMAINKEIDLRFVLGYTPIEFRDTLHMLADGKINATPLITGRVGLPGVEAAFEALGDPEAHAKILIDPKSEVKAP
>LR130759.1|VDM91069.1|5341036_5341309_-|putative-transmembrane-sensor-domain-protein
MAMFGAPTDLADHAIRAWLAALAIQDETRRLAGEIEHRDGVALQLRVGRNSGQVVAGEIGSAALGYTAIGEQGGMAQRMESAAGYPAMGP
>LR130759.1|VDM91070.1|5341373_5341784_-|hypothetical-protein
MALTVPPTTQRDLEGWADYTAPIVLTPAAAADVSPGCGDPALAVIGFYAALMRNDDVTGYLLTPDDNVMVRKLETLRSWTFRRLEVRSVRLRGSRKATIRIAVEIDVDGKRDDGTDEIKLQRDGDDGPWRIERPPT

Crispr_ID: LR130759_19

• CRISPR_ID: LR130759_19
• CRISPR_location: 5329906-5330434
• CRISPR_type: Orphan
• Repeat_type: NA
• Spacer_info: 7 spacers

Consensus repeat of LR130759_19

Consensus_repeat	Method
CGGNNNCGGCGGCNNCGGCGGCNCCGGCGGC	CRT

spacers of LR130759_19

>19.1|5329937|32|LR130759|CRT
ACCAACGGCTCCGGCGGCGCGGGCGGGACCGG
>19.2|5330000|20|LR130759|CRT
ACCGGCAAAGACAGCGCCAC
>19.3|5330051|32|LR130759|CRT
ACCGGCGGCCAAGCAGGCGCCGGCGGAGCAGG
>19.4|5330114|23|LR130759|CRT
AGCACGGGCGCCGTCGGCGATGC
>19.5|5330168|53|LR130759|CRT
CAGGGCGGAACCGGCGGCGATGGACTCAGCGCGGGACTGGCCGGGTTTGCCGG
>19.6|5330252|50|LR130759|CRT
AGCGCAGCCGCCAGCGGCATCAACGGCGCCGGCGGCGCCGGCGGTATCGG
>19.7|5330333|71|LR130759|CRT
GACGGCTTCGGAGCCAACGGCGGCACCGGCGGTAACGGCGGCCAAGGTGGGACCGGCGGCGACGCGGGAGC

CRISPR arrays and Neighbor proteins around LR130759_19

CRISPR arrays

The CRISPR arrays of LR130759_19

>merge|LR130759|19|5329906-5330434|CRT
CGGCCAAGGCGGAGACACCGGCGCCGGCGGCACCAACGGCTCCGGCGGCGCGGGCGGGACCGGCGGCACCGGCGGCACCGGCGGCACCGGCGGCACCGGCAAAGACAGCGCCACCGACATCGGCGGCACCGGCGGCACCGGCGGCACCGGCGGCCAAGCAGGCGCCGGCGGAGCAGGCGGCGCCGCCGGCACCGGCGGCACCGGCGGCAGCACGGGCGCCGTCGGCGATGCGGGTACCGGCGGCACCGGCGGCACCGGCGGCCAGGGCGGAACCGGCGGCGATGGACTCAGCGCGGGACTGGCCGGGTTTGCCGGCGGACAAGGCGGCCAGGGCGGCGCCGGCGGCAGCGCAGCCGCCAGCGGCATCAACGGCGCCGGCGGCGCCGGCGGTATCGGCGGAACCGGCGGCCAGGGCGCCGCGGCGGCGGACGGCTTCGGAGCCAACGGCGGCACCGGCGGTAACGGCGGCCAAGGTGGGACCGGCGGCGACGCGGGAGCCGGAGCCGGCGCAGACGGCGCCGGTGGCGCG

>LR130759|19|9|5329906-5330434|CRT
CGGCCAAGGCGGAGACACCGGCGCCGGCGGC	ACCAACGGCTCCGGCGGCGCGGGCGGGACCGG
CGGCACCGGCGGCACCGGCGGCACCGGCGGC	ACCGGCAAAGACAGCGCCAC
CGACATCGGCGGCACCGGCGGCACCGGCGGC	ACCGGCGGCCAAGCAGGCGCCGGCGGAGCAGG
CGGCGCCGCCGGCACCGGCGGCACCGGCGGC	AGCACGGGCGCCGTCGGCGATGC
GGGTACCGGCGGCACCGGCGGCACCGGCGGC	CAGGGCGGAACCGGCGGCGATGGACTCAGCGCGGGACTGGCCGGGTTTGCCGG
CGGACAAGGCGGCCAGGGCGGCGCCGGCGGC	AGCGCAGCCGCCAGCGGCATCAACGGCGCCGGCGGCGCCGGCGGTATCGG
CGGAACCGGCGGCCAGGGCGCCGCGGCGGCG	GACGGCTTCGGAGCCAACGGCGGCACCGGCGGTAACGGCGGCCAAGGTGGGACCGGCGGCGACGCGGGAGC
CGGAGCCGGCGCAGACGGCGCCGGTGGCGCG

Neighbor Proteins Overview

Protein	Signature genes	Signature genes Name	Protein_function
LR130759.1|VDM91064.1|5337471_5338146_+|Cutinase	unknown	unknown	gnl|CDD|366455
LR130759.1|VDM91060.1|5323019_5326955_+|PE-family-protein	unknown	unknown	gnl|CDD|376422
LR130759.1|VDM91066.1|5339196_5339343_-|hypothetical-protein	unknown	unknown	unknown
LR130759.1|VDM91057.1|5307825_5307939_-|hypothetical-protein	unknown	unknown	unknown
LR130759.1|VDM91056.1|5305602_5307075_+|PE-family-protein	unknown	unknown	gnl|CDD|376422
LR130759.1|VDM91052.1|5300765_5302199_-|Putrescine-oxidase	unknown	unknown	gnl|CDD|366721
LR130759.1|VDM91055.1|5304775_5305603_+|hypothetical-protein	unknown	unknown	unknown
LR130759.1|VDM91054.1|5304648_5304774_+|hypothetical-protein	unknown	unknown	unknown
LR130759.1|VDM91063.1|5337257_5337431_+|CsbD-like-protein	unknown	unknown	gnl|CDD|283241
LR130759.1|VDM91053.1|5302861_5304544_-|PE-family-protein	unknown	unknown	gnl|CDD|376422
LR130759.1|VDM91069.1|5341036_5341309_-|putative-transmembrane-sensor-domain-protein	unknown	unknown	gnl|CDD|143636
LR130759.1|VDM91051.1|5300252_5300591_-|Sensor-protein-FixL	unknown	unknown	gnl|CDD|272971
LR130759.1|VDM91070.1|5341373_5341784_-|hypothetical-protein	unknown	unknown	unknown
LR130759.1|VDM91067.1|5339371_5339755_-|PPOX-class-probable-F420-dependent-enzyme,-family	unknown	unknown	gnl|CDD|274712
LR130759.1|VDM91062.1|5336425_5336950_-|hypothetical-protein	unknown	unknown	unknown
LR130759.1|VDM91058.1|5307942_5314032_+|PE-family-protein	unknown	unknown	gnl|CDD|376422
LR130759.1|VDM91068.1|5339895_5341050_+|L-idonate-5-dehydrogenase	unknown	unknown	gnl|CDD|176223
LR130759.1|VDM91059.1|5314200_5321979_+|PE-family-protein	unknown	unknown	gnl|CDD|376422
LR130759.1|VDM91061.1|5335370_5336429_+|dihydrodipicolinate-reductase	unknown	unknown	gnl|CDD|226326
LR130759.1|VDM91065.1|5338202_5339180_+|UDP-N-acetylglucosamine-4,6-dehydratase-(inverting)	unknown	unknown	gnl|CDD|187539

rpsblast for functional proteins

Protein	Function_ID	Function_description	E-value
LR130759.1|VDM91064.1|5337471_5338146_+|Cutinase	gnl|CDD|366455	pfam01083, Cutinase, Cutinase.	4.82419e-47
LR130759.1|VDM91060.1|5323019_5326955_+|PE-family-protein	gnl|CDD|376422	pfam00934, PE, PE family. This family named after a PE motif near to the amino terminus of the domain. The PE family of proteins all contain an amino-terminal region of about 110 amino acids. The carboxyl terminus of this family are variable and fall into several classes. The largest class of PE proteins is the highly repetitive PGRS class which have a high glycine content. The function of these proteins is uncertain but it has been suggested that they may be related to antigenic variation of Mycobacterium tuberculosis.	1.60272e-26
LR130759.1|VDM91068.1|5339895_5341050_+|L-idonate-5-dehydrogenase	gnl|CDD|176223	cd08262, Zn_ADH8, Alcohol dehydrogenases of the MDR family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines.	9.63219e-157
LR130759.1|VDM91065.1|5338202_5339180_+|UDP-N-acetylglucosamine-4,6-dehydratase-(inverting)	gnl|CDD|187539	cd05228, AR_FR_like_1_SDR_e, uncharacterized subgroup of aldehyde reductase and flavonoid reductase related proteins, extended (e) SDRs. This subgroup contains proteins of unknown function related to aldehyde reductase and flavonoid reductase of the extended SDR-type. Aldehyde reductase I (aka carbonyl reductase) is an NADP-binding SDR; it has an NADP-binding motif consensus that is slightly different from the canonical SDR form and lacks the Asn of the extended SDR active site tetrad. Aldehyde reductase I catalyzes the NADP-dependent reduction of ethyl 4-chloro-3-oxobutanoate to ethyl (R)-4-chloro-3-hydroxybutanoate. The related flavonoid reductases act in the NADP-dependent reduction of flavonoids, ketone-containing plant secondary metabolites. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	3.69419e-46
LR130759.1|VDM91056.1|5305602_5307075_+|PE-family-protein	gnl|CDD|376422	pfam00934, PE, PE family. This family named after a PE motif near to the amino terminus of the domain. The PE family of proteins all contain an amino-terminal region of about 110 amino acids. The carboxyl terminus of this family are variable and fall into several classes. The largest class of PE proteins is the highly repetitive PGRS class which have a high glycine content. The function of these proteins is uncertain but it has been suggested that they may be related to antigenic variation of Mycobacterium tuberculosis.	2.55512e-14
LR130759.1|VDM91052.1|5300765_5302199_-|Putrescine-oxidase	gnl|CDD|366721	pfam01593, Amino_oxidase, Flavin containing amine oxidoreductase. This family consists of various amine oxidases, including maze polyamine oxidase (PAO) and various flavin containing monoamine oxidases (MAO). The aligned region includes the flavin binding site of these enzymes. The family also contains phytoene dehydrogenases and related enzymes. In vertebrates MAO plays an important role regulating the intracellular levels of amines via there oxidation; these include various neurotransmitters, neurotoxins and trace amines. In lower eukaryotes such as aspergillus and in bacteria the main role of amine oxidases is to provide a source of ammonium. PAOs in plants, bacteria and protozoa oxidase spermidine and spermine to an aminobutyral, diaminopropane and hydrogen peroxide and are involved in the catabolism of polyamines. Other members of this family include tryptophan 2-monooxygenase, putrescine oxidase, corticosteroid binding proteins and antibacterial glycoproteins.	5.58701e-50
LR130759.1|VDM91053.1|5302861_5304544_-|PE-family-protein	gnl|CDD|376422	pfam00934, PE, PE family. This family named after a PE motif near to the amino terminus of the domain. The PE family of proteins all contain an amino-terminal region of about 110 amino acids. The carboxyl terminus of this family are variable and fall into several classes. The largest class of PE proteins is the highly repetitive PGRS class which have a high glycine content. The function of these proteins is uncertain but it has been suggested that they may be related to antigenic variation of Mycobacterium tuberculosis.	8.96053e-35
LR130759.1|VDM91069.1|5341036_5341309_-|putative-transmembrane-sensor-domain-protein	gnl|CDD|143636	cd07302, CHD, cyclase homology domain. Catalytic domains of the mononucleotidyl cyclases (MNC's), also called cyclase homology domains (CHDs), are part of the class III nucleotidyl cyclases. This class includes eukaryotic and prokaryotic adenylate cyclases (AC's) and guanylate cyclases (GC's). They seem to share a common catalytic mechanism in their requirement for two magnesium ions to bind the polyphosphate moiety of the nucleotide.	2.11058e-18
LR130759.1|VDM91051.1|5300252_5300591_-|Sensor-protein-FixL	gnl|CDD|272971	TIGR00229, Sensor_protein_FixL, PAS domain S-box. The PAS domain was previously described. This sensory box, or S-box domain occupies the central portion of the PAS domain but is more widely distributed. It is often tandemly repeated. Known prosthetic groups bound in the S-box domain include heme in the oxygen sensor FixL, FAD in the redox potential sensor NifL, and a 4-hydroxycinnamyl chromophore in photoactive yellow protein. Proteins containing the domain often contain other regulatory domains such as response regulator or sensor histidine kinase domains. Other S-box proteins include phytochromes and the aryl hydrocarbon receptor nuclear translocator. [Regulatory functions, Small molecule interactions].	4.30792e-10
LR130759.1|VDM91063.1|5337257_5337431_+|CsbD-like-protein	gnl|CDD|283241	pfam05532, CsbD, CsbD-like. CsbD is a bacterial general stress response protein. It's expression is mediated by sigma-B, an alternative sigma factor. The role of CsbD in stress response is unclear.	1.26425e-05
LR130759.1|VDM91058.1|5307942_5314032_+|PE-family-protein	gnl|CDD|376422	pfam00934, PE, PE family. This family named after a PE motif near to the amino terminus of the domain. The PE family of proteins all contain an amino-terminal region of about 110 amino acids. The carboxyl terminus of this family are variable and fall into several classes. The largest class of PE proteins is the highly repetitive PGRS class which have a high glycine content. The function of these proteins is uncertain but it has been suggested that they may be related to antigenic variation of Mycobacterium tuberculosis.	7.2357e-27
LR130759.1|VDM91059.1|5314200_5321979_+|PE-family-protein	gnl|CDD|376422	pfam00934, PE, PE family. This family named after a PE motif near to the amino terminus of the domain. The PE family of proteins all contain an amino-terminal region of about 110 amino acids. The carboxyl terminus of this family are variable and fall into several classes. The largest class of PE proteins is the highly repetitive PGRS class which have a high glycine content. The function of these proteins is uncertain but it has been suggested that they may be related to antigenic variation of Mycobacterium tuberculosis.	4.13656e-28
LR130759.1|VDM91061.1|5335370_5336429_+|dihydrodipicolinate-reductase	gnl|CDD|226326	COG3804, COG3804, Uncharacterized conserved protein related to dihydrodipicolinate reductase [Function unknown].	5.13709e-54
LR130759.1|VDM91067.1|5339371_5339755_-|PPOX-class-probable-F420-dependent-enzyme,-family	gnl|CDD|274712	TIGR03666, Rv2061_F420, PPOX class probable F420-dependent enzyme, Rv2061 family. A Genome Properties metabolic reconstruction for F420 biosynthesis shows that slightly over 10 percent of all prokaryotes with fully sequenced genomes, including about two thirds of the Actinomycetales, make F420. A variant of the Partial Phylogenetic Profiling algorithm, SIMBAL, shows that this protein likely binds F420 in a cleft similar to that in which the homologous enzyme pyridoxamine phosphate oxidase (PPOX) binds FMN. [Unknown function, Enzymes of unknown specificity].	4.84452e-53

Protein sequences

>LR130759.1|VDM91060.1|5323019_5326955_+|PE-family-protein
MASFVVVMPEALLAASESLTGLGSTIEAANAAAAASTIQLVAAGQDEVSAAIARLFGSYAQEYQALSTQMGQFHAQFVQALAGSQNVYGAAEAANASPLQILERHLLAIINAPTNALLARPLIGNGANGVDGTGANGGAGGILYGNGGNGGSGAPGQAGGAGGAAGLIGNGGHGGAGGIGAPGQSGGNGGPGGAGGLLSGSGGAGGAGGAGGAGAVGQVGGSGGTGGAGGPGLIGGAGGAGGAGGAGGAGAPGAPAGGAGATGMAGGNGGAGGSGGAASGLPGLFSVGGAGGDGGAGGLGGDGGAGGSGVGYQTTGGTGGAGGTGGNAGAGGAGGAGSPFGLSGVNGSGGTGGGGGTGGDGGIGDTGAFMGGSGGQGGTGGAAGAAGSGGRGGSIGAGGIGGGGGAGGTGGTGTTGGSSQSPTIGGQGGQGGSGGQGGTGGSGIGGVGGGTGGTGGVGGTGGDGGTGGTNTGTSGGAGADGGAGGTGGTAGAAGHGTDGGAIGLIGHGGNGGNGGNGGIGGTGTPGTDATTPSQGSQGGQGGGGGAGGAGGAGIDGLNGGNGGHGGTGGAGGTGGHGGANTGTGGGDGAAGGQGGTGGGAGAAGSGTDGGSNGQHGTGGTGGTGGDGGTGGDGAAGVDDPDSPTAGTQGGQGGAGGAGGTGGAGIGGFGGGTGGTGGTGGAGGTGGVGGTNTGTTGGAGANGGQGGTGGTAGAAGHGTDGGAIGLIGHGGHGGDGGSGGTGATGTEGTNSTSPTAGGTGGQGGTGGTGGDGGAGIDGLNGGNGGTGGTGGQGGTGGQGGTVLGGIGGGNGADGGQGGIGGTAGSAGSGTDGGANGANGTGGQGGTGGAGGAGQIGTQGVSDPTPTPGGTGGSGGAGGAGGSGGAGINGQGGGAGGAGGNGGTGGVGGTGGTNTGSSGDGAAGGQGGAGGAAGAAGSGTDGGAVGNIGTGGTGGAGGTGGTGSTGAIGTSSDTPTPGSQGGQGGAGGTGGAGGIGIGGVGGGQGGNGGNGGTGGTGGTGGTNTDTTGGAGASGGQGGAGGAAGAAGSGTDGAADGINGTGGTGGTGGRGGQGGTGSAGGLSAPGPGGMGGEGGAGGVGGAGIDGLGGGDGGTGGIGGTGGTGGASGTANDGVGGAGGEAGAGGTGGSGTDGGSGGAGGAGGAGGVGATGKDDDAAQGGAGGIGGQGGAGGTGGNAGGGNGTGGVGGQGGMGGQGGGGGAGKGLGGGDGGQGGMGGHGGTGGTGSGSGLGGFGGDGGDGGTGGHGGTGLHGPGQPGAAGQDGGPGGGPSGNDGGAGGGGSIGGGGGPGGPGNT
>LR130759.1|VDM91059.1|5314200_5321979_+|PE-family-protein
MSSFVVVSPEVLVSASGSLAGIGSAISEANAAAARATTQVLAAGGDEVSVAIAQLFGGYAQQYQLLSVRAGQFHARFVESLIGSGQGYGLAEAAGVGPLQAFEQQVLGVVNAPAYALWGRGLIGDGANGAPGSGQPGGAGGLLIGNGGAGGSGAPGQAGGAGGAAGLIGNGGVGGAGGAGEVGGAGGRGGWWVGNGGAGGVGGVGAQGGVGGAAGLIGNGGVGGAGGTGAGGGVGGAGGWLWGDGGAGGGGGAGGLGQAGGTGGGGGAGGLMGGFGGAGGAGGEGGAGAAGQAGGDGGAGGAGGLTRALFGWAGGDGGAGGQGGAGAIGEAGLGGGSGGAGSTGGHGGVGGAGGAATGWLGMGGLFSAGGAGGGGGAGGAGGGGGAGGSGIGLGMAGGAGGEGAAGGAGGSGGAGGSAGLLGLSGVNGSGGIGGGGGAGGTGGHGDTGALSGGAGGQGGAGGAAGVAGTGGRAGANGVGGLGGHGGHGGQGGAGQAGLTDPNTPTAGDTGGTGGAGGQGGAGGAGIGGVGGGAGGTGGTGGTGGIGGSGGTNTGDSGGTGAAGGQGGTGGAAGAAGQGTDGATNGANGTGGHGGTGGTGGAGGFGAVGASTPTPTAGGQGGHGGAGGAGGTGGAGIGGVGGGAGGAGGVGGAGGVGGYGGDNTGTAGGAGAAGGVGGTGGTAGAGGVGTDGATNGTHGTGGVGGQGGIGGNGATGTIGTSSSTPTAGGQGGHGGAGGQGGTGGAGIDGIGGGAGGAGGIGGTGGTGGTGGTNNATSGGGDGAAGGQGGTGGTAGAGGVGTDGATNGTHGTGGAGGQGGNGGTGATGTTGTSSSTPTAGGTGGHGGNGGAGGTGGAGIDGIGGGAGGQGGTGGTGGQGGVGGTNTNTSGGTGAAGGQGGTGGTAGAGGAGTDGATNGTHGTGGIGGRGGTGGNGGAGMDGSNDPLAPVAGAQGGQGGTGGQGGNGGAGIDGIGGGAGGAGGTGGTGGTGGTGGSNTGANGGTGAAGGQGGTGGTAGAAGLGTDGATNGTHGTGGQGGTGGNGGHGATGTTGTSGSTPTPGGTGGQGGTGGTGGNGGAGINGIGGGAGGAGGTGGTGGTGGTGGTAANGGDGANGGQGGTGGTAGAGGAGTDGATNGTHGTGGQGGTGGNGGHGATGTTGTSGSTPTPGGTGGHGGGGGQGGNGGAGINGIGGGAGGQGGNGGTGGTGGTGGTGTSANNGANGGDGANGGQGGTGGTAGAGGAGTDGATNGTHGTGGVGGQGGTGGHGATGTTGTDGTPTAPPTPGGTGGHGGGGGQGGNGGAGINGIGGGAGGQGGTGGTGGDGGTGGTGTSANNGANGGDGANGGQGGQGGTAGTPGSGTDGGANGTNGTGGQGGNGGTGGTGGQGGTGIDDPNSPTSGTQGGQGGTGGAGGAGGAGIGGVGGGAGGNGGTGGDGGTGGTGGTNTGTTGGAGADGGAGGTGGTAGAAGHGTDGGVIGLIGNGGTGGNGGQGGNGGVGTTGTDDPSVPAPAHLGGQGGNGGQGGTGGTGGAGIDGINGGQGGNGGQGGNGGQGGNGGTGGDGGHGSSGGTGAGGGQGGAGGTGGSAGHGTDGGAHGTGGGGGDGGTGGTGGTGGTGTSSSSPTAGGTGGTGGTGGAGGAGIAASGGGAGGQGGSGGTGGHGGTGGQGQFAADGAVGGAGGQGGAAGTGGTGTDGNHNGTNGTGGQGGTGGSGGDGGHGADGADDPNSPTSGTQGGQGGTGGAGGAGGTGIDATGGGDGGQGGTGGNGGDGGAGGSNTGTTGGKGADGGHGGTGGAAGAAGSGTDGGAGGANGAGGNGGNGGNGGNGGNGTPGDSGISPETGGQGGQGGIGGAGGAGGAGINGIGGGNGGQGGAGGNGGIAGPGGTNTGSTGGNGGDGGDGGAGGTGGTAGSGTDGGTHGNGGQGGNGGTGGTGGAGPAGADGLTPGVGGTGGNGGTGGQGGQGGTGINGIAGGAGGNGGTGGTAGNGGTGGNNTGSTGSTGANGGAGGTGGNGGTLGTGTDGGTNGTGGTGGTGGTGGHGGTGPLGANGLTPGNGGTGGNGGPGGQGGQGGTGINGIGGGNGGQGGNGGTGGTGGHGGNNTGGDGEDGATGGDGGTGGNAGLGGSGTDGGTNGNNGTGGTGGQGGTGGDGAFGESGSISQPAQSGGNGGNGGQGGAGGAGIAGNGGGTGGQGGAGGQGGQGGAAGDAPLGSGTGGVGGTGGAGGNGTDGGSGGDGGTGGAAGTGGIATDVSDGGNGGQGGEGGTGGQGSGIGIGGNGGQGGAGGSGSDAGTKVGYAGSGGNGGQGGSGGNSETGDAGNGGNGGQGGEGGTGGNRDENPTPGGPGGDGGNGGTGGTSGGNGTAGQGGQGGLGGNGGQGGLGVPGLTGGAGGSGGVGGNGGQGGASSGQGPAGDGGAGGQGGAGGIGGNGGSNLGNGNGGDGGQGGNGGDGGQGGAGKGAIGGGNGGLAGTGGAGGSGGNGVGSGTGGSGGSGGTGGIGGTGGNGPGGQGLPGAPGDGGSQGSPPSGQAGGAGAPGGQGGSGGNGGPGTASGSLFSPPPMLPVAATVPPSETDQFEGLATGAGGLGTLTSIFRRG
>LR130759.1|VDM91058.1|5307942_5314032_+|PE-family-protein
MSFTLPCFESTHTLLVIWSVEMSSFVVVSPEVLVSASGSLAGIGSAISEANAAAARATTQVLAAGGDEVSVAIAQLFGGYAQQYQLLSVRAGQFHARFVESLIGSGQGYGLAEAAGVGPLQAFEQQVLGVVNAPAYALWGRGLIGDGANGAPGSGQPGGAGGLLIGNGGAGGSGAPGQAGGAGGAAGLIGNGGVGGAGGAGEVGGAGGRGGWWVGNGGAGGVGGVGAQGGVGGAAGLIGNGGVGGAGGTGAGGGVGGAGGWLWGDGGAGGGGGAGGLGQAGGTGGGGGAGGLMGGFGGAGGAGGEGGAGAAGQAGGDGGAGGAGGLTRALFGWAGGDGGAGGQGGAGAIGEAGLGGGSGGAGSTGGHGGVGGAGGAATGWLGMGGLFSAGGAGGGGGAGGAGGGGGAGGSGIGLGMAGGAGGEGAAGGAGGSGGAGGSAGLLGLSGVNGSGGIGGGGGAGGTGGHGDTGALSGGAGGQGGAGGAAGVAGTGGRAGANGVGGLGGHGGHGGQGGAGQAGLTDPNTPTAGDTGGTGGAGGQGGAGGAGIGGVGGGAGGTGGTGGTGGIGGSGGTNTGDSGGTGAAGGQGGTGGAAGAAGQGTDGATNGANGTGGHGGTGGTGGAGGFGAVGASTPTPTAGGQGGHGGAGGAGGTGGAGIGGVGGGAGGAGGVGGAGGVGGYGGDNTGTAGGAGAAGGVGGTGGTAGAGGVGTDGATNGTHGTGGVGGQGGIGGNGATGTIGTSSSTPTAGGQGGHGGAGGQGGTGGAGIDGIGGGAGGAGGIGGTGGTGGTGGTNNATSGGGDGAAGGQGGTGGTAGAGGVGTDGATNGTHGTGGAGGQGGNGGTGATGTTGTSSSTPTAGGTGGHGGNGGQGGNGGAGIDGIGGGAGGAGGTGGTGGQGGVGGTNTNTSGGTGAAGGQGGTGGTAGAGGAGTDGATNGTHGTGGIGGRGGTGGNGGAGMDGSNDPLAPVAGAQGGQGGTGGQGGNGGAGIDGIGGGAGGAGGTGGTGGTGGTGGSNTGANGGTGAAGGQGGTGGTAGAAGLGTDGATNGTHGTGGQGGTGGNGGHGATGTTGTDGTPTAPPTPGGTGGHGGTGGTGGNGGAGINGIGGGAGGQGGNGGNGGTGGTGGTAANGGDGANGGQGGTGGTAGAGGAGTDGATNGTHGTGGVGGQGGTGGHGATGTTGTDGTPTAPPTPGGTGGHGGGGGQGGNGGAGINGIGGGAGGQGGTGGTGGDGGTGGTGTSANNGANGGDGANGGQGGQGGTAGTPGSGTDGGANGTNGTGGQGGNGGTGGTGGQGGTGTGTGNTGGTGGRGGQGGAGGAGGAGSALLVGGGAGGNGGTGGDGGTGGTGSLVTGAGGAGGMGGAGGTAGTGTDGGANGTGGDGGTGGSGGTGGTGGIGSNDPNSPQTGSQGGQGGAGGAGGTGGSGFGGIGGGNGGSGGTGGQGGQGGFGGDNTGTTGGNGADGGQGGAGGAAGVAGTGTDGGTSGANGTGGEGGQGGTGGSGGTGTTGSDGVTPTTGGQGGQGGAGGAGGAGGAGIGGIGGGAGGTGGTGGSGGTGGTGGTNNGISGGAGADGGQGGTGGTAGAGGAGTDGGVSGSNGTGGSGGTGGTGGTGGTGTTGTASHSSLPGGNGGIGGQGGAGGQGGNGGAGLDGIGGGQGGTGGTGGTGGTGGTGGANIGANAGNGGAGGQGGAGGTAGVSGTGTDGGANGSHGSGGSGGSGGAGGQGGRGLDGSTFVTPAPGTQGGQGGAGGQGGSGGAGFGGVGGGAGGQGGTGGQGGTGGNGTTGADGDGTAGGQGGTGGAAGTGGTGTDGGANGGNGSGGVGGIGGIGGTGGTGAAGSAGNNPTPGGSGGAGGTGGTGGLGGSGIGGVGGGAGGTGGTGGTGGTGGLGGTGVSNDGAAGGEGGVGGQGGDGGSGTDGGAGGTGGQGGSAGGGGAGGNGNGANHTGGSGGKGGTGGTGGTGGTGTGGGVGGQGGAGGTGGTGGTGSLGNPGQSGTPGDVGDPGGAPIGNDGGTGGPGGNGGDGGTGGP
>LR130759.1|VDM91057.1|5307825_5307939_-|hypothetical-protein
MRSAKGKTNIAEFFQTNAAVFLTRYARWPSAELIKCY
>LR130759.1|VDM91056.1|5305602_5307075_+|PE-family-protein
MWPRRRRPLWWWPPVPISAAIAALLSAHGQAYQALSAQAAAFHAQFIEALRAGADAYAAAEAANVEQVLLGVINGPTEALLGRPLIGDGVNGADGTGQAGGAGGILVGNGGNGGSGGVGQDGGAGGAAGLFGHGGSGGAGGDNGAGNAGAGGAGGAGGLVWGNGGAGGVGGNAAFPGPGSGGNGGAGGSAGLIGNGGTGANGGFSSGSFGAQSGAGGAGGDGGWLYGNGGNGGNDRSGSALGGDGGDAYLFGDGGNGGGGGVGGVAGRAGLLIGDGGNGGSSQPGANGGLLWGNGGDGGGSLSSFRTPGVGGNAGLFGNGGAGGDGLPQAGADGGAGGLIFGNGGAGGNGGSSADGGAGGTAGLLGSGGAGGTGGNASPIAVAGNGGAGGNGGALFGNGGAGGAGGAGLVTNPNGGTGGDGGMGGLIGNGGRGGNAGISTGLGSGIGGNGGNARLIGNGGDGGSGTGGGPGGVGGTGGQLLGAKGTNGAP
>LR130759.1|VDM91055.1|5304775_5305603_+|hypothetical-protein
MECISVAETGRYRLAMTQAPMHVSQKPFTRRLAPAAMGGIRASEPVQYQSSRIVLHKARFTLDRAHGMCSPVPPLSWRRRCGVWPEWNRLSARRIRPRRVGGGNTEAGRNRNGANGGTGGTGWLGWGGIAGSHLRAKAAAALGALADMAVPQATAAPSAVAGAQGFPPLPVARNTRHQANKSILVNSQTVSCILTLLFTQYRLRLLRDSAKLIELLVRMCYIPLWFGSWPLGTTWVGPVAVEVGGDSDVVCDCRAAGGGVCGHRFGWYRLVDQCG
>LR130759.1|VDM91054.1|5304648_5304774_+|hypothetical-protein
MSLAESLGKRKRYCATKGKRVIDNQLVIYYFPEASHQTAGT
>LR130759.1|VDM91053.1|5302861_5304544_-|PE-family-protein
MSFVIAAPQVVVSAATDLAGIGSSISAANVAAASSTTVVVAAGADEVSAAIAALLSAHGQAYQALSAQAAAFHAQFIEALRAGADAYAAAEAANVEQVLLGVINGPTEALLGRPLIGDGVNGADGTGQAGGAGGILVGNGGNGGSGGVGQDGGAGGAAGLFGHGGSGGAGGDNGAGNAGAGGAGGAGGLVWGNGGAGGVGGNAAFPGPGSGGNGGAGGSAGLIGNGGTGANGGFSSGSFGAQSGAGGAGGDGGWLYGNGGNGGNDRSGSALGGDGGDAYLFGDGGNGGGGGVGGVAGRAGLLIGDGGNGGSSQPGANGGLLWGNGGDGGGSLSSFRTPGVGGNAGLFGNGGAGGDGLPQAGADGGAGGLIFGNGGAGGAARGLSDGDGFAGGNGGNAGLWGIGGTGGSGGFGASGGAGGVGGTGGRGGMLFGAGGTGGTGGIGYEAAGFGVGTGAAGGNGGDAGLFGTGGAGGTGGTGVFGGSGGTGGTGGAGGLVFGDGGRGGDAGTSSGSGSGTGGNGGSAEWIGNGGNGGNGTGGGPGGSGGPGGKLAGKNGTDGTP
>LR130759.1|VDM91052.1|5300765_5302199_-|Putrescine-oxidase
MVDRRFEVLRDGLIPRPGRHRSVVVVGAGISGVVCARLLHDAGYEVQVLEARDRAGGRLWAVDGVGGQYYELGGMRFSESNQLAMEVFRQAGVTVSPFPLQHKSFFFGGRHFHPDGFLPSSAGFDIPPEDDRPLTELLDRVMAPVNAIYERQDNDEEEAFFECLDRFDRYSIQTWLTERGLSPGAVNCLSLVNNIEGRLNFSFSEWAEYVRVDAFGPNLLYVEEGTTELMRRLVEPIAHLVRFGVQATRIEQSLSTATVHWRAGGREGSIRADEVILAVPPIVLRHIPIEGMSTAKDAALRRTYCGRAAKVFLRFNRRWWDDIVGDKGGLAVTDLPVRNVLFTVAGQGDDPSRGAIIGSYTWESDSMVFANLPVEERIERVLSDVELMYPEAVGSFEGGVAHDWGSDRWAGGVGGLFRPTEMSGDHYRDLIEPLGRVWFAGETYDRRSRRWVEGALKSAVKNCMALHDNARDNLPLD
>LR130759.1|VDM91051.1|5300252_5300591_-|Sensor-protein-FixL
MEIYADDKGSILAVTEPELLGYTSEELIGKKVEIIVPYKYREAHRRGLKRWSESGEAKVMGTWLLIEARHRDGDLVRMELVLTQRMDNTGRRVVTANIKPVSDDDMFRLAPI
>LR130759.1|VDM91061.1|5335370_5336429_+|dihydrodipicolinate-reductase
MPNNYRVVQWTTGNVGKSSLQAIAAHPALQLVGCYAWSPQKVGRDAGDLCGIAPLGVTASNDTDALLALKPDCVVYNPMWIDVDELVRILSAGVNVVTTAAFITGHNLGPGRDRILDACHQGGSTIFGSGVSPGFAELLAIVSTMVCNRVDKVTVNEAADTTFYDSPATERPVGFGQPIDHPELQAMTAVGTAIFGEAVRLIADALGLELDDVHCEAEYAQTTAELNLGSWSIPAGCVAGVAASWQGVLGHRTLVELNVRWRKGQTLEPDWRIDQDGWVIKVDGRPTVTTTVSFLPPPYFEAETIADFMMLGHIMTAMPTINSIPAVVAAQPGIVTYNDLPLTVPRGVVPRR
>LR130759.1|VDM91062.1|5336425_5336950_-|hypothetical-protein
MPQSKLANPIFNVIAPRVAGLAFSGGFGAMYFPGVKSLVQGDTSFQDGEVPGANGVVTGRGLAKMYAALANDGHLGYHESPVPGLLNGFGHVGLGGTLGWADPETASSFGYVHNRLLTPLLFDMGSFAGLVRPLRNAIRAARRHGFFEVPEFGANYPKPARQQVVSEHAAVGDG
>LR130759.1|VDM91063.1|5337257_5337431_+|CsbD-like-protein
MSAEDKVKNKIEDLGGRAKEAIGHATGDKNTKDEGRLDQAKASLKDAGEKVKDALRK
>LR130759.1|VDM91064.1|5337471_5338146_+|Cutinase
MAVSAVVAMLVSVSAMLGMPAPPAAAEPCPDVEVLFARGTGEPPGVGGIGGSFVEALRSQIGSRSLAVYPINYPASTDFSNPDFPQTVIAGIRDASSHIEATAANCPNTKEVLGGYSQGAAVAGYVTSAAVPPGVPAAAVPEPMPPEIASHVAAVTLFGTPSDDFLNQYGAPPIVIGPLYQPKTIELCADGDGICGAGNNPAAHAAYVVNGMTSQGADFAASHL
>LR130759.1|VDM91065.1|5338202_5339180_+|UDP-N-acetylglucosamine-4,6-dehydratase-(inverting)
MRVLVTGGTGFVGGWTARAIADEGHSVRFLVRNPAKLDTSVAELGVDVSDFVVGDIKDRDSVREALTGCDAVVHSAALVATDPRQTPRMQSTNMEGARNVLGQAVQLGLDPIVHVSSFTALFHPDLERLTADLPVVGGTDGYGTSKAQVEIYARGLQDAGAPVNITYPGMVLGPPVGNQFGEAGEGVKAALQIHTIPGRRAAWLVIDVRDVAAVHAALLEPGMGPRRYMVGGHRIPVAELAKMLEQVANTPMLTFPVPDTVLRVAGSLLDLAGPYLPFENPFTAAGMQYYTQMPESDDSPSEKELGIIYRDPRVTLSDTVAALRR
>LR130759.1|VDM91066.1|5339196_5339343_-|hypothetical-protein
MDRVTSAIVATLALLGIGIVTNELLRLRRWLKNSPAEGDDAEPPDEPT
>LR130759.1|VDM91067.1|5339371_5339755_-|PPOX-class-probable-F420-dependent-enzyme,-family
MAANFRDVIKSKYLLLTTFTKDGRPKPTAIWGVPDGDRLLVITDDGSWKVKRIRNTPRVTLAKSGALGKPKGEPVEAVARVLPKSETKRVYNAVLKRYWYHAWWFYPHSLVRGGIDKVHIGLEVKSA
>LR130759.1|VDM91068.1|5339895_5341050_+|L-idonate-5-dehydrogenase
MRAVTCTNAKLEVVDQPTPTPAKGQLLVEVLRCGICGSDLHARKHCDELADVMAESGYDAFMRSGQQVVFGHEFCGEVVDHGPRTRKTPRPGTPVVALPLLRRGDEVHGIGLSTLAPGAYAEQLLVEQALAFPVPNGLAPEIAALTEPMAVGWHAVRRGEVGKGDVAIVIGCGPIGLAVICMLKTHGVRMVIASDFSAGRRALATACGADVVVDPTRDSPYEHGKGHVHSIIDAFDLALGTVEKLHRLRLPWWHVWRAAEAVGAAAPKHPIIFECVGVPGVIDTIMASAPLFSRVVVVGVCMGADHIRPAMAINKEIDLRFVLGYTPIEFRDTLHMLADGKINATPLITGRVGLPGVEAAFEALGDPEAHAKILIDPKSEVKAP
>LR130759.1|VDM91069.1|5341036_5341309_-|putative-transmembrane-sensor-domain-protein
MAMFGAPTDLADHAIRAWLAALAIQDETRRLAGEIEHRDGVALQLRVGRNSGQVVAGEIGSAALGYTAIGEQGGMAQRMESAAGYPAMGP
>LR130759.1|VDM91070.1|5341373_5341784_-|hypothetical-protein
MALTVPPTTQRDLEGWADYTAPIVLTPAAAADVSPGCGDPALAVIGFYAALMRNDDVTGYLLTPDDNVMVRKLETLRSWTFRRLEVRSVRLRGSRKATIRIAVEIDVDGKRDDGTDEIKLQRDGDDGPWRIERPPT

Crispr_ID: LR130759_17

• CRISPR_ID: LR130759_17
• CRISPR_location: 5328844-5329529
• CRISPR_type: Orphan
• Repeat_type: NA
• Spacer_info: 14 spacers

Consensus repeat of LR130759_17

Consensus_repeat	Method
CGGNNNNGGCGGNACCGGCGNNACCGGCGGNA	CRT
GGCNNNGNCGGCNCCGNCGGCACCGGCGGCA	CRT

spacers of LR130759_17

>17.1|5328876|31|LR130759|CRT
CCAACGGTTCCGGGGGTAGCGGCGGAGTCGG
>17.2|5328939|19|LR130759|CRT
CCGGCGAAGACAGCGCCAC
>17.3|5328990|31|LR130759|CRT
CCGGCGGCCAAGCAGGCGCCGGCGGAGCAGG
>17.4|5329053|22|LR130759|CRT
GCACGGGCGCCGTCGGCGATGC
>17.5|5329107|37|LR130759|CRT
AGGGAGGCCAGGGCGGTCAGGGCGCGGCCGGAGCCGA
>17.6|5328972|41|LR130759|CRT
CCGGCGGCACCGGCGGCACCGGCGGCCAAGCAGGCGCCGGC
>17.7|5329044|23|LR130759|CRT
CCGGCGGCAGCACGGGCGCCGTC
>17.8|5329098|29|LR130759|CRT
CCGGCGGTCAGGGAGGCCAGGGCGGTCAG
>17.9|5329158|41|LR130759|CRT
CCGGCGAAATCGGGTTCACCGGCGGCCAAGGCGGCCAGGGC
>17.10|5329230|32|LR130759|CRT
CCAACGGCTCCGGCGGCGCGGGCGGGACCGGC
>17.11|5329293|20|LR130759|CRT
CCGGCGAAGACAGCGCCACT
>17.12|5329344|32|LR130759|CRT
CCGGCGGCCAAGCAGGCGCCGGCGGAGCAGGC
>17.13|5329407|23|LR130759|CRT
GCACGGGCGCCGTCGGCGATGCG
>17.14|5329461|38|LR130759|CRT
AGGGAGGCCAGGGCGGTCAGGGCGCGGCCGGAGCCGAC

CRISPR arrays and Neighbor proteins around LR130759_17

CRISPR arrays

The CRISPR arrays of LR130759_17

>merge|LR130759|17|5328844-5329529|CRT,CRT
CGGGCAGGGCGGTAACGCCGCGGCCGGCGGCACCAACGGTTCCGGGGGTAGCGGCGGAGTCGGCGGTCGGGGCGGTACCGGCGGCACCGGCGGGACCGGCGAAGACAGCGCCACCGGCATCGGCGGCACCGGCGGCACCGGCGGCACCGGCGGCCAAGCAGGCGCCGGCGGAGCAGGCGGCGCCGCCGGCACCGGCGGCACCGGCGGCAGCACGGGCGCCGTCGGCGATGCGGGTACCGGCGGCACCGGCGGCACCGGCGGTCAGGGAGGCCAGGGCGGTCAGGGCGCGGCCGGAGCCGACGGCACGGGCGGCACCGGCGAAATCGGGTTCACCGGCGGCCAAGGCGGCCAGGGCGGCCAAGGCGGAGACACCGGCGCCGGCGGCACCAACGGCTCCGGCGGCGCGGGCGGGACCGGCGGCACCGGCGGCACCGGCGGCACCGGCGGCACCGGCGAAGACAGCGCCACTGGCATCGGCGGCACCGGCGGCACCGGCGGCACCGGCGGCCAAGCAGGCGCCGGCGGAGCAGGCGGCGCCGCCGGCACCGGCGGCACCGGCGGCAGCACGGGCGCCGTCGGCGATGCGGGTACCGGCGGCACCGGCGGCACCGGCGGTCAGGGAGGCCAGGGCGGTCAGGGCGCGGCCGGAGCCGACGGCACGGGCGGCACCGGCGAAATCGGGTTCA

>LR130759|17|6|5328844-5329175|CRT
CGGGCAGGGCGGTAACGCCGCGGCCGGCGGCA	CCAACGGTTCCGGGGGTAGCGGCGGAGTCGG
CGGTCGGGGCGGTACCGGCGGCACCGGCGGGA	CCGGCGAAGACAGCGCCAC
CGGCATCGGCGGCA	CCGGCGGCACCGGCGGCACCGGCGGCCAAGCAGGCGCCGGC
	CCGGCGGCCAAGCAGGCGCCGGCGGAGCAGG
CGGCGCCGCCGGCACCGGCGGCA	CCGGCGGCAGCACGGGCGCCGTC
	GCACGGGCGCCGTCGGCGATGC
GGGTACCGGCGGCACCGGCGGCA	CCGGCGGTCAGGGAGGCCAGGGCGGTCAG
	AGGGAGGCCAGGGCGGTCAGGGCGCGGCCGGAGCCGA
CGGCACGGGCGGCA	CCGGCGAAATCGGGTTCACCGGCGGCCAAGGCGGCCAGGGC
GGCCAAGGCGGAGACACCGGCGCCGGCGGCA	CCAACGGCTCCGGCGGCGCGGGCGGGACCGGC
GGCACCGGCGGCACCGGCGGCACCGGCGGCA	CCGGCGAAGACAGCGCCACT
GGCATCGGCGGCACCGGCGGCACCGGCGGCA	CCGGCGGCCAAGCAGGCGCCGGCGGAGCAGGC
GGCGCCGCCGGCACCGGCGGCACCGGCGGCA	GCACGGGCGCCGTCGGCGATGCG
GGTACCGGCGGCACCGGCGGCACCGGCGGTC	AGGGAGGCCAGGGCGGTCAGGGCGCGGCCGGAGCCGAC


>LR130759|17|7|5328941-5329529|CRT
	CCAACGGTTCCGGGGGTAGCGGCGGAGTCGG
CGGTCGGGGCGGTACCGGCGGCACCGGCGGGA	CCGGCGAAGACAGCGCCAC
CGGCATCGGCGGCA	CCGGCGGCACCGGCGGCACCGGCGGCCAAGCAGGCGCCGGC
	CCGGCGGCCAAGCAGGCGCCGGCGGAGCAGG
CGGCGCCGCCGGCACCGGCGGCA	CCGGCGGCAGCACGGGCGCCGTC
	GCACGGGCGCCGTCGGCGATGC
GGGTACCGGCGGCACCGGCGGCA	CCGGCGGTCAGGGAGGCCAGGGCGGTCAG
	AGGGAGGCCAGGGCGGTCAGGGCGCGGCCGGAGCCGA
CGGCACGGGCGGCA	CCGGCGAAATCGGGTTCACCGGCGGCCAAGGCGGCCAGGGC
GGCCAAGGCGGAGACACCGGCGCCGGCGGCA	CCAACGGCTCCGGCGGCGCGGGCGGGACCGGC
GGCACCGGCGGCACCGGCGGCACCGGCGGCA	CCGGCGAAGACAGCGCCACT
GGCATCGGCGGCACCGGCGGCACCGGCGGCA	CCGGCGGCCAAGCAGGCGCCGGCGGAGCAGGC
GGCGCCGCCGGCACCGGCGGCACCGGCGGCA	GCACGGGCGCCGTCGGCGATGCG
GGTACCGGCGGCACCGGCGGCACCGGCGGTC	AGGGAGGCCAGGGCGGTCAGGGCGCGGCCGGAGCCGAC
GGCACGGGCGGCACCGGCGAAATCGGGTTCA

Neighbor Proteins Overview

Protein	Signature genes	Signature genes Name	Protein_function
LR130759.1|VDM91064.1|5337471_5338146_+|Cutinase	unknown	unknown	gnl|CDD|366455
LR130759.1|VDM91060.1|5323019_5326955_+|PE-family-protein	unknown	unknown	gnl|CDD|376422
LR130759.1|VDM91066.1|5339196_5339343_-|hypothetical-protein	unknown	unknown	unknown
LR130759.1|VDM91057.1|5307825_5307939_-|hypothetical-protein	unknown	unknown	unknown
LR130759.1|VDM91056.1|5305602_5307075_+|PE-family-protein	unknown	unknown	gnl|CDD|376422
LR130759.1|VDM91052.1|5300765_5302199_-|Putrescine-oxidase	unknown	unknown	gnl|CDD|366721
LR130759.1|VDM91055.1|5304775_5305603_+|hypothetical-protein	unknown	unknown	unknown
LR130759.1|VDM91054.1|5304648_5304774_+|hypothetical-protein	unknown	unknown	unknown
LR130759.1|VDM91063.1|5337257_5337431_+|CsbD-like-protein	unknown	unknown	gnl|CDD|283241
LR130759.1|VDM91053.1|5302861_5304544_-|PE-family-protein	unknown	unknown	gnl|CDD|376422
LR130759.1|VDM91069.1|5341036_5341309_-|putative-transmembrane-sensor-domain-protein	unknown	unknown	gnl|CDD|143636
LR130759.1|VDM91051.1|5300252_5300591_-|Sensor-protein-FixL	unknown	unknown	gnl|CDD|272971
LR130759.1|VDM91070.1|5341373_5341784_-|hypothetical-protein	unknown	unknown	unknown
LR130759.1|VDM91067.1|5339371_5339755_-|PPOX-class-probable-F420-dependent-enzyme,-family	unknown	unknown	gnl|CDD|274712
LR130759.1|VDM91062.1|5336425_5336950_-|hypothetical-protein	unknown	unknown	unknown
LR130759.1|VDM91058.1|5307942_5314032_+|PE-family-protein	unknown	unknown	gnl|CDD|376422
LR130759.1|VDM91068.1|5339895_5341050_+|L-idonate-5-dehydrogenase	unknown	unknown	gnl|CDD|176223
LR130759.1|VDM91059.1|5314200_5321979_+|PE-family-protein	unknown	unknown	gnl|CDD|376422
LR130759.1|VDM91061.1|5335370_5336429_+|dihydrodipicolinate-reductase	unknown	unknown	gnl|CDD|226326
LR130759.1|VDM91065.1|5338202_5339180_+|UDP-N-acetylglucosamine-4,6-dehydratase-(inverting)	unknown	unknown	gnl|CDD|187539

rpsblast for functional proteins

Protein	Function_ID	Function_description	E-value
LR130759.1|VDM91064.1|5337471_5338146_+|Cutinase	gnl|CDD|366455	pfam01083, Cutinase, Cutinase.	4.82419e-47
LR130759.1|VDM91060.1|5323019_5326955_+|PE-family-protein	gnl|CDD|376422	pfam00934, PE, PE family. This family named after a PE motif near to the amino terminus of the domain. The PE family of proteins all contain an amino-terminal region of about 110 amino acids. The carboxyl terminus of this family are variable and fall into several classes. The largest class of PE proteins is the highly repetitive PGRS class which have a high glycine content. The function of these proteins is uncertain but it has been suggested that they may be related to antigenic variation of Mycobacterium tuberculosis.	1.60272e-26
LR130759.1|VDM91068.1|5339895_5341050_+|L-idonate-5-dehydrogenase	gnl|CDD|176223	cd08262, Zn_ADH8, Alcohol dehydrogenases of the MDR family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines.	9.63219e-157
LR130759.1|VDM91065.1|5338202_5339180_+|UDP-N-acetylglucosamine-4,6-dehydratase-(inverting)	gnl|CDD|187539	cd05228, AR_FR_like_1_SDR_e, uncharacterized subgroup of aldehyde reductase and flavonoid reductase related proteins, extended (e) SDRs. This subgroup contains proteins of unknown function related to aldehyde reductase and flavonoid reductase of the extended SDR-type. Aldehyde reductase I (aka carbonyl reductase) is an NADP-binding SDR; it has an NADP-binding motif consensus that is slightly different from the canonical SDR form and lacks the Asn of the extended SDR active site tetrad. Aldehyde reductase I catalyzes the NADP-dependent reduction of ethyl 4-chloro-3-oxobutanoate to ethyl (R)-4-chloro-3-hydroxybutanoate. The related flavonoid reductases act in the NADP-dependent reduction of flavonoids, ketone-containing plant secondary metabolites. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	3.69419e-46
LR130759.1|VDM91056.1|5305602_5307075_+|PE-family-protein	gnl|CDD|376422	pfam00934, PE, PE family. This family named after a PE motif near to the amino terminus of the domain. The PE family of proteins all contain an amino-terminal region of about 110 amino acids. The carboxyl terminus of this family are variable and fall into several classes. The largest class of PE proteins is the highly repetitive PGRS class which have a high glycine content. The function of these proteins is uncertain but it has been suggested that they may be related to antigenic variation of Mycobacterium tuberculosis.	2.55512e-14
LR130759.1|VDM91052.1|5300765_5302199_-|Putrescine-oxidase	gnl|CDD|366721	pfam01593, Amino_oxidase, Flavin containing amine oxidoreductase. This family consists of various amine oxidases, including maze polyamine oxidase (PAO) and various flavin containing monoamine oxidases (MAO). The aligned region includes the flavin binding site of these enzymes. The family also contains phytoene dehydrogenases and related enzymes. In vertebrates MAO plays an important role regulating the intracellular levels of amines via there oxidation; these include various neurotransmitters, neurotoxins and trace amines. In lower eukaryotes such as aspergillus and in bacteria the main role of amine oxidases is to provide a source of ammonium. PAOs in plants, bacteria and protozoa oxidase spermidine and spermine to an aminobutyral, diaminopropane and hydrogen peroxide and are involved in the catabolism of polyamines. Other members of this family include tryptophan 2-monooxygenase, putrescine oxidase, corticosteroid binding proteins and antibacterial glycoproteins.	5.58701e-50
LR130759.1|VDM91053.1|5302861_5304544_-|PE-family-protein	gnl|CDD|376422	pfam00934, PE, PE family. This family named after a PE motif near to the amino terminus of the domain. The PE family of proteins all contain an amino-terminal region of about 110 amino acids. The carboxyl terminus of this family are variable and fall into several classes. The largest class of PE proteins is the highly repetitive PGRS class which have a high glycine content. The function of these proteins is uncertain but it has been suggested that they may be related to antigenic variation of Mycobacterium tuberculosis.	8.96053e-35
LR130759.1|VDM91069.1|5341036_5341309_-|putative-transmembrane-sensor-domain-protein	gnl|CDD|143636	cd07302, CHD, cyclase homology domain. Catalytic domains of the mononucleotidyl cyclases (MNC's), also called cyclase homology domains (CHDs), are part of the class III nucleotidyl cyclases. This class includes eukaryotic and prokaryotic adenylate cyclases (AC's) and guanylate cyclases (GC's). They seem to share a common catalytic mechanism in their requirement for two magnesium ions to bind the polyphosphate moiety of the nucleotide.	2.11058e-18
LR130759.1|VDM91051.1|5300252_5300591_-|Sensor-protein-FixL	gnl|CDD|272971	TIGR00229, Sensor_protein_FixL, PAS domain S-box. The PAS domain was previously described. This sensory box, or S-box domain occupies the central portion of the PAS domain but is more widely distributed. It is often tandemly repeated. Known prosthetic groups bound in the S-box domain include heme in the oxygen sensor FixL, FAD in the redox potential sensor NifL, and a 4-hydroxycinnamyl chromophore in photoactive yellow protein. Proteins containing the domain often contain other regulatory domains such as response regulator or sensor histidine kinase domains. Other S-box proteins include phytochromes and the aryl hydrocarbon receptor nuclear translocator. [Regulatory functions, Small molecule interactions].	4.30792e-10
LR130759.1|VDM91063.1|5337257_5337431_+|CsbD-like-protein	gnl|CDD|283241	pfam05532, CsbD, CsbD-like. CsbD is a bacterial general stress response protein. It's expression is mediated by sigma-B, an alternative sigma factor. The role of CsbD in stress response is unclear.	1.26425e-05
LR130759.1|VDM91058.1|5307942_5314032_+|PE-family-protein	gnl|CDD|376422	pfam00934, PE, PE family. This family named after a PE motif near to the amino terminus of the domain. The PE family of proteins all contain an amino-terminal region of about 110 amino acids. The carboxyl terminus of this family are variable and fall into several classes. The largest class of PE proteins is the highly repetitive PGRS class which have a high glycine content. The function of these proteins is uncertain but it has been suggested that they may be related to antigenic variation of Mycobacterium tuberculosis.	7.2357e-27
LR130759.1|VDM91059.1|5314200_5321979_+|PE-family-protein	gnl|CDD|376422	pfam00934, PE, PE family. This family named after a PE motif near to the amino terminus of the domain. The PE family of proteins all contain an amino-terminal region of about 110 amino acids. The carboxyl terminus of this family are variable and fall into several classes. The largest class of PE proteins is the highly repetitive PGRS class which have a high glycine content. The function of these proteins is uncertain but it has been suggested that they may be related to antigenic variation of Mycobacterium tuberculosis.	4.13656e-28
LR130759.1|VDM91061.1|5335370_5336429_+|dihydrodipicolinate-reductase	gnl|CDD|226326	COG3804, COG3804, Uncharacterized conserved protein related to dihydrodipicolinate reductase [Function unknown].	5.13709e-54
LR130759.1|VDM91067.1|5339371_5339755_-|PPOX-class-probable-F420-dependent-enzyme,-family	gnl|CDD|274712	TIGR03666, Rv2061_F420, PPOX class probable F420-dependent enzyme, Rv2061 family. A Genome Properties metabolic reconstruction for F420 biosynthesis shows that slightly over 10 percent of all prokaryotes with fully sequenced genomes, including about two thirds of the Actinomycetales, make F420. A variant of the Partial Phylogenetic Profiling algorithm, SIMBAL, shows that this protein likely binds F420 in a cleft similar to that in which the homologous enzyme pyridoxamine phosphate oxidase (PPOX) binds FMN. [Unknown function, Enzymes of unknown specificity].	4.84452e-53

Protein sequences

>LR130759.1|VDM91060.1|5323019_5326955_+|PE-family-protein
MASFVVVMPEALLAASESLTGLGSTIEAANAAAAASTIQLVAAGQDEVSAAIARLFGSYAQEYQALSTQMGQFHAQFVQALAGSQNVYGAAEAANASPLQILERHLLAIINAPTNALLARPLIGNGANGVDGTGANGGAGGILYGNGGNGGSGAPGQAGGAGGAAGLIGNGGHGGAGGIGAPGQSGGNGGPGGAGGLLSGSGGAGGAGGAGGAGAVGQVGGSGGTGGAGGPGLIGGAGGAGGAGGAGGAGAPGAPAGGAGATGMAGGNGGAGGSGGAASGLPGLFSVGGAGGDGGAGGLGGDGGAGGSGVGYQTTGGTGGAGGTGGNAGAGGAGGAGSPFGLSGVNGSGGTGGGGGTGGDGGIGDTGAFMGGSGGQGGTGGAAGAAGSGGRGGSIGAGGIGGGGGAGGTGGTGTTGGSSQSPTIGGQGGQGGSGGQGGTGGSGIGGVGGGTGGTGGVGGTGGDGGTGGTNTGTSGGAGADGGAGGTGGTAGAAGHGTDGGAIGLIGHGGNGGNGGNGGIGGTGTPGTDATTPSQGSQGGQGGGGGAGGAGGAGIDGLNGGNGGHGGTGGAGGTGGHGGANTGTGGGDGAAGGQGGTGGGAGAAGSGTDGGSNGQHGTGGTGGTGGDGGTGGDGAAGVDDPDSPTAGTQGGQGGAGGAGGTGGAGIGGFGGGTGGTGGTGGAGGTGGVGGTNTGTTGGAGANGGQGGTGGTAGAAGHGTDGGAIGLIGHGGHGGDGGSGGTGATGTEGTNSTSPTAGGTGGQGGTGGTGGDGGAGIDGLNGGNGGTGGTGGQGGTGGQGGTVLGGIGGGNGADGGQGGIGGTAGSAGSGTDGGANGANGTGGQGGTGGAGGAGQIGTQGVSDPTPTPGGTGGSGGAGGAGGSGGAGINGQGGGAGGAGGNGGTGGVGGTGGTNTGSSGDGAAGGQGGAGGAAGAAGSGTDGGAVGNIGTGGTGGAGGTGGTGSTGAIGTSSDTPTPGSQGGQGGAGGTGGAGGIGIGGVGGGQGGNGGNGGTGGTGGTGGTNTDTTGGAGASGGQGGAGGAAGAAGSGTDGAADGINGTGGTGGTGGRGGQGGTGSAGGLSAPGPGGMGGEGGAGGVGGAGIDGLGGGDGGTGGIGGTGGTGGASGTANDGVGGAGGEAGAGGTGGSGTDGGSGGAGGAGGAGGVGATGKDDDAAQGGAGGIGGQGGAGGTGGNAGGGNGTGGVGGQGGMGGQGGGGGAGKGLGGGDGGQGGMGGHGGTGGTGSGSGLGGFGGDGGDGGTGGHGGTGLHGPGQPGAAGQDGGPGGGPSGNDGGAGGGGSIGGGGGPGGPGNT
>LR130759.1|VDM91059.1|5314200_5321979_+|PE-family-protein
MSSFVVVSPEVLVSASGSLAGIGSAISEANAAAARATTQVLAAGGDEVSVAIAQLFGGYAQQYQLLSVRAGQFHARFVESLIGSGQGYGLAEAAGVGPLQAFEQQVLGVVNAPAYALWGRGLIGDGANGAPGSGQPGGAGGLLIGNGGAGGSGAPGQAGGAGGAAGLIGNGGVGGAGGAGEVGGAGGRGGWWVGNGGAGGVGGVGAQGGVGGAAGLIGNGGVGGAGGTGAGGGVGGAGGWLWGDGGAGGGGGAGGLGQAGGTGGGGGAGGLMGGFGGAGGAGGEGGAGAAGQAGGDGGAGGAGGLTRALFGWAGGDGGAGGQGGAGAIGEAGLGGGSGGAGSTGGHGGVGGAGGAATGWLGMGGLFSAGGAGGGGGAGGAGGGGGAGGSGIGLGMAGGAGGEGAAGGAGGSGGAGGSAGLLGLSGVNGSGGIGGGGGAGGTGGHGDTGALSGGAGGQGGAGGAAGVAGTGGRAGANGVGGLGGHGGHGGQGGAGQAGLTDPNTPTAGDTGGTGGAGGQGGAGGAGIGGVGGGAGGTGGTGGTGGIGGSGGTNTGDSGGTGAAGGQGGTGGAAGAAGQGTDGATNGANGTGGHGGTGGTGGAGGFGAVGASTPTPTAGGQGGHGGAGGAGGTGGAGIGGVGGGAGGAGGVGGAGGVGGYGGDNTGTAGGAGAAGGVGGTGGTAGAGGVGTDGATNGTHGTGGVGGQGGIGGNGATGTIGTSSSTPTAGGQGGHGGAGGQGGTGGAGIDGIGGGAGGAGGIGGTGGTGGTGGTNNATSGGGDGAAGGQGGTGGTAGAGGVGTDGATNGTHGTGGAGGQGGNGGTGATGTTGTSSSTPTAGGTGGHGGNGGAGGTGGAGIDGIGGGAGGQGGTGGTGGQGGVGGTNTNTSGGTGAAGGQGGTGGTAGAGGAGTDGATNGTHGTGGIGGRGGTGGNGGAGMDGSNDPLAPVAGAQGGQGGTGGQGGNGGAGIDGIGGGAGGAGGTGGTGGTGGTGGSNTGANGGTGAAGGQGGTGGTAGAAGLGTDGATNGTHGTGGQGGTGGNGGHGATGTTGTSGSTPTPGGTGGQGGTGGTGGNGGAGINGIGGGAGGAGGTGGTGGTGGTGGTAANGGDGANGGQGGTGGTAGAGGAGTDGATNGTHGTGGQGGTGGNGGHGATGTTGTSGSTPTPGGTGGHGGGGGQGGNGGAGINGIGGGAGGQGGNGGTGGTGGTGGTGTSANNGANGGDGANGGQGGTGGTAGAGGAGTDGATNGTHGTGGVGGQGGTGGHGATGTTGTDGTPTAPPTPGGTGGHGGGGGQGGNGGAGINGIGGGAGGQGGTGGTGGDGGTGGTGTSANNGANGGDGANGGQGGQGGTAGTPGSGTDGGANGTNGTGGQGGNGGTGGTGGQGGTGIDDPNSPTSGTQGGQGGTGGAGGAGGAGIGGVGGGAGGNGGTGGDGGTGGTGGTNTGTTGGAGADGGAGGTGGTAGAAGHGTDGGVIGLIGNGGTGGNGGQGGNGGVGTTGTDDPSVPAPAHLGGQGGNGGQGGTGGTGGAGIDGINGGQGGNGGQGGNGGQGGNGGTGGDGGHGSSGGTGAGGGQGGAGGTGGSAGHGTDGGAHGTGGGGGDGGTGGTGGTGGTGTSSSSPTAGGTGGTGGTGGAGGAGIAASGGGAGGQGGSGGTGGHGGTGGQGQFAADGAVGGAGGQGGAAGTGGTGTDGNHNGTNGTGGQGGTGGSGGDGGHGADGADDPNSPTSGTQGGQGGTGGAGGAGGTGIDATGGGDGGQGGTGGNGGDGGAGGSNTGTTGGKGADGGHGGTGGAAGAAGSGTDGGAGGANGAGGNGGNGGNGGNGGNGTPGDSGISPETGGQGGQGGIGGAGGAGGAGINGIGGGNGGQGGAGGNGGIAGPGGTNTGSTGGNGGDGGDGGAGGTGGTAGSGTDGGTHGNGGQGGNGGTGGTGGAGPAGADGLTPGVGGTGGNGGTGGQGGQGGTGINGIAGGAGGNGGTGGTAGNGGTGGNNTGSTGSTGANGGAGGTGGNGGTLGTGTDGGTNGTGGTGGTGGTGGHGGTGPLGANGLTPGNGGTGGNGGPGGQGGQGGTGINGIGGGNGGQGGNGGTGGTGGHGGNNTGGDGEDGATGGDGGTGGNAGLGGSGTDGGTNGNNGTGGTGGQGGTGGDGAFGESGSISQPAQSGGNGGNGGQGGAGGAGIAGNGGGTGGQGGAGGQGGQGGAAGDAPLGSGTGGVGGTGGAGGNGTDGGSGGDGGTGGAAGTGGIATDVSDGGNGGQGGEGGTGGQGSGIGIGGNGGQGGAGGSGSDAGTKVGYAGSGGNGGQGGSGGNSETGDAGNGGNGGQGGEGGTGGNRDENPTPGGPGGDGGNGGTGGTSGGNGTAGQGGQGGLGGNGGQGGLGVPGLTGGAGGSGGVGGNGGQGGASSGQGPAGDGGAGGQGGAGGIGGNGGSNLGNGNGGDGGQGGNGGDGGQGGAGKGAIGGGNGGLAGTGGAGGSGGNGVGSGTGGSGGSGGTGGIGGTGGNGPGGQGLPGAPGDGGSQGSPPSGQAGGAGAPGGQGGSGGNGGPGTASGSLFSPPPMLPVAATVPPSETDQFEGLATGAGGLGTLTSIFRRG
>LR130759.1|VDM91058.1|5307942_5314032_+|PE-family-protein
MSFTLPCFESTHTLLVIWSVEMSSFVVVSPEVLVSASGSLAGIGSAISEANAAAARATTQVLAAGGDEVSVAIAQLFGGYAQQYQLLSVRAGQFHARFVESLIGSGQGYGLAEAAGVGPLQAFEQQVLGVVNAPAYALWGRGLIGDGANGAPGSGQPGGAGGLLIGNGGAGGSGAPGQAGGAGGAAGLIGNGGVGGAGGAGEVGGAGGRGGWWVGNGGAGGVGGVGAQGGVGGAAGLIGNGGVGGAGGTGAGGGVGGAGGWLWGDGGAGGGGGAGGLGQAGGTGGGGGAGGLMGGFGGAGGAGGEGGAGAAGQAGGDGGAGGAGGLTRALFGWAGGDGGAGGQGGAGAIGEAGLGGGSGGAGSTGGHGGVGGAGGAATGWLGMGGLFSAGGAGGGGGAGGAGGGGGAGGSGIGLGMAGGAGGEGAAGGAGGSGGAGGSAGLLGLSGVNGSGGIGGGGGAGGTGGHGDTGALSGGAGGQGGAGGAAGVAGTGGRAGANGVGGLGGHGGHGGQGGAGQAGLTDPNTPTAGDTGGTGGAGGQGGAGGAGIGGVGGGAGGTGGTGGTGGIGGSGGTNTGDSGGTGAAGGQGGTGGAAGAAGQGTDGATNGANGTGGHGGTGGTGGAGGFGAVGASTPTPTAGGQGGHGGAGGAGGTGGAGIGGVGGGAGGAGGVGGAGGVGGYGGDNTGTAGGAGAAGGVGGTGGTAGAGGVGTDGATNGTHGTGGVGGQGGIGGNGATGTIGTSSSTPTAGGQGGHGGAGGQGGTGGAGIDGIGGGAGGAGGIGGTGGTGGTGGTNNATSGGGDGAAGGQGGTGGTAGAGGVGTDGATNGTHGTGGAGGQGGNGGTGATGTTGTSSSTPTAGGTGGHGGNGGQGGNGGAGIDGIGGGAGGAGGTGGTGGQGGVGGTNTNTSGGTGAAGGQGGTGGTAGAGGAGTDGATNGTHGTGGIGGRGGTGGNGGAGMDGSNDPLAPVAGAQGGQGGTGGQGGNGGAGIDGIGGGAGGAGGTGGTGGTGGTGGSNTGANGGTGAAGGQGGTGGTAGAAGLGTDGATNGTHGTGGQGGTGGNGGHGATGTTGTDGTPTAPPTPGGTGGHGGTGGTGGNGGAGINGIGGGAGGQGGNGGNGGTGGTGGTAANGGDGANGGQGGTGGTAGAGGAGTDGATNGTHGTGGVGGQGGTGGHGATGTTGTDGTPTAPPTPGGTGGHGGGGGQGGNGGAGINGIGGGAGGQGGTGGTGGDGGTGGTGTSANNGANGGDGANGGQGGQGGTAGTPGSGTDGGANGTNGTGGQGGNGGTGGTGGQGGTGTGTGNTGGTGGRGGQGGAGGAGGAGSALLVGGGAGGNGGTGGDGGTGGTGSLVTGAGGAGGMGGAGGTAGTGTDGGANGTGGDGGTGGSGGTGGTGGIGSNDPNSPQTGSQGGQGGAGGAGGTGGSGFGGIGGGNGGSGGTGGQGGQGGFGGDNTGTTGGNGADGGQGGAGGAAGVAGTGTDGGTSGANGTGGEGGQGGTGGSGGTGTTGSDGVTPTTGGQGGQGGAGGAGGAGGAGIGGIGGGAGGTGGTGGSGGTGGTGGTNNGISGGAGADGGQGGTGGTAGAGGAGTDGGVSGSNGTGGSGGTGGTGGTGGTGTTGTASHSSLPGGNGGIGGQGGAGGQGGNGGAGLDGIGGGQGGTGGTGGTGGTGGTGGANIGANAGNGGAGGQGGAGGTAGVSGTGTDGGANGSHGSGGSGGSGGAGGQGGRGLDGSTFVTPAPGTQGGQGGAGGQGGSGGAGFGGVGGGAGGQGGTGGQGGTGGNGTTGADGDGTAGGQGGTGGAAGTGGTGTDGGANGGNGSGGVGGIGGIGGTGGTGAAGSAGNNPTPGGSGGAGGTGGTGGLGGSGIGGVGGGAGGTGGTGGTGGTGGLGGTGVSNDGAAGGEGGVGGQGGDGGSGTDGGAGGTGGQGGSAGGGGAGGNGNGANHTGGSGGKGGTGGTGGTGGTGTGGGVGGQGGAGGTGGTGGTGSLGNPGQSGTPGDVGDPGGAPIGNDGGTGGPGGNGGDGGTGGP
>LR130759.1|VDM91057.1|5307825_5307939_-|hypothetical-protein
MRSAKGKTNIAEFFQTNAAVFLTRYARWPSAELIKCY
>LR130759.1|VDM91056.1|5305602_5307075_+|PE-family-protein
MWPRRRRPLWWWPPVPISAAIAALLSAHGQAYQALSAQAAAFHAQFIEALRAGADAYAAAEAANVEQVLLGVINGPTEALLGRPLIGDGVNGADGTGQAGGAGGILVGNGGNGGSGGVGQDGGAGGAAGLFGHGGSGGAGGDNGAGNAGAGGAGGAGGLVWGNGGAGGVGGNAAFPGPGSGGNGGAGGSAGLIGNGGTGANGGFSSGSFGAQSGAGGAGGDGGWLYGNGGNGGNDRSGSALGGDGGDAYLFGDGGNGGGGGVGGVAGRAGLLIGDGGNGGSSQPGANGGLLWGNGGDGGGSLSSFRTPGVGGNAGLFGNGGAGGDGLPQAGADGGAGGLIFGNGGAGGNGGSSADGGAGGTAGLLGSGGAGGTGGNASPIAVAGNGGAGGNGGALFGNGGAGGAGGAGLVTNPNGGTGGDGGMGGLIGNGGRGGNAGISTGLGSGIGGNGGNARLIGNGGDGGSGTGGGPGGVGGTGGQLLGAKGTNGAP
>LR130759.1|VDM91055.1|5304775_5305603_+|hypothetical-protein
MECISVAETGRYRLAMTQAPMHVSQKPFTRRLAPAAMGGIRASEPVQYQSSRIVLHKARFTLDRAHGMCSPVPPLSWRRRCGVWPEWNRLSARRIRPRRVGGGNTEAGRNRNGANGGTGGTGWLGWGGIAGSHLRAKAAAALGALADMAVPQATAAPSAVAGAQGFPPLPVARNTRHQANKSILVNSQTVSCILTLLFTQYRLRLLRDSAKLIELLVRMCYIPLWFGSWPLGTTWVGPVAVEVGGDSDVVCDCRAAGGGVCGHRFGWYRLVDQCG
>LR130759.1|VDM91054.1|5304648_5304774_+|hypothetical-protein
MSLAESLGKRKRYCATKGKRVIDNQLVIYYFPEASHQTAGT
>LR130759.1|VDM91053.1|5302861_5304544_-|PE-family-protein
MSFVIAAPQVVVSAATDLAGIGSSISAANVAAASSTTVVVAAGADEVSAAIAALLSAHGQAYQALSAQAAAFHAQFIEALRAGADAYAAAEAANVEQVLLGVINGPTEALLGRPLIGDGVNGADGTGQAGGAGGILVGNGGNGGSGGVGQDGGAGGAAGLFGHGGSGGAGGDNGAGNAGAGGAGGAGGLVWGNGGAGGVGGNAAFPGPGSGGNGGAGGSAGLIGNGGTGANGGFSSGSFGAQSGAGGAGGDGGWLYGNGGNGGNDRSGSALGGDGGDAYLFGDGGNGGGGGVGGVAGRAGLLIGDGGNGGSSQPGANGGLLWGNGGDGGGSLSSFRTPGVGGNAGLFGNGGAGGDGLPQAGADGGAGGLIFGNGGAGGAARGLSDGDGFAGGNGGNAGLWGIGGTGGSGGFGASGGAGGVGGTGGRGGMLFGAGGTGGTGGIGYEAAGFGVGTGAAGGNGGDAGLFGTGGAGGTGGTGVFGGSGGTGGTGGAGGLVFGDGGRGGDAGTSSGSGSGTGGNGGSAEWIGNGGNGGNGTGGGPGGSGGPGGKLAGKNGTDGTP
>LR130759.1|VDM91052.1|5300765_5302199_-|Putrescine-oxidase
MVDRRFEVLRDGLIPRPGRHRSVVVVGAGISGVVCARLLHDAGYEVQVLEARDRAGGRLWAVDGVGGQYYELGGMRFSESNQLAMEVFRQAGVTVSPFPLQHKSFFFGGRHFHPDGFLPSSAGFDIPPEDDRPLTELLDRVMAPVNAIYERQDNDEEEAFFECLDRFDRYSIQTWLTERGLSPGAVNCLSLVNNIEGRLNFSFSEWAEYVRVDAFGPNLLYVEEGTTELMRRLVEPIAHLVRFGVQATRIEQSLSTATVHWRAGGREGSIRADEVILAVPPIVLRHIPIEGMSTAKDAALRRTYCGRAAKVFLRFNRRWWDDIVGDKGGLAVTDLPVRNVLFTVAGQGDDPSRGAIIGSYTWESDSMVFANLPVEERIERVLSDVELMYPEAVGSFEGGVAHDWGSDRWAGGVGGLFRPTEMSGDHYRDLIEPLGRVWFAGETYDRRSRRWVEGALKSAVKNCMALHDNARDNLPLD
>LR130759.1|VDM91051.1|5300252_5300591_-|Sensor-protein-FixL
MEIYADDKGSILAVTEPELLGYTSEELIGKKVEIIVPYKYREAHRRGLKRWSESGEAKVMGTWLLIEARHRDGDLVRMELVLTQRMDNTGRRVVTANIKPVSDDDMFRLAPI
>LR130759.1|VDM91061.1|5335370_5336429_+|dihydrodipicolinate-reductase
MPNNYRVVQWTTGNVGKSSLQAIAAHPALQLVGCYAWSPQKVGRDAGDLCGIAPLGVTASNDTDALLALKPDCVVYNPMWIDVDELVRILSAGVNVVTTAAFITGHNLGPGRDRILDACHQGGSTIFGSGVSPGFAELLAIVSTMVCNRVDKVTVNEAADTTFYDSPATERPVGFGQPIDHPELQAMTAVGTAIFGEAVRLIADALGLELDDVHCEAEYAQTTAELNLGSWSIPAGCVAGVAASWQGVLGHRTLVELNVRWRKGQTLEPDWRIDQDGWVIKVDGRPTVTTTVSFLPPPYFEAETIADFMMLGHIMTAMPTINSIPAVVAAQPGIVTYNDLPLTVPRGVVPRR
>LR130759.1|VDM91062.1|5336425_5336950_-|hypothetical-protein
MPQSKLANPIFNVIAPRVAGLAFSGGFGAMYFPGVKSLVQGDTSFQDGEVPGANGVVTGRGLAKMYAALANDGHLGYHESPVPGLLNGFGHVGLGGTLGWADPETASSFGYVHNRLLTPLLFDMGSFAGLVRPLRNAIRAARRHGFFEVPEFGANYPKPARQQVVSEHAAVGDG
>LR130759.1|VDM91063.1|5337257_5337431_+|CsbD-like-protein
MSAEDKVKNKIEDLGGRAKEAIGHATGDKNTKDEGRLDQAKASLKDAGEKVKDALRK
>LR130759.1|VDM91064.1|5337471_5338146_+|Cutinase
MAVSAVVAMLVSVSAMLGMPAPPAAAEPCPDVEVLFARGTGEPPGVGGIGGSFVEALRSQIGSRSLAVYPINYPASTDFSNPDFPQTVIAGIRDASSHIEATAANCPNTKEVLGGYSQGAAVAGYVTSAAVPPGVPAAAVPEPMPPEIASHVAAVTLFGTPSDDFLNQYGAPPIVIGPLYQPKTIELCADGDGICGAGNNPAAHAAYVVNGMTSQGADFAASHL
>LR130759.1|VDM91065.1|5338202_5339180_+|UDP-N-acetylglucosamine-4,6-dehydratase-(inverting)
MRVLVTGGTGFVGGWTARAIADEGHSVRFLVRNPAKLDTSVAELGVDVSDFVVGDIKDRDSVREALTGCDAVVHSAALVATDPRQTPRMQSTNMEGARNVLGQAVQLGLDPIVHVSSFTALFHPDLERLTADLPVVGGTDGYGTSKAQVEIYARGLQDAGAPVNITYPGMVLGPPVGNQFGEAGEGVKAALQIHTIPGRRAAWLVIDVRDVAAVHAALLEPGMGPRRYMVGGHRIPVAELAKMLEQVANTPMLTFPVPDTVLRVAGSLLDLAGPYLPFENPFTAAGMQYYTQMPESDDSPSEKELGIIYRDPRVTLSDTVAALRR
>LR130759.1|VDM91066.1|5339196_5339343_-|hypothetical-protein
MDRVTSAIVATLALLGIGIVTNELLRLRRWLKNSPAEGDDAEPPDEPT
>LR130759.1|VDM91067.1|5339371_5339755_-|PPOX-class-probable-F420-dependent-enzyme,-family
MAANFRDVIKSKYLLLTTFTKDGRPKPTAIWGVPDGDRLLVITDDGSWKVKRIRNTPRVTLAKSGALGKPKGEPVEAVARVLPKSETKRVYNAVLKRYWYHAWWFYPHSLVRGGIDKVHIGLEVKSA
>LR130759.1|VDM91068.1|5339895_5341050_+|L-idonate-5-dehydrogenase
MRAVTCTNAKLEVVDQPTPTPAKGQLLVEVLRCGICGSDLHARKHCDELADVMAESGYDAFMRSGQQVVFGHEFCGEVVDHGPRTRKTPRPGTPVVALPLLRRGDEVHGIGLSTLAPGAYAEQLLVEQALAFPVPNGLAPEIAALTEPMAVGWHAVRRGEVGKGDVAIVIGCGPIGLAVICMLKTHGVRMVIASDFSAGRRALATACGADVVVDPTRDSPYEHGKGHVHSIIDAFDLALGTVEKLHRLRLPWWHVWRAAEAVGAAAPKHPIIFECVGVPGVIDTIMASAPLFSRVVVVGVCMGADHIRPAMAINKEIDLRFVLGYTPIEFRDTLHMLADGKINATPLITGRVGLPGVEAAFEALGDPEAHAKILIDPKSEVKAP
>LR130759.1|VDM91069.1|5341036_5341309_-|putative-transmembrane-sensor-domain-protein
MAMFGAPTDLADHAIRAWLAALAIQDETRRLAGEIEHRDGVALQLRVGRNSGQVVAGEIGSAALGYTAIGEQGGMAQRMESAAGYPAMGP
>LR130759.1|VDM91070.1|5341373_5341784_-|hypothetical-protein
MALTVPPTTQRDLEGWADYTAPIVLTPAAAADVSPGCGDPALAVIGFYAALMRNDDVTGYLLTPDDNVMVRKLETLRSWTFRRLEVRSVRLRGSRKATIRIAVEIDVDGKRDDGTDEIKLQRDGDDGPWRIERPPT

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
LR130759_1	1.7|586800|18|LR130759|CRISPRCasFinder	586800-586817	18	LR130759.1	589299-589316	0	1.0
LR130759_1	1.7|586800|18|LR130759|CRISPRCasFinder	586800-586817	18	LR130759.1	589329-589346	0	1.0
LR130759_1	1.7|586800|18|LR130759|CRISPRCasFinder	586800-586817	18	LR130759.1	590715-590732	0	1.0
LR130759_1	1.7|586800|18|LR130759|CRISPRCasFinder	586800-586817	18	LR130759.1	590745-590762	0	1.0
LR130759_1	1.7|586800|18|LR130759|CRISPRCasFinder	586800-586817	18	LR130759.1	594300-594317	0	1.0
LR130759_1	1.7|586800|18|LR130759|CRISPRCasFinder	586800-586817	18	LR130759.1	596073-596090	0	1.0
LR130759_1	1.7|586800|18|LR130759|CRISPRCasFinder	586800-586817	18	LR130759.1	600306-600323	0	1.0
LR130759_1	1.7|586800|18|LR130759|CRISPRCasFinder	586800-586817	18	LR130759.1	602862-602879	0	1.0
LR130759_1	1.8|586845|18|LR130759|CRISPRCasFinder	586845-586862	18	LR130759.1	590730-590747	0	1.0
LR130759_1	1.8|586845|18|LR130759|CRISPRCasFinder	586845-586862	18	LR130759.1	591963-591980	0	1.0
LR130759_1	1.9|586890|21|LR130759|CRISPRCasFinder	586890-586910	21	LR130759.1	589389-589409	0	1.0
LR130759_3	3.2|587907|18|LR130759|CRISPRCasFinder	587907-587924	18	LR130759.1	590730-590747	0	1.0
LR130759_3	3.2|587907|18|LR130759|CRISPRCasFinder	587907-587924	18	LR130759.1	591963-591980	0	1.0
LR130759_14	14.3|5303584|30|LR130759|CRISPRCasFinder	5303584-5303613	30	LR130759.1	5306444-5306473	0	1.0
LR130759_14	14.4|5303641|39|LR130759|CRISPRCasFinder	5303641-5303679	39	LR130759.1	5306378-5306416	0	1.0
LR130759_17	17.9|5329158|41|LR130759|CRT	5329158-5329198	41	LR130759.1	5329512-5329552	0	1.0
LR130759_17	17.9|5329158|41|LR130759|CRT	5329158-5329198	41	LR130759.1	5329866-5329906	0	1.0
LR130759_1	1.7|586800|18|LR130759|CRISPRCasFinder	586800-586817	18	LR130759.1	594330-594347	1	0.944
LR130759_1	1.7|586800|18|LR130759|CRISPRCasFinder	586800-586817	18	LR130759.1	600336-600353	1	0.944
LR130759_1	1.7|586800|18|LR130759|CRISPRCasFinder	586800-586817	18	LR130759.1	4153850-4153867	1	0.944
LR130759_1	1.8|586845|18|LR130759|CRISPRCasFinder	586845-586862	18	LR130759.1	589344-589361	1	0.944
LR130759_1	1.8|586845|18|LR130759|CRISPRCasFinder	586845-586862	18	LR130759.1	595872-595889	1	0.944
LR130759_1	1.8|586845|18|LR130759|CRISPRCasFinder	586845-586862	18	LR130759.1	595902-595919	1	0.944
LR130759_1	1.8|586845|18|LR130759|CRISPRCasFinder	586845-586862	18	LR130759.1	597537-597554	1	0.944
LR130759_1	1.8|586845|18|LR130759|CRISPRCasFinder	586845-586862	18	LR130759.1	598914-598931	1	0.944
LR130759_1	1.8|586845|18|LR130759|CRISPRCasFinder	586845-586862	18	LR130759.1	598944-598961	1	0.944
LR130759_1	1.8|586845|18|LR130759|CRISPRCasFinder	586845-586862	18	LR130759.1	600351-600368	1	0.944
LR130759_1	1.8|586845|18|LR130759|CRISPRCasFinder	586845-586862	18	LR130759.1	601719-601736	1	0.944
LR130759_1	1.8|586845|18|LR130759|CRISPRCasFinder	586845-586862	18	LR130759.1	1752116-1752133	1	0.944
LR130759_3	3.2|587907|18|LR130759|CRISPRCasFinder	587907-587924	18	LR130759.1	589344-589361	1	0.944
LR130759_3	3.2|587907|18|LR130759|CRISPRCasFinder	587907-587924	18	LR130759.1	595872-595889	1	0.944
LR130759_3	3.2|587907|18|LR130759|CRISPRCasFinder	587907-587924	18	LR130759.1	595902-595919	1	0.944
LR130759_3	3.2|587907|18|LR130759|CRISPRCasFinder	587907-587924	18	LR130759.1	597537-597554	1	0.944
LR130759_3	3.2|587907|18|LR130759|CRISPRCasFinder	587907-587924	18	LR130759.1	598914-598931	1	0.944
LR130759_3	3.2|587907|18|LR130759|CRISPRCasFinder	587907-587924	18	LR130759.1	598944-598961	1	0.944
LR130759_3	3.2|587907|18|LR130759|CRISPRCasFinder	587907-587924	18	LR130759.1	600351-600368	1	0.944
LR130759_3	3.2|587907|18|LR130759|CRISPRCasFinder	587907-587924	18	LR130759.1	601719-601736	1	0.944
LR130759_3	3.2|587907|18|LR130759|CRISPRCasFinder	587907-587924	18	LR130759.1	1752116-1752133	1	0.944
LR130759_3	3.3|587952|21|LR130759|CRISPRCasFinder	587952-587972	21	LR130759.1	589389-589409	1	0.952
LR130759_6	6.2|2166913|18|LR130759|CRT	2166913-2166930	18	LR130759.1	4032637-4032654	1	0.944
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	LR130759.1	4362981-4363002	1	0.955
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	LR130759.1	4363266-4363287	1	0.955
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	LR130759.1	4363554-4363575	1	0.955
LR130759_12	12.6|4362679|22|LR130759|CRT	4362679-4362700	22	LR130759.1	5312016-5312037	1	0.955
LR130759_17	17.2|5328939|19|LR130759|CRT	5328939-5328957	19	LR130759.1	973536-973554	1	0.947
LR130759_6	6.4|2166988|21|LR130759|CRT	2166988-2167008	21	LR130759.1	2753799-2753819	2	0.905
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	LR130759.1	234395-234416	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	LR130759.1	234668-234689	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	LR130759.1	234899-234920	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	LR130759.1	234908-234929	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	LR130759.1	234998-235019	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	LR130759.1	1432425-1432446	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	LR130759.1	1432677-1432698	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	LR130759.1	2625324-2625345	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	LR130759.1	2625333-2625354	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	LR130759.1	2625342-2625363	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	LR130759.1	3450027-3450048	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	LR130759.1	4011066-4011087	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	LR130759.1	4233243-4233264	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	LR130759.1	4233480-4233501	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	LR130759.1	4278827-4278848	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	LR130759.1	4278836-4278857	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	LR130759.1	4362990-4363011	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	LR130759.1	4363797-4363818	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	LR130759.1	4363935-4363956	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	LR130759.1	4410915-4410936	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	LR130759.1	4999652-4999673	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	LR130759.1	5017245-5017266	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	LR130759.1	5161338-5161359	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	LR130759.1	5161347-5161368	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	LR130759.1	5288114-5288135	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	LR130759.1	5289974-5289995	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	LR130759.1	5302944-5302965	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	LR130759.1	5319641-5319662	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	LR130759.1	5319650-5319671	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	LR130759.1	5319659-5319680	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	LR130759.1	5467633-5467654	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	LR130759.1	5469298-5469319	2	0.909
LR130759_10	10.1|4230335|20|LR130759|CRT	4230335-4230354	20	LR130759.1	2617021-2617040	2	0.9
LR130759_10	10.1|4230335|20|LR130759|CRT	4230335-4230354	20	LR130759.1	2623454-2623473	2	0.9
LR130759_10	10.1|4230335|20|LR130759|CRT	4230335-4230354	20	LR130759.1	4407313-4407332	2	0.9
LR130759_12	12.6|4362679|22|LR130759|CRT	4362679-4362700	22	LR130759.1	4365061-4365082	2	0.909
LR130759_12	12.6|4362679|22|LR130759|CRT	4362679-4362700	22	LR130759.1	4365070-4365091	2	0.909
LR130759_12	12.6|4362679|22|LR130759|CRT	4362679-4362700	22	LR130759.1	5289087-5289108	2	0.909
LR130759_17	17.2|5328939|19|LR130759|CRT	5328939-5328957	19	LR130759.1	5480298-5480316	2	0.895
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	LR130759.1	5284196-5284227	2	0.938
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	LR130759.1	5284196-5284226	2	0.935
LR130759_18	18.2|5329647|19|LR130759|CRT	5329647-5329665	19	LR130759.1	3304231-3304249	2	0.895
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	LR130759.1	5284195-5284226	2	0.938
LR130759_19	19.2|5330000|20|LR130759|CRT	5330000-5330019	20	LR130759.1	973535-973554	2	0.9
LR130759_15	15.1|5306112|65|LR130759|CRISPRCasFinder	5306112-5306176	65	LR130759.1	5303881-5303945	5	0.923
LR130759_15	15.2|5306208|68|LR130759|CRISPRCasFinder	5306208-5306275	68	LR130759.1	5303782-5303849	8	0.882

1. spacer 1.7|586800|18|LR130759|CRISPRCasFinder matches to position: 589299-589316, mismatch: 0, identity: 1.0

gtgttgccgaagccgatg	CRISPR spacer
gtgttgccgaagccgatg	Protospacer
******************

2. spacer 1.7|586800|18|LR130759|CRISPRCasFinder matches to position: 589329-589346, mismatch: 0, identity: 1.0

gtgttgccgaagccgatg	CRISPR spacer
gtgttgccgaagccgatg	Protospacer
******************

3. spacer 1.7|586800|18|LR130759|CRISPRCasFinder matches to position: 590715-590732, mismatch: 0, identity: 1.0

gtgttgccgaagccgatg	CRISPR spacer
gtgttgccgaagccgatg	Protospacer
******************

4. spacer 1.7|586800|18|LR130759|CRISPRCasFinder matches to position: 590745-590762, mismatch: 0, identity: 1.0

gtgttgccgaagccgatg	CRISPR spacer
gtgttgccgaagccgatg	Protospacer
******************

5. spacer 1.7|586800|18|LR130759|CRISPRCasFinder matches to position: 594300-594317, mismatch: 0, identity: 1.0

gtgttgccgaagccgatg	CRISPR spacer
gtgttgccgaagccgatg	Protospacer
******************

6. spacer 1.7|586800|18|LR130759|CRISPRCasFinder matches to position: 596073-596090, mismatch: 0, identity: 1.0

gtgttgccgaagccgatg	CRISPR spacer
gtgttgccgaagccgatg	Protospacer
******************

7. spacer 1.7|586800|18|LR130759|CRISPRCasFinder matches to position: 600306-600323, mismatch: 0, identity: 1.0

gtgttgccgaagccgatg	CRISPR spacer
gtgttgccgaagccgatg	Protospacer
******************

8. spacer 1.7|586800|18|LR130759|CRISPRCasFinder matches to position: 602862-602879, mismatch: 0, identity: 1.0

gtgttgccgaagccgatg	CRISPR spacer
gtgttgccgaagccgatg	Protospacer
******************

9. spacer 1.8|586845|18|LR130759|CRISPRCasFinder matches to position: 590730-590747, mismatch: 0, identity: 1.0

atgttgttgctgccggtg	CRISPR spacer
atgttgttgctgccggtg	Protospacer
******************

10. spacer 1.8|586845|18|LR130759|CRISPRCasFinder matches to position: 591963-591980, mismatch: 0, identity: 1.0

atgttgttgctgccggtg	CRISPR spacer
atgttgttgctgccggtg	Protospacer
******************

11. spacer 1.9|586890|21|LR130759|CRISPRCasFinder matches to position: 589389-589409, mismatch: 0, identity: 1.0

tcggtcaacgaggcaccggaa	CRISPR spacer
tcggtcaacgaggcaccggaa	Protospacer
*********************

12. spacer 3.2|587907|18|LR130759|CRISPRCasFinder matches to position: 590730-590747, mismatch: 0, identity: 1.0

atgttgttgctgccggtg	CRISPR spacer
atgttgttgctgccggtg	Protospacer
******************

13. spacer 3.2|587907|18|LR130759|CRISPRCasFinder matches to position: 591963-591980, mismatch: 0, identity: 1.0

atgttgttgctgccggtg	CRISPR spacer
atgttgttgctgccggtg	Protospacer
******************

14. spacer 14.3|5303584|30|LR130759|CRISPRCasFinder matches to position: 5306444-5306473, mismatch: 0, identity: 1.0

gcagtccgccgttggctccgggctgtgacg	CRISPR spacer
gcagtccgccgttggctccgggctgtgacg	Protospacer
******************************

15. spacer 14.4|5303641|39|LR130759|CRISPRCasFinder matches to position: 5306378-5306416, mismatch: 0, identity: 1.0

gcagcccggcccgaccggcgacaccaccgaccccaccgc	CRISPR spacer
gcagcccggcccgaccggcgacaccaccgaccccaccgc	Protospacer
***************************************

16. spacer 17.9|5329158|41|LR130759|CRT matches to position: 5329512-5329552, mismatch: 0, identity: 1.0

ccggcgaaatcgggttcaccggcggccaaggcggccagggc	CRISPR spacer
ccggcgaaatcgggttcaccggcggccaaggcggccagggc	Protospacer
*****************************************

17. spacer 17.9|5329158|41|LR130759|CRT matches to position: 5329866-5329906, mismatch: 0, identity: 1.0

ccggcgaaatcgggttcaccggcggccaaggcggccagggc	CRISPR spacer
ccggcgaaatcgggttcaccggcggccaaggcggccagggc	Protospacer
*****************************************

18. spacer 1.7|586800|18|LR130759|CRISPRCasFinder matches to position: 594330-594347, mismatch: 1, identity: 0.944

gtgttgccgaagccgatg	CRISPR spacer
gtgttgccgaagccggtg	Protospacer
***************.**

19. spacer 1.7|586800|18|LR130759|CRISPRCasFinder matches to position: 600336-600353, mismatch: 1, identity: 0.944

gtgttgccgaagccgatg	CRISPR spacer
gtgttgccgaaaccgatg	Protospacer
***********.******

20. spacer 1.7|586800|18|LR130759|CRISPRCasFinder matches to position: 4153850-4153867, mismatch: 1, identity: 0.944

gtgttgccgaagccgatg	CRISPR spacer
gtgttgccgaagccggtg	Protospacer
***************.**

21. spacer 1.8|586845|18|LR130759|CRISPRCasFinder matches to position: 589344-589361, mismatch: 1, identity: 0.944

atgttgttgctgccggtg	CRISPR spacer
atgttgttgctgcccgtg	Protospacer
************** ***

22. spacer 1.8|586845|18|LR130759|CRISPRCasFinder matches to position: 595872-595889, mismatch: 1, identity: 0.944

atgttgttgctgccggtg	CRISPR spacer
atgttgttgttgccggtg	Protospacer
*********.********

23. spacer 1.8|586845|18|LR130759|CRISPRCasFinder matches to position: 595902-595919, mismatch: 1, identity: 0.944

atgttgttgctgccggtg	CRISPR spacer
atgttgttgttgccggtg	Protospacer
*********.********

24. spacer 1.8|586845|18|LR130759|CRISPRCasFinder matches to position: 597537-597554, mismatch: 1, identity: 0.944

atgttgttgctgccggtg	CRISPR spacer
atgttgttgttgccggtg	Protospacer
*********.********

25. spacer 1.8|586845|18|LR130759|CRISPRCasFinder matches to position: 598914-598931, mismatch: 1, identity: 0.944

atgttgttgctgccggtg	CRISPR spacer
atgttgttgttgccggtg	Protospacer
*********.********

26. spacer 1.8|586845|18|LR130759|CRISPRCasFinder matches to position: 598944-598961, mismatch: 1, identity: 0.944

atgttgttgctgccggtg	CRISPR spacer
atgttgttgttgccggtg	Protospacer
*********.********

27. spacer 1.8|586845|18|LR130759|CRISPRCasFinder matches to position: 600351-600368, mismatch: 1, identity: 0.944

atgttgttgctgccggtg	CRISPR spacer
atgttgttgttgccggtg	Protospacer
*********.********

28. spacer 1.8|586845|18|LR130759|CRISPRCasFinder matches to position: 601719-601736, mismatch: 1, identity: 0.944

atgttgttgctgccggtg	CRISPR spacer
atgttgttgttgccggtg	Protospacer
*********.********

29. spacer 1.8|586845|18|LR130759|CRISPRCasFinder matches to position: 1752116-1752133, mismatch: 1, identity: 0.944

atgttgttgctgccggtg	CRISPR spacer
atgttgttactgccggtg	Protospacer
********.*********

30. spacer 3.2|587907|18|LR130759|CRISPRCasFinder matches to position: 589344-589361, mismatch: 1, identity: 0.944

atgttgttgctgccggtg	CRISPR spacer
atgttgttgctgcccgtg	Protospacer
************** ***

31. spacer 3.2|587907|18|LR130759|CRISPRCasFinder matches to position: 595872-595889, mismatch: 1, identity: 0.944

atgttgttgctgccggtg	CRISPR spacer
atgttgttgttgccggtg	Protospacer
*********.********

32. spacer 3.2|587907|18|LR130759|CRISPRCasFinder matches to position: 595902-595919, mismatch: 1, identity: 0.944

atgttgttgctgccggtg	CRISPR spacer
atgttgttgttgccggtg	Protospacer
*********.********

33. spacer 3.2|587907|18|LR130759|CRISPRCasFinder matches to position: 597537-597554, mismatch: 1, identity: 0.944

atgttgttgctgccggtg	CRISPR spacer
atgttgttgttgccggtg	Protospacer
*********.********

34. spacer 3.2|587907|18|LR130759|CRISPRCasFinder matches to position: 598914-598931, mismatch: 1, identity: 0.944

atgttgttgctgccggtg	CRISPR spacer
atgttgttgttgccggtg	Protospacer
*********.********

35. spacer 3.2|587907|18|LR130759|CRISPRCasFinder matches to position: 598944-598961, mismatch: 1, identity: 0.944

atgttgttgctgccggtg	CRISPR spacer
atgttgttgttgccggtg	Protospacer
*********.********

36. spacer 3.2|587907|18|LR130759|CRISPRCasFinder matches to position: 600351-600368, mismatch: 1, identity: 0.944

atgttgttgctgccggtg	CRISPR spacer
atgttgttgttgccggtg	Protospacer
*********.********

37. spacer 3.2|587907|18|LR130759|CRISPRCasFinder matches to position: 601719-601736, mismatch: 1, identity: 0.944

atgttgttgctgccggtg	CRISPR spacer
atgttgttgttgccggtg	Protospacer
*********.********

38. spacer 3.2|587907|18|LR130759|CRISPRCasFinder matches to position: 1752116-1752133, mismatch: 1, identity: 0.944

atgttgttgctgccggtg	CRISPR spacer
atgttgttactgccggtg	Protospacer
********.*********

39. spacer 3.3|587952|21|LR130759|CRISPRCasFinder matches to position: 589389-589409, mismatch: 1, identity: 0.952

tcggtcaacgaggcgccggaa	CRISPR spacer
tcggtcaacgaggcaccggaa	Protospacer
**************.******

40. spacer 6.2|2166913|18|LR130759|CRT matches to position: 4032637-4032654, mismatch: 1, identity: 0.944

ctgctcggtgccggcgga	CRISPR spacer
ctgctcggcgccggcgga	Protospacer
********.*********

41. spacer 9.18|3084540|22|LR130759|CRT matches to position: 4362981-4363002, mismatch: 1, identity: 0.955

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacgccggcaacggcggcaa	Protospacer
*****.****************

42. spacer 9.18|3084540|22|LR130759|CRT matches to position: 4363266-4363287, mismatch: 1, identity: 0.955

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacgccggcaacggcggcaa	Protospacer
*****.****************

43. spacer 9.18|3084540|22|LR130759|CRT matches to position: 4363554-4363575, mismatch: 1, identity: 0.955

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacgccggcaacggcggcaa	Protospacer
*****.****************

44. spacer 12.6|4362679|22|LR130759|CRT matches to position: 5312016-5312037, mismatch: 1, identity: 0.955

gggcggcatgggcggcgacggc	CRISPR spacer
gggcggcatgggcggcgccggc	Protospacer
***************** ****

45. spacer 17.2|5328939|19|LR130759|CRT matches to position: 973536-973554, mismatch: 1, identity: 0.947

ccggcgaagacagcgccac	CRISPR spacer
ccggcgaagacggcgccac	Protospacer
***********.*******

46. spacer 6.4|2166988|21|LR130759|CRT matches to position: 2753799-2753819, mismatch: 2, identity: 0.905

aacggtggattcctgtatggc	CRISPR spacer
aacggcgggttcctgtatggc	Protospacer
*****.**.************

47. spacer 9.18|3084540|22|LR130759|CRT matches to position: 234395-234416, mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacggcggcaacggcggcaa	Protospacer
*****. ***************

48. spacer 9.18|3084540|22|LR130759|CRT matches to position: 234668-234689, mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacggcggcaacggcggcaa	Protospacer
*****. ***************

49. spacer 9.18|3084540|22|LR130759|CRT matches to position: 234899-234920, mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacggcggcaacggcggcaa	Protospacer
*****. ***************

50. spacer 9.18|3084540|22|LR130759|CRT matches to position: 234908-234929, mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacggcggcaacggcggcaa	Protospacer
*****. ***************

51. spacer 9.18|3084540|22|LR130759|CRT matches to position: 234998-235019, mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacggcggcaacggcggcaa	Protospacer
*****. ***************

52. spacer 9.18|3084540|22|LR130759|CRT matches to position: 1432425-1432446, mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacggcggcaacggcggcaa	Protospacer
*****. ***************

53. spacer 9.18|3084540|22|LR130759|CRT matches to position: 1432677-1432698, mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacggcggcaacggcggcaa	Protospacer
*****. ***************

54. spacer 9.18|3084540|22|LR130759|CRT matches to position: 2625324-2625345, mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacggcggcaacggcggcaa	Protospacer
*****. ***************

55. spacer 9.18|3084540|22|LR130759|CRT matches to position: 2625333-2625354, mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacggcggcaacggcggcaa	Protospacer
*****. ***************

56. spacer 9.18|3084540|22|LR130759|CRT matches to position: 2625342-2625363, mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacggcggcaacggcggcaa	Protospacer
*****. ***************

57. spacer 9.18|3084540|22|LR130759|CRT matches to position: 3450027-3450048, mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacggcggcaacggcggcaa	Protospacer
*****. ***************

58. spacer 9.18|3084540|22|LR130759|CRT matches to position: 4011066-4011087, mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacgccggcaacggtggcaa	Protospacer
*****.**********.*****

59. spacer 9.18|3084540|22|LR130759|CRT matches to position: 4233243-4233264, mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacggcggcaacggcggcaa	Protospacer
*****. ***************

60. spacer 9.18|3084540|22|LR130759|CRT matches to position: 4233480-4233501, mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacggcggcaacggcggcaa	Protospacer
*****. ***************

61. spacer 9.18|3084540|22|LR130759|CRT matches to position: 4278827-4278848, mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacggcggcaacggcggcaa	Protospacer
*****. ***************

62. spacer 9.18|3084540|22|LR130759|CRT matches to position: 4278836-4278857, mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacggcggcaacggcggcaa	Protospacer
*****. ***************

63. spacer 9.18|3084540|22|LR130759|CRT matches to position: 4362990-4363011, mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacggcggcaacggcggcaa	Protospacer
*****. ***************

64. spacer 9.18|3084540|22|LR130759|CRT matches to position: 4363797-4363818, mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacggcggcaacggcggcaa	Protospacer
*****. ***************

65. spacer 9.18|3084540|22|LR130759|CRT matches to position: 4363935-4363956, mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacggcggcaacggcggcaa	Protospacer
*****. ***************

66. spacer 9.18|3084540|22|LR130759|CRT matches to position: 4410915-4410936, mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacggcggcaacggcggcaa	Protospacer
*****. ***************

67. spacer 9.18|3084540|22|LR130759|CRT matches to position: 4999652-4999673, mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaccgccggcaacggcggcaa	Protospacer
*** *.****************

68. spacer 9.18|3084540|22|LR130759|CRT matches to position: 5017245-5017266, mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacggcggcaacggcggcaa	Protospacer
*****. ***************

69. spacer 9.18|3084540|22|LR130759|CRT matches to position: 5161338-5161359, mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacggcggcaacggcggcaa	Protospacer
*****. ***************

70. spacer 9.18|3084540|22|LR130759|CRT matches to position: 5161347-5161368, mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacggcggcaacggcggcaa	Protospacer
*****. ***************

71. spacer 9.18|3084540|22|LR130759|CRT matches to position: 5288114-5288135, mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacggcggcaacggcggcaa	Protospacer
*****. ***************

72. spacer 9.18|3084540|22|LR130759|CRT matches to position: 5289974-5289995, mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacggcggcaacggcggcaa	Protospacer
*****. ***************

73. spacer 9.18|3084540|22|LR130759|CRT matches to position: 5302944-5302965, mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacggcggcaacggcggcaa	Protospacer
*****. ***************

74. spacer 9.18|3084540|22|LR130759|CRT matches to position: 5319641-5319662, mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacggcggcaacggcggcaa	Protospacer
*****. ***************

75. spacer 9.18|3084540|22|LR130759|CRT matches to position: 5319650-5319671, mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacggcggcaacggcggcaa	Protospacer
*****. ***************

76. spacer 9.18|3084540|22|LR130759|CRT matches to position: 5319659-5319680, mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacggcggcaacggcggcaa	Protospacer
*****. ***************

77. spacer 9.18|3084540|22|LR130759|CRT matches to position: 5467633-5467654, mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacggcggcaacggcggcaa	Protospacer
*****. ***************

78. spacer 9.18|3084540|22|LR130759|CRT matches to position: 5469298-5469319, mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacggcggcaacggcggcaa	Protospacer
*****. ***************

79. spacer 10.1|4230335|20|LR130759|CRT matches to position: 2617021-2617040, mismatch: 2, identity: 0.9

ggtggtgccgccgggctcat	CRISPR spacer
ggcggtgccgccggcctcat	Protospacer
**.*********** *****

80. spacer 10.1|4230335|20|LR130759|CRT matches to position: 2623454-2623473, mismatch: 2, identity: 0.9

ggtggtgccgccgggctcat	CRISPR spacer
ggcggtgccgccgggctgat	Protospacer
**.************** **

81. spacer 10.1|4230335|20|LR130759|CRT matches to position: 4407313-4407332, mismatch: 2, identity: 0.9

ggtggtgccgccgggctcat	CRISPR spacer
ggaggtgccgccgggctgat	Protospacer
** ************** **

82. spacer 12.6|4362679|22|LR130759|CRT matches to position: 4365061-4365082, mismatch: 2, identity: 0.909

gggcggcatgggcggcgacggc	CRISPR spacer
gggcggcatgggcggcaccggc	Protospacer
****************. ****

83. spacer 12.6|4362679|22|LR130759|CRT matches to position: 4365070-4365091, mismatch: 2, identity: 0.909

gggcggcatgggcggcgacggc	CRISPR spacer
gggcggcaccggcggcgacggc	Protospacer
********. ************

84. spacer 12.6|4362679|22|LR130759|CRT matches to position: 5289087-5289108, mismatch: 2, identity: 0.909

gggcggcatgggcggcgacggc	CRISPR spacer
gggcggcaccggcggcgacggc	Protospacer
********. ************

85. spacer 17.2|5328939|19|LR130759|CRT matches to position: 5480298-5480316, mismatch: 2, identity: 0.895

ccggcgaagacagcgccac	CRISPR spacer
ccggcgcagacggcgccac	Protospacer
****** ****.*******

86. spacer 17.10|5329230|32|LR130759|CRT matches to position: 5284196-5284227, mismatch: 2, identity: 0.938

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
ccaacggctccggcggcgccggcggcaccggc	Protospacer
******************* ***** ******

87. spacer 18.1|5329584|31|LR130759|CRT matches to position: 5284196-5284226, mismatch: 2, identity: 0.935

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaacggctccggcggcgccggcggcaccgg	Protospacer
******************* ***** *****

88. spacer 18.2|5329647|19|LR130759|CRT matches to position: 3304231-3304249, mismatch: 2, identity: 0.895

ccggcaaagacagcgccgc	CRISPR spacer
ccggcaatgacaccgccgc	Protospacer
******* **** ******

89. spacer 19.1|5329937|32|LR130759|CRT matches to position: 5284195-5284226, mismatch: 2, identity: 0.938

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
accaacggctccggcggcgccggcggcaccgg	Protospacer
******************** ***** *****

90. spacer 19.2|5330000|20|LR130759|CRT matches to position: 973535-973554, mismatch: 2, identity: 0.9

accggcaaagacagcgccac	CRISPR spacer
accggcgaagacggcgccac	Protospacer
******.*****.*******

91. spacer 15.1|5306112|65|LR130759|CRISPRCasFinder matches to position: 5303881-5303945, mismatch: 5, identity: 0.923

cggtaacgctgcatttcctggcccgggcagcggtggtaacggtggcgcgggcggctcggc	CRISPR spacer
cggtaacgctgcatttcctggcccgggcagcggtggtaacggtggcgcgggcggctcggc	Protospacer
************************************************************

92. spacer 15.2|5306208|68|LR130759|CRISPRCasFinder matches to position: 5303782-5303849, mismatch: 8, identity: 0.882

cggcttttcctctggcagcttcggtgcccagagtggtgccggtggtgccggcggcgacgg	CRISPR spacer
cggcttttcctctggcagcttcggtgcccagagtggtgccggtggtgccggcggcgacgg	Protospacer
************************************************************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	MH153804	Rhodococcus phage Jace, complete genome	20831-20852	1	0.955
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NZ_CP025508	Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvB, complete sequence	535569-535590	1	0.955
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NZ_CP022667	Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR2, complete sequence	102014-102035	1	0.955
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NZ_CP050087	Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b5, complete sequence	534353-534374	1	0.955
LR130759_12	12.6|4362679|22|LR130759|CRT	4362679-4362700	22	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	3467038-3467059	1	0.955
LR130759_12	12.6|4362679|22|LR130759|CRT	4362679-4362700	22	NZ_CP020331	Martelella mediterranea DSM 17316 strain MACL11 plasmid pMM593, complete sequence	529568-529589	1	0.955
LR130759_12	12.6|4362679|22|LR130759|CRT	4362679-4362700	22	KY555147	Caulobacter phage Ccr34, complete genome	65703-65724	1	0.955
LR130759_12	12.6|4362679|22|LR130759|CRT	4362679-4362700	22	KY555145	Caulobacter phage Ccr29, complete genome	69616-69637	1	0.955
LR130759_12	12.6|4362679|22|LR130759|CRT	4362679-4362700	22	KY555143	Caulobacter phage Ccr2, complete genome	65083-65104	1	0.955
LR130759_12	12.6|4362679|22|LR130759|CRT	4362679-4362700	22	MH779505	Mycobacterium phage Grizzly, complete genome	21921-21942	1	0.955
LR130759_12	12.6|4362679|22|LR130759|CRT	4362679-4362700	22	KY555146	Caulobacter phage Ccr32, complete genome	65262-65283	1	0.955
LR130759_12	12.6|4362679|22|LR130759|CRT	4362679-4362700	22	KY555144	Caulobacter phage Ccr5, complete genome	64535-64556	1	0.955
LR130759_12	12.6|4362679|22|LR130759|CRT	4362679-4362700	22	JX163858	Caulobacter phage phiCbK, complete genome	142574-142595	1	0.955
LR130759_12	12.6|4362679|22|LR130759|CRT	4362679-4362700	22	KY555142	Caulobacter phage Ccr10, complete genome	64608-64629	1	0.955
LR130759_8	8.15|3078614|22|LR130759|CRT	3078614-3078635	22	NZ_CP050953	Rhodococcus sp. DMU1 plasmid unnamed	48672-48693	2	0.909
LR130759_9	9.15|3084357|22|LR130759|CRT	3084357-3084378	22	NZ_CP050953	Rhodococcus sp. DMU1 plasmid unnamed	48672-48693	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NZ_CP026282	Klebsiella oxytoca strain KONIH2 plasmid pKOR-e3cb, complete sequence	3745-3766	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NZ_CP018351	Klebsiella pneumoniae strain CAV1417 plasmid pCAV1417-185, complete sequence	46581-46602	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NZ_CP050074	Enterobacter kobei strain 070 plasmid p070, complete sequence	61325-61346	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NZ_CP050837	Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-3, complete sequence	108282-108303	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NZ_KX839208	Klebsiella pneumoniae strain KP1814 plasmid pKP1814-2, complete sequence	131842-131863	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NZ_CP023418	Klebsiella pneumoniae strain 1050 plasmid pKp1050-2, complete sequence	54555-54576	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NZ_CP026276	Klebsiella oxytoca strain KONIH5 plasmid pKOR-ab4d, complete sequence	236202-236223	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NZ_LN824135	Klebsiella pneumoniae genome assembly MS6671.v1, plasmid : _Plasmid_B_Kpneumoniae_MS6671	58233-58254	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NZ_CP026237	Citrobacter freundii complex sp. CFNIH3 plasmid pCFR-9161, complete sequence	141880-141901	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NZ_CP028954	Klebsiella pneumoniae strain AR_0141 plasmid unnamed1, complete sequence	154602-154623	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NZ_CP020842	Klebsiella pneumoniae strain KPN1482 plasmid pKPN1482-1, complete sequence	73637-73658	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NZ_CP022274	Citrobacter freundii strain 18-1 plasmid pA18-1, complete sequence	155582-155603	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	MN310380	Raoultella ornithinolytica strain 170602815 plasmid p602815-NR, complete sequence	78216-78237	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NZ_CP015502	Klebsiella pneumoniae strain SKGH01 plasmid unnamed 2, complete sequence	117915-117936	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NZ_CP025213	Klebsiella pneumoniae strain HZW25 plasmid unnamed2, complete sequence	29432-29453	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NZ_CP033823	Klebsiella sp. FDAARGOS_511 plasmid unnamed1, complete sequence	20042-20063	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NZ_CP012571	Klebsiella pneumoniae strain UCLAOXA232KP plasmid pUCLAOXA232-5.X, complete sequence	96724-96745	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NZ_CP042513	Serratia marcescens strain E28 plasmid pE28_001, complete sequence	63548-63569	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NZ_CP026208	Escherichia coli strain ECONIH5 plasmid pECO-109b, complete sequence	231510-231531	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NZ_CP036193	Klebsiella pneumoniae strain BA34918 plasmid pIncFIBpQil, complete sequence	37565-37586	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NZ_CP026179	Klebsiella pneumoniae strain KPNIH49 plasmid pKPC-224e, complete sequence	92946-92967	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	CP052526	Klebsiella pneumoniae strain B16KP0177 plasmid pB16KP0177-2, complete sequence	28612-28633	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NZ_AP019689	Klebsiella quasipneumoniae strain SNI47 plasmid pTMSNI47-2, complete sequence	70493-70514	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NZ_CP028551	Klebsiella variicola strain WCHKP19 plasmid p3_020019, complete sequence	45382-45403	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NC_022609	Klebsiella pneumoniae strain N11-0042 plasmid pKp11-42, complete sequence	144271-144292	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NZ_CP048380	Klebsiella variicola strain 118 plasmid p118_A, complete sequence	27208-27229	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NZ_CP026397	Klebsiella pneumoniae strain KPNIH48 plasmid pKPN-10f7, complete sequence	186722-186743	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NZ_CP012566	Klebsiella pneumoniae strain UCLAOXA232KP plasmid pUCLAOXA232-5, complete sequence	97551-97572	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NZ_CP024516	Klebsiella pneumoniae strain KSB1_10J plasmid unnamed1, complete sequence	116076-116097	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NZ_CP035907	Klebsiella pneumoniae strain BA4656 plasmid pIncFIBpQil, complete sequence	37571-37592	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NZ_CP034132	Klebsiella quasipneumoniae strain G4584 plasmid pG4584_81.9Kb, complete sequence	28268-28289	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NZ_CP024431	Klebsiella pneumoniae strain DA48896 plasmid p48896_2, complete sequence	55817-55838	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NC_021198	Klebsiella pneumoniae subsp. pneumoniae KPX plasmid pKPX-1 DNA, complete sequence	30193-30214	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	CP052538	Klebsiella pneumoniae strain B16KP0141 plasmid pB16KP0141-1, complete sequence	68030-68051	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NZ_CP045678	Klebsiella pneumoniae strain WSD411 plasmid pWSD411_5, complete sequence	32744-32765	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	CP052441	Klebsiella pneumoniae strain C16KP0102 plasmid pC16KP0102-1, complete sequence	116215-116236	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NZ_CP026212	Citrobacter sp. CFNIH10 plasmid pCIT-a850, complete sequence	80793-80814	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NZ_CP013340	Raoultella ornithinolytica strain Yangling I2 plasmid pKPYL2, complete sequence	1309-1330	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NZ_CP024500	Klebsiella pneumoniae strain KSB1_4E plasmid unnamed1, complete sequence	116076-116097	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NZ_CP029724	Klebsiella pneumoniae strain AR_0140 plasmid unnamed2, complete sequence	92569-92590	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NZ_CP034140	Klebsiella quasipneumoniae subsp. similipneumoniae strain G747 plasmid pG747_84.1Kb, complete sequence	28264-28285	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NZ_CP011634	Klebsiella oxytoca strain CAV1374 plasmid pCAV1374-228, complete sequence	197055-197076	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NZ_CP024508	Klebsiella pneumoniae strain KSB2_1B plasmid unnamed2, complete sequence	118359-118380	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NZ_CP024509	Klebsiella pneumoniae strain KSB2_1B plasmid unnamed3, complete sequence	9024-9045	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NZ_CP032189	Klebsiella pneumoniae strain AR_0075 plasmid unnamed4, complete sequence	17141-17162	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NZ_CP018361	Klebsiella oxytoca strain CAV1752 plasmid pCAV1752-278, complete sequence	148418-148439	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NZ_CP026234	Citrobacter freundii complex sp. CFNIH4 plasmid pCFR-4109, complete sequence	207951-207972	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	CP052499	Klebsiella pneumoniae strain B17KP0021 plasmid pB17KP0021-1, complete sequence	116215-116236	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NZ_CP021698	Klebsiella pneumoniae strain AR_0158 plasmid tig00000183, complete sequence	11517-11538	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NZ_CP024483	Klebsiella pneumoniae strain INF322 plasmid unnamed1, complete sequence	116079-116100	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NZ_CP026716	Klebsiella oxytoca strain AR_0028 plasmid unitig_1_pilon, complete sequence	4852-4873	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	CP052243	Klebsiella pneumoniae strain E17KP0019 plasmid pE17KP0019-2, complete sequence	116215-116236	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NZ_CP021758	Klebsiella pneumoniae strain AR_0138 plasmid tig00000001, complete sequence	41054-41075	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	MK649823	Klebsiella pneumoniae strain BA6740 plasmid pBA6740_1, complete sequence	122007-122028	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NZ_CP014763	Klebsiella pneumoniae strain KPNIH39 plasmid pKPN-332, complete sequence	54927-54948	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NZ_CP044111	Klebsiella michiganensis strain FDAARGOS_647 plasmid unnamed2	134223-134244	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	CP052337	Klebsiella pneumoniae strain D17KP0018 plasmid pD17KP0018-1, complete sequence	118176-118197	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NZ_CP016810	Klebsiella pneumoniae strain DHQP1002001 plasmid p_IncFIB_DHQP1002001, complete sequence	13818-13839	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NZ_MH056209	Enterobacter cloacae strain NRZ-10170 plasmid pNRZ-10170-LMB-1, complete sequence	27409-27430	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NZ_CP032893	Enterobacter kobei strain WCHEK045523 plasmid p1_045523, complete sequence	81387-81408	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NZ_KY271404	Klebsiella pneumoniae strain Kp-48 plasmid pKPN3-307_typeA, complete sequence	50335-50356	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NZ_KY271406	Klebsiella pneumoniae strain H150820806 plasmid pKPN3-307_TypeC, complete sequence	209795-209816	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NZ_MF788070	Raoultella ornithinolytica strain 23141 plasmid p23141-2, complete sequence	15383-15404	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NZ_CP032323	Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence	83951-83972	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NZ_MN366357	Bacterium plasmid pALTS28, complete sequence	21108-21129	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NZ_CP020047	Thiomonas intermedia strain ATCC 15466 plasmid pXI1, complete sequence	17832-17853	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NZ_CP022363	Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence	219214-219235	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	MF495477	Aeromonas salmonicida plasmid pS28-3, complete sequence	22778-22799	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NZ_CP007795	Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence	80736-80757	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NZ_CP007795	Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence	498359-498380	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	KJ850907	Uncultured bacterium plasmid pSFA231, complete sequence	20305-20326	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NZ_CP032347	Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence	87168-87189	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NZ_CP032347	Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence	506551-506572	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	MF668282	Gordonia phage ShayRa, complete genome	4776-4797	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	KY379511	Pseudoalteromonas phage PHS21, complete genome	2711-2732	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NC_030698	Gordonia phage Soups, complete genome	4776-4797	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	KU998251	Gordonia phage KatherineG, complete genome	4776-4797	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NC_042123	Gordonia phage Waits, complete genome	4628-4649	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	MN284898	Gordonia phage MinecraftSteve, complete genome	4776-4797	2	0.909
LR130759_9	9.18|3084540|22|LR130759|CRT	3084540-3084561	22	NC_030694	Gordonia phage Rosalind, complete genome	4776-4797	2	0.909
LR130759_12	12.6|4362679|22|LR130759|CRT	4362679-4362700	22	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	1403668-1403689	2	0.909
LR130759_12	12.6|4362679|22|LR130759|CRT	4362679-4362700	22	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	3466606-3466627	2	0.909
LR130759_12	12.6|4362679|22|LR130759|CRT	4362679-4362700	22	NZ_CP020331	Martelella mediterranea DSM 17316 strain MACL11 plasmid pMM593, complete sequence	529184-529205	2	0.909
LR130759_12	12.6|4362679|22|LR130759|CRT	4362679-4362700	22	NZ_CP032686	Rhizobium sp. CCGE531 plasmid pRCCGE531c, complete sequence	279893-279914	2	0.909
LR130759_12	12.6|4362679|22|LR130759|CRT	4362679-4362700	22	NZ_CP039697	Novosphingobium sp. ABRDHK2 plasmid pABRDHK22, complete sequence	573613-573634	2	0.909
LR130759_12	12.6|4362679|22|LR130759|CRT	4362679-4362700	22	NZ_CP032691	Rhizobium sp. CCGE532 plasmid pRCCGE532c, complete sequence	274872-274893	2	0.909
LR130759_12	12.6|4362679|22|LR130759|CRT	4362679-4362700	22	NZ_LR134465	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 23, complete sequence	79484-79505	2	0.909
LR130759_12	12.6|4362679|22|LR130759|CRT	4362679-4362700	22	NZ_CP025613	Niveispirillum cyanobacteriorum strain TH16 plasmid unnamed1, complete sequence	557441-557462	2	0.909
LR130759_12	12.6|4362679|22|LR130759|CRT	4362679-4362700	22	NZ_CP024895	Amycolatopsis sp. AA4 plasmid unnamed1, complete sequence	73112-73133	2	0.909
LR130759_12	12.6|4362679|22|LR130759|CRT	4362679-4362700	22	NZ_CP018230	Rhizobium leguminosarum strain Vaf-108 plasmid unnamed2, complete sequence	436155-436176	2	0.909
LR130759_12	12.6|4362679|22|LR130759|CRT	4362679-4362700	22	NC_012858	Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132502, complete sequence	421567-421588	2	0.909
LR130759_12	12.6|4362679|22|LR130759|CRT	4362679-4362700	22	NZ_CP051294	Mesorhizobium sp. NZP2077 plasmid pMSNZP2077A, complete sequence	119593-119614	2	0.909
LR130759_12	12.6|4362679|22|LR130759|CRT	4362679-4362700	22	NZ_CP032297	Rahnella aquatilis strain ZF7 plasmid pRAZF7, complete sequence	270171-270192	2	0.909
LR130759_12	12.6|4362679|22|LR130759|CRT	4362679-4362700	22	NC_017060	Rahnella aquatilis HX2 plasmid PRA1, complete sequence	384549-384570	2	0.909
LR130759_12	12.6|4362679|22|LR130759|CRT	4362679-4362700	22	NZ_CP029833	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed3, complete sequence	147255-147276	2	0.909
LR130759_12	12.6|4362679|22|LR130759|CRT	4362679-4362700	22	NZ_AP022333	Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49a, complete sequence	190097-190118	2	0.909
LR130759_12	12.6|4362679|22|LR130759|CRT	4362679-4362700	22	NZ_AP022333	Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49a, complete sequence	190400-190421	2	0.909
LR130759_12	12.6|4362679|22|LR130759|CRT	4362679-4362700	22	NZ_CP029358	Azospirillum sp. CFH 70021 plasmid unnamed3	111608-111629	2	0.909
LR130759_12	12.6|4362679|22|LR130759|CRT	4362679-4362700	22	NZ_CP039965	Pseudorhodobacter sp. S12M18 plasmid unnamed1, complete sequence	1508936-1508957	2	0.909
LR130759_12	12.6|4362679|22|LR130759|CRT	4362679-4362700	22	NC_015062	Rahnella sp. Y9602 plasmid pRAHAQ01, complete sequence	387365-387386	2	0.909
LR130759_12	12.6|4362679|22|LR130759|CRT	4362679-4362700	22	NZ_CP039644	Azospirillum sp. TSA2s plasmid p2, complete sequence	151873-151894	2	0.909
LR130759_12	12.6|4362679|22|LR130759|CRT	4362679-4362700	22	NZ_CP033363	Mesorhizobium sp. NZP2077 plasmid pMSNZP2077NSa, complete sequence	119593-119614	2	0.909
LR130759_12	12.6|4362679|22|LR130759|CRT	4362679-4362700	22	NC_011758	Methylorubrum extorquens CM4 plasmid pCMU01, complete sequence	231609-231630	2	0.909
LR130759_12	12.6|4362679|22|LR130759|CRT	4362679-4362700	22	NZ_CP034838	Rahnella aquatilis strain KM12 plasmid pKM12v1, complete sequence	369976-369997	2	0.909
LR130759_12	12.6|4362679|22|LR130759|CRT	4362679-4362700	22	NZ_CP034839	Rahnella aquatilis strain KM25 plasmid pKM12v2, complete sequence	369976-369997	2	0.909
LR130759_12	12.6|4362679|22|LR130759|CRT	4362679-4362700	22	NZ_CP034837	Rahnella aquatilis strain KM05 plasmid pKM05, complete sequence	324789-324810	2	0.909
LR130759_12	12.6|4362679|22|LR130759|CRT	4362679-4362700	22	NZ_CP043439	Cupriavidus campinensis strain MJ1 plasmid unnamed2, complete sequence	196824-196845	2	0.909
LR130759_12	12.6|4362679|22|LR130759|CRT	4362679-4362700	22	NC_019408	Caulobacter phage CcrRogue, complete genome	66138-66159	2	0.909
LR130759_12	12.6|4362679|22|LR130759|CRT	4362679-4362700	22	MH588544	Caulobacter phage CcrBL10, complete genome	64979-65000	2	0.909
LR130759_12	12.6|4362679|22|LR130759|CRT	4362679-4362700	22	MH727561	Mycobacterium phage Serendipitous, complete genome	32392-32413	2	0.909
LR130759_17	17.4|5329053|22|LR130759|CRT	5329053-5329074	22	NZ_CP016083	Streptomyces sp. SAT1 plasmid unnamed3, complete sequence	625381-625402	2	0.909
LR130759_17	17.4|5329053|22|LR130759|CRT	5329053-5329074	22	NZ_CP011046	Clavibacter michiganensis subsp. insidiosus strain R1-1 plasmid pCI3, complete sequence	97139-97160	2	0.909
LR130759_17	17.4|5329053|22|LR130759|CRT	5329053-5329074	22	NZ_CP011045	Clavibacter michiganensis subsp. insidiosus strain R1-1 plasmid pCI2, complete sequence	9496-9517	2	0.909
LR130759_17	17.4|5329053|22|LR130759|CRT	5329053-5329074	22	NZ_CP021036	Clavibacter michiganensis subsp. insidiosus strain R1-3 plasmid pCI2, complete sequence	9496-9517	2	0.909
LR130759_17	17.4|5329053|22|LR130759|CRT	5329053-5329074	22	NZ_CP021037	Clavibacter michiganensis subsp. insidiosus strain R1-3 plasmid pCI3, complete sequence	96064-96085	2	0.909
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP020440	Paracoccus yeei strain FDAARGOS_252 plasmid unnamed2, complete sequence	35533-35555	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP031080	Paracoccus yeei strain CCUG 32053 plasmid pYEE2, complete sequence	186641-186663	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	CP023013	Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence	1798455-1798477	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP049790	Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence	1824693-1824715	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP024582	Roseomonas sp. FDAARGOS_362 plasmid unnamed1, complete sequence	363646-363668	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP022766	Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence	1857203-1857225	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP021763	Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence	1883897-1883919	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP042515	Serratia marcescens strain E28 plasmid pE28_003	8135-8157	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP015116	Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence	2028147-2028169	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP016555	Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence	1509577-1509599	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP052069	Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence	1788810-1788832	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP010630	Phaeobacter inhibens strain P78 plasmid pP78_a, complete sequence	199036-199058	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP016915	Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence	399330-399352	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP016905	Ralstonia solanacearum strain KACC 10709 plasmid unnamed1	761790-761812	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP022769	Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence	1866689-1866711	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP022773	Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence	1575456-1575478	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP022783	Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence	1805762-1805784	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP022791	Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence	1803579-1803601	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP022795	Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence	1800632-1800654	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP052071	Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence	1872680-1872702	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP009763	Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence	1743444-1743466	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	CP023015	Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence	1801989-1802011	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP022779	Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence	1878169-1878191	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP052075	Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence	1872647-1872669	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP052085	Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence	1778924-1778946	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP052095	Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence	1856423-1856445	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP052105	Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence	1871390-1871412	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP021765	Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence	1883897-1883919	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP052077	Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence	1769072-1769094	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP052087	Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence	1779236-1779258	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP052097	Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence	1856423-1856445	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP052115	Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence	1871489-1871511	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP052127	Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence	1778924-1778946	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP025552	Streptomyces rimosus strain WT5260 plasmid unnamed, complete sequence	222724-222746	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP052079	Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence	1769719-1769741	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP052089	Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence	1778127-1778149	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP052093	Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence	1856423-1856445	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP052101	Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence	1856423-1856445	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP052099	Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence	1856423-1856445	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP052107	Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence	1871485-1871507	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP022781	Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence	1930018-1930040	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP052117	Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence	1871474-1871496	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP052125	Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence	1769095-1769117	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP022793	Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence	1783399-1783421	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP022785	Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence	1764036-1764058	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP022787	Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence	1823930-1823952	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP022756	Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence	1855918-1855940	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP052129	Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence	1853738-1853760	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP052121	Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence	1871474-1871496	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP052123	Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence	1769095-1769117	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP052131	Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence	1779235-1779257	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	CP011998	Ralstonia solanacearum strain YC45 plasmid, complete sequence	1806344-1806366	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP052073	Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence	1872471-1872493	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP052081	Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence	1769095-1769117	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP052083	Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence	1769095-1769117	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP052109	Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence	1871485-1871507	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP052091	Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence	1856428-1856450	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP052103	Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence	1871496-1871518	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP052119	Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence	1871297-1871319	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP013369	Burkholderia ubonensis strain RF23-BP41 plasmid pRF23, complete sequence	126941-126963	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP016613	Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence	842112-842134	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP010612	Phaeobacter inhibens strain P92 plasmid pP92_b, complete sequence	160765-160787	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP010624	Phaeobacter inhibens strain P51 plasmid pP51_a, complete sequence	153537-153559	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP021449	Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence	261099-261121	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP010669	Phaeobacter inhibens strain P57 plasmid pP57_a, complete sequence	153537-153559	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP049794	Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence	847163-847185	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP049788	Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence	36153-36175	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP049792	Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence	628639-628661	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	508028-508050	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP015851	Ralstonia solanacearum strain YC40-M plasmid, complete sequence	606626-606648	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP031953	Phaeobacter inhibens strain 2.10 plasmid unnamed1, complete sequence	171077-171099	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NC_018421	Phaeobacter inhibens 2.10 plasmid pPGA2_239, complete sequence	170984-171006	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP022482	Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence	1299937-1299959	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP010742	Phaeobacter inhibens strain P59 plasmid pP59_a, complete sequence	170920-170942	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP010618	Phaeobacter inhibens strain P30 isolate M4-3.1A plasmid pP30_a, complete sequence	175021-175043	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP010726	Phaeobacter inhibens strain P88 plasmid pP88_a, complete sequence	161319-161341	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP010651	Phaeobacter inhibens strain P54 plasmid pP54_a, complete sequence	176370-176392	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP030829	Neorhizobium sp. NCHU2750 plasmid pNCHU2750b, complete sequence	358209-358231	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP010697	Phaeobacter inhibens strain P24 plasmid pP24_a, complete sequence	153537-153559	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP010746	Phaeobacter inhibens strain P48 isolate M21-2.3 plasmid pP48_a, complete sequence	168435-168457	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP019308	Phaeobacter inhibens strain DOK1-1 plasmid pDOK1-1-1, complete sequence	4456-4478	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP052111	Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence	146078-146100	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP052113	Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence	146078-146100	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP025188	Roseomonas mucosa strain AD2 plasmid p1-AD2, complete sequence	63665-63687	2	0.913
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	MF140416	Mycobacterium phage LastHope, complete genome	12364-12386	2	0.913
LR130759_17	17.13|5329407|23|LR130759|CRT	5329407-5329429	23	NZ_CP015203	Rhodococcus sp. 008 plasmid pR8L1, complete sequence	320663-320685	2	0.913
LR130759_17	17.13|5329407|23|LR130759|CRT	5329407-5329429	23	NZ_CP040453	Halomonas sp. PA16-9 plasmid p_unnamed2, complete sequence	76969-76991	2	0.913
LR130759_17	17.13|5329407|23|LR130759|CRT	5329407-5329429	23	KJ410133	Mycobacterium phage Jolie2, complete genome	14510-14532	2	0.913
LR130759_18	18.4|5329761|22|LR130759|CRT	5329761-5329782	22	NZ_CP016083	Streptomyces sp. SAT1 plasmid unnamed3, complete sequence	625381-625402	2	0.909
LR130759_18	18.4|5329761|22|LR130759|CRT	5329761-5329782	22	NZ_CP011046	Clavibacter michiganensis subsp. insidiosus strain R1-1 plasmid pCI3, complete sequence	97139-97160	2	0.909
LR130759_18	18.4|5329761|22|LR130759|CRT	5329761-5329782	22	NZ_CP011045	Clavibacter michiganensis subsp. insidiosus strain R1-1 plasmid pCI2, complete sequence	9496-9517	2	0.909
LR130759_18	18.4|5329761|22|LR130759|CRT	5329761-5329782	22	NZ_CP021036	Clavibacter michiganensis subsp. insidiosus strain R1-3 plasmid pCI2, complete sequence	9496-9517	2	0.909
LR130759_18	18.4|5329761|22|LR130759|CRT	5329761-5329782	22	NZ_CP021037	Clavibacter michiganensis subsp. insidiosus strain R1-3 plasmid pCI3, complete sequence	96064-96085	2	0.909
LR130759_12	12.6|4362679|22|LR130759|CRT	4362679-4362700	22	MN856085	Myoviridae sp. isolate 322, complete genome	5512-5533	3	0.864
LR130759_13	13.2|5303059|24|LR130759|CRISPRCasFinder	5303059-5303082	24	NZ_CP019037	Massilia putida strain 6NM-7 plasmid unnamed2, complete sequence	115258-115281	3	0.875
LR130759_13	13.2|5303059|24|LR130759|CRISPRCasFinder	5303059-5303082	24	NZ_CP029834	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed4, complete sequence	49350-49373	3	0.875
LR130759_13	13.2|5303059|24|LR130759|CRISPRCasFinder	5303059-5303082	24	NZ_CP038636	Cupriavidus oxalaticus strain X32 plasmid unnamed1, complete sequence	838119-838142	3	0.875
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP024424	Paracoccus yeei strain TT13 plasmid pTT13-2, complete sequence	156677-156699	3	0.87
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP034351	Streptomyces sp. W1SF4 plasmid p1, complete sequence	214172-214194	3	0.87
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_AP014579	Burkholderia sp. RPE67 plasmid p1, complete sequence	37620-37642	3	0.87
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP054616	Azospirillum oryzae strain KACC 14407 plasmid unnamed2, complete sequence	76607-76629	3	0.87
LR130759_17	17.7|5329044|23|LR130759|CRT	5329044-5329066	23	NZ_CP044082	Paracoccus yeei strain FDAARGOS_643 plasmid unnamed4, complete sequence	20365-20387	3	0.87
LR130759_17	17.13|5329407|23|LR130759|CRT	5329407-5329429	23	NZ_CP016083	Streptomyces sp. SAT1 plasmid unnamed3, complete sequence	625381-625403	3	0.87
LR130759_17	17.13|5329407|23|LR130759|CRT	5329407-5329429	23	NZ_CP046101	Rhodococcus sp. AQ5-07 plasmid unnamed2, complete sequence	51169-51191	3	0.87
LR130759_17	17.13|5329407|23|LR130759|CRT	5329407-5329429	23	NZ_CP011046	Clavibacter michiganensis subsp. insidiosus strain R1-1 plasmid pCI3, complete sequence	97138-97160	3	0.87
LR130759_17	17.13|5329407|23|LR130759|CRT	5329407-5329429	23	NZ_CP011045	Clavibacter michiganensis subsp. insidiosus strain R1-1 plasmid pCI2, complete sequence	9495-9517	3	0.87
LR130759_17	17.13|5329407|23|LR130759|CRT	5329407-5329429	23	NZ_CP021036	Clavibacter michiganensis subsp. insidiosus strain R1-3 plasmid pCI2, complete sequence	9495-9517	3	0.87
LR130759_17	17.13|5329407|23|LR130759|CRT	5329407-5329429	23	NZ_CP021037	Clavibacter michiganensis subsp. insidiosus strain R1-3 plasmid pCI3, complete sequence	96063-96085	3	0.87
LR130759_19	19.4|5330114|23|LR130759|CRT	5330114-5330136	23	NZ_CP011046	Clavibacter michiganensis subsp. insidiosus strain R1-1 plasmid pCI3, complete sequence	97139-97161	3	0.87
LR130759_19	19.4|5330114|23|LR130759|CRT	5330114-5330136	23	NZ_CP011045	Clavibacter michiganensis subsp. insidiosus strain R1-1 plasmid pCI2, complete sequence	9496-9518	3	0.87
LR130759_19	19.4|5330114|23|LR130759|CRT	5330114-5330136	23	NZ_CP021036	Clavibacter michiganensis subsp. insidiosus strain R1-3 plasmid pCI2, complete sequence	9496-9518	3	0.87
LR130759_19	19.4|5330114|23|LR130759|CRT	5330114-5330136	23	NZ_CP021037	Clavibacter michiganensis subsp. insidiosus strain R1-3 plasmid pCI3, complete sequence	96064-96086	3	0.87
LR130759_19	19.4|5330114|23|LR130759|CRT	5330114-5330136	23	NZ_CP016083	Streptomyces sp. SAT1 plasmid unnamed3, complete sequence	625380-625402	3	0.87
LR130759_13	13.2|5303059|24|LR130759|CRISPRCasFinder	5303059-5303082	24	NZ_AP022611	Mycolicibacterium madagascariense strain JCM 13574 plasmid pJCM13574	176104-176127	4	0.833
LR130759_17	17.8|5329098|29|LR130759|CRT	5329098-5329126	29	MK291445	Paracoccus phage vB_PyeM_Pyei1, complete genome	41307-41335	4	0.862
LR130759_17	17.8|5329098|29|LR130759|CRT	5329098-5329126	29	NZ_LN832562	Paracoccus aminovorans isolate JCM7685 plasmid IV, complete sequence	330489-330517	4	0.862
LR130759_17	17.8|5329098|29|LR130759|CRT	5329098-5329126	29	KX987127	Thermus phage G20c, complete genome	50352-50380	4	0.862
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2210639-2210670	4	0.875
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NZ_CP029832	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence	156053-156084	4	0.875
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2210639-2210669	4	0.871
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP029832	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence	156054-156084	4	0.871
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	1266683-1266713	5	0.839
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	546852-546882	5	0.839
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP012477	Arthrobacter sp. ERGS1:01 isolate water plasmid unnamed2, complete sequence	427286-427316	5	0.839
LR130759_17	17.8|5329098|29|LR130759|CRT	5329098-5329126	29	KT001914	Caulobacter phage Seuss, complete genome	10291-10319	5	0.828
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP016613	Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence	543133-543163	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP021449	Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence	165765-165795	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP026091	Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence	121542-121572	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NC_014309	Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome	106769-106799	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	CP023013	Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence	85892-85922	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP021653	Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence	106125-106155	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP049790	Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence	109264-109294	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP049794	Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence	542385-542415	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP049788	Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence	1849474-1849504	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP022766	Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence	87212-87242	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP021763	Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence	144078-144108	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP026093	Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence	121542-121572	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP021767	Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence	106167-106197	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP015116	Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence	245948-245978	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP016555	Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence	1815725-1815755	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP012688	Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence	106125-106155	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP049792	Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence	323861-323891	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP052069	Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence	86895-86925	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP016915	Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence	704083-704113	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP016905	Ralstonia solanacearum strain KACC 10709 plasmid unnamed1	1125879-1125909	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	318551-318581	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP022769	Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence	88536-88566	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP015851	Ralstonia solanacearum strain YC40-M plasmid, complete sequence	295904-295934	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP022773	Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence	90996-91026	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP022783	Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence	85972-86002	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP022791	Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence	1922353-1922383	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP022795	Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence	85977-86007	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP052071	Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence	101958-101988	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP022482	Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence	997239-997269	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP009763	Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence	86835-86865	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	CP023015	Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence	85950-85980	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP022779	Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence	88554-88584	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP052075	Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence	101958-101988	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP052085	Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence	103664-103694	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP052095	Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence	86911-86941	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP052105	Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence	101958-101988	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP021765	Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence	144105-144135	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP052077	Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence	88708-88738	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP052087	Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence	103664-103694	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP052097	Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence	86911-86941	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	CP047139	Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence	46932-46962	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP052115	Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence	101958-101988	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP052127	Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence	103664-103694	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	CP047137	Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence	36351-36381	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP052079	Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence	88708-88738	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP052089	Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence	103664-103694	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP052093	Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence	86911-86941	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP052101	Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence	86911-86941	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP052099	Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence	86911-86941	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP052107	Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence	101958-101988	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP022781	Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence	88453-88483	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP052117	Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence	101958-101988	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP052125	Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence	88708-88738	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP022793	Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence	90997-91027	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP022785	Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence	90988-91018	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP022787	Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence	88431-88461	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP022756	Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence	89337-89367	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP052129	Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence	85733-85763	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP052121	Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence	101958-101988	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP052123	Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence	88708-88738	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP052131	Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence	103664-103694	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	CP011998	Ralstonia solanacearum strain YC45 plasmid, complete sequence	123192-123222	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP052073	Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence	101958-101988	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP052081	Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence	88708-88738	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP052083	Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence	88708-88738	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP052109	Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence	101958-101988	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP052091	Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence	86911-86941	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP052111	Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence	87286-87316	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP052103	Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence	101958-101988	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP052119	Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence	101958-101988	5	0.839
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP052113	Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence	87286-87316	5	0.839
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	1266683-1266713	5	0.839
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	546852-546882	5	0.839
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP012477	Arthrobacter sp. ERGS1:01 isolate water plasmid unnamed2, complete sequence	427286-427316	5	0.839
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP029832	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence	156054-156085	5	0.844
LR130759_2	2.1|587586|33|LR130759|CRISPRCasFinder	587586-587618	33	NZ_CP017563	Paraburkholderia sprentiae WSM5005 plasmid pl1WSM5005, complete sequence	697155-697187	6	0.818
LR130759_4	4.1|680629|33|LR130759|PILER-CR	680629-680661	33	MF417939	Uncultured Caudovirales phage clone 7S_2, partial genome	3617-3649	6	0.818
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NC_012586	Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence	2277007-2277037	6	0.806
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP010016	Burkholderia thailandensis 34 plasmid unnamed, complete sequence	179182-179212	6	0.806
LR130759_17	17.8|5329098|29|LR130759|CRT	5329098-5329126	29	NZ_CP018784	Curtobacterium pusillum strain AA3 plasmid pCPAA3, complete sequence	408183-408211	6	0.793
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NZ_LN832560	Paracoccus aminovorans isolate JCM7685 plasmid II, complete sequence	65569-65600	6	0.812
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NZ_AP022333	Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49a, complete sequence	190346-190377	6	0.812
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	MF668280	Mycobacterium phage Phabba, complete genome	85586-85617	6	0.812
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NC_023316	Streptomyces sp. 14R-10 plasmid pZL1, complete sequence	32783-32814	6	0.812
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NC_012586	Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence	2277006-2277037	6	0.812
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP012477	Arthrobacter sp. ERGS1:01 isolate water plasmid unnamed2, complete sequence	427286-427317	6	0.812
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_LN832560	Paracoccus aminovorans isolate JCM7685 plasmid II, complete sequence	65569-65599	6	0.806
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_AP022333	Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49a, complete sequence	190347-190377	6	0.806
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	MF668280	Mycobacterium phage Phabba, complete genome	85586-85616	6	0.806
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NC_023714	Mycobacterium phage LinStu, complete genome	80741-80771	6	0.806
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	GQ303262	Mycobacterium phage LRRHood, complete genome	80132-80162	6	0.806
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	MT889395	Mycobacterium phage Shifa, complete genome	79106-79136	6	0.806
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	MH910040	Mycobacterium phage Sauce, complete genome	79830-79860	6	0.806
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	MN062707	Mycobacterium phage Grungle, complete genome	77162-77192	6	0.806
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	KX831080	Mycobacterium phage Lukilu, complete genome	81142-81172	6	0.806
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NC_028869	Mycobacterium phage HyRo, complete genome	79840-79870	6	0.806
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	MF919513	Mycobacterium phage Koguma, complete genome	78324-78354	6	0.806
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	JN204348	Mycobacterium phage Sebata, complete genome	81299-81329	6	0.806
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	KX752698	Mycobacterium phage Tonenili, complete genome	83397-83427	6	0.806
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NC_023316	Streptomyces sp. 14R-10 plasmid pZL1, complete sequence	32783-32813	6	0.806
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP040824	Paraoceanicella profunda strain D4M1 plasmid pD4M1F, complete sequence	14685-14715	6	0.806
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP040824	Paraoceanicella profunda strain D4M1 plasmid pD4M1F, complete sequence	110897-110927	6	0.806
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP021820	Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence	1496624-1496654	6	0.806
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	MT936332	Streptomyces phage phiRKBJ001, complete genome	10261-10291	6	0.806
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NC_012586	Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence	2277007-2277037	6	0.806
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP010016	Burkholderia thailandensis 34 plasmid unnamed, complete sequence	179182-179212	6	0.806
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NC_023714	Mycobacterium phage LinStu, complete genome	80740-80771	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	GQ303262	Mycobacterium phage LRRHood, complete genome	80131-80162	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	MT889395	Mycobacterium phage Shifa, complete genome	79105-79136	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	MH910040	Mycobacterium phage Sauce, complete genome	79829-79860	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	MN062707	Mycobacterium phage Grungle, complete genome	77161-77192	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	KX831080	Mycobacterium phage Lukilu, complete genome	81141-81172	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NC_028869	Mycobacterium phage HyRo, complete genome	79839-79870	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	MF919513	Mycobacterium phage Koguma, complete genome	78323-78354	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	JN204348	Mycobacterium phage Sebata, complete genome	81298-81329	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	KX752698	Mycobacterium phage Tonenili, complete genome	83396-83427	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP016613	Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence	543133-543164	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP021449	Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence	165764-165795	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP026091	Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence	121541-121572	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NC_014309	Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome	106768-106799	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	CP023013	Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence	85891-85922	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP021653	Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence	106124-106155	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP049790	Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence	109263-109294	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP049794	Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence	542385-542416	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP049788	Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence	1849474-1849505	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP022766	Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence	87211-87242	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP021763	Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence	144077-144108	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP026093	Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence	121541-121572	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP021767	Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence	106166-106197	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP015116	Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence	245947-245978	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP016555	Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence	1815724-1815755	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP012688	Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence	106124-106155	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP049792	Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence	323861-323892	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP052069	Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence	86894-86925	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP016915	Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence	704082-704113	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP016905	Ralstonia solanacearum strain KACC 10709 plasmid unnamed1	1125878-1125909	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	318550-318581	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP022769	Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence	88535-88566	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP015851	Ralstonia solanacearum strain YC40-M plasmid, complete sequence	295904-295935	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP022773	Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence	90995-91026	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP022783	Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence	85971-86002	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP022791	Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence	1922353-1922384	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP022795	Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence	85976-86007	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP052071	Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence	101957-101988	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP022482	Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence	997239-997270	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP009763	Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence	86834-86865	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	CP023015	Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence	85949-85980	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP022779	Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence	88553-88584	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP052075	Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence	101957-101988	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP052085	Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence	103663-103694	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP052095	Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence	86910-86941	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP052105	Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence	101957-101988	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP021765	Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence	144104-144135	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP052077	Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence	88707-88738	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP052087	Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence	103663-103694	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP052097	Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence	86910-86941	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	CP047139	Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence	46932-46963	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP052115	Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence	101957-101988	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP052127	Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence	103663-103694	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	CP047137	Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence	36351-36382	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP052079	Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence	88707-88738	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP052089	Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence	103663-103694	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP052093	Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence	86910-86941	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP052101	Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence	86910-86941	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP052099	Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence	86910-86941	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP052107	Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence	101957-101988	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP022781	Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence	88452-88483	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP052117	Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence	101957-101988	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP052125	Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence	88707-88738	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP022793	Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence	90996-91027	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP022785	Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence	90987-91018	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP022787	Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence	88430-88461	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP022756	Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence	89336-89367	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP052129	Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence	85732-85763	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP052121	Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence	101957-101988	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP052123	Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence	88707-88738	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP052131	Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence	103663-103694	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	CP011998	Ralstonia solanacearum strain YC45 plasmid, complete sequence	123191-123222	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP052073	Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence	101957-101988	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP052081	Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence	88707-88738	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP052083	Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence	88707-88738	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP052109	Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence	101957-101988	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP052091	Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence	86910-86941	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP052111	Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence	87285-87316	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP052103	Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence	101957-101988	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP052119	Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence	101957-101988	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP052113	Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence	87285-87316	6	0.812
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	MT936332	Streptomyces phage phiRKBJ001, complete genome	10260-10291	6	0.812
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP010016	Burkholderia thailandensis 34 plasmid unnamed, complete sequence	179182-179213	6	0.812
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	1266683-1266714	6	0.812
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	546851-546882	6	0.812
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP012477	Arthrobacter sp. ERGS1:01 isolate water plasmid unnamed2, complete sequence	427285-427316	6	0.812
LR130759_21	21.1|5588868|30|LR130759|CRISPRCasFinder	5588868-5588897	30	NZ_CP013256	Kocuria flava strain HO-9041 plasmid 2, complete sequence	755-784	6	0.8
LR130759_1	1.4|586584|33|LR130759|CRISPRCasFinder	586584-586616	33	AP018698	Arthrobacter sp. MN05-02 plasmid plasmid1 DNA, complete genome	116806-116838	7	0.788
LR130759_1	1.4|586584|33|LR130759|CRISPRCasFinder	586584-586616	33	NC_011984	Agrobacterium vitis S4 plasmid pAtS4c, complete sequence	195085-195117	7	0.788
LR130759_2	2.1|587586|33|LR130759|CRISPRCasFinder	587586-587618	33	NZ_CP013255	Kocuria flava strain HO-9041 plasmid 1, complete sequence	50167-50199	7	0.788
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP031163	Deinococcus wulumuqiensis strain NEB 479 plasmid pDrdI, complete sequence	386342-386372	7	0.774
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP017294	Pseudomonas aeruginosa strain PA83 plasmid unnamed1, complete sequence	329716-329746	7	0.774
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NC_013857	Azospirillum sp. B510 plasmid pAB510c, complete sequence	413470-413500	7	0.774
LR130759_17	17.8|5329098|29|LR130759|CRT	5329098-5329126	29	AF428260	Propionibacterium phage phiB5, complete genome	2523-2551	7	0.759
LR130759_17	17.8|5329098|29|LR130759|CRT	5329098-5329126	29	NC_003460	Propionibacterium phage B5, complete genome	2523-2551	7	0.759
LR130759_17	17.8|5329098|29|LR130759|CRT	5329098-5329126	29	NC_023284	Streptomyces sp. F2 plasmid pFRL4, complete sequence	316505-316533	7	0.759
LR130759_17	17.8|5329098|29|LR130759|CRT	5329098-5329126	29	NZ_CP009216	Corynebacterium ureicelerivorans strain IMMIB RIV-2301 plasmid unnamed, complete sequence	44037-44065	7	0.759
LR130759_17	17.8|5329098|29|LR130759|CRT	5329098-5329126	29	NC_017805	Deinococcus gobiensis I-0 plasmid P1, complete sequence	2877-2905	7	0.759
LR130759_17	17.8|5329098|29|LR130759|CRT	5329098-5329126	29	NZ_CP047178	Rathayibacter sp. VKM Ac-2759 plasmid unnamed2, complete sequence	45609-45637	7	0.759
LR130759_17	17.8|5329098|29|LR130759|CRT	5329098-5329126	29	NC_023286	Streptomyces sp. F12 plasmid pFRL6, complete sequence	171770-171798	7	0.759
LR130759_17	17.8|5329098|29|LR130759|CRT	5329098-5329126	29	NC_023283	Streptomyces sp. FR1 plasmid pFRL3, complete sequence	238953-238981	7	0.759
LR130759_17	17.8|5329098|29|LR130759|CRT	5329098-5329126	29	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	1173401-1173429	7	0.759
LR130759_17	17.8|5329098|29|LR130759|CRT	5329098-5329126	29	NC_016587	Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence	118063-118091	7	0.759
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NC_023714	Mycobacterium phage LinStu, complete genome	80741-80772	7	0.781
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	GQ303262	Mycobacterium phage LRRHood, complete genome	80132-80163	7	0.781
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	MT889395	Mycobacterium phage Shifa, complete genome	79106-79137	7	0.781
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	MH910040	Mycobacterium phage Sauce, complete genome	79830-79861	7	0.781
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	MN062707	Mycobacterium phage Grungle, complete genome	77162-77193	7	0.781
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	KX831080	Mycobacterium phage Lukilu, complete genome	81142-81173	7	0.781
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NC_028869	Mycobacterium phage HyRo, complete genome	79840-79871	7	0.781
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	MF919513	Mycobacterium phage Koguma, complete genome	78324-78355	7	0.781
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	JN204348	Mycobacterium phage Sebata, complete genome	81299-81330	7	0.781
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	KX752698	Mycobacterium phage Tonenili, complete genome	83397-83428	7	0.781
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NZ_AP022571	Mycolicibacterium poriferae strain JCM 12603 plasmid pJCM12603, complete sequence	68732-68763	7	0.781
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NZ_CP020445	Paracoccus yeei strain FDAARGOS_252 plasmid unnamed5, complete sequence	101686-101717	7	0.781
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NZ_CP044079	Paracoccus yeei strain FDAARGOS_643 plasmid unnamed2, complete sequence	115565-115596	7	0.781
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NZ_CP031079	Paracoccus yeei strain CCUG 32053 plasmid pYEE1, complete sequence	305781-305812	7	0.781
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NZ_CP040824	Paraoceanicella profunda strain D4M1 plasmid pD4M1F, complete sequence	14684-14715	7	0.781
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NZ_CP040824	Paraoceanicella profunda strain D4M1 plasmid pD4M1F, complete sequence	110896-110927	7	0.781
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NZ_CP022760	Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence	601709-601740	7	0.781
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NZ_CP022789	Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence	601699-601730	7	0.781
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NZ_CP033582	Streptomyces sp. ADI95-16 plasmid pADI95-16a, complete sequence	182011-182042	7	0.781
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NZ_CP033582	Streptomyces sp. ADI95-16 plasmid pADI95-16a, complete sequence	470435-470466	7	0.781
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NZ_CP053207	Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1C, complete sequence	375823-375854	7	0.781
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NZ_CP022775	Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence	708509-708540	7	0.781
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NZ_CP022762	Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence	603795-603826	7	0.781
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NZ_CP045122	Rubrobacter sp. SCSIO 52915 plasmid unnamed1, complete sequence	164978-165009	7	0.781
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NZ_CP015065	Mesorhizobium ciceri biovar biserrulae strain WSM1284 plasmid pMc1284, complete sequence	103982-104013	7	0.781
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NZ_CP015063	Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence	126931-126962	7	0.781
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NZ_CP023017	Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence	662683-662714	7	0.781
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP022775	Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence	724893-724924	7	0.781
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NC_014310	Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence	716425-716456	7	0.781
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP022762	Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence	620181-620212	7	0.781
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP023017	Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence	685840-685871	7	0.781
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP014703	Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence	619296-619327	7	0.781
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP022760	Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence	617087-617118	7	0.781
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP022789	Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence	617077-617108	7	0.781
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP022771	Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence	620169-620200	7	0.781
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP022777	Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence	620187-620218	7	0.781
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP022799	Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence	620166-620197	7	0.781
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP022764	Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence	724957-724988	7	0.781
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP022797	Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence	724957-724988	7	0.781
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP022758	Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence	724943-724974	7	0.781
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP017947	Bosea sp. Tri-49 plasmid unnamed1, complete sequence	191035-191065	7	0.774
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP016083	Streptomyces sp. SAT1 plasmid unnamed3, complete sequence	624255-624285	7	0.774
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_LR134451	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 9, complete sequence	40360-40390	7	0.774
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	675864-675894	7	0.774
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_AP022571	Mycolicibacterium poriferae strain JCM 12603 plasmid pJCM12603, complete sequence	68732-68762	7	0.774
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP020445	Paracoccus yeei strain FDAARGOS_252 plasmid unnamed5, complete sequence	101686-101716	7	0.774
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP054621	Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence	109562-109592	7	0.774
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP044079	Paracoccus yeei strain FDAARGOS_643 plasmid unnamed2, complete sequence	115565-115595	7	0.774
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP031079	Paracoccus yeei strain CCUG 32053 plasmid pYEE1, complete sequence	305782-305812	7	0.774
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NC_016624	Azospirillum lipoferum 4B plasmid AZO_p5, complete sequence	36904-36934	7	0.774
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP023064	Sinorhizobium sp. CCBAU 05631 plasmid pSS05631b, complete sequence	45541-45571	7	0.774
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP021082	Deinococcus ficus strain CC-FR2-10 plasmid pDFI1, complete sequence	316126-316156	7	0.774
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP053207	Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1C, complete sequence	375823-375853	7	0.774
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	MT553347	Mycobacterium phage Awesomesauce, complete genome	21056-21086	7	0.774
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	MH020243	Mycobacterium phage TootsiePop, complete genome	21061-21091	7	0.774
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	MH020242	Mycobacterium phage Misha28, complete genome	21061-21091	7	0.774
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	MK494120	Mycobacterium phage Piper2020, complete genome	21058-21088	7	0.774
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP031163	Deinococcus wulumuqiensis strain NEB 479 plasmid pDrdI, complete sequence	386342-386372	7	0.774
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP017294	Pseudomonas aeruginosa strain PA83 plasmid unnamed1, complete sequence	329716-329746	7	0.774
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NC_013857	Azospirillum sp. B510 plasmid pAB510c, complete sequence	413470-413500	7	0.774
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_LN832560	Paracoccus aminovorans isolate JCM7685 plasmid II, complete sequence	65568-65599	7	0.781
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_AP022333	Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49a, complete sequence	190347-190378	7	0.781
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	MF668280	Mycobacterium phage Phabba, complete genome	85585-85616	7	0.781
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP017947	Bosea sp. Tri-49 plasmid unnamed1, complete sequence	191034-191065	7	0.781
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NC_023316	Streptomyces sp. 14R-10 plasmid pZL1, complete sequence	32782-32813	7	0.781
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP040824	Paraoceanicella profunda strain D4M1 plasmid pD4M1F, complete sequence	14685-14716	7	0.781
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP040824	Paraoceanicella profunda strain D4M1 plasmid pD4M1F, complete sequence	110897-110928	7	0.781
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NC_023286	Streptomyces sp. F12 plasmid pFRL6, complete sequence	280181-280212	7	0.781
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NC_016624	Azospirillum lipoferum 4B plasmid AZO_p5, complete sequence	36904-36935	7	0.781
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NC_012586	Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence	2277007-2277038	7	0.781
LR130759_20	20.1|5490160|31|LR130759|CRISPRCasFinder	5490160-5490190	31	NZ_CP021071	Mesorhizobium sp. WSM1497 plasmid pWSM1497, complete sequence	151413-151443	7	0.774
LR130759_20	20.1|5490160|31|LR130759|CRISPRCasFinder	5490160-5490190	31	NZ_CP015065	Mesorhizobium ciceri biovar biserrulae strain WSM1284 plasmid pMc1284, complete sequence	181746-181776	7	0.774
LR130759_20	20.1|5490160|31|LR130759|CRISPRCasFinder	5490160-5490190	31	NZ_CP015063	Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence	199452-199482	7	0.774
LR130759_20	20.1|5490160|31|LR130759|CRISPRCasFinder	5490160-5490190	31	NZ_CP015420	Rhodovulum sulfidophilum DSM 1374 plasmid unnamed2, complete sequence	75990-76020	7	0.774
LR130759_20	20.1|5490160|31|LR130759|CRISPRCasFinder	5490160-5490190	31	NC_014918	Mesorhizobium ciceri biovar biserrulae WSM1271 plasmid pMESCI01, complete sequence	338692-338722	7	0.774
LR130759_20	20.2|5490220|31|LR130759|CRISPRCasFinder	5490220-5490250	31	NZ_CP042500	Enterobacter sp. E76 plasmid pE76_001, complete sequence	41464-41494	7	0.774
LR130759_2	2.1|587586|33|LR130759|CRISPRCasFinder	587586-587618	33	MT522006	Gordonia phage BBQValindra, complete genome	11578-11610	8	0.758
LR130759_2	2.1|587586|33|LR130759|CRISPRCasFinder	587586-587618	33	NC_010399	Clavibacter michiganensis subsp. sepedonicus plasmid pCS1, complete sequence	50312-50344	8	0.758
LR130759_5	5.1|1423971|33|LR130759|CRISPRCasFinder	1423971-1424003	33	MN204493	Streptomyces phage Zuko, complete genome	59030-59062	8	0.758
LR130759_8	8.17|3078734|34|LR130759|CRT	3078734-3078767	34	NZ_CP045074	Paracoccus kondratievae strain BJQ0001 plasmid unnamed1, complete sequence	128442-128475	8	0.765
LR130759_17	17.1|5328876|31|LR130759|CRT	5328876-5328906	31	NZ_CP032349	Azospirillum brasilense strain MTCC4039 plasmid p3, complete sequence	236853-236883	8	0.742
LR130759_17	17.1|5328876|31|LR130759|CRT	5328876-5328906	31	NZ_CP012918	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p4, complete sequence	54384-54414	8	0.742
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP050092	Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b6, complete sequence	782145-782175	8	0.742
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP050104	Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b2, complete sequence	206518-206548	8	0.742
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP016287	Rhizobium leguminosarum strain Vaf10 plasmid unnamed1, complete sequence	617446-617476	8	0.742
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP050109	Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b2, complete sequence	206518-206548	8	0.742
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP048281	Rhizobium leguminosarum bv. viciae 248 plasmid pRle248e, complete sequence	688245-688275	8	0.742
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NC_015727	Cupriavidus necator N-1 plasmid pBB1, complete sequence	623336-623366	8	0.742
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	500598-500628	8	0.742
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP021119	Streptomyces sp. CLI2509 strain CLI2905 plasmid unnamed1, complete sequence	100757-100787	8	0.742
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	MH371116	Mycobacterium phage DMoney, complete genome	23373-23403	8	0.742
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	MH045569	Mycobacterium phage Schiebel, complete genome	23373-23403	8	0.742
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	MH371119	Mycobacterium phage OctaviousRex, complete genome	23373-23403	8	0.742
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	MF919497	Mycobacterium phage Chance64, complete genome	23373-23403	8	0.742
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	MH001456	Mycobacterium phage CLED96, complete genome	23373-23403	8	0.742
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	GQ303261	Mycobacterium phage Hope, complete genome	23373-23403	8	0.742
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	MG099946	Mycobacterium phage LouisV14, complete genome	23373-23403	8	0.742
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	KC787112	Mycobacterium phage Clark, partial genome	22404-22434	8	0.742
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	MH779513	Mycobacterium phage Olga, complete genome	23373-23403	8	0.742
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	MK919475	Mycobacterium phage Camri, complete genome	23373-23403	8	0.742
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	MK310146	Mycobacterium phage Crespo, complete genome	23374-23404	8	0.742
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	MK524493	Mycobacterium phage Darionha, complete genome	23373-23403	8	0.742
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	MH779505	Mycobacterium phage Grizzly, complete genome	23377-23407	8	0.742
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	EU568876	Mycobacterium phage BPs, complete genome	23373-23403	8	0.742
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	KC787107	Mycobacterium phage Bo4, complete genome	16178-16208	8	0.742
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	MF668268	Mycobacterium phage Aroostook, complete genome	23373-23403	8	0.742
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	KX588251	Mycobacterium phage Jane, complete genome	23373-23403	8	0.742
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	KC787103	Mycobacterium phage Chy2, partial genome	21879-21909	8	0.742
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	MH001455	Mycobacterium phage Remy19, complete genome	23373-23403	8	0.742
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	KT355472	Mycobacterium phage Cedasite, complete genome	23373-23403	8	0.742
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	KX664455	Mycobacterium phage Zombie, complete genome	23373-23403	8	0.742
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	MH077584	Mycobacterium phage Phish, complete genome	23373-23403	8	0.742
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	KC787108	Mycobacterium phage DNAIII, complete genome	23124-23154	8	0.742
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	MN444875	Mycobacterium phage Jonghyun, complete genome	23373-23403	8	0.742
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	MK433279	Mycobacterium phage Kareem, complete genome	23373-23403	8	0.742
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	KJ725374	Mycobacterium phage Guo1, complete genome	10706-10736	8	0.742
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	MT818422	Mycobacterium phage Periodt, complete genome	23373-23403	8	0.742
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	MK305884	Mycobacterium phage BQuat, complete genome	23364-23394	8	0.742
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	MF668272	Mycobacterium phage Gideon, complete genome	23373-23403	8	0.742
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	MH779515	Mycobacterium phage Sweets, complete genome	23368-23398	8	0.742
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	MW119570	Mycobacterium phage Lang, complete genome	23447-23477	8	0.742
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	KC787111	Mycobacterium phage Sedge, partial genome	23055-23085	8	0.742
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	MF612073	Klebsiella phage SopranoGao, complete genome	36154-36184	8	0.742
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	KC787104	Mycobacterium phage Chy3, partial genome	23494-23524	8	0.742
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NC_012788	Mycobacterium phage Angel, complete genome	23373-23403	8	0.742
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	KX443326	Mycobacterium phage BruceB, complete genome	23373-23403	8	0.742
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	MK433277	Mycobacterium phage Renaissance, complete genome	23373-23403	8	0.742
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	MH590605	Mycobacterium phage Cherrybomb426, complete genome	23373-23403	8	0.742
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	MH779509	Mycobacterium phage Kasen3, complete genome	23374-23404	8	0.742
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	JN699002	Mycobacterium phage Avrafan, complete genome	23373-23403	8	0.742
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	MH779507	Mycobacterium phage Hotshotbaby7, complete genome	23373-23403	8	0.742
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	KT355474	Mycobacterium phage Frosty24, complete genome	23373-23403	8	0.742
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	KC787109	Mycobacterium phage Legendre, partial genome	17594-17624	8	0.742
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	JN412593	Mycobacterium phage Liefie, complete genome	23372-23402	8	0.742
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	MH479920	Mycobacterium phage Mowgli, complete genome	23373-23403	8	0.742
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NC_008202	Mycobacterium phage Halo, complete genome	23368-23398	8	0.742
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	KM923970	Mycobacterium phage Gomashi, complete genome	23374-23404	8	0.742
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	MH450127	Mycobacterium phage Plagueis, complete genome	23208-23238	8	0.742
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	KT347314	Mycobacterium phage Phreak, complete genome	23373-23403	8	0.742
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	KT365399	Mycobacterium phage Annihilator, complete genome	23364-23394	8	0.742
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	KC787110	Mycobacterium phage Leo, complete genome	23131-23161	8	0.742
LR130759_17	17.8|5329098|29|LR130759|CRT	5329098-5329126	29	NZ_LR134447	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 5, complete sequence	144478-144506	8	0.724
LR130759_17	17.8|5329098|29|LR130759|CRT	5329098-5329126	29	CP021131	Meiothermus taiwanensis strain WR-220 plasmid pMtWR-220, complete sequence	144279-144307	8	0.724
LR130759_17	17.8|5329098|29|LR130759|CRT	5329098-5329126	29	NZ_CP025613	Niveispirillum cyanobacteriorum strain TH16 plasmid unnamed1, complete sequence	354586-354614	8	0.724
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NZ_CP017947	Bosea sp. Tri-49 plasmid unnamed1, complete sequence	191035-191066	8	0.75
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NC_014310	Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence	701047-701078	8	0.75
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	675864-675895	8	0.75
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NZ_CP018236	Rhizobium leguminosarum strain Vaf-108 plasmid unnamed8	82406-82437	8	0.75
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	504298-504329	8	0.75
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	1308771-1308802	8	0.75
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NZ_CP020331	Martelella mediterranea DSM 17316 strain MACL11 plasmid pMM593, complete sequence	395568-395599	8	0.75
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NZ_CP010858	Marinovum algicola DG 898 plasmid pMaD3	33036-33067	8	0.75
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NZ_CP045074	Paracoccus kondratievae strain BJQ0001 plasmid unnamed1, complete sequence	94887-94918	8	0.75
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NZ_AP017899	Sphingopyxis sp. FD7 plasmid pSFD01, complete sequence	230527-230558	8	0.75
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NC_016624	Azospirillum lipoferum 4B plasmid AZO_p5, complete sequence	36903-36934	8	0.75
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP050092	Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b6, complete sequence	782145-782176	8	0.75
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP050104	Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b2, complete sequence	206518-206549	8	0.75
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP016287	Rhizobium leguminosarum strain Vaf10 plasmid unnamed1, complete sequence	617445-617476	8	0.75
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP050109	Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b2, complete sequence	206518-206549	8	0.75
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP048281	Rhizobium leguminosarum bv. viciae 248 plasmid pRle248e, complete sequence	688245-688276	8	0.75
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP031163	Deinococcus wulumuqiensis strain NEB 479 plasmid pDrdI, complete sequence	386341-386372	8	0.75
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NC_015727	Cupriavidus necator N-1 plasmid pBB1, complete sequence	623336-623367	8	0.75
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP017294	Pseudomonas aeruginosa strain PA83 plasmid unnamed1, complete sequence	329715-329746	8	0.75
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NC_013857	Azospirillum sp. B510 plasmid pAB510c, complete sequence	413470-413501	8	0.75
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP021119	Streptomyces sp. CLI2509 strain CLI2905 plasmid unnamed1, complete sequence	100756-100787	8	0.75
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	MH371116	Mycobacterium phage DMoney, complete genome	23373-23404	8	0.75
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	MH045569	Mycobacterium phage Schiebel, complete genome	23373-23404	8	0.75
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	MH371119	Mycobacterium phage OctaviousRex, complete genome	23373-23404	8	0.75
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	MF919497	Mycobacterium phage Chance64, complete genome	23373-23404	8	0.75
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	MH001456	Mycobacterium phage CLED96, complete genome	23373-23404	8	0.75
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	GQ303261	Mycobacterium phage Hope, complete genome	23373-23404	8	0.75
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	MG099946	Mycobacterium phage LouisV14, complete genome	23373-23404	8	0.75
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	KC787112	Mycobacterium phage Clark, partial genome	22404-22435	8	0.75
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	MH779513	Mycobacterium phage Olga, complete genome	23373-23404	8	0.75
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	MK919475	Mycobacterium phage Camri, complete genome	23373-23404	8	0.75
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	MK310146	Mycobacterium phage Crespo, complete genome	23374-23405	8	0.75
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	MK524493	Mycobacterium phage Darionha, complete genome	23373-23404	8	0.75
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	MH779505	Mycobacterium phage Grizzly, complete genome	23377-23408	8	0.75
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	EU568876	Mycobacterium phage BPs, complete genome	23373-23404	8	0.75
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	KC787107	Mycobacterium phage Bo4, complete genome	16177-16208	8	0.75
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	MF668268	Mycobacterium phage Aroostook, complete genome	23373-23404	8	0.75
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	KX588251	Mycobacterium phage Jane, complete genome	23373-23404	8	0.75
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	KC787103	Mycobacterium phage Chy2, partial genome	21879-21910	8	0.75
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	MH001455	Mycobacterium phage Remy19, complete genome	23373-23404	8	0.75
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	KT355472	Mycobacterium phage Cedasite, complete genome	23373-23404	8	0.75
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	KX664455	Mycobacterium phage Zombie, complete genome	23373-23404	8	0.75
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	MH077584	Mycobacterium phage Phish, complete genome	23373-23404	8	0.75
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	KC787108	Mycobacterium phage DNAIII, complete genome	23124-23155	8	0.75
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	MN444875	Mycobacterium phage Jonghyun, complete genome	23373-23404	8	0.75
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	MK433279	Mycobacterium phage Kareem, complete genome	23373-23404	8	0.75
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	KJ725374	Mycobacterium phage Guo1, complete genome	10705-10736	8	0.75
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	MT818422	Mycobacterium phage Periodt, complete genome	23373-23404	8	0.75
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	MK305884	Mycobacterium phage BQuat, complete genome	23364-23395	8	0.75
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	MF668272	Mycobacterium phage Gideon, complete genome	23373-23404	8	0.75
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	MH779515	Mycobacterium phage Sweets, complete genome	23368-23399	8	0.75
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	MW119570	Mycobacterium phage Lang, complete genome	23447-23478	8	0.75
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	KC787111	Mycobacterium phage Sedge, partial genome	23055-23086	8	0.75
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	KC787104	Mycobacterium phage Chy3, partial genome	23494-23525	8	0.75
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NC_012788	Mycobacterium phage Angel, complete genome	23373-23404	8	0.75
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	KX443326	Mycobacterium phage BruceB, complete genome	23373-23404	8	0.75
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	MK433277	Mycobacterium phage Renaissance, complete genome	23373-23404	8	0.75
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	MH590605	Mycobacterium phage Cherrybomb426, complete genome	23373-23404	8	0.75
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	MH779509	Mycobacterium phage Kasen3, complete genome	23374-23405	8	0.75
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	JN699002	Mycobacterium phage Avrafan, complete genome	23373-23404	8	0.75
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	MH779507	Mycobacterium phage Hotshotbaby7, complete genome	23373-23404	8	0.75
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	KT355474	Mycobacterium phage Frosty24, complete genome	23373-23404	8	0.75
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	KC787109	Mycobacterium phage Legendre, partial genome	17593-17624	8	0.75
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	JN412593	Mycobacterium phage Liefie, complete genome	23372-23403	8	0.75
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	MH479920	Mycobacterium phage Mowgli, complete genome	23373-23404	8	0.75
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NC_008202	Mycobacterium phage Halo, complete genome	23368-23399	8	0.75
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	KM923970	Mycobacterium phage Gomashi, complete genome	23374-23405	8	0.75
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	MH450127	Mycobacterium phage Plagueis, complete genome	23208-23239	8	0.75
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	KT347314	Mycobacterium phage Phreak, complete genome	23373-23404	8	0.75
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	KT365399	Mycobacterium phage Annihilator, complete genome	23364-23395	8	0.75
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	KC787110	Mycobacterium phage Leo, complete genome	23131-23162	8	0.75
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_LR134445	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 3, complete sequence	137-167	8	0.742
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP007130	Gemmatirosa kalamazoonesis strain KBS708 plasmid 2, complete sequence	892943-892973	8	0.742
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NC_018022	Mycolicibacterium chubuense NBB4 plasmid pMYCCH.01, complete sequence	447955-447985	8	0.742
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP018236	Rhizobium leguminosarum strain Vaf-108 plasmid unnamed8	82406-82436	8	0.742
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	504298-504328	8	0.742
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	1308772-1308802	8	0.742
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP021820	Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence	1052670-1052700	8	0.742
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP010858	Marinovum algicola DG 898 plasmid pMaD3	33037-33067	8	0.742
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NC_019849	Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence	714982-715012	8	0.742
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NC_003078	Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence	1021724-1021754	8	0.742
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_LR134456	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 14, complete sequence	170162-170192	8	0.742
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NC_023497	Amycolatopsis keratiniphila plasmid pXL100, complete sequence	10727-10757	8	0.742
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP019586	Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence	990557-990587	8	0.742
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NC_017326	Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence	700437-700467	8	0.742
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP021799	Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence	1087944-1087974	8	0.742
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP008954	Amycolatopsis japonica strain DSM 44213 plasmid pAmyja1, complete sequence	16722-16752	8	0.742
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NC_017323	Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence	296882-296912	8	0.742
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NC_023286	Streptomyces sp. F12 plasmid pFRL6, complete sequence	280181-280211	8	0.742
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP009146	Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence	708685-708715	8	0.742
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NC_018701	Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence	698186-698216	8	0.742
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP021828	Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence	592469-592499	8	0.742
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP012399	Chelatococcus sp. CO-6 plasmid pCO-6, complete sequence	670675-670705	8	0.742
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP021802	Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence	1366393-1366423	8	0.742
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP021831	Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence	959933-959963	8	0.742
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP021823	Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence	709351-709381	8	0.742
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP021814	Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence	622070-622100	8	0.742
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP021795	Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence	228808-228838	8	0.742
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP021810	Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence	1487160-1487190	8	0.742
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP021806	Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence	309103-309133	8	0.742
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP021218	Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence	859801-859831	8	0.742
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP026527	Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence	721515-721545	8	0.742
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP019484	Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence	1161695-1161725	8	0.742
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP019487	Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence	935088-935118	8	0.742
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NC_020560	Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence	1021727-1021757	8	0.742
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	KY092482	Streptomyces phage Mojorita, complete genome	5752-5782	8	0.742
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	KY092480	Streptomyces phage Picard, complete genome	5752-5782	8	0.742
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP050092	Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b6, complete sequence	782145-782175	8	0.742
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP050104	Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b2, complete sequence	206518-206548	8	0.742
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP016287	Rhizobium leguminosarum strain Vaf10 plasmid unnamed1, complete sequence	617446-617476	8	0.742
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP050109	Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b2, complete sequence	206518-206548	8	0.742
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP048281	Rhizobium leguminosarum bv. viciae 248 plasmid pRle248e, complete sequence	688245-688275	8	0.742
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NC_015727	Cupriavidus necator N-1 plasmid pBB1, complete sequence	623336-623366	8	0.742
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	500598-500628	8	0.742
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP021119	Streptomyces sp. CLI2509 strain CLI2905 plasmid unnamed1, complete sequence	100757-100787	8	0.742
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	MH371116	Mycobacterium phage DMoney, complete genome	23373-23403	8	0.742
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	MH045569	Mycobacterium phage Schiebel, complete genome	23373-23403	8	0.742
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	MH371119	Mycobacterium phage OctaviousRex, complete genome	23373-23403	8	0.742
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	MF919497	Mycobacterium phage Chance64, complete genome	23373-23403	8	0.742
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	MH001456	Mycobacterium phage CLED96, complete genome	23373-23403	8	0.742
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	GQ303261	Mycobacterium phage Hope, complete genome	23373-23403	8	0.742
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	MG099946	Mycobacterium phage LouisV14, complete genome	23373-23403	8	0.742
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	KC787112	Mycobacterium phage Clark, partial genome	22404-22434	8	0.742
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	MH779513	Mycobacterium phage Olga, complete genome	23373-23403	8	0.742
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	MK919475	Mycobacterium phage Camri, complete genome	23373-23403	8	0.742
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	MK310146	Mycobacterium phage Crespo, complete genome	23374-23404	8	0.742
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	MK524493	Mycobacterium phage Darionha, complete genome	23373-23403	8	0.742
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	MH779505	Mycobacterium phage Grizzly, complete genome	23377-23407	8	0.742
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	EU568876	Mycobacterium phage BPs, complete genome	23373-23403	8	0.742
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	KC787107	Mycobacterium phage Bo4, complete genome	16178-16208	8	0.742
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	MF668268	Mycobacterium phage Aroostook, complete genome	23373-23403	8	0.742
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	KX588251	Mycobacterium phage Jane, complete genome	23373-23403	8	0.742
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	KC787103	Mycobacterium phage Chy2, partial genome	21879-21909	8	0.742
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	MH001455	Mycobacterium phage Remy19, complete genome	23373-23403	8	0.742
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	KT355472	Mycobacterium phage Cedasite, complete genome	23373-23403	8	0.742
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	KX664455	Mycobacterium phage Zombie, complete genome	23373-23403	8	0.742
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	MH077584	Mycobacterium phage Phish, complete genome	23373-23403	8	0.742
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	KC787108	Mycobacterium phage DNAIII, complete genome	23124-23154	8	0.742
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	MN444875	Mycobacterium phage Jonghyun, complete genome	23373-23403	8	0.742
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	MK433279	Mycobacterium phage Kareem, complete genome	23373-23403	8	0.742
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	KJ725374	Mycobacterium phage Guo1, complete genome	10706-10736	8	0.742
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	MT818422	Mycobacterium phage Periodt, complete genome	23373-23403	8	0.742
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	MK305884	Mycobacterium phage BQuat, complete genome	23364-23394	8	0.742
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	MF668272	Mycobacterium phage Gideon, complete genome	23373-23403	8	0.742
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	MH779515	Mycobacterium phage Sweets, complete genome	23368-23398	8	0.742
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	MW119570	Mycobacterium phage Lang, complete genome	23447-23477	8	0.742
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	KC787111	Mycobacterium phage Sedge, partial genome	23055-23085	8	0.742
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	MF612073	Klebsiella phage SopranoGao, complete genome	36154-36184	8	0.742
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	KC787104	Mycobacterium phage Chy3, partial genome	23494-23524	8	0.742
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NC_012788	Mycobacterium phage Angel, complete genome	23373-23403	8	0.742
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	KX443326	Mycobacterium phage BruceB, complete genome	23373-23403	8	0.742
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	MK433277	Mycobacterium phage Renaissance, complete genome	23373-23403	8	0.742
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	MH590605	Mycobacterium phage Cherrybomb426, complete genome	23373-23403	8	0.742
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	MH779509	Mycobacterium phage Kasen3, complete genome	23374-23404	8	0.742
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	JN699002	Mycobacterium phage Avrafan, complete genome	23373-23403	8	0.742
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	MH779507	Mycobacterium phage Hotshotbaby7, complete genome	23373-23403	8	0.742
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	KT355474	Mycobacterium phage Frosty24, complete genome	23373-23403	8	0.742
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	KC787109	Mycobacterium phage Legendre, partial genome	17594-17624	8	0.742
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	JN412593	Mycobacterium phage Liefie, complete genome	23372-23402	8	0.742
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	MH479920	Mycobacterium phage Mowgli, complete genome	23373-23403	8	0.742
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NC_008202	Mycobacterium phage Halo, complete genome	23368-23398	8	0.742
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	KM923970	Mycobacterium phage Gomashi, complete genome	23374-23404	8	0.742
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	MH450127	Mycobacterium phage Plagueis, complete genome	23208-23238	8	0.742
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	KT347314	Mycobacterium phage Phreak, complete genome	23373-23403	8	0.742
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	KT365399	Mycobacterium phage Annihilator, complete genome	23364-23394	8	0.742
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	KC787110	Mycobacterium phage Leo, complete genome	23131-23161	8	0.742
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	675863-675894	8	0.75
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP021820	Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence	1052670-1052701	8	0.75
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP010858	Marinovum algicola DG 898 plasmid pMaD3	33037-33068	8	0.75
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NC_019849	Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence	714982-715013	8	0.75
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NC_003078	Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence	1021723-1021754	8	0.75
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NC_023497	Amycolatopsis keratiniphila plasmid pXL100, complete sequence	10726-10757	8	0.75
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP019586	Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence	990556-990587	8	0.75
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NC_017326	Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence	700437-700468	8	0.75
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP021799	Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence	1087943-1087974	8	0.75
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NC_017323	Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence	296882-296913	8	0.75
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP009146	Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence	708685-708716	8	0.75
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NC_018701	Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence	698186-698217	8	0.75
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP021828	Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence	592468-592499	8	0.75
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP021802	Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence	1366393-1366424	8	0.75
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP021831	Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence	959933-959964	8	0.75
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP021823	Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence	709350-709381	8	0.75
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP021814	Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence	622070-622101	8	0.75
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP021795	Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence	228807-228838	8	0.75
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP021810	Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence	1487160-1487191	8	0.75
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP021806	Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence	309102-309133	8	0.75
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP021218	Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence	859801-859832	8	0.75
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP026527	Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence	721515-721546	8	0.75
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP023064	Sinorhizobium sp. CCBAU 05631 plasmid pSS05631b, complete sequence	45540-45571	8	0.75
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP021082	Deinococcus ficus strain CC-FR2-10 plasmid pDFI1, complete sequence	316125-316156	8	0.75
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP019484	Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence	1161694-1161725	8	0.75
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP053207	Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1C, complete sequence	375822-375853	8	0.75
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP019487	Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence	935087-935118	8	0.75
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NC_020560	Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence	1021726-1021757	8	0.75
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	MT553347	Mycobacterium phage Awesomesauce, complete genome	21056-21087	8	0.75
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	MH020243	Mycobacterium phage TootsiePop, complete genome	21061-21092	8	0.75
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	MH020242	Mycobacterium phage Misha28, complete genome	21061-21092	8	0.75
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	MK494120	Mycobacterium phage Piper2020, complete genome	21058-21089	8	0.75
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP031163	Deinococcus wulumuqiensis strain NEB 479 plasmid pDrdI, complete sequence	386342-386373	8	0.75
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP015090	Pelagibaca abyssi strain JLT2014 plasmid pPABY2, complete sequence	153535-153566	8	0.75
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP017294	Pseudomonas aeruginosa strain PA83 plasmid unnamed1, complete sequence	329716-329747	8	0.75
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NC_013857	Azospirillum sp. B510 plasmid pAB510c, complete sequence	413469-413500	8	0.75
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP021119	Streptomyces sp. CLI2509 strain CLI2905 plasmid unnamed1, complete sequence	100757-100788	8	0.75
LR130759_20	20.1|5490160|31|LR130759|CRISPRCasFinder	5490160-5490190	31	NZ_CP032346	Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence	1739710-1739740	8	0.742
LR130759_2	2.1|587586|33|LR130759|CRISPRCasFinder	587586-587618	33	NZ_CP030372	Salinibacter ruber strain RM158 plasmid pSR67, complete sequence	44564-44596	9	0.727
LR130759_2	2.1|587586|33|LR130759|CRISPRCasFinder	587586-587618	33	NC_014157	Salinibacter ruber M8 plasmid pSR84, complete sequence	13445-13477	9	0.727
LR130759_5	5.1|1423971|33|LR130759|CRISPRCasFinder	1423971-1424003	33	MF477236	Nocardia phage NTR1, complete genome	51586-51618	9	0.727
LR130759_8	8.17|3078734|34|LR130759|CRT	3078734-3078767	34	NZ_CP030264	Ensifer adhaerens strain Corn53 plasmid AB, complete sequence	694228-694261	9	0.735
LR130759_8	8.17|3078734|34|LR130759|CRT	3078734-3078767	34	NZ_CP015882	Ensifer adhaerens strain Casida A plasmid pCasidaAB, complete sequence	271401-271434	9	0.735
LR130759_16	16.3|5306652|41|LR130759|CRISPRCasFinder	5306652-5306692	41	NZ_CP015203	Rhodococcus sp. 008 plasmid pR8L1, complete sequence	596224-596264	9	0.78
LR130759_16	16.3|5306652|41|LR130759|CRISPRCasFinder	5306652-5306692	41	NZ_CP046100	Rhodococcus sp. AQ5-07 plasmid unnamed1, complete sequence	134963-135003	9	0.78
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP018348	Klebsiella pneumoniae strain CAV1417 plasmid pCAV1417-9294, complete sequence	6149-6179	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP018672	Klebsiella pneumoniae strain CAV1217 plasmid pCAV1217-9294, complete sequence	525-555	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	CP052171	Klebsiella pneumoniae strain F16KP0075 plasmid pF16KP0075-4, complete sequence	6291-6321	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP032199	Klebsiella pneumoniae strain AR_0097 plasmid unnamed5, complete sequence	8686-8716	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP022775	Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence	724893-724923	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	CP052486	Klebsiella pneumoniae strain C16KP0036 plasmid pC16KP0036-2, complete sequence	1623-1653	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP021756	Klebsiella pneumoniae strain AR_0113 plasmid unitig_5, complete sequence	1969-1999	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP023852	Escherichia coli strain 4/0 plasmid p4_0.3, complete sequence	2602-2632	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP018433	Klebsiella pneumoniae strain MNCRE53 plasmid pMNCRE53_1, complete sequence	9414-9444	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	CP052166	Klebsiella pneumoniae strain F16KP0082 plasmid pF16KP0082-4, complete sequence	3037-3067	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP018445	Klebsiella pneumoniae strain Kp_Goe_822917 plasmid pKp_Goe_917-4, complete sequence	595-625	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	CP052411	Klebsiella pneumoniae strain C17KP0008 plasmid pC17KP0008-4, complete sequence	468-498	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	CP052161	Klebsiella pneumoniae strain F16KP0084 plasmid pF16KP0084-3, complete sequence	5926-5956	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NC_014310	Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence	716425-716455	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP014648	Klebsiella pneumoniae strain KPNIH36 plasmid pKPN-821, complete sequence	39268-39298	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP011979	Klebsiella pneumoniae DMC1097 plasmid pDMC1097-20.222kb, complete sequence	15917-15947	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	CP052402	Klebsiella pneumoniae strain C17KP0039 plasmid pC17KP0039-3, complete sequence	5101-5131	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	CP052312	Klebsiella pneumoniae strain E16KP0102 plasmid pE16KP0102-3, complete sequence	9157-9187	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP010394	Klebsiella pneumoniae strain 34618 plasmid p34618-13.841kb, complete sequence	11129-11159	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP022762	Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence	620181-620211	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NC_009793	Citrobacter koseri ATCC BAA-895 plasmid pCKO3, complete sequence	8588-8618	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	CP052146	Klebsiella pneumoniae strain F17KP0012 plasmid pF17KP0012-3, complete sequence	8909-8939	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_LS992179	Citrobacter freundii isolate Citrobacter freundii str. E2614 plasmid 5, complete sequence	735-765	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP024884	Klebsiella aerogenes strain AR_0009 plasmid tig00000054_pilon, complete sequence	214-244	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP033630	Klebsiella pneumoniae strain 4743 plasmid unnamed5	7567-7597	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP033630	Klebsiella pneumoniae strain 4743 plasmid unnamed5	18546-18576	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP011988	Klebsiella pneumoniae UHKPC07 plasmid pUHKPC07-13.841kb, complete sequence	8340-8370	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	CP052360	Klebsiella pneumoniae strain D16KP0144 plasmid pD16KP0144-4, complete sequence	2369-2399	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP011982	Klebsiella pneumoniae 500_1420 plasmid p500_1420-51.662kb, complete sequence	32478-32508	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP011982	Klebsiella pneumoniae 500_1420 plasmid p500_1420-51.662kb, complete sequence	46318-46348	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP011984	Klebsiella pneumoniae 500_1420 plasmid p500_1420-13.838kb, complete sequence	8559-8589	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP020840	Klebsiella pneumoniae strain BK13043 plasmid pBK13043-3, complete sequence	5830-5860	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP011993	Klebsiella pneumoniae UHKPC33 plasmid pUHKPC33-13.841kb, complete sequence	7485-7515	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP027058	Klebsiella pneumoniae strain 2_GR_12 plasmid ColRNAI, complete sequence	4381-4411	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	CP052447	Klebsiella pneumoniae strain C16KP0098 plasmid pC16KP0098-4, complete sequence	8226-8256	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NC_018953	Klebsiella pneumoniae plasmid pIGMS32, complete sequence	360-390	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NC_019156	Klebsiella pneumoniae plasmid pAAC154, complete sequence	14308-14338	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NC_019159	Klebsiella pneumoniae plasmid ColEST258, complete sequence	7149-7179	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP018425	Klebsiella pneumoniae strain MNCRE69 plasmid pMNCRE69_1, complete sequence	9414-9444	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP032930	Klebsiella aerogenes strain AR_0062 plasmid unnamed5, complete sequence	2117-2147	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NC_021656	Klebsiella pneumoniae plasmid pKpQIL-SC29, complete sequence	40539-40569	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NC_021666	Klebsiella pneumoniae plasmid ColE-LS6, complete sequence	9040-9070	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP024651	Escherichia coli strain BH100 substr. MG2014 plasmid pAp, complete sequence	371-401	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	CP052418	Klebsiella pneumoniae strain C16KP0189 plasmid pC16KP0189-4, complete sequence	8008-8038	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP021837	Klebsiella pneumoniae strain AR_0120 plasmid tig00000601_pilon, complete sequence	12094-12124	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP045796	Klebsiella pneumoniae subsp. pneumoniae strain AUSMDU00008079 plasmid pAUSMDU00008079_04, complete sequence	8433-8463	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP007796	Azospirillum brasilense strain Az39 plasmid AbAZ39_p3, complete sequence	222922-222952	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP022921	Klebsiella pneumoniae strain ST307PT03 plasmid pJYC03B, complete sequence	1559-1589	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	CP052234	Klebsiella pneumoniae strain E17KP0033 plasmid pE17KP0033-3, complete sequence	3171-3201	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP046275	Enterobacter hormaechei strain E70 plasmid pE70-TEM1, complete sequence	5477-5507	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	CP052555	Klebsiella pneumoniae strain A17KP0038 plasmid pA17KP0038-4, complete sequence	5728-5758	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP014122	Klebsiella pneumoniae strain FDAARGOS_156 plasmid unnamed4, complete sequence	6888-6918	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP014122	Klebsiella pneumoniae strain FDAARGOS_156 plasmid unnamed4, complete sequence	19841-19871	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP031807	Klebsiella pneumoniae strain MSB1_8A-sc-2280397 plasmid unnamed7, complete sequence	9237-9267	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	CP052210	Klebsiella pneumoniae strain E17KP0085 plasmid pE17KP0085-3, complete sequence	1184-1214	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP023528	Citrobacter koseri strain FDAARGOS_393 plasmid unnamed, complete sequence	3791-3821	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP018353	Klebsiella pneumoniae strain CAV1453 plasmid pCAV1453-14, complete sequence	12063-12093	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP021548	Klebsiella pneumoniae strain AR_0112 plasmid tig00000005, complete sequence	12287-12317	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	CP052529	Klebsiella pneumoniae strain B16KP0177 plasmid pB16KP0177-5, complete sequence	5518-5548	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP021543	Klebsiella pneumoniae strain AR_0047 plasmid tig00000004, complete sequence	6978-7008	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP009877	Klebsiella pneumoniae subsp. pneumoniae strain KPNIH31 plasmid pAAC154-a9e, complete sequence	14112-14142	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP009772	Klebsiella pneumoniae subsp. pneumoniae strain KPNIH33 plasmid pEA1509_B, complete sequence	360-390	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP009778	Klebsiella pneumoniae subsp. pneumoniae strain KPNIH32 plasmid pKPN-c8b, complete sequence	14265-14295	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP008832	Klebsiella pneumoniae subsp. pneumoniae KPR0928 plasmid pKPN-294, complete sequence	13048-13078	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP008799	Klebsiella pneumoniae subsp. pneumoniae KPNIH24 plasmid pKPN-819, complete sequence	35132-35162	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP006928	Klebsiella pneumoniae 30660/NJST258_1 plasmid pNJST258N4, complete sequence	11026-11056	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP007728	Klebsiella pneumoniae subsp. pneumoniae KPNIH10 plasmid pAAC154-a50, complete sequence	14303-14333	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP006919	Klebsiella pneumoniae 30684/NJST258_2 plasmid pNJST258C2, complete sequence	14028-14058	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	CP052283	Klebsiella pneumoniae strain E16KP0224 plasmid pE16KP0224-3, complete sequence	2625-2655	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	CP052428	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-1, complete sequence	2060-2090	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	CP052548	Klebsiella pneumoniae strain B16KP0089 plasmid pB16KP0089-2, complete sequence	4255-4285	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP036449	Klebsiella pneumoniae strain KPNIH45 plasmid pKPC-610e, complete sequence	10150-10180	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP020066	Klebsiella pneumoniae strain AR_0117 plasmid unitig_5, complete sequence	1153-1183	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP020075	Klebsiella pneumoniae strain AR_0115 plasmid tig00000005, complete sequence	13850-13880	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP020112	Klebsiella pneumoniae strain AR_0098 plasmid tig00000004, complete sequence	10865-10895	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP015391	Klebsiella pneumoniae strain NY9 plasmid pNY9_6, complete sequence	935-965	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP023017	Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence	685840-685870	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP036445	Klebsiella pneumoniae strain ABFPV plasmid tig00001273_pilon, complete sequence	2453-2483	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP050378	Klebsiella pneumoniae strain 51015 plasmid p51015_COL_RNAI, complete sequence	4599-4629	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP050378	Klebsiella pneumoniae strain 51015 plasmid p51015_COL_RNAI, complete sequence	14024-14054	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP031757	Klebsiella aerogenes strain FDAARGOS_327 plasmid unnamed1, complete sequence	6234-6264	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	CP052424	Klebsiella pneumoniae strain C16KP0164 plasmid pC16KP0164-2, complete sequence	1540-1570	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_LR130551	Klebsiella pneumoniae strain KPC2 isolate KPC2 plasmid 4	9805-9835	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP022576	Klebsiella pneumoniae strain BIC-1 plasmid pBIC-1c, complete sequence	883-913	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP024463	Klebsiella pneumoniae strain QS17-0161 plasmid pMRSN480738_10.0, complete sequence	3803-3833	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	CP052191	Klebsiella pneumoniae strain F16KP0019 plasmid pF16KP0019-2, complete sequence	865-895	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	CP052541	Klebsiella pneumoniae strain B16KP0141 plasmid pB16KP0141-4, complete sequence	5607-5637	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP021717	Klebsiella pneumoniae strain AR_0129 plasmid tig00000004, complete sequence	7096-7126	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	CP052536	Klebsiella pneumoniae strain B16KP0157 plasmid pB16KP0157-3, complete sequence	8474-8504	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP014703	Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence	619296-619326	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP021860	Klebsiella pneumoniae strain AR_0125 plasmid tig00000007_pilon, complete sequence	22626-22656	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP022760	Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence	617087-617117	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP022789	Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence	617077-617107	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP032835	Klebsiella pneumoniae strain INF237 plasmid pINF237_02, complete sequence	50146-50176	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP027052	Klebsiella pneumoniae strain 20_GR_12 plasmid ColRNAI, complete sequence	953-983	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	CP052305	Klebsiella pneumoniae strain E16KP0172 plasmid pE16KP0172-2, complete sequence	1385-1415	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP022771	Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence	620169-620199	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP022777	Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence	620187-620217	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP022799	Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence	620166-620196	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	CP052206	Klebsiella pneumoniae strain F16KP0002 plasmid pF16KP0002-3, complete sequence	7637-7667	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP036436	Citrobacter sp. ABFQG plasmid pKPC-5fbf, complete sequence	1838-1868	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP036441	Klebsiella pneumoniae strain ABFQB plasmid pKPC-5fbf, complete sequence	541-571	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NC_011382	Klebsiella pneumoniae plasmid 15S, complete sequence	8536-8566	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP025009	Klebsiella pneumoniae strain AUSMDU00008119 plasmid pAUSMDU8119-1, complete sequence	85159-85189	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NC_022083	Klebsiella pneumoniae JM45 plasmid p2, complete sequence	2036-2066	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP022918	Klebsiella pneumoniae strain ST307PT04 plasmid pJYC04B	8130-8160	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	CP052238	Klebsiella pneumoniae strain E17KP0029 plasmid pE17KP0029-3, complete sequence	8534-8564	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	CP052180	Klebsiella pneumoniae strain F16KP0045 plasmid pF16KP0045-2, complete sequence	5348-5378	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	CP052439	Klebsiella pneumoniae strain C16KP0108 plasmid pC16KP0108-5, complete sequence	4105-4135	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	CP052355	Klebsiella pneumoniae strain D16KP0146 plasmid pD17KP0032-3, complete sequence	7264-7294	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP022764	Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence	724957-724987	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP054267	Klebsiella pneumoniae strain 39427 plasmid pKPN39427.3, complete sequence	44164-44194	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP026710	Citrobacter koseri strain AR_0024 plasmid unitig_1_pilon, complete sequence	5981-6011	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	CP052396	Klebsiella pneumoniae strain C17KP0040 plasmid pC17KP0040-3, complete sequence	9097-9127	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	CP052481	Klebsiella pneumoniae strain C16KP0050 plasmid pC16KP0050-5, complete sequence	674-704	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP032177	Klebsiella pneumoniae strain AR_0135 plasmid unnamed2, complete sequence	847-877	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP018431	Klebsiella pneumoniae strain MNCRE78 plasmid pMNCRE78_1, complete sequence	9411-9441	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	CP052318	Klebsiella pneumoniae strain E16KP0093 plasmid pE16KP0093-3, complete sequence	4071-4101	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP025252	Escherichia coli strain BH100 substr. MG2017 plasmid pApR, complete sequence	18013-18043	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	CP052473	Klebsiella pneumoniae strain C16KP0053 plasmid pC16KP0053-5, complete sequence	3195-3225	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP015384	Klebsiella pneumoniae strain CN1 plasmid pCN1_2, complete sequence	753-783	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP033818	Klebsiella aerogenes strain FDAARGOS_513 plasmid unnamed1, complete sequence	1991-2021	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP037930	Klebsiella pneumoniae subsp. pneumoniae strain KP-8788 plasmid p8788-IT, complete sequence	44088-44118	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP019010	Escherichia coli strain Ecol_AZ161 plasmid pECAZ161_KPC, complete sequence	38284-38314	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP022797	Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence	724957-724987	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP021779	UNVERIFIED_ORG: Enterobacter cloacae strain AR_0053 plasmid unitig_4, complete sequence	8789-8819	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP015396	Klebsiella pneumoniae strain CR14 plasmid pCR14_4, complete sequence	59032-59062	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP027698	Klebsiella pneumoniae strain KP30835 plasmid unnamed3, complete sequence	7855-7885	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_LT985216	Escherichia coli strain 533 plasmid RCS12TR533_p, complete sequence	12065-12095	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_LT985257	Escherichia coli strain 580 plasmid RCS49_pIV, complete sequence	11925-11955	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	LC505458	Klebsiella pneumoniae A1-1 plasmid pColRNAI-Kp1-1 DNA, complete sequence	6233-6263	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	CP052497	Klebsiella pneumoniae strain B17KP0067 plasmid pB17KP0067-3, complete sequence	3050-3080	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_MH909340	Klebsiella pneumoniae strain A1763 plasmid pA1763-KPC, complete sequence	42844-42874	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_MH909332	Klebsiella pneumoniae strain A1731 plasmid pA1731-KPC, complete sequence	60993-61023	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_MH909338	Klebsiella pneumoniae strain A1759 plasmid pA1759-KPC, complete sequence	33114-33144	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_MF150119	Klebsiella pneumoniae strain A64477 plasmid pKP64477e, complete sequence	4531-4561	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_MF150124	Klebsiella pneumoniae strain A64216 plasmid pKP64216c, complete sequence	4929-4959	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP022075	Citrobacter koseri strain FDAARGOS_287 plasmid unnamed2, complete sequence	4412-4442	9	0.71
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP022758	Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence	724943-724973	9	0.71
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	969856-969887	9	0.719
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NZ_CP032322	Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence	1658516-1658547	9	0.719
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NC_019849	Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence	714981-715012	9	0.719
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NC_003078	Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence	1021724-1021755	9	0.719
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NZ_LR134456	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 14, complete sequence	170161-170192	9	0.719
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NZ_CP019586	Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence	990557-990588	9	0.719
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NZ_CP007130	Gemmatirosa kalamazoonesis strain KBS708 plasmid 2, complete sequence	892942-892973	9	0.719
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NC_017326	Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence	700436-700467	9	0.719
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NZ_CP021799	Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence	1087944-1087975	9	0.719
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NC_017323	Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence	296881-296912	9	0.719
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NZ_CP009146	Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence	708684-708715	9	0.719
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NZ_CP021828	Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence	592469-592500	9	0.719
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NZ_CP021802	Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence	1366392-1366423	9	0.719
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NZ_CP021820	Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence	1052669-1052700	9	0.719
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NZ_CP021831	Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence	959932-959963	9	0.719
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NZ_CP021823	Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence	709351-709382	9	0.719
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NZ_CP032054	Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence	571616-571647	9	0.719
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NZ_CP021814	Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence	622069-622100	9	0.719
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NZ_CP021795	Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence	228808-228839	9	0.719
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NZ_CP021806	Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence	309103-309134	9	0.719
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NZ_CP021218	Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence	859800-859831	9	0.719
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NZ_CP026527	Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence	721514-721545	9	0.719
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NZ_CP016560	Streptomyces clavuligerus strain F613-1 plasmid pSCL4, complete sequence	228872-228903	9	0.719
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NZ_CP019484	Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence	1161695-1161726	9	0.719
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NZ_CP019487	Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence	935088-935119	9	0.719
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NC_020560	Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence	1021727-1021758	9	0.719
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NC_023497	Amycolatopsis keratiniphila plasmid pXL100, complete sequence	10727-10758	9	0.719
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NZ_CP008954	Amycolatopsis japonica strain DSM 44213 plasmid pAmyja1, complete sequence	16722-16753	9	0.719
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NC_023286	Streptomyces sp. F12 plasmid pFRL6, complete sequence	280180-280211	9	0.719
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NZ_CP020539	Sphingobium herbicidovorans strain MH plasmid pMSHV, complete sequence	14718-14749	9	0.719
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NZ_CP045223	Achromobacter xylosoxidans strain DN002 plasmid unnamed	118267-118298	9	0.719
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NC_018701	Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence	698185-698216	9	0.719
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NZ_CP012399	Chelatococcus sp. CO-6 plasmid pCO-6, complete sequence	670675-670706	9	0.719
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	1266682-1266713	9	0.719
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	546852-546883	9	0.719
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	500598-500629	9	0.719
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	MF612073	Klebsiella phage SopranoGao, complete genome	36153-36184	9	0.719
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP028971	Aminobacter sp. MSH1 plasmid pUSP3, complete sequence	73173-73203	9	0.71
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP020371	Candidatus Thiodictyon syntrophicum strain Cad16T plasmid pTs417, complete sequence	214553-214583	9	0.71
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP045122	Rubrobacter sp. SCSIO 52915 plasmid unnamed1, complete sequence	164978-165008	9	0.71
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP020539	Sphingobium herbicidovorans strain MH plasmid pMSHV, complete sequence	14718-14748	9	0.71
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP032347	Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence	650520-650550	9	0.71
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	HM486077	Tsukamurella phage TPA2, complete sequence	37485-37515	9	0.71
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NC_015210	Tsukamurella phage TPA2, complete genome	37485-37515	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP018348	Klebsiella pneumoniae strain CAV1417 plasmid pCAV1417-9294, complete sequence	6149-6179	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP018672	Klebsiella pneumoniae strain CAV1217 plasmid pCAV1217-9294, complete sequence	525-555	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	CP052171	Klebsiella pneumoniae strain F16KP0075 plasmid pF16KP0075-4, complete sequence	6291-6321	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP032199	Klebsiella pneumoniae strain AR_0097 plasmid unnamed5, complete sequence	8686-8716	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP022775	Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence	724893-724923	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	CP052486	Klebsiella pneumoniae strain C16KP0036 plasmid pC16KP0036-2, complete sequence	1623-1653	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP021756	Klebsiella pneumoniae strain AR_0113 plasmid unitig_5, complete sequence	1969-1999	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP023852	Escherichia coli strain 4/0 plasmid p4_0.3, complete sequence	2602-2632	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP018433	Klebsiella pneumoniae strain MNCRE53 plasmid pMNCRE53_1, complete sequence	9414-9444	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	CP052166	Klebsiella pneumoniae strain F16KP0082 plasmid pF16KP0082-4, complete sequence	3037-3067	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP018445	Klebsiella pneumoniae strain Kp_Goe_822917 plasmid pKp_Goe_917-4, complete sequence	595-625	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	CP052411	Klebsiella pneumoniae strain C17KP0008 plasmid pC17KP0008-4, complete sequence	468-498	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	CP052161	Klebsiella pneumoniae strain F16KP0084 plasmid pF16KP0084-3, complete sequence	5926-5956	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NC_014310	Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence	716425-716455	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP014648	Klebsiella pneumoniae strain KPNIH36 plasmid pKPN-821, complete sequence	39268-39298	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP011979	Klebsiella pneumoniae DMC1097 plasmid pDMC1097-20.222kb, complete sequence	15917-15947	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	CP052402	Klebsiella pneumoniae strain C17KP0039 plasmid pC17KP0039-3, complete sequence	5101-5131	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	CP052312	Klebsiella pneumoniae strain E16KP0102 plasmid pE16KP0102-3, complete sequence	9157-9187	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP010394	Klebsiella pneumoniae strain 34618 plasmid p34618-13.841kb, complete sequence	11129-11159	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP022762	Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence	620181-620211	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NC_009793	Citrobacter koseri ATCC BAA-895 plasmid pCKO3, complete sequence	8588-8618	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	CP052146	Klebsiella pneumoniae strain F17KP0012 plasmid pF17KP0012-3, complete sequence	8909-8939	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_LS992179	Citrobacter freundii isolate Citrobacter freundii str. E2614 plasmid 5, complete sequence	735-765	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP024884	Klebsiella aerogenes strain AR_0009 plasmid tig00000054_pilon, complete sequence	214-244	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP033630	Klebsiella pneumoniae strain 4743 plasmid unnamed5	7567-7597	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP033630	Klebsiella pneumoniae strain 4743 plasmid unnamed5	18546-18576	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP011988	Klebsiella pneumoniae UHKPC07 plasmid pUHKPC07-13.841kb, complete sequence	8340-8370	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	CP052360	Klebsiella pneumoniae strain D16KP0144 plasmid pD16KP0144-4, complete sequence	2369-2399	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP011982	Klebsiella pneumoniae 500_1420 plasmid p500_1420-51.662kb, complete sequence	32478-32508	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP011982	Klebsiella pneumoniae 500_1420 plasmid p500_1420-51.662kb, complete sequence	46318-46348	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP011984	Klebsiella pneumoniae 500_1420 plasmid p500_1420-13.838kb, complete sequence	8559-8589	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP020840	Klebsiella pneumoniae strain BK13043 plasmid pBK13043-3, complete sequence	5830-5860	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP011993	Klebsiella pneumoniae UHKPC33 plasmid pUHKPC33-13.841kb, complete sequence	7485-7515	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP027058	Klebsiella pneumoniae strain 2_GR_12 plasmid ColRNAI, complete sequence	4381-4411	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	CP052447	Klebsiella pneumoniae strain C16KP0098 plasmid pC16KP0098-4, complete sequence	8226-8256	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NC_018953	Klebsiella pneumoniae plasmid pIGMS32, complete sequence	360-390	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NC_019156	Klebsiella pneumoniae plasmid pAAC154, complete sequence	14308-14338	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NC_019159	Klebsiella pneumoniae plasmid ColEST258, complete sequence	7149-7179	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP018425	Klebsiella pneumoniae strain MNCRE69 plasmid pMNCRE69_1, complete sequence	9414-9444	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP032930	Klebsiella aerogenes strain AR_0062 plasmid unnamed5, complete sequence	2117-2147	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NC_021656	Klebsiella pneumoniae plasmid pKpQIL-SC29, complete sequence	40539-40569	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NC_021666	Klebsiella pneumoniae plasmid ColE-LS6, complete sequence	9040-9070	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP024651	Escherichia coli strain BH100 substr. MG2014 plasmid pAp, complete sequence	371-401	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	CP052418	Klebsiella pneumoniae strain C16KP0189 plasmid pC16KP0189-4, complete sequence	8008-8038	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP021837	Klebsiella pneumoniae strain AR_0120 plasmid tig00000601_pilon, complete sequence	12094-12124	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP045796	Klebsiella pneumoniae subsp. pneumoniae strain AUSMDU00008079 plasmid pAUSMDU00008079_04, complete sequence	8433-8463	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP007796	Azospirillum brasilense strain Az39 plasmid AbAZ39_p3, complete sequence	222922-222952	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP022921	Klebsiella pneumoniae strain ST307PT03 plasmid pJYC03B, complete sequence	1559-1589	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	CP052234	Klebsiella pneumoniae strain E17KP0033 plasmid pE17KP0033-3, complete sequence	3171-3201	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP046275	Enterobacter hormaechei strain E70 plasmid pE70-TEM1, complete sequence	5477-5507	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	CP052555	Klebsiella pneumoniae strain A17KP0038 plasmid pA17KP0038-4, complete sequence	5728-5758	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP014122	Klebsiella pneumoniae strain FDAARGOS_156 plasmid unnamed4, complete sequence	6888-6918	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP014122	Klebsiella pneumoniae strain FDAARGOS_156 plasmid unnamed4, complete sequence	19841-19871	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP031807	Klebsiella pneumoniae strain MSB1_8A-sc-2280397 plasmid unnamed7, complete sequence	9237-9267	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	CP052210	Klebsiella pneumoniae strain E17KP0085 plasmid pE17KP0085-3, complete sequence	1184-1214	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP023528	Citrobacter koseri strain FDAARGOS_393 plasmid unnamed, complete sequence	3791-3821	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP018353	Klebsiella pneumoniae strain CAV1453 plasmid pCAV1453-14, complete sequence	12063-12093	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP021548	Klebsiella pneumoniae strain AR_0112 plasmid tig00000005, complete sequence	12287-12317	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	CP052529	Klebsiella pneumoniae strain B16KP0177 plasmid pB16KP0177-5, complete sequence	5518-5548	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP021543	Klebsiella pneumoniae strain AR_0047 plasmid tig00000004, complete sequence	6978-7008	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP009877	Klebsiella pneumoniae subsp. pneumoniae strain KPNIH31 plasmid pAAC154-a9e, complete sequence	14112-14142	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP009772	Klebsiella pneumoniae subsp. pneumoniae strain KPNIH33 plasmid pEA1509_B, complete sequence	360-390	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP009778	Klebsiella pneumoniae subsp. pneumoniae strain KPNIH32 plasmid pKPN-c8b, complete sequence	14265-14295	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP008832	Klebsiella pneumoniae subsp. pneumoniae KPR0928 plasmid pKPN-294, complete sequence	13048-13078	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP008799	Klebsiella pneumoniae subsp. pneumoniae KPNIH24 plasmid pKPN-819, complete sequence	35132-35162	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP006928	Klebsiella pneumoniae 30660/NJST258_1 plasmid pNJST258N4, complete sequence	11026-11056	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP007728	Klebsiella pneumoniae subsp. pneumoniae KPNIH10 plasmid pAAC154-a50, complete sequence	14303-14333	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP006919	Klebsiella pneumoniae 30684/NJST258_2 plasmid pNJST258C2, complete sequence	14028-14058	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	CP052283	Klebsiella pneumoniae strain E16KP0224 plasmid pE16KP0224-3, complete sequence	2625-2655	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	CP052428	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-1, complete sequence	2060-2090	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	CP052548	Klebsiella pneumoniae strain B16KP0089 plasmid pB16KP0089-2, complete sequence	4255-4285	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP036449	Klebsiella pneumoniae strain KPNIH45 plasmid pKPC-610e, complete sequence	10150-10180	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP020066	Klebsiella pneumoniae strain AR_0117 plasmid unitig_5, complete sequence	1153-1183	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP020075	Klebsiella pneumoniae strain AR_0115 plasmid tig00000005, complete sequence	13850-13880	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP020112	Klebsiella pneumoniae strain AR_0098 plasmid tig00000004, complete sequence	10865-10895	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP015391	Klebsiella pneumoniae strain NY9 plasmid pNY9_6, complete sequence	935-965	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP023017	Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence	685840-685870	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP036445	Klebsiella pneumoniae strain ABFPV plasmid tig00001273_pilon, complete sequence	2453-2483	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP050378	Klebsiella pneumoniae strain 51015 plasmid p51015_COL_RNAI, complete sequence	4599-4629	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP050378	Klebsiella pneumoniae strain 51015 plasmid p51015_COL_RNAI, complete sequence	14024-14054	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP031757	Klebsiella aerogenes strain FDAARGOS_327 plasmid unnamed1, complete sequence	6234-6264	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	CP052424	Klebsiella pneumoniae strain C16KP0164 plasmid pC16KP0164-2, complete sequence	1540-1570	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_LR130551	Klebsiella pneumoniae strain KPC2 isolate KPC2 plasmid 4	9805-9835	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP022576	Klebsiella pneumoniae strain BIC-1 plasmid pBIC-1c, complete sequence	883-913	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP024463	Klebsiella pneumoniae strain QS17-0161 plasmid pMRSN480738_10.0, complete sequence	3803-3833	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	CP052191	Klebsiella pneumoniae strain F16KP0019 plasmid pF16KP0019-2, complete sequence	865-895	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	CP052541	Klebsiella pneumoniae strain B16KP0141 plasmid pB16KP0141-4, complete sequence	5607-5637	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP021717	Klebsiella pneumoniae strain AR_0129 plasmid tig00000004, complete sequence	7096-7126	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	CP052536	Klebsiella pneumoniae strain B16KP0157 plasmid pB16KP0157-3, complete sequence	8474-8504	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP014703	Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence	619296-619326	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP021860	Klebsiella pneumoniae strain AR_0125 plasmid tig00000007_pilon, complete sequence	22626-22656	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP022760	Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence	617087-617117	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP022789	Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence	617077-617107	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP032835	Klebsiella pneumoniae strain INF237 plasmid pINF237_02, complete sequence	50146-50176	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP027052	Klebsiella pneumoniae strain 20_GR_12 plasmid ColRNAI, complete sequence	953-983	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	CP052305	Klebsiella pneumoniae strain E16KP0172 plasmid pE16KP0172-2, complete sequence	1385-1415	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP022771	Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence	620169-620199	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP022777	Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence	620187-620217	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP022799	Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence	620166-620196	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	CP052206	Klebsiella pneumoniae strain F16KP0002 plasmid pF16KP0002-3, complete sequence	7637-7667	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP036436	Citrobacter sp. ABFQG plasmid pKPC-5fbf, complete sequence	1838-1868	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP036441	Klebsiella pneumoniae strain ABFQB plasmid pKPC-5fbf, complete sequence	541-571	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NC_011382	Klebsiella pneumoniae plasmid 15S, complete sequence	8536-8566	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP025009	Klebsiella pneumoniae strain AUSMDU00008119 plasmid pAUSMDU8119-1, complete sequence	85159-85189	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NC_022083	Klebsiella pneumoniae JM45 plasmid p2, complete sequence	2036-2066	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP022918	Klebsiella pneumoniae strain ST307PT04 plasmid pJYC04B	8130-8160	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	CP052238	Klebsiella pneumoniae strain E17KP0029 plasmid pE17KP0029-3, complete sequence	8534-8564	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	CP052180	Klebsiella pneumoniae strain F16KP0045 plasmid pF16KP0045-2, complete sequence	5348-5378	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	CP052439	Klebsiella pneumoniae strain C16KP0108 plasmid pC16KP0108-5, complete sequence	4105-4135	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	CP052355	Klebsiella pneumoniae strain D16KP0146 plasmid pD17KP0032-3, complete sequence	7264-7294	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP022764	Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence	724957-724987	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP054267	Klebsiella pneumoniae strain 39427 plasmid pKPN39427.3, complete sequence	44164-44194	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP026710	Citrobacter koseri strain AR_0024 plasmid unitig_1_pilon, complete sequence	5981-6011	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	CP052396	Klebsiella pneumoniae strain C17KP0040 plasmid pC17KP0040-3, complete sequence	9097-9127	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	CP052481	Klebsiella pneumoniae strain C16KP0050 plasmid pC16KP0050-5, complete sequence	674-704	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP032177	Klebsiella pneumoniae strain AR_0135 plasmid unnamed2, complete sequence	847-877	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP018431	Klebsiella pneumoniae strain MNCRE78 plasmid pMNCRE78_1, complete sequence	9411-9441	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	CP052318	Klebsiella pneumoniae strain E16KP0093 plasmid pE16KP0093-3, complete sequence	4071-4101	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP025252	Escherichia coli strain BH100 substr. MG2017 plasmid pApR, complete sequence	18013-18043	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	CP052473	Klebsiella pneumoniae strain C16KP0053 plasmid pC16KP0053-5, complete sequence	3195-3225	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP015384	Klebsiella pneumoniae strain CN1 plasmid pCN1_2, complete sequence	753-783	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP033818	Klebsiella aerogenes strain FDAARGOS_513 plasmid unnamed1, complete sequence	1991-2021	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP037930	Klebsiella pneumoniae subsp. pneumoniae strain KP-8788 plasmid p8788-IT, complete sequence	44088-44118	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP019010	Escherichia coli strain Ecol_AZ161 plasmid pECAZ161_KPC, complete sequence	38284-38314	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP022797	Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence	724957-724987	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP021779	UNVERIFIED_ORG: Enterobacter cloacae strain AR_0053 plasmid unitig_4, complete sequence	8789-8819	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP015396	Klebsiella pneumoniae strain CR14 plasmid pCR14_4, complete sequence	59032-59062	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP027698	Klebsiella pneumoniae strain KP30835 plasmid unnamed3, complete sequence	7855-7885	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_LT985216	Escherichia coli strain 533 plasmid RCS12TR533_p, complete sequence	12065-12095	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_LT985257	Escherichia coli strain 580 plasmid RCS49_pIV, complete sequence	11925-11955	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	LC505458	Klebsiella pneumoniae A1-1 plasmid pColRNAI-Kp1-1 DNA, complete sequence	6233-6263	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	CP052497	Klebsiella pneumoniae strain B17KP0067 plasmid pB17KP0067-3, complete sequence	3050-3080	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_MH909340	Klebsiella pneumoniae strain A1763 plasmid pA1763-KPC, complete sequence	42844-42874	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_MH909332	Klebsiella pneumoniae strain A1731 plasmid pA1731-KPC, complete sequence	60993-61023	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_MH909338	Klebsiella pneumoniae strain A1759 plasmid pA1759-KPC, complete sequence	33114-33144	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_MF150119	Klebsiella pneumoniae strain A64477 plasmid pKP64477e, complete sequence	4531-4561	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_MF150124	Klebsiella pneumoniae strain A64216 plasmid pKP64216c, complete sequence	4929-4959	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP022075	Citrobacter koseri strain FDAARGOS_287 plasmid unnamed2, complete sequence	4412-4442	9	0.71
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP022758	Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence	724943-724973	9	0.71
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP007130	Gemmatirosa kalamazoonesis strain KBS708 plasmid 2, complete sequence	892943-892974	9	0.719
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP018236	Rhizobium leguminosarum strain Vaf-108 plasmid unnamed8	82405-82436	9	0.719
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	504297-504328	9	0.719
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	1308772-1308803	9	0.719
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP020371	Candidatus Thiodictyon syntrophicum strain Cad16T plasmid pTs417, complete sequence	214553-214584	9	0.719
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_LR134456	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 14, complete sequence	170162-170193	9	0.719
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP008954	Amycolatopsis japonica strain DSM 44213 plasmid pAmyja1, complete sequence	16721-16752	9	0.719
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP012399	Chelatococcus sp. CO-6 plasmid pCO-6, complete sequence	670674-670705	9	0.719
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	KY092482	Streptomyces phage Mojorita, complete genome	5752-5783	9	0.719
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	KY092480	Streptomyces phage Picard, complete genome	5752-5783	9	0.719
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP050092	Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b6, complete sequence	782144-782175	9	0.719
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP050104	Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b2, complete sequence	206517-206548	9	0.719
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP016287	Rhizobium leguminosarum strain Vaf10 plasmid unnamed1, complete sequence	617446-617477	9	0.719
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP050109	Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b2, complete sequence	206517-206548	9	0.719
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP048281	Rhizobium leguminosarum bv. viciae 248 plasmid pRle248e, complete sequence	688244-688275	9	0.719
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NC_015727	Cupriavidus necator N-1 plasmid pBB1, complete sequence	623335-623366	9	0.719
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	500597-500628	9	0.719
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	MH371116	Mycobacterium phage DMoney, complete genome	23372-23403	9	0.719
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	MH045569	Mycobacterium phage Schiebel, complete genome	23372-23403	9	0.719
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	MH371119	Mycobacterium phage OctaviousRex, complete genome	23372-23403	9	0.719
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	MF919497	Mycobacterium phage Chance64, complete genome	23372-23403	9	0.719
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	MH001456	Mycobacterium phage CLED96, complete genome	23372-23403	9	0.719
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	GQ303261	Mycobacterium phage Hope, complete genome	23372-23403	9	0.719
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	MG099946	Mycobacterium phage LouisV14, complete genome	23372-23403	9	0.719
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	KC787112	Mycobacterium phage Clark, partial genome	22403-22434	9	0.719
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	MH779513	Mycobacterium phage Olga, complete genome	23372-23403	9	0.719
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	MK919475	Mycobacterium phage Camri, complete genome	23372-23403	9	0.719
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	MK310146	Mycobacterium phage Crespo, complete genome	23373-23404	9	0.719
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	MK524493	Mycobacterium phage Darionha, complete genome	23372-23403	9	0.719
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	MH779505	Mycobacterium phage Grizzly, complete genome	23376-23407	9	0.719
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	EU568876	Mycobacterium phage BPs, complete genome	23372-23403	9	0.719
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	KC787107	Mycobacterium phage Bo4, complete genome	16178-16209	9	0.719
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	MF668268	Mycobacterium phage Aroostook, complete genome	23372-23403	9	0.719
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	KX588251	Mycobacterium phage Jane, complete genome	23372-23403	9	0.719
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	KC787103	Mycobacterium phage Chy2, partial genome	21878-21909	9	0.719
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	MH001455	Mycobacterium phage Remy19, complete genome	23372-23403	9	0.719
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	KT355472	Mycobacterium phage Cedasite, complete genome	23372-23403	9	0.719
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	KX664455	Mycobacterium phage Zombie, complete genome	23372-23403	9	0.719
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	MH077584	Mycobacterium phage Phish, complete genome	23372-23403	9	0.719
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	KC787108	Mycobacterium phage DNAIII, complete genome	23123-23154	9	0.719
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	MN444875	Mycobacterium phage Jonghyun, complete genome	23372-23403	9	0.719
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	MK433279	Mycobacterium phage Kareem, complete genome	23372-23403	9	0.719
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	KJ725374	Mycobacterium phage Guo1, complete genome	10706-10737	9	0.719
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	MT818422	Mycobacterium phage Periodt, complete genome	23372-23403	9	0.719
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	MK305884	Mycobacterium phage BQuat, complete genome	23363-23394	9	0.719
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	MF668272	Mycobacterium phage Gideon, complete genome	23372-23403	9	0.719
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	MH779515	Mycobacterium phage Sweets, complete genome	23367-23398	9	0.719
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	MW119570	Mycobacterium phage Lang, complete genome	23446-23477	9	0.719
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	KC787111	Mycobacterium phage Sedge, partial genome	23054-23085	9	0.719
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	MF612073	Klebsiella phage SopranoGao, complete genome	36154-36185	9	0.719
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	KC787104	Mycobacterium phage Chy3, partial genome	23493-23524	9	0.719
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NC_012788	Mycobacterium phage Angel, complete genome	23372-23403	9	0.719
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	KX443326	Mycobacterium phage BruceB, complete genome	23372-23403	9	0.719
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	MK433277	Mycobacterium phage Renaissance, complete genome	23372-23403	9	0.719
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	MH590605	Mycobacterium phage Cherrybomb426, complete genome	23372-23403	9	0.719
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	MH779509	Mycobacterium phage Kasen3, complete genome	23373-23404	9	0.719
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	JN699002	Mycobacterium phage Avrafan, complete genome	23372-23403	9	0.719
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	MH779507	Mycobacterium phage Hotshotbaby7, complete genome	23372-23403	9	0.719
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	KT355474	Mycobacterium phage Frosty24, complete genome	23372-23403	9	0.719
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	KC787109	Mycobacterium phage Legendre, partial genome	17594-17625	9	0.719
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	JN412593	Mycobacterium phage Liefie, complete genome	23371-23402	9	0.719
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	MH479920	Mycobacterium phage Mowgli, complete genome	23372-23403	9	0.719
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NC_008202	Mycobacterium phage Halo, complete genome	23367-23398	9	0.719
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	KM923970	Mycobacterium phage Gomashi, complete genome	23373-23404	9	0.719
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	MH450127	Mycobacterium phage Plagueis, complete genome	23207-23238	9	0.719
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	KT347314	Mycobacterium phage Phreak, complete genome	23372-23403	9	0.719
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	KT365399	Mycobacterium phage Annihilator, complete genome	23363-23394	9	0.719
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	KC787110	Mycobacterium phage Leo, complete genome	23130-23161	9	0.719
LR130759_20	20.1|5490160|31|LR130759|CRISPRCasFinder	5490160-5490190	31	NZ_CP038238	Leisingera sp. NJS201 plasmid unnamed4, complete sequence	65908-65938	9	0.71
LR130759_20	20.1|5490160|31|LR130759|CRISPRCasFinder	5490160-5490190	31	MH588544	Caulobacter phage CcrBL10, complete genome	129599-129629	9	0.71
LR130759_1	1.4|586584|33|LR130759|CRISPRCasFinder	586584-586616	33	NZ_CP039697	Novosphingobium sp. ABRDHK2 plasmid pABRDHK22, complete sequence	67861-67893	10	0.697
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP013003	Caulobacter henricii strain CB4 plasmid pCB4, complete sequence	70337-70367	10	0.677
LR130759_17	17.3|5328990|31|LR130759|CRT	5328990-5329020	31	NZ_CP022306	Thalassococcus sp. S3 plasmid pS3C, complete sequence	2383-2413	10	0.677
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NZ_CP020371	Candidatus Thiodictyon syntrophicum strain Cad16T plasmid pTs417, complete sequence	214552-214583	10	0.688
LR130759_17	17.10|5329230|32|LR130759|CRT	5329230-5329261	32	NC_015184	Agrobacterium sp. H13-3 plasmid pAspH13-3a, complete sequence	72751-72782	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP018348	Klebsiella pneumoniae strain CAV1417 plasmid pCAV1417-9294, complete sequence	6149-6180	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP018672	Klebsiella pneumoniae strain CAV1217 plasmid pCAV1217-9294, complete sequence	524-555	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	CP052171	Klebsiella pneumoniae strain F16KP0075 plasmid pF16KP0075-4, complete sequence	6290-6321	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP032199	Klebsiella pneumoniae strain AR_0097 plasmid unnamed5, complete sequence	8685-8716	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	CP052486	Klebsiella pneumoniae strain C16KP0036 plasmid pC16KP0036-2, complete sequence	1623-1654	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP021756	Klebsiella pneumoniae strain AR_0113 plasmid unitig_5, complete sequence	1968-1999	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP023852	Escherichia coli strain 4/0 plasmid p4_0.3, complete sequence	2601-2632	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP018433	Klebsiella pneumoniae strain MNCRE53 plasmid pMNCRE53_1, complete sequence	9414-9445	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	CP052166	Klebsiella pneumoniae strain F16KP0082 plasmid pF16KP0082-4, complete sequence	3037-3068	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP018445	Klebsiella pneumoniae strain Kp_Goe_822917 plasmid pKp_Goe_917-4, complete sequence	595-626	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	CP052411	Klebsiella pneumoniae strain C17KP0008 plasmid pC17KP0008-4, complete sequence	467-498	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	CP052161	Klebsiella pneumoniae strain F16KP0084 plasmid pF16KP0084-3, complete sequence	5926-5957	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP014648	Klebsiella pneumoniae strain KPNIH36 plasmid pKPN-821, complete sequence	39268-39299	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP011979	Klebsiella pneumoniae DMC1097 plasmid pDMC1097-20.222kb, complete sequence	15916-15947	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	CP052402	Klebsiella pneumoniae strain C17KP0039 plasmid pC17KP0039-3, complete sequence	5101-5132	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	CP052312	Klebsiella pneumoniae strain E16KP0102 plasmid pE16KP0102-3, complete sequence	9156-9187	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP010394	Klebsiella pneumoniae strain 34618 plasmid p34618-13.841kb, complete sequence	11128-11159	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NC_009793	Citrobacter koseri ATCC BAA-895 plasmid pCKO3, complete sequence	8587-8618	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	CP052146	Klebsiella pneumoniae strain F17KP0012 plasmid pF17KP0012-3, complete sequence	8908-8939	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_LS992179	Citrobacter freundii isolate Citrobacter freundii str. E2614 plasmid 5, complete sequence	735-766	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP024884	Klebsiella aerogenes strain AR_0009 plasmid tig00000054_pilon, complete sequence	214-245	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP033630	Klebsiella pneumoniae strain 4743 plasmid unnamed5	7567-7598	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP033630	Klebsiella pneumoniae strain 4743 plasmid unnamed5	18545-18576	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP011988	Klebsiella pneumoniae UHKPC07 plasmid pUHKPC07-13.841kb, complete sequence	8339-8370	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	CP052360	Klebsiella pneumoniae strain D16KP0144 plasmid pD16KP0144-4, complete sequence	2369-2400	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP011982	Klebsiella pneumoniae 500_1420 plasmid p500_1420-51.662kb, complete sequence	32478-32509	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP011982	Klebsiella pneumoniae 500_1420 plasmid p500_1420-51.662kb, complete sequence	46318-46349	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP011984	Klebsiella pneumoniae 500_1420 plasmid p500_1420-13.838kb, complete sequence	8558-8589	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP020840	Klebsiella pneumoniae strain BK13043 plasmid pBK13043-3, complete sequence	5829-5860	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP011993	Klebsiella pneumoniae UHKPC33 plasmid pUHKPC33-13.841kb, complete sequence	7484-7515	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP027058	Klebsiella pneumoniae strain 2_GR_12 plasmid ColRNAI, complete sequence	4380-4411	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	CP052447	Klebsiella pneumoniae strain C16KP0098 plasmid pC16KP0098-4, complete sequence	8226-8257	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NC_018953	Klebsiella pneumoniae plasmid pIGMS32, complete sequence	359-390	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NC_019156	Klebsiella pneumoniae plasmid pAAC154, complete sequence	14308-14339	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NC_019159	Klebsiella pneumoniae plasmid ColEST258, complete sequence	7149-7180	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP018425	Klebsiella pneumoniae strain MNCRE69 plasmid pMNCRE69_1, complete sequence	9414-9445	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP032930	Klebsiella aerogenes strain AR_0062 plasmid unnamed5, complete sequence	2116-2147	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NC_021656	Klebsiella pneumoniae plasmid pKpQIL-SC29, complete sequence	40538-40569	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NC_021666	Klebsiella pneumoniae plasmid ColE-LS6, complete sequence	9040-9071	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP024651	Escherichia coli strain BH100 substr. MG2014 plasmid pAp, complete sequence	371-402	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	CP052418	Klebsiella pneumoniae strain C16KP0189 plasmid pC16KP0189-4, complete sequence	8007-8038	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP021837	Klebsiella pneumoniae strain AR_0120 plasmid tig00000601_pilon, complete sequence	12093-12124	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP045796	Klebsiella pneumoniae subsp. pneumoniae strain AUSMDU00008079 plasmid pAUSMDU00008079_04, complete sequence	8432-8463	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP007796	Azospirillum brasilense strain Az39 plasmid AbAZ39_p3, complete sequence	222921-222952	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP022921	Klebsiella pneumoniae strain ST307PT03 plasmid pJYC03B, complete sequence	1559-1590	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	CP052234	Klebsiella pneumoniae strain E17KP0033 plasmid pE17KP0033-3, complete sequence	3171-3202	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP046275	Enterobacter hormaechei strain E70 plasmid pE70-TEM1, complete sequence	5477-5508	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	CP052555	Klebsiella pneumoniae strain A17KP0038 plasmid pA17KP0038-4, complete sequence	5728-5759	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP014122	Klebsiella pneumoniae strain FDAARGOS_156 plasmid unnamed4, complete sequence	6887-6918	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP014122	Klebsiella pneumoniae strain FDAARGOS_156 plasmid unnamed4, complete sequence	19840-19871	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP031807	Klebsiella pneumoniae strain MSB1_8A-sc-2280397 plasmid unnamed7, complete sequence	9237-9268	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	CP052210	Klebsiella pneumoniae strain E17KP0085 plasmid pE17KP0085-3, complete sequence	1183-1214	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP023528	Citrobacter koseri strain FDAARGOS_393 plasmid unnamed, complete sequence	3790-3821	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP018353	Klebsiella pneumoniae strain CAV1453 plasmid pCAV1453-14, complete sequence	12062-12093	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP021548	Klebsiella pneumoniae strain AR_0112 plasmid tig00000005, complete sequence	12286-12317	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	CP052529	Klebsiella pneumoniae strain B16KP0177 plasmid pB16KP0177-5, complete sequence	5517-5548	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP021543	Klebsiella pneumoniae strain AR_0047 plasmid tig00000004, complete sequence	6978-7009	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP009877	Klebsiella pneumoniae subsp. pneumoniae strain KPNIH31 plasmid pAAC154-a9e, complete sequence	14112-14143	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP009772	Klebsiella pneumoniae subsp. pneumoniae strain KPNIH33 plasmid pEA1509_B, complete sequence	359-390	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP009778	Klebsiella pneumoniae subsp. pneumoniae strain KPNIH32 plasmid pKPN-c8b, complete sequence	14265-14296	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP008832	Klebsiella pneumoniae subsp. pneumoniae KPR0928 plasmid pKPN-294, complete sequence	13048-13079	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP008799	Klebsiella pneumoniae subsp. pneumoniae KPNIH24 plasmid pKPN-819, complete sequence	35131-35162	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP006928	Klebsiella pneumoniae 30660/NJST258_1 plasmid pNJST258N4, complete sequence	11025-11056	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP007728	Klebsiella pneumoniae subsp. pneumoniae KPNIH10 plasmid pAAC154-a50, complete sequence	14303-14334	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP006919	Klebsiella pneumoniae 30684/NJST258_2 plasmid pNJST258C2, complete sequence	14027-14058	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	CP052283	Klebsiella pneumoniae strain E16KP0224 plasmid pE16KP0224-3, complete sequence	2624-2655	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	CP052428	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-1, complete sequence	2060-2091	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	CP052548	Klebsiella pneumoniae strain B16KP0089 plasmid pB16KP0089-2, complete sequence	4255-4286	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP036449	Klebsiella pneumoniae strain KPNIH45 plasmid pKPC-610e, complete sequence	10149-10180	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP020066	Klebsiella pneumoniae strain AR_0117 plasmid unitig_5, complete sequence	1153-1184	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP020075	Klebsiella pneumoniae strain AR_0115 plasmid tig00000005, complete sequence	13849-13880	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP020112	Klebsiella pneumoniae strain AR_0098 plasmid tig00000004, complete sequence	10864-10895	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP015391	Klebsiella pneumoniae strain NY9 plasmid pNY9_6, complete sequence	934-965	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP036445	Klebsiella pneumoniae strain ABFPV plasmid tig00001273_pilon, complete sequence	2453-2484	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP050378	Klebsiella pneumoniae strain 51015 plasmid p51015_COL_RNAI, complete sequence	4599-4630	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP050378	Klebsiella pneumoniae strain 51015 plasmid p51015_COL_RNAI, complete sequence	14023-14054	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP031757	Klebsiella aerogenes strain FDAARGOS_327 plasmid unnamed1, complete sequence	6233-6264	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	CP052424	Klebsiella pneumoniae strain C16KP0164 plasmid pC16KP0164-2, complete sequence	1540-1571	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_LR130551	Klebsiella pneumoniae strain KPC2 isolate KPC2 plasmid 4	9805-9836	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP022576	Klebsiella pneumoniae strain BIC-1 plasmid pBIC-1c, complete sequence	882-913	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP024463	Klebsiella pneumoniae strain QS17-0161 plasmid pMRSN480738_10.0, complete sequence	3802-3833	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	CP052191	Klebsiella pneumoniae strain F16KP0019 plasmid pF16KP0019-2, complete sequence	864-895	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	CP052541	Klebsiella pneumoniae strain B16KP0141 plasmid pB16KP0141-4, complete sequence	5606-5637	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP021717	Klebsiella pneumoniae strain AR_0129 plasmid tig00000004, complete sequence	7096-7127	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	CP052536	Klebsiella pneumoniae strain B16KP0157 plasmid pB16KP0157-3, complete sequence	8474-8505	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP021860	Klebsiella pneumoniae strain AR_0125 plasmid tig00000007_pilon, complete sequence	22625-22656	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP032835	Klebsiella pneumoniae strain INF237 plasmid pINF237_02, complete sequence	50146-50177	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP027052	Klebsiella pneumoniae strain 20_GR_12 plasmid ColRNAI, complete sequence	952-983	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	CP052305	Klebsiella pneumoniae strain E16KP0172 plasmid pE16KP0172-2, complete sequence	1384-1415	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	CP052206	Klebsiella pneumoniae strain F16KP0002 plasmid pF16KP0002-3, complete sequence	7636-7667	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP036436	Citrobacter sp. ABFQG plasmid pKPC-5fbf, complete sequence	1837-1868	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP036441	Klebsiella pneumoniae strain ABFQB plasmid pKPC-5fbf, complete sequence	540-571	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NC_011382	Klebsiella pneumoniae plasmid 15S, complete sequence	8535-8566	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP025009	Klebsiella pneumoniae strain AUSMDU00008119 plasmid pAUSMDU8119-1, complete sequence	85159-85190	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NC_022083	Klebsiella pneumoniae JM45 plasmid p2, complete sequence	2035-2066	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP022918	Klebsiella pneumoniae strain ST307PT04 plasmid pJYC04B	8129-8160	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	CP052238	Klebsiella pneumoniae strain E17KP0029 plasmid pE17KP0029-3, complete sequence	8533-8564	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	CP052180	Klebsiella pneumoniae strain F16KP0045 plasmid pF16KP0045-2, complete sequence	5347-5378	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	CP052439	Klebsiella pneumoniae strain C16KP0108 plasmid pC16KP0108-5, complete sequence	4105-4136	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	CP052355	Klebsiella pneumoniae strain D16KP0146 plasmid pD17KP0032-3, complete sequence	7264-7295	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP054267	Klebsiella pneumoniae strain 39427 plasmid pKPN39427.3, complete sequence	44163-44194	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP026710	Citrobacter koseri strain AR_0024 plasmid unitig_1_pilon, complete sequence	5980-6011	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	CP052396	Klebsiella pneumoniae strain C17KP0040 plasmid pC17KP0040-3, complete sequence	9096-9127	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	CP052481	Klebsiella pneumoniae strain C16KP0050 plasmid pC16KP0050-5, complete sequence	673-704	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP032177	Klebsiella pneumoniae strain AR_0135 plasmid unnamed2, complete sequence	847-878	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP018431	Klebsiella pneumoniae strain MNCRE78 plasmid pMNCRE78_1, complete sequence	9411-9442	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	CP052318	Klebsiella pneumoniae strain E16KP0093 plasmid pE16KP0093-3, complete sequence	4070-4101	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP025252	Escherichia coli strain BH100 substr. MG2017 plasmid pApR, complete sequence	18012-18043	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	CP052473	Klebsiella pneumoniae strain C16KP0053 plasmid pC16KP0053-5, complete sequence	3195-3226	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP015384	Klebsiella pneumoniae strain CN1 plasmid pCN1_2, complete sequence	753-784	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP033818	Klebsiella aerogenes strain FDAARGOS_513 plasmid unnamed1, complete sequence	1991-2022	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP037930	Klebsiella pneumoniae subsp. pneumoniae strain KP-8788 plasmid p8788-IT, complete sequence	44087-44118	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP019010	Escherichia coli strain Ecol_AZ161 plasmid pECAZ161_KPC, complete sequence	38283-38314	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP021779	UNVERIFIED_ORG: Enterobacter cloacae strain AR_0053 plasmid unitig_4, complete sequence	8788-8819	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP015396	Klebsiella pneumoniae strain CR14 plasmid pCR14_4, complete sequence	59032-59063	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP027698	Klebsiella pneumoniae strain KP30835 plasmid unnamed3, complete sequence	7855-7886	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_LT985216	Escherichia coli strain 533 plasmid RCS12TR533_p, complete sequence	12065-12096	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_LT985257	Escherichia coli strain 580 plasmid RCS49_pIV, complete sequence	11924-11955	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	LC505458	Klebsiella pneumoniae A1-1 plasmid pColRNAI-Kp1-1 DNA, complete sequence	6233-6264	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	CP052497	Klebsiella pneumoniae strain B17KP0067 plasmid pB17KP0067-3, complete sequence	3050-3081	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_MH909340	Klebsiella pneumoniae strain A1763 plasmid pA1763-KPC, complete sequence	42843-42874	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_MH909332	Klebsiella pneumoniae strain A1731 plasmid pA1731-KPC, complete sequence	60993-61024	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_MH909338	Klebsiella pneumoniae strain A1759 plasmid pA1759-KPC, complete sequence	33113-33144	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_MF150119	Klebsiella pneumoniae strain A64477 plasmid pKP64477e, complete sequence	4531-4562	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_MF150124	Klebsiella pneumoniae strain A64216 plasmid pKP64216c, complete sequence	4929-4960	10	0.688
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP022075	Citrobacter koseri strain FDAARGOS_287 plasmid unnamed2, complete sequence	4412-4443	10	0.688
LR130759_18	18.1|5329584|31|LR130759|CRT	5329584-5329614	31	NZ_CP026093	Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence	835768-835798	10	0.677
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP013003	Caulobacter henricii strain CB4 plasmid pCB4, complete sequence	70337-70367	10	0.677
LR130759_18	18.3|5329698|31|LR130759|CRT	5329698-5329728	31	NZ_CP022306	Thalassococcus sp. S3 plasmid pS3C, complete sequence	2383-2413	10	0.677
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP045122	Rubrobacter sp. SCSIO 52915 plasmid unnamed1, complete sequence	164977-165008	10	0.688
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP020539	Sphingobium herbicidovorans strain MH plasmid pMSHV, complete sequence	14717-14748	10	0.688
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NZ_CP032347	Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence	650520-650551	10	0.688
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	HM486077	Tsukamurella phage TPA2, complete sequence	37484-37515	10	0.688
LR130759_19	19.1|5329937|32|LR130759|CRT	5329937-5329968	32	NC_015210	Tsukamurella phage TPA2, complete genome	37484-37515	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP023017	Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence	685839-685870	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP018348	Klebsiella pneumoniae strain CAV1417 plasmid pCAV1417-9294, complete sequence	6148-6179	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP018672	Klebsiella pneumoniae strain CAV1217 plasmid pCAV1217-9294, complete sequence	525-556	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	CP052171	Klebsiella pneumoniae strain F16KP0075 plasmid pF16KP0075-4, complete sequence	6291-6322	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP032199	Klebsiella pneumoniae strain AR_0097 plasmid unnamed5, complete sequence	8686-8717	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP022775	Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence	724892-724923	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	CP052486	Klebsiella pneumoniae strain C16KP0036 plasmid pC16KP0036-2, complete sequence	1622-1653	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP021756	Klebsiella pneumoniae strain AR_0113 plasmid unitig_5, complete sequence	1969-2000	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP023852	Escherichia coli strain 4/0 plasmid p4_0.3, complete sequence	2602-2633	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP018433	Klebsiella pneumoniae strain MNCRE53 plasmid pMNCRE53_1, complete sequence	9413-9444	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	CP052166	Klebsiella pneumoniae strain F16KP0082 plasmid pF16KP0082-4, complete sequence	3036-3067	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP018445	Klebsiella pneumoniae strain Kp_Goe_822917 plasmid pKp_Goe_917-4, complete sequence	594-625	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	CP052411	Klebsiella pneumoniae strain C17KP0008 plasmid pC17KP0008-4, complete sequence	468-499	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	CP052161	Klebsiella pneumoniae strain F16KP0084 plasmid pF16KP0084-3, complete sequence	5925-5956	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NC_014310	Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence	716424-716455	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP014648	Klebsiella pneumoniae strain KPNIH36 plasmid pKPN-821, complete sequence	39267-39298	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP011979	Klebsiella pneumoniae DMC1097 plasmid pDMC1097-20.222kb, complete sequence	15917-15948	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	CP052402	Klebsiella pneumoniae strain C17KP0039 plasmid pC17KP0039-3, complete sequence	5100-5131	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	CP052312	Klebsiella pneumoniae strain E16KP0102 plasmid pE16KP0102-3, complete sequence	9157-9188	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP010394	Klebsiella pneumoniae strain 34618 plasmid p34618-13.841kb, complete sequence	11129-11160	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP022762	Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence	620180-620211	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NC_009793	Citrobacter koseri ATCC BAA-895 plasmid pCKO3, complete sequence	8588-8619	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	CP052146	Klebsiella pneumoniae strain F17KP0012 plasmid pF17KP0012-3, complete sequence	8909-8940	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_LS992179	Citrobacter freundii isolate Citrobacter freundii str. E2614 plasmid 5, complete sequence	734-765	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP024884	Klebsiella aerogenes strain AR_0009 plasmid tig00000054_pilon, complete sequence	213-244	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP033630	Klebsiella pneumoniae strain 4743 plasmid unnamed5	7566-7597	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP033630	Klebsiella pneumoniae strain 4743 plasmid unnamed5	18546-18577	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP011988	Klebsiella pneumoniae UHKPC07 plasmid pUHKPC07-13.841kb, complete sequence	8340-8371	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	CP052360	Klebsiella pneumoniae strain D16KP0144 plasmid pD16KP0144-4, complete sequence	2368-2399	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP011982	Klebsiella pneumoniae 500_1420 plasmid p500_1420-51.662kb, complete sequence	32477-32508	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP011982	Klebsiella pneumoniae 500_1420 plasmid p500_1420-51.662kb, complete sequence	46317-46348	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP011984	Klebsiella pneumoniae 500_1420 plasmid p500_1420-13.838kb, complete sequence	8559-8590	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP020840	Klebsiella pneumoniae strain BK13043 plasmid pBK13043-3, complete sequence	5830-5861	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP011993	Klebsiella pneumoniae UHKPC33 plasmid pUHKPC33-13.841kb, complete sequence	7485-7516	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP027058	Klebsiella pneumoniae strain 2_GR_12 plasmid ColRNAI, complete sequence	4381-4412	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	CP052447	Klebsiella pneumoniae strain C16KP0098 plasmid pC16KP0098-4, complete sequence	8225-8256	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NC_018953	Klebsiella pneumoniae plasmid pIGMS32, complete sequence	360-391	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NC_019156	Klebsiella pneumoniae plasmid pAAC154, complete sequence	14307-14338	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NC_019159	Klebsiella pneumoniae plasmid ColEST258, complete sequence	7148-7179	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP018425	Klebsiella pneumoniae strain MNCRE69 plasmid pMNCRE69_1, complete sequence	9413-9444	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP032930	Klebsiella aerogenes strain AR_0062 plasmid unnamed5, complete sequence	2117-2148	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NC_021656	Klebsiella pneumoniae plasmid pKpQIL-SC29, complete sequence	40539-40570	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NC_021666	Klebsiella pneumoniae plasmid ColE-LS6, complete sequence	9039-9070	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP024651	Escherichia coli strain BH100 substr. MG2014 plasmid pAp, complete sequence	370-401	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	CP052418	Klebsiella pneumoniae strain C16KP0189 plasmid pC16KP0189-4, complete sequence	8008-8039	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP021837	Klebsiella pneumoniae strain AR_0120 plasmid tig00000601_pilon, complete sequence	12094-12125	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP045796	Klebsiella pneumoniae subsp. pneumoniae strain AUSMDU00008079 plasmid pAUSMDU00008079_04, complete sequence	8433-8464	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP007796	Azospirillum brasilense strain Az39 plasmid AbAZ39_p3, complete sequence	222922-222953	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP022921	Klebsiella pneumoniae strain ST307PT03 plasmid pJYC03B, complete sequence	1558-1589	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	CP052234	Klebsiella pneumoniae strain E17KP0033 plasmid pE17KP0033-3, complete sequence	3170-3201	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP046275	Enterobacter hormaechei strain E70 plasmid pE70-TEM1, complete sequence	5476-5507	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	CP052555	Klebsiella pneumoniae strain A17KP0038 plasmid pA17KP0038-4, complete sequence	5727-5758	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP014122	Klebsiella pneumoniae strain FDAARGOS_156 plasmid unnamed4, complete sequence	6888-6919	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP014122	Klebsiella pneumoniae strain FDAARGOS_156 plasmid unnamed4, complete sequence	19841-19872	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP031807	Klebsiella pneumoniae strain MSB1_8A-sc-2280397 plasmid unnamed7, complete sequence	9236-9267	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	CP052210	Klebsiella pneumoniae strain E17KP0085 plasmid pE17KP0085-3, complete sequence	1184-1215	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP023528	Citrobacter koseri strain FDAARGOS_393 plasmid unnamed, complete sequence	3791-3822	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP018353	Klebsiella pneumoniae strain CAV1453 plasmid pCAV1453-14, complete sequence	12063-12094	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP021548	Klebsiella pneumoniae strain AR_0112 plasmid tig00000005, complete sequence	12287-12318	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	CP052529	Klebsiella pneumoniae strain B16KP0177 plasmid pB16KP0177-5, complete sequence	5518-5549	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP021543	Klebsiella pneumoniae strain AR_0047 plasmid tig00000004, complete sequence	6977-7008	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP009877	Klebsiella pneumoniae subsp. pneumoniae strain KPNIH31 plasmid pAAC154-a9e, complete sequence	14111-14142	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP009772	Klebsiella pneumoniae subsp. pneumoniae strain KPNIH33 plasmid pEA1509_B, complete sequence	360-391	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP009778	Klebsiella pneumoniae subsp. pneumoniae strain KPNIH32 plasmid pKPN-c8b, complete sequence	14264-14295	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP008832	Klebsiella pneumoniae subsp. pneumoniae KPR0928 plasmid pKPN-294, complete sequence	13047-13078	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP008799	Klebsiella pneumoniae subsp. pneumoniae KPNIH24 plasmid pKPN-819, complete sequence	35132-35163	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP006928	Klebsiella pneumoniae 30660/NJST258_1 plasmid pNJST258N4, complete sequence	11026-11057	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP007728	Klebsiella pneumoniae subsp. pneumoniae KPNIH10 plasmid pAAC154-a50, complete sequence	14302-14333	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP006919	Klebsiella pneumoniae 30684/NJST258_2 plasmid pNJST258C2, complete sequence	14028-14059	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	CP052283	Klebsiella pneumoniae strain E16KP0224 plasmid pE16KP0224-3, complete sequence	2625-2656	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	CP052428	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-1, complete sequence	2059-2090	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	CP052548	Klebsiella pneumoniae strain B16KP0089 plasmid pB16KP0089-2, complete sequence	4254-4285	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP036449	Klebsiella pneumoniae strain KPNIH45 plasmid pKPC-610e, complete sequence	10150-10181	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP020066	Klebsiella pneumoniae strain AR_0117 plasmid unitig_5, complete sequence	1152-1183	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP020075	Klebsiella pneumoniae strain AR_0115 plasmid tig00000005, complete sequence	13850-13881	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP020112	Klebsiella pneumoniae strain AR_0098 plasmid tig00000004, complete sequence	10865-10896	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP015391	Klebsiella pneumoniae strain NY9 plasmid pNY9_6, complete sequence	935-966	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP036445	Klebsiella pneumoniae strain ABFPV plasmid tig00001273_pilon, complete sequence	2452-2483	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP050378	Klebsiella pneumoniae strain 51015 plasmid p51015_COL_RNAI, complete sequence	4598-4629	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP050378	Klebsiella pneumoniae strain 51015 plasmid p51015_COL_RNAI, complete sequence	14024-14055	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP031757	Klebsiella aerogenes strain FDAARGOS_327 plasmid unnamed1, complete sequence	6234-6265	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	CP052424	Klebsiella pneumoniae strain C16KP0164 plasmid pC16KP0164-2, complete sequence	1539-1570	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_LR130551	Klebsiella pneumoniae strain KPC2 isolate KPC2 plasmid 4	9804-9835	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP022576	Klebsiella pneumoniae strain BIC-1 plasmid pBIC-1c, complete sequence	883-914	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP024463	Klebsiella pneumoniae strain QS17-0161 plasmid pMRSN480738_10.0, complete sequence	3803-3834	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	CP052191	Klebsiella pneumoniae strain F16KP0019 plasmid pF16KP0019-2, complete sequence	865-896	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	CP052541	Klebsiella pneumoniae strain B16KP0141 plasmid pB16KP0141-4, complete sequence	5607-5638	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP021717	Klebsiella pneumoniae strain AR_0129 plasmid tig00000004, complete sequence	7095-7126	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	CP052536	Klebsiella pneumoniae strain B16KP0157 plasmid pB16KP0157-3, complete sequence	8473-8504	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP014703	Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence	619295-619326	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP021860	Klebsiella pneumoniae strain AR_0125 plasmid tig00000007_pilon, complete sequence	22626-22657	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP022760	Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence	617086-617117	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP022789	Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence	617076-617107	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP032835	Klebsiella pneumoniae strain INF237 plasmid pINF237_02, complete sequence	50145-50176	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP027052	Klebsiella pneumoniae strain 20_GR_12 plasmid ColRNAI, complete sequence	953-984	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	CP052305	Klebsiella pneumoniae strain E16KP0172 plasmid pE16KP0172-2, complete sequence	1385-1416	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP022771	Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence	620168-620199	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP022777	Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence	620186-620217	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP022799	Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence	620165-620196	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	CP052206	Klebsiella pneumoniae strain F16KP0002 plasmid pF16KP0002-3, complete sequence	7637-7668	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP036436	Citrobacter sp. ABFQG plasmid pKPC-5fbf, complete sequence	1838-1869	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP036441	Klebsiella pneumoniae strain ABFQB plasmid pKPC-5fbf, complete sequence	541-572	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NC_011382	Klebsiella pneumoniae plasmid 15S, complete sequence	8536-8567	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP025009	Klebsiella pneumoniae strain AUSMDU00008119 plasmid pAUSMDU8119-1, complete sequence	85158-85189	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NC_022083	Klebsiella pneumoniae JM45 plasmid p2, complete sequence	2036-2067	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP022918	Klebsiella pneumoniae strain ST307PT04 plasmid pJYC04B	8130-8161	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	CP052238	Klebsiella pneumoniae strain E17KP0029 plasmid pE17KP0029-3, complete sequence	8534-8565	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	CP052180	Klebsiella pneumoniae strain F16KP0045 plasmid pF16KP0045-2, complete sequence	5348-5379	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	CP052439	Klebsiella pneumoniae strain C16KP0108 plasmid pC16KP0108-5, complete sequence	4104-4135	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	CP052355	Klebsiella pneumoniae strain D16KP0146 plasmid pD17KP0032-3, complete sequence	7263-7294	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP022764	Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence	724956-724987	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP054267	Klebsiella pneumoniae strain 39427 plasmid pKPN39427.3, complete sequence	44164-44195	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP026710	Citrobacter koseri strain AR_0024 plasmid unitig_1_pilon, complete sequence	5981-6012	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	CP052396	Klebsiella pneumoniae strain C17KP0040 plasmid pC17KP0040-3, complete sequence	9097-9128	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	CP052481	Klebsiella pneumoniae strain C16KP0050 plasmid pC16KP0050-5, complete sequence	674-705	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP032177	Klebsiella pneumoniae strain AR_0135 plasmid unnamed2, complete sequence	846-877	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP018431	Klebsiella pneumoniae strain MNCRE78 plasmid pMNCRE78_1, complete sequence	9410-9441	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	CP052318	Klebsiella pneumoniae strain E16KP0093 plasmid pE16KP0093-3, complete sequence	4071-4102	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP025252	Escherichia coli strain BH100 substr. MG2017 plasmid pApR, complete sequence	18013-18044	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	CP052473	Klebsiella pneumoniae strain C16KP0053 plasmid pC16KP0053-5, complete sequence	3194-3225	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP015384	Klebsiella pneumoniae strain CN1 plasmid pCN1_2, complete sequence	752-783	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP033818	Klebsiella aerogenes strain FDAARGOS_513 plasmid unnamed1, complete sequence	1990-2021	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP037930	Klebsiella pneumoniae subsp. pneumoniae strain KP-8788 plasmid p8788-IT, complete sequence	44088-44119	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP019010	Escherichia coli strain Ecol_AZ161 plasmid pECAZ161_KPC, complete sequence	38284-38315	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP022797	Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence	724956-724987	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP021779	UNVERIFIED_ORG: Enterobacter cloacae strain AR_0053 plasmid unitig_4, complete sequence	8789-8820	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP015396	Klebsiella pneumoniae strain CR14 plasmid pCR14_4, complete sequence	59031-59062	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP027698	Klebsiella pneumoniae strain KP30835 plasmid unnamed3, complete sequence	7854-7885	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_LT985216	Escherichia coli strain 533 plasmid RCS12TR533_p, complete sequence	12064-12095	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_LT985257	Escherichia coli strain 580 plasmid RCS49_pIV, complete sequence	11925-11956	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	LC505458	Klebsiella pneumoniae A1-1 plasmid pColRNAI-Kp1-1 DNA, complete sequence	6232-6263	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	CP052497	Klebsiella pneumoniae strain B17KP0067 plasmid pB17KP0067-3, complete sequence	3049-3080	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_MH909340	Klebsiella pneumoniae strain A1763 plasmid pA1763-KPC, complete sequence	42844-42875	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_MH909332	Klebsiella pneumoniae strain A1731 plasmid pA1731-KPC, complete sequence	60992-61023	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_MH909338	Klebsiella pneumoniae strain A1759 plasmid pA1759-KPC, complete sequence	33114-33145	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_MF150119	Klebsiella pneumoniae strain A64477 plasmid pKP64477e, complete sequence	4530-4561	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_MF150124	Klebsiella pneumoniae strain A64216 plasmid pKP64216c, complete sequence	4928-4959	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP022075	Citrobacter koseri strain FDAARGOS_287 plasmid unnamed2, complete sequence	4411-4442	10	0.688
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP022758	Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence	724942-724973	10	0.688
LR130759_20	20.1|5490160|31|LR130759|CRISPRCasFinder	5490160-5490190	31	NZ_LR594692	Variovorax sp. WDL1 plasmid 4	84200-84230	10	0.677
LR130759_12	12.3|4362478|37|LR130759|CRT	4362478-4362514	37	NZ_CP016613	Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence	1035866-1035902	11	0.703
LR130759_12	12.3|4362478|37|LR130759|CRT	4362478-4362514	37	NZ_CP022781	Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence	369321-369357	11	0.703
LR130759_12	12.3|4362478|37|LR130759|CRT	4362478-4362514	37	NZ_CP022766	Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence	1664505-1664541	11	0.703
LR130759_12	12.3|4362478|37|LR130759|CRT	4362478-4362514	37	NZ_CP052069	Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence	1595042-1595078	11	0.703
LR130759_12	12.3|4362478|37|LR130759|CRT	4362478-4362514	37	NZ_CP016905	Ralstonia solanacearum strain KACC 10709 plasmid unnamed1	580811-580847	11	0.703
LR130759_12	12.3|4362478|37|LR130759|CRT	4362478-4362514	37	NZ_CP022769	Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence	1673106-1673142	11	0.703
LR130759_12	12.3|4362478|37|LR130759|CRT	4362478-4362514	37	NZ_CP022773	Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence	1381605-1381641	11	0.703
LR130759_12	12.3|4362478|37|LR130759|CRT	4362478-4362514	37	NZ_CP022791	Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence	1632161-1632197	11	0.703
LR130759_12	12.3|4362478|37|LR130759|CRT	4362478-4362514	37	NZ_CP022779	Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence	1684586-1684622	11	0.703
LR130759_12	12.3|4362478|37|LR130759|CRT	4362478-4362514	37	NZ_CP022793	Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence	1589547-1589583	11	0.703
LR130759_12	12.3|4362478|37|LR130759|CRT	4362478-4362514	37	NZ_CP022785	Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence	1570194-1570230	11	0.703
LR130759_12	12.3|4362478|37|LR130759|CRT	4362478-4362514	37	NZ_CP022787	Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence	1625189-1625225	11	0.703
LR130759_12	12.3|4362478|37|LR130759|CRT	4362478-4362514	37	NZ_CP022756	Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence	1662343-1662379	11	0.703
LR130759_17	17.5|5329107|37|LR130759|CRT	5329107-5329143	37	NZ_CP023976	Streptomyces alboflavus strain MDJK44 plasmid pMDJK44.1, complete sequence	54909-54945	11	0.703
LR130759_17	17.12|5329344|32|LR130759|CRT	5329344-5329375	32	NZ_CP022306	Thalassococcus sp. S3 plasmid pS3C, complete sequence	2383-2414	11	0.656
LR130759_18	18.5|5329815|37|LR130759|CRT	5329815-5329851	37	NZ_CP023976	Streptomyces alboflavus strain MDJK44 plasmid pMDJK44.1, complete sequence	54909-54945	11	0.703
LR130759_19	19.3|5330051|32|LR130759|CRT	5330051-5330082	32	NZ_CP022306	Thalassococcus sp. S3 plasmid pS3C, complete sequence	2382-2413	11	0.656
LR130759_14	14.4|5303641|39|LR130759|CRISPRCasFinder	5303641-5303679	39	NC_016586	Azospirillum lipoferum 4B plasmid AZO_p2, complete sequence	348932-348970	12	0.692
LR130759_14	14.4|5303641|39|LR130759|CRISPRCasFinder	5303641-5303679	39	NZ_CP029832	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence	222459-222497	12	0.692

1. spacer 9.18|3084540|22|LR130759|CRT matches to MH153804 (Rhodococcus phage Jace, complete genome) position: , mismatch: 1, identity: 0.955

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacggcggcag	Protospacer
*********************.

2. spacer 9.18|3084540|22|LR130759|CRT matches to NZ_CP025508 (Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvB, complete sequence) position: , mismatch: 1, identity: 0.955

gcaacaccggcaacggcggcaa	CRISPR spacer
gcatcaccggcaacggcggcaa	Protospacer
*** ******************

3. spacer 9.18|3084540|22|LR130759|CRT matches to NZ_CP022667 (Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR2, complete sequence) position: , mismatch: 1, identity: 0.955

gcaacaccggcaacggcggcaa	CRISPR spacer
gcatcaccggcaacggcggcaa	Protospacer
*** ******************

4. spacer 9.18|3084540|22|LR130759|CRT matches to NZ_CP050087 (Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b5, complete sequence) position: , mismatch: 1, identity: 0.955

gcaacaccggcaacggcggcaa	CRISPR spacer
gcatcaccggcaacggcggcaa	Protospacer
*** ******************

5. spacer 12.6|4362679|22|LR130759|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 1, identity: 0.955

gggcggcatgggcggcgacggc	CRISPR spacer
gggcggcacgggcggcgacggc	Protospacer
********.*************

6. spacer 12.6|4362679|22|LR130759|CRT matches to NZ_CP020331 (Martelella mediterranea DSM 17316 strain MACL11 plasmid pMM593, complete sequence) position: , mismatch: 1, identity: 0.955

gggcggcatgggcggcgacggc	CRISPR spacer
gggcggcgtgggcggcgacggc	Protospacer
*******.**************

7. spacer 12.6|4362679|22|LR130759|CRT matches to KY555147 (Caulobacter phage Ccr34, complete genome) position: , mismatch: 1, identity: 0.955

gggcggcatgggcggcgacggc	CRISPR spacer
gggcggcatgggcggcggcggc	Protospacer
*****************.****

8. spacer 12.6|4362679|22|LR130759|CRT matches to KY555145 (Caulobacter phage Ccr29, complete genome) position: , mismatch: 1, identity: 0.955

gggcggcatgggcggcgacggc	CRISPR spacer
gggcggcatgggcggcggcggc	Protospacer
*****************.****

9. spacer 12.6|4362679|22|LR130759|CRT matches to KY555143 (Caulobacter phage Ccr2, complete genome) position: , mismatch: 1, identity: 0.955

gggcggcatgggcggcgacggc	CRISPR spacer
gggcggcatgggcggcggcggc	Protospacer
*****************.****

10. spacer 12.6|4362679|22|LR130759|CRT matches to MH779505 (Mycobacterium phage Grizzly, complete genome) position: , mismatch: 1, identity: 0.955

gggcggcatgggcggcgacggc	CRISPR spacer
gggcggcatgggcggcgccggc	Protospacer
***************** ****

11. spacer 12.6|4362679|22|LR130759|CRT matches to KY555146 (Caulobacter phage Ccr32, complete genome) position: , mismatch: 1, identity: 0.955

gggcggcatgggcggcgacggc	CRISPR spacer
gggcggcatgggcggcggcggc	Protospacer
*****************.****

12. spacer 12.6|4362679|22|LR130759|CRT matches to KY555144 (Caulobacter phage Ccr5, complete genome) position: , mismatch: 1, identity: 0.955

gggcggcatgggcggcgacggc	CRISPR spacer
gggcggcatgggcggcggcggc	Protospacer
*****************.****

13. spacer 12.6|4362679|22|LR130759|CRT matches to JX163858 (Caulobacter phage phiCbK, complete genome) position: , mismatch: 1, identity: 0.955

gggcggcatgggcggcgacggc	CRISPR spacer
gggcggcatgggcggcggcggc	Protospacer
*****************.****

14. spacer 12.6|4362679|22|LR130759|CRT matches to KY555142 (Caulobacter phage Ccr10, complete genome) position: , mismatch: 1, identity: 0.955

gggcggcatgggcggcgacggc	CRISPR spacer
gggcggcatgggcggcggcggc	Protospacer
*****************.****

15. spacer 8.15|3078614|22|LR130759|CRT matches to NZ_CP050953 (Rhodococcus sp. DMU1 plasmid unnamed) position: , mismatch: 2, identity: 0.909

gcaacatcggcaccggcggaag	CRISPR spacer
ccaacatcggcaccggcggcag	Protospacer
 ****************** **

16. spacer 9.15|3084357|22|LR130759|CRT matches to NZ_CP050953 (Rhodococcus sp. DMU1 plasmid unnamed) position: , mismatch: 2, identity: 0.909

gcaacatcggcaccggcggaag	CRISPR spacer
ccaacatcggcaccggcggcag	Protospacer
 ****************** **

17. spacer 9.18|3084540|22|LR130759|CRT matches to NZ_CP026282 (Klebsiella oxytoca strain KONIH2 plasmid pKOR-e3cb, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacggcggctg	Protospacer
******************** .

18. spacer 9.18|3084540|22|LR130759|CRT matches to NZ_CP018351 (Klebsiella pneumoniae strain CAV1417 plasmid pCAV1417-185, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacggcggctg	Protospacer
******************** .

19. spacer 9.18|3084540|22|LR130759|CRT matches to NZ_CP050074 (Enterobacter kobei strain 070 plasmid p070, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacggcggctg	Protospacer
******************** .

20. spacer 9.18|3084540|22|LR130759|CRT matches to NZ_CP050837 (Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-3, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacggcggctg	Protospacer
******************** .

21. spacer 9.18|3084540|22|LR130759|CRT matches to NZ_KX839208 (Klebsiella pneumoniae strain KP1814 plasmid pKP1814-2, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacggcggctg	Protospacer
******************** .

22. spacer 9.18|3084540|22|LR130759|CRT matches to NZ_CP023418 (Klebsiella pneumoniae strain 1050 plasmid pKp1050-2, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacggcggctg	Protospacer
******************** .

23. spacer 9.18|3084540|22|LR130759|CRT matches to NZ_CP026276 (Klebsiella oxytoca strain KONIH5 plasmid pKOR-ab4d, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacggcggctg	Protospacer
******************** .

24. spacer 9.18|3084540|22|LR130759|CRT matches to NZ_LN824135 (Klebsiella pneumoniae genome assembly MS6671.v1, plasmid : _Plasmid_B_Kpneumoniae_MS6671) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacggcggctg	Protospacer
******************** .

25. spacer 9.18|3084540|22|LR130759|CRT matches to NZ_CP026237 (Citrobacter freundii complex sp. CFNIH3 plasmid pCFR-9161, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacggcggctg	Protospacer
******************** .

26. spacer 9.18|3084540|22|LR130759|CRT matches to NZ_CP028954 (Klebsiella pneumoniae strain AR_0141 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacggcggctg	Protospacer
******************** .

27. spacer 9.18|3084540|22|LR130759|CRT matches to NZ_CP020842 (Klebsiella pneumoniae strain KPN1482 plasmid pKPN1482-1, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacggcggctg	Protospacer
******************** .

28. spacer 9.18|3084540|22|LR130759|CRT matches to NZ_CP022274 (Citrobacter freundii strain 18-1 plasmid pA18-1, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacggcggctg	Protospacer
******************** .

29. spacer 9.18|3084540|22|LR130759|CRT matches to MN310380 (Raoultella ornithinolytica strain 170602815 plasmid p602815-NR, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacggcggctg	Protospacer
******************** .

30. spacer 9.18|3084540|22|LR130759|CRT matches to NZ_CP015502 (Klebsiella pneumoniae strain SKGH01 plasmid unnamed 2, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacggcggctg	Protospacer
******************** .

31. spacer 9.18|3084540|22|LR130759|CRT matches to NZ_CP025213 (Klebsiella pneumoniae strain HZW25 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacggcggctg	Protospacer
******************** .

32. spacer 9.18|3084540|22|LR130759|CRT matches to NZ_CP033823 (Klebsiella sp. FDAARGOS_511 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacggcggctg	Protospacer
******************** .

33. spacer 9.18|3084540|22|LR130759|CRT matches to NZ_CP012571 (Klebsiella pneumoniae strain UCLAOXA232KP plasmid pUCLAOXA232-5.X, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacggcggctg	Protospacer
******************** .

34. spacer 9.18|3084540|22|LR130759|CRT matches to NZ_CP042513 (Serratia marcescens strain E28 plasmid pE28_001, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacggcggctg	Protospacer
******************** .

35. spacer 9.18|3084540|22|LR130759|CRT matches to NZ_CP026208 (Escherichia coli strain ECONIH5 plasmid pECO-109b, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacggcggctg	Protospacer
******************** .

36. spacer 9.18|3084540|22|LR130759|CRT matches to NZ_CP036193 (Klebsiella pneumoniae strain BA34918 plasmid pIncFIBpQil, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacggcggctg	Protospacer
******************** .

37. spacer 9.18|3084540|22|LR130759|CRT matches to NZ_CP026179 (Klebsiella pneumoniae strain KPNIH49 plasmid pKPC-224e, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacggcggctg	Protospacer
******************** .

38. spacer 9.18|3084540|22|LR130759|CRT matches to CP052526 (Klebsiella pneumoniae strain B16KP0177 plasmid pB16KP0177-2, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacggcggctg	Protospacer
******************** .

39. spacer 9.18|3084540|22|LR130759|CRT matches to NZ_AP019689 (Klebsiella quasipneumoniae strain SNI47 plasmid pTMSNI47-2, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacggcggctg	Protospacer
******************** .

40. spacer 9.18|3084540|22|LR130759|CRT matches to NZ_CP028551 (Klebsiella variicola strain WCHKP19 plasmid p3_020019, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacggcggctg	Protospacer
******************** .

41. spacer 9.18|3084540|22|LR130759|CRT matches to NC_022609 (Klebsiella pneumoniae strain N11-0042 plasmid pKp11-42, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacggcggctg	Protospacer
******************** .

42. spacer 9.18|3084540|22|LR130759|CRT matches to NZ_CP048380 (Klebsiella variicola strain 118 plasmid p118_A, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacggcggctg	Protospacer
******************** .

43. spacer 9.18|3084540|22|LR130759|CRT matches to NZ_CP026397 (Klebsiella pneumoniae strain KPNIH48 plasmid pKPN-10f7, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacggcggctg	Protospacer
******************** .

44. spacer 9.18|3084540|22|LR130759|CRT matches to NZ_CP012566 (Klebsiella pneumoniae strain UCLAOXA232KP plasmid pUCLAOXA232-5, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacggcggctg	Protospacer
******************** .

45. spacer 9.18|3084540|22|LR130759|CRT matches to NZ_CP024516 (Klebsiella pneumoniae strain KSB1_10J plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacggcggctg	Protospacer
******************** .

46. spacer 9.18|3084540|22|LR130759|CRT matches to NZ_CP035907 (Klebsiella pneumoniae strain BA4656 plasmid pIncFIBpQil, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacggcggctg	Protospacer
******************** .

47. spacer 9.18|3084540|22|LR130759|CRT matches to NZ_CP034132 (Klebsiella quasipneumoniae strain G4584 plasmid pG4584_81.9Kb, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacggcggctg	Protospacer
******************** .

48. spacer 9.18|3084540|22|LR130759|CRT matches to NZ_CP024431 (Klebsiella pneumoniae strain DA48896 plasmid p48896_2, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacggcggctg	Protospacer
******************** .

49. spacer 9.18|3084540|22|LR130759|CRT matches to NC_021198 (Klebsiella pneumoniae subsp. pneumoniae KPX plasmid pKPX-1 DNA, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacggcggctg	Protospacer
******************** .

50. spacer 9.18|3084540|22|LR130759|CRT matches to CP052538 (Klebsiella pneumoniae strain B16KP0141 plasmid pB16KP0141-1, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacggcggctg	Protospacer
******************** .

51. spacer 9.18|3084540|22|LR130759|CRT matches to NZ_CP045678 (Klebsiella pneumoniae strain WSD411 plasmid pWSD411_5, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacggcggctg	Protospacer
******************** .

52. spacer 9.18|3084540|22|LR130759|CRT matches to CP052441 (Klebsiella pneumoniae strain C16KP0102 plasmid pC16KP0102-1, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacggcggctg	Protospacer
******************** .

53. spacer 9.18|3084540|22|LR130759|CRT matches to NZ_CP026212 (Citrobacter sp. CFNIH10 plasmid pCIT-a850, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacggcggctg	Protospacer
******************** .

54. spacer 9.18|3084540|22|LR130759|CRT matches to NZ_CP013340 (Raoultella ornithinolytica strain Yangling I2 plasmid pKPYL2, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacggcggctg	Protospacer
******************** .

55. spacer 9.18|3084540|22|LR130759|CRT matches to NZ_CP024500 (Klebsiella pneumoniae strain KSB1_4E plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacggcggctg	Protospacer
******************** .

56. spacer 9.18|3084540|22|LR130759|CRT matches to NZ_CP029724 (Klebsiella pneumoniae strain AR_0140 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacggcggctg	Protospacer
******************** .

57. spacer 9.18|3084540|22|LR130759|CRT matches to NZ_CP034140 (Klebsiella quasipneumoniae subsp. similipneumoniae strain G747 plasmid pG747_84.1Kb, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacggcggctg	Protospacer
******************** .

58. spacer 9.18|3084540|22|LR130759|CRT matches to NZ_CP011634 (Klebsiella oxytoca strain CAV1374 plasmid pCAV1374-228, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacggcggctg	Protospacer
******************** .

59. spacer 9.18|3084540|22|LR130759|CRT matches to NZ_CP024508 (Klebsiella pneumoniae strain KSB2_1B plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacggcggctg	Protospacer
******************** .

60. spacer 9.18|3084540|22|LR130759|CRT matches to NZ_CP024509 (Klebsiella pneumoniae strain KSB2_1B plasmid unnamed3, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacggcggctg	Protospacer
******************** .

61. spacer 9.18|3084540|22|LR130759|CRT matches to NZ_CP032189 (Klebsiella pneumoniae strain AR_0075 plasmid unnamed4, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacggcggctg	Protospacer
******************** .

62. spacer 9.18|3084540|22|LR130759|CRT matches to NZ_CP018361 (Klebsiella oxytoca strain CAV1752 plasmid pCAV1752-278, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacggcggctg	Protospacer
******************** .

63. spacer 9.18|3084540|22|LR130759|CRT matches to NZ_CP026234 (Citrobacter freundii complex sp. CFNIH4 plasmid pCFR-4109, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacggcggctg	Protospacer
******************** .

64. spacer 9.18|3084540|22|LR130759|CRT matches to CP052499 (Klebsiella pneumoniae strain B17KP0021 plasmid pB17KP0021-1, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacggcggctg	Protospacer
******************** .

65. spacer 9.18|3084540|22|LR130759|CRT matches to NZ_CP021698 (Klebsiella pneumoniae strain AR_0158 plasmid tig00000183, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacggcggctg	Protospacer
******************** .

66. spacer 9.18|3084540|22|LR130759|CRT matches to NZ_CP024483 (Klebsiella pneumoniae strain INF322 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacggcggctg	Protospacer
******************** .

67. spacer 9.18|3084540|22|LR130759|CRT matches to NZ_CP026716 (Klebsiella oxytoca strain AR_0028 plasmid unitig_1_pilon, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacggcggctg	Protospacer
******************** .

68. spacer 9.18|3084540|22|LR130759|CRT matches to CP052243 (Klebsiella pneumoniae strain E17KP0019 plasmid pE17KP0019-2, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacggcggctg	Protospacer
******************** .

69. spacer 9.18|3084540|22|LR130759|CRT matches to NZ_CP021758 (Klebsiella pneumoniae strain AR_0138 plasmid tig00000001, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacggcggctg	Protospacer
******************** .

70. spacer 9.18|3084540|22|LR130759|CRT matches to MK649823 (Klebsiella pneumoniae strain BA6740 plasmid pBA6740_1, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacggcggctg	Protospacer
******************** .

71. spacer 9.18|3084540|22|LR130759|CRT matches to NZ_CP014763 (Klebsiella pneumoniae strain KPNIH39 plasmid pKPN-332, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacggcggctg	Protospacer
******************** .

72. spacer 9.18|3084540|22|LR130759|CRT matches to NZ_CP044111 (Klebsiella michiganensis strain FDAARGOS_647 plasmid unnamed2) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacggcggctg	Protospacer
******************** .

73. spacer 9.18|3084540|22|LR130759|CRT matches to CP052337 (Klebsiella pneumoniae strain D17KP0018 plasmid pD17KP0018-1, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacggcggctg	Protospacer
******************** .

74. spacer 9.18|3084540|22|LR130759|CRT matches to NZ_CP016810 (Klebsiella pneumoniae strain DHQP1002001 plasmid p_IncFIB_DHQP1002001, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacggcggctg	Protospacer
******************** .

75. spacer 9.18|3084540|22|LR130759|CRT matches to NZ_MH056209 (Enterobacter cloacae strain NRZ-10170 plasmid pNRZ-10170-LMB-1, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacggcggctg	Protospacer
******************** .

76. spacer 9.18|3084540|22|LR130759|CRT matches to NZ_CP032893 (Enterobacter kobei strain WCHEK045523 plasmid p1_045523, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacggcggctg	Protospacer
******************** .

77. spacer 9.18|3084540|22|LR130759|CRT matches to NZ_KY271404 (Klebsiella pneumoniae strain Kp-48 plasmid pKPN3-307_typeA, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacggcggctg	Protospacer
******************** .

78. spacer 9.18|3084540|22|LR130759|CRT matches to NZ_KY271406 (Klebsiella pneumoniae strain H150820806 plasmid pKPN3-307_TypeC, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacggcggctg	Protospacer
******************** .

79. spacer 9.18|3084540|22|LR130759|CRT matches to NZ_MF788070 (Raoultella ornithinolytica strain 23141 plasmid p23141-2, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacggcggctg	Protospacer
******************** .

80. spacer 9.18|3084540|22|LR130759|CRT matches to NZ_CP032323 (Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
ccaacaccggcaacggcagcaa	Protospacer
 ****************.****

81. spacer 9.18|3084540|22|LR130759|CRT matches to NZ_MN366357 (Bacterium plasmid pALTS28, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
ccaacaccggcagcggcggcaa	Protospacer
 ***********.*********

82. spacer 9.18|3084540|22|LR130759|CRT matches to NZ_CP020047 (Thiomonas intermedia strain ATCC 15466 plasmid pXI1, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
ccaacaccggcagcggcggcaa	Protospacer
 ***********.*********

83. spacer 9.18|3084540|22|LR130759|CRT matches to NZ_CP022363 (Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacgccggcac	Protospacer
*************** ***** 

84. spacer 9.18|3084540|22|LR130759|CRT matches to MF495477 (Aeromonas salmonicida plasmid pS28-3, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
ccaacaccggcagcggcggcaa	Protospacer
 ***********.*********

85. spacer 9.18|3084540|22|LR130759|CRT matches to NZ_CP007795 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
ccaacaccggcaacggcagcaa	Protospacer
 ****************.****

86. spacer 9.18|3084540|22|LR130759|CRT matches to NZ_CP007795 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacgccggcac	Protospacer
*************** ***** 

87. spacer 9.18|3084540|22|LR130759|CRT matches to KJ850907 (Uncultured bacterium plasmid pSFA231, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
ccaacaccggcagcggcggcaa	Protospacer
 ***********.*********

88. spacer 9.18|3084540|22|LR130759|CRT matches to NZ_CP032347 (Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
ccaacaccggcaacggcagcaa	Protospacer
 ****************.****

89. spacer 9.18|3084540|22|LR130759|CRT matches to NZ_CP032347 (Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcaacaccggcaacgccggcac	Protospacer
*************** ***** 

90. spacer 9.18|3084540|22|LR130759|CRT matches to MF668282 (Gordonia phage ShayRa, complete genome) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
ccaacaccggcaagggcggcaa	Protospacer
 ************ ********

91. spacer 9.18|3084540|22|LR130759|CRT matches to KY379511 (Pseudoalteromonas phage PHS21, complete genome) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
gcagcaccggcaacggcggcag	Protospacer
***.*****************.

92. spacer 9.18|3084540|22|LR130759|CRT matches to NC_030698 (Gordonia phage Soups, complete genome) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
ccaacaccggcaagggcggcaa	Protospacer
 ************ ********

93. spacer 9.18|3084540|22|LR130759|CRT matches to KU998251 (Gordonia phage KatherineG, complete genome) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
ccaacaccggcaagggcggcaa	Protospacer
 ************ ********

94. spacer 9.18|3084540|22|LR130759|CRT matches to NC_042123 (Gordonia phage Waits, complete genome) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
ccaacaccggcaagggcggcaa	Protospacer
 ************ ********

95. spacer 9.18|3084540|22|LR130759|CRT matches to MN284898 (Gordonia phage MinecraftSteve, complete genome) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
ccaacaccggcaagggcggcaa	Protospacer
 ************ ********

96. spacer 9.18|3084540|22|LR130759|CRT matches to NC_030694 (Gordonia phage Rosalind, complete genome) position: , mismatch: 2, identity: 0.909

gcaacaccggcaacggcggcaa	CRISPR spacer
ccaacaccggcaagggcggcaa	Protospacer
 ************ ********

97. spacer 12.6|4362679|22|LR130759|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 2, identity: 0.909

gggcggcatgggcggcgacggc	CRISPR spacer
cggcggcaggggcggcgacggc	Protospacer
 ******* *************

98. spacer 12.6|4362679|22|LR130759|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 2, identity: 0.909

gggcggcatgggcggcgacggc	CRISPR spacer
cggcggcaagggcggcgacggc	Protospacer
 ******* *************

99. spacer 12.6|4362679|22|LR130759|CRT matches to NZ_CP020331 (Martelella mediterranea DSM 17316 strain MACL11 plasmid pMM593, complete sequence) position: , mismatch: 2, identity: 0.909

gggcggcatgggcggcgacggc	CRISPR spacer
cggcggcacgggcggcgacggc	Protospacer
 *******.*************

100. spacer 12.6|4362679|22|LR130759|CRT matches to NZ_CP032686 (Rhizobium sp. CCGE531 plasmid pRCCGE531c, complete sequence) position: , mismatch: 2, identity: 0.909

gggcggcatgggcggcgacggc	CRISPR spacer
tgccggcatgggcggcgacggc	Protospacer
 * *******************

101. spacer 12.6|4362679|22|LR130759|CRT matches to NZ_CP039697 (Novosphingobium sp. ABRDHK2 plasmid pABRDHK22, complete sequence) position: , mismatch: 2, identity: 0.909

gggcggcatgggcggcgacggc	CRISPR spacer
gggcggcatgggcggccacggg	Protospacer
**************** **** 

102. spacer 12.6|4362679|22|LR130759|CRT matches to NZ_CP032691 (Rhizobium sp. CCGE532 plasmid pRCCGE532c, complete sequence) position: , mismatch: 2, identity: 0.909

gggcggcatgggcggcgacggc	CRISPR spacer
tgccggcatgggcggcgacggc	Protospacer
 * *******************

103. spacer 12.6|4362679|22|LR130759|CRT matches to NZ_LR134465 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 23, complete sequence) position: , mismatch: 2, identity: 0.909

gggcggcatgggcggcgacggc	CRISPR spacer
gggcggcatgtgcggcgacggg	Protospacer
********** ********** 

104. spacer 12.6|4362679|22|LR130759|CRT matches to NZ_CP025613 (Niveispirillum cyanobacteriorum strain TH16 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.909

gggcggcatgggcggcgacggc	CRISPR spacer
cggtggcatgggcggcgacggc	Protospacer
 **.******************

105. spacer 12.6|4362679|22|LR130759|CRT matches to NZ_CP024895 (Amycolatopsis sp. AA4 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.909

gggcggcatgggcggcgacggc	CRISPR spacer
cggcggcctgggcggcgacggc	Protospacer
 ****** **************

106. spacer 12.6|4362679|22|LR130759|CRT matches to NZ_CP018230 (Rhizobium leguminosarum strain Vaf-108 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.909

gggcggcatgggcggcgacggc	CRISPR spacer
cggcggcatgggcggcggcggc	Protospacer
 ****************.****

107. spacer 12.6|4362679|22|LR130759|CRT matches to NC_012858 (Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132502, complete sequence) position: , mismatch: 2, identity: 0.909

gggcggcatgggcggcgacggc	CRISPR spacer
aggcggcttgggcggcgacggc	Protospacer
.****** **************

108. spacer 12.6|4362679|22|LR130759|CRT matches to NZ_CP051294 (Mesorhizobium sp. NZP2077 plasmid pMSNZP2077A, complete sequence) position: , mismatch: 2, identity: 0.909

gggcggcatgggcggcgacggc	CRISPR spacer
tggcggcatgggcggcggcggc	Protospacer
 ****************.****

109. spacer 12.6|4362679|22|LR130759|CRT matches to NZ_CP032297 (Rahnella aquatilis strain ZF7 plasmid pRAZF7, complete sequence) position: , mismatch: 2, identity: 0.909

gggcggcatgggcggcgacggc	CRISPR spacer
gcgcggcatgggcggcgacggt	Protospacer
* *******************.

110. spacer 12.6|4362679|22|LR130759|CRT matches to NC_017060 (Rahnella aquatilis HX2 plasmid PRA1, complete sequence) position: , mismatch: 2, identity: 0.909

gggcggcatgggcggcgacggc	CRISPR spacer
gcgcggcatgggcggcgacggt	Protospacer
* *******************.

111. spacer 12.6|4362679|22|LR130759|CRT matches to NZ_CP029833 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed3, complete sequence) position: , mismatch: 2, identity: 0.909

gggcggcatgggcggcgacggc	CRISPR spacer
cggcggcatgggcggcgaaggc	Protospacer
 ***************** ***

112. spacer 12.6|4362679|22|LR130759|CRT matches to NZ_AP022333 (Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49a, complete sequence) position: , mismatch: 2, identity: 0.909

gggcggcatgggcggcgacggc	CRISPR spacer
cggcggcatgggcggcggcggc	Protospacer
 ****************.****

113. spacer 12.6|4362679|22|LR130759|CRT matches to NZ_AP022333 (Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49a, complete sequence) position: , mismatch: 2, identity: 0.909

gggcggcatgggcggcgacggc	CRISPR spacer
cggcggcataggcggcgacggc	Protospacer
 ********.************

114. spacer 12.6|4362679|22|LR130759|CRT matches to NZ_CP029358 (Azospirillum sp. CFH 70021 plasmid unnamed3) position: , mismatch: 2, identity: 0.909

gggcggcatgggcggcgacggc	CRISPR spacer
gggcggcatgggcggcgaccgt	Protospacer
******************* *.

115. spacer 12.6|4362679|22|LR130759|CRT matches to NZ_CP039965 (Pseudorhodobacter sp. S12M18 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.909

gggcggcatgggcggcgacggc	CRISPR spacer
gggcggcatgggcggcggcggg	Protospacer
*****************.*** 

116. spacer 12.6|4362679|22|LR130759|CRT matches to NC_015062 (Rahnella sp. Y9602 plasmid pRAHAQ01, complete sequence) position: , mismatch: 2, identity: 0.909

gggcggcatgggcggcgacggc	CRISPR spacer
gcgcggcatgggcggcgacggt	Protospacer
* *******************.

117. spacer 12.6|4362679|22|LR130759|CRT matches to NZ_CP039644 (Azospirillum sp. TSA2s plasmid p2, complete sequence) position: , mismatch: 2, identity: 0.909

gggcggcatgggcggcgacggc	CRISPR spacer
tggcggcataggcggcgacggc	Protospacer
 ********.************

118. spacer 12.6|4362679|22|LR130759|CRT matches to NZ_CP033363 (Mesorhizobium sp. NZP2077 plasmid pMSNZP2077NSa, complete sequence) position: , mismatch: 2, identity: 0.909

gggcggcatgggcggcgacggc	CRISPR spacer
tggcggcatgggcggcggcggc	Protospacer
 ****************.****

119. spacer 12.6|4362679|22|LR130759|CRT matches to NC_011758 (Methylorubrum extorquens CM4 plasmid pCMU01, complete sequence) position: , mismatch: 2, identity: 0.909

gggcggcatgggcggcgacggc	CRISPR spacer
cggcggcatgggcggcgacagc	Protospacer
 ******************.**

120. spacer 12.6|4362679|22|LR130759|CRT matches to NZ_CP034838 (Rahnella aquatilis strain KM12 plasmid pKM12v1, complete sequence) position: , mismatch: 2, identity: 0.909

gggcggcatgggcggcgacggc	CRISPR spacer
gcgcggcatgggcggcgacggt	Protospacer
* *******************.

121. spacer 12.6|4362679|22|LR130759|CRT matches to NZ_CP034839 (Rahnella aquatilis strain KM25 plasmid pKM12v2, complete sequence) position: , mismatch: 2, identity: 0.909

gggcggcatgggcggcgacggc	CRISPR spacer
gcgcggcatgggcggcgacggt	Protospacer
* *******************.

122. spacer 12.6|4362679|22|LR130759|CRT matches to NZ_CP034837 (Rahnella aquatilis strain KM05 plasmid pKM05, complete sequence) position: , mismatch: 2, identity: 0.909

gggcggcatgggcggcgacggc	CRISPR spacer
gcgcggcatgggcggcgacggt	Protospacer
* *******************.

123. spacer 12.6|4362679|22|LR130759|CRT matches to NZ_CP043439 (Cupriavidus campinensis strain MJ1 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.909

gggcggcatgggcggcgacggc	CRISPR spacer
gggcggcatgggcggcggcggg	Protospacer
*****************.*** 

124. spacer 12.6|4362679|22|LR130759|CRT matches to NC_019408 (Caulobacter phage CcrRogue, complete genome) position: , mismatch: 2, identity: 0.909

gggcggcatgggcggcgacggc	CRISPR spacer
cggcggcatgggcggcggcggc	Protospacer
 ****************.****

125. spacer 12.6|4362679|22|LR130759|CRT matches to MH588544 (Caulobacter phage CcrBL10, complete genome) position: , mismatch: 2, identity: 0.909

gggcggcatgggcggcgacggc	CRISPR spacer
gggcggcatgggcggcggcggt	Protospacer
*****************.***.

126. spacer 12.6|4362679|22|LR130759|CRT matches to MH727561 (Mycobacterium phage Serendipitous, complete genome) position: , mismatch: 2, identity: 0.909

gggcggcatgggcggcgacggc	CRISPR spacer
gggcggcaagggcggcgacggt	Protospacer
******** ************.

127. spacer 17.4|5329053|22|LR130759|CRT matches to NZ_CP016083 (Streptomyces sp. SAT1 plasmid unnamed3, complete sequence) position: , mismatch: 2, identity: 0.909

gcacgggcgccgtcggcgatgc	CRISPR spacer
acaccggcgccgtcggcgatgc	Protospacer
.*** *****************

128. spacer 17.4|5329053|22|LR130759|CRT matches to NZ_CP011046 (Clavibacter michiganensis subsp. insidiosus strain R1-1 plasmid pCI3, complete sequence) position: , mismatch: 2, identity: 0.909

gcacgggcgccgtcggcgatgc	CRISPR spacer
gcacgggcgccgtcgacgatgg	Protospacer
***************.***** 

129. spacer 17.4|5329053|22|LR130759|CRT matches to NZ_CP011045 (Clavibacter michiganensis subsp. insidiosus strain R1-1 plasmid pCI2, complete sequence) position: , mismatch: 2, identity: 0.909

gcacgggcgccgtcggcgatgc	CRISPR spacer
gcacgggcgccgtcgacgatgg	Protospacer
***************.***** 

130. spacer 17.4|5329053|22|LR130759|CRT matches to NZ_CP021036 (Clavibacter michiganensis subsp. insidiosus strain R1-3 plasmid pCI2, complete sequence) position: , mismatch: 2, identity: 0.909

gcacgggcgccgtcggcgatgc	CRISPR spacer
gcacgggcgccgtcgacgatgg	Protospacer
***************.***** 

131. spacer 17.4|5329053|22|LR130759|CRT matches to NZ_CP021037 (Clavibacter michiganensis subsp. insidiosus strain R1-3 plasmid pCI3, complete sequence) position: , mismatch: 2, identity: 0.909

gcacgggcgccgtcggcgatgc	CRISPR spacer
gcacgggcgccgtcgacgatgg	Protospacer
***************.***** 

132. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP020440 (Paracoccus yeei strain FDAARGOS_252 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
tcggcggcggcacgggcgccgtc	Protospacer
.*******.**************

133. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP031080 (Paracoccus yeei strain CCUG 32053 plasmid pYEE2, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
tcggcggcggcacgggcgccgtc	Protospacer
.*******.**************

134. spacer 17.7|5329044|23|LR130759|CRT matches to CP023013 (Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcacgcgcgccgcc	Protospacer
************** ******.*

135. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP049790 (Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcacgcgcgccgcc	Protospacer
************** ******.*

136. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP024582 (Roseomonas sp. FDAARGOS_362 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcaggagcgccgtc	Protospacer
************ *.********

137. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP022766 (Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcacgcgcgccgcc	Protospacer
************** ******.*

138. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP021763 (Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcacgcgcgccgcc	Protospacer
************** ******.*

139. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP042515 (Serratia marcescens strain E28 plasmid pE28_003) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggccgcacgcgcgccgtc	Protospacer
******** ***** ********

140. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP015116 (Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcacgcgcgccgcc	Protospacer
************** ******.*

141. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP016555 (Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcacgcgcgccgcc	Protospacer
************** ******.*

142. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP052069 (Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcacgcgcgccgcc	Protospacer
************** ******.*

143. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP010630 (Phaeobacter inhibens strain P78 plasmid pP78_a, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcaatacgggcgccgtc	Protospacer
*********..************

144. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP016915 (Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcacgcgcgccgcc	Protospacer
************** ******.*

145. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP016905 (Ralstonia solanacearum strain KACC 10709 plasmid unnamed1) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcacgcgcgccgcc	Protospacer
************** ******.*

146. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP022769 (Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcacgcgcgccgcc	Protospacer
************** ******.*

147. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP022773 (Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcacgcgcgccgcc	Protospacer
************** ******.*

148. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP022783 (Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcacgcgcgccgcc	Protospacer
************** ******.*

149. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP022791 (Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcacgcgcgccgcc	Protospacer
************** ******.*

150. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP022795 (Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcacgcgcgccgcc	Protospacer
************** ******.*

151. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP052071 (Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcacgcgcgccgcc	Protospacer
************** ******.*

152. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP009763 (Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcacgcgcgccgcc	Protospacer
************** ******.*

153. spacer 17.7|5329044|23|LR130759|CRT matches to CP023015 (Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcacgcgcgccgcc	Protospacer
************** ******.*

154. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP022779 (Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcacgcgcgccgcc	Protospacer
************** ******.*

155. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP052075 (Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcacgcgcgccgcc	Protospacer
************** ******.*

156. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP052085 (Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcacgcgcgccgcc	Protospacer
************** ******.*

157. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP052095 (Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcacgcgcgccgcc	Protospacer
************** ******.*

158. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP052105 (Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcacgcgcgccgcc	Protospacer
************** ******.*

159. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP021765 (Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcacgcgcgccgcc	Protospacer
************** ******.*

160. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP052077 (Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcacgcgcgccgcc	Protospacer
************** ******.*

161. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP052087 (Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcacgcgcgccgcc	Protospacer
************** ******.*

162. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP052097 (Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcacgcgcgccgcc	Protospacer
************** ******.*

163. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP052115 (Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcacgcgcgccgcc	Protospacer
************** ******.*

164. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP052127 (Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcacgcgcgccgcc	Protospacer
************** ******.*

165. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP025552 (Streptomyces rimosus strain WT5260 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccgccggcagcaccggcgccgtc	Protospacer
*** ********* *********

166. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP052079 (Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcacgcgcgccgcc	Protospacer
************** ******.*

167. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP052089 (Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcacgcgcgccgcc	Protospacer
************** ******.*

168. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP052093 (Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcacgcgcgccgcc	Protospacer
************** ******.*

169. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP052101 (Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcacgcgcgccgcc	Protospacer
************** ******.*

170. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP052099 (Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcacgcgcgccgcc	Protospacer
************** ******.*

171. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP052107 (Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcacgcgcgccgcc	Protospacer
************** ******.*

172. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP022781 (Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcacgcgcgccgcc	Protospacer
************** ******.*

173. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP052117 (Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcacgcgcgccgcc	Protospacer
************** ******.*

174. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP052125 (Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcacgcgcgccgcc	Protospacer
************** ******.*

175. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP022793 (Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcacgcgcgccgcc	Protospacer
************** ******.*

176. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP022785 (Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcacgcgcgccgcc	Protospacer
************** ******.*

177. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP022787 (Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcacgcgcgccgcc	Protospacer
************** ******.*

178. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP022756 (Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcacgcgcgccgcc	Protospacer
************** ******.*

179. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP052129 (Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcacgcgcgccgcc	Protospacer
************** ******.*

180. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP052121 (Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcacgcgcgccgcc	Protospacer
************** ******.*

181. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP052123 (Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcacgcgcgccgcc	Protospacer
************** ******.*

182. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP052131 (Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcacgcgcgccgcc	Protospacer
************** ******.*

183. spacer 17.7|5329044|23|LR130759|CRT matches to CP011998 (Ralstonia solanacearum strain YC45 plasmid, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcacgcgcgccgcc	Protospacer
************** ******.*

184. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP052073 (Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcacgcgcgccgcc	Protospacer
************** ******.*

185. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP052081 (Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcacgcgcgccgcc	Protospacer
************** ******.*

186. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP052083 (Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcacgcgcgccgcc	Protospacer
************** ******.*

187. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP052109 (Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcacgcgcgccgcc	Protospacer
************** ******.*

188. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP052091 (Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcacgcgcgccgcc	Protospacer
************** ******.*

189. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP052103 (Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcacgcgcgccgcc	Protospacer
************** ******.*

190. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP052119 (Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcacgcgcgccgcc	Protospacer
************** ******.*

191. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP013369 (Burkholderia ubonensis strain RF23-BP41 plasmid pRF23, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcacgggcggcatc	Protospacer
****************** *.**

192. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP016613 (Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcacgcgcgccgcc	Protospacer
************** ******.*

193. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP010612 (Phaeobacter inhibens strain P92 plasmid pP92_b, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcaatacgggcgccgtc	Protospacer
*********..************

194. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP010624 (Phaeobacter inhibens strain P51 plasmid pP51_a, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcaatacgggcgccgtc	Protospacer
*********..************

195. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP021449 (Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcacgcgcgccgcc	Protospacer
************** ******.*

196. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP010669 (Phaeobacter inhibens strain P57 plasmid pP57_a, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcaatacgggcgccgtc	Protospacer
*********..************

197. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP049794 (Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcacgcgcgccgcc	Protospacer
************** ******.*

198. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP049788 (Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcacgcgcgccgcc	Protospacer
************** ******.*

199. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP049792 (Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcacgcgcgccgcc	Protospacer
************** ******.*

200. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcacgcgcgccgcc	Protospacer
************** ******.*

201. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP015851 (Ralstonia solanacearum strain YC40-M plasmid, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcacgcgcgccgcc	Protospacer
************** ******.*

202. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP031953 (Phaeobacter inhibens strain 2.10 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcaatacgggcgccgtc	Protospacer
*********..************

203. spacer 17.7|5329044|23|LR130759|CRT matches to NC_018421 (Phaeobacter inhibens 2.10 plasmid pPGA2_239, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcaatacgggcgccgtc	Protospacer
*********..************

204. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP022482 (Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcacgcgcgccgcc	Protospacer
************** ******.*

205. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP010742 (Phaeobacter inhibens strain P59 plasmid pP59_a, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcaatacgggcgccgtc	Protospacer
*********..************

206. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP010618 (Phaeobacter inhibens strain P30 isolate M4-3.1A plasmid pP30_a, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcaatacgggcgccgtc	Protospacer
*********..************

207. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP010726 (Phaeobacter inhibens strain P88 plasmid pP88_a, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcaatacgggcgccgtc	Protospacer
*********..************

208. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP010651 (Phaeobacter inhibens strain P54 plasmid pP54_a, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcaatacgggcgccgtc	Protospacer
*********..************

209. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP030829 (Neorhizobium sp. NCHU2750 plasmid pNCHU2750b, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcaccggcgccttc	Protospacer
************* ****** **

210. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP010697 (Phaeobacter inhibens strain P24 plasmid pP24_a, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcaatacgggcgccgtc	Protospacer
*********..************

211. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP010746 (Phaeobacter inhibens strain P48 isolate M21-2.3 plasmid pP48_a, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcaatacgggcgccgtc	Protospacer
*********..************

212. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP019308 (Phaeobacter inhibens strain DOK1-1 plasmid pDOK1-1-1, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcaatacgggcgccgtc	Protospacer
*********..************

213. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP052111 (Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcacgcgcgccgcc	Protospacer
************** ******.*

214. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP052113 (Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcacgcgcgccgcc	Protospacer
************** ******.*

215. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP025188 (Roseomonas mucosa strain AD2 plasmid p1-AD2, complete sequence) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcggcagcaggagcgccgtc	Protospacer
************ *.********

216. spacer 17.7|5329044|23|LR130759|CRT matches to MF140416 (Mycobacterium phage LastHope, complete genome) position: , mismatch: 2, identity: 0.913

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggcgccagcgcgggcgccgtc	Protospacer
****** ****.***********

217. spacer 17.13|5329407|23|LR130759|CRT matches to NZ_CP015203 (Rhodococcus sp. 008 plasmid pR8L1, complete sequence) position: , mismatch: 2, identity: 0.913

gcacgggcgccgtcggcgatgcg	CRISPR spacer
gctcgggcgccctcggcgatgcg	Protospacer
** ******** ***********

218. spacer 17.13|5329407|23|LR130759|CRT matches to NZ_CP040453 (Halomonas sp. PA16-9 plasmid p_unnamed2, complete sequence) position: , mismatch: 2, identity: 0.913

gcacgggcgccgtcggcgatgcg	CRISPR spacer
gcgcgggcgccgtaggcgatgcg	Protospacer
**.********** *********

219. spacer 17.13|5329407|23|LR130759|CRT matches to KJ410133 (Mycobacterium phage Jolie2, complete genome) position: , mismatch: 2, identity: 0.913

gcacgggcgccgtcggcgatgcg	CRISPR spacer
gcacgggcgccggcggcgatccg	Protospacer
************ ******* **

220. spacer 18.4|5329761|22|LR130759|CRT matches to NZ_CP016083 (Streptomyces sp. SAT1 plasmid unnamed3, complete sequence) position: , mismatch: 2, identity: 0.909

gcacgggcgccgtcggcgatgc	CRISPR spacer
acaccggcgccgtcggcgatgc	Protospacer
.*** *****************

221. spacer 18.4|5329761|22|LR130759|CRT matches to NZ_CP011046 (Clavibacter michiganensis subsp. insidiosus strain R1-1 plasmid pCI3, complete sequence) position: , mismatch: 2, identity: 0.909

gcacgggcgccgtcggcgatgc	CRISPR spacer
gcacgggcgccgtcgacgatgg	Protospacer
***************.***** 

222. spacer 18.4|5329761|22|LR130759|CRT matches to NZ_CP011045 (Clavibacter michiganensis subsp. insidiosus strain R1-1 plasmid pCI2, complete sequence) position: , mismatch: 2, identity: 0.909

gcacgggcgccgtcggcgatgc	CRISPR spacer
gcacgggcgccgtcgacgatgg	Protospacer
***************.***** 

223. spacer 18.4|5329761|22|LR130759|CRT matches to NZ_CP021036 (Clavibacter michiganensis subsp. insidiosus strain R1-3 plasmid pCI2, complete sequence) position: , mismatch: 2, identity: 0.909

gcacgggcgccgtcggcgatgc	CRISPR spacer
gcacgggcgccgtcgacgatgg	Protospacer
***************.***** 

224. spacer 18.4|5329761|22|LR130759|CRT matches to NZ_CP021037 (Clavibacter michiganensis subsp. insidiosus strain R1-3 plasmid pCI3, complete sequence) position: , mismatch: 2, identity: 0.909

gcacgggcgccgtcggcgatgc	CRISPR spacer
gcacgggcgccgtcgacgatgg	Protospacer
***************.***** 

225. spacer 12.6|4362679|22|LR130759|CRT matches to MN856085 (Myoviridae sp. isolate 322, complete genome) position: , mismatch: 3, identity: 0.864

gggcggcatgggcggcgacggc	CRISPR spacer
cggcggcatgggcggcgacgca	Protospacer
 *******************  

226. spacer 13.2|5303059|24|LR130759|CRISPRCasFinder matches to NZ_CP019037 (Massilia putida strain 6NM-7 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.875

ccagcccgccggcgccaccggtac	CRISPR spacer
ccagcccgccggcgccaccagcgc	Protospacer
*******************.*..*

227. spacer 13.2|5303059|24|LR130759|CRISPRCasFinder matches to NZ_CP029834 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed4, complete sequence) position: , mismatch: 3, identity: 0.875

ccagcccgccggcgccaccggtac	CRISPR spacer
ccagcccgccggcgcaaccggacc	Protospacer
*************** *****  *

228. spacer 13.2|5303059|24|LR130759|CRISPRCasFinder matches to NZ_CP038636 (Cupriavidus oxalaticus strain X32 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

ccagcccgccggcgccaccggtac	CRISPR spacer
ccagcccgccggcgccatcggcat	Protospacer
*****************.***.*.

229. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP024424 (Paracoccus yeei strain TT13 plasmid pTT13-2, complete sequence) position: , mismatch: 3, identity: 0.87

ccggcggcagcacgggcgccgtc	CRISPR spacer
ttggcggcggcacgggcgccgtc	Protospacer
..******.**************

230. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP034351 (Streptomyces sp. W1SF4 plasmid p1, complete sequence) position: , mismatch: 3, identity: 0.87

ccggcggcagcacgggcgccgtc	CRISPR spacer
gcggcggcagcacgggcgccccc	Protospacer
 ******************* .*

231. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_AP014579 (Burkholderia sp. RPE67 plasmid p1, complete sequence) position: , mismatch: 3, identity: 0.87

ccggcggcagcacgggcgccgtc	CRISPR spacer
tgggcggcagcacgggcgcggtc	Protospacer
. ***************** ***

232. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP054616 (Azospirillum oryzae strain KACC 14407 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.87

ccggcggcagcacgggcgccgtc	CRISPR spacer
ccggccgcagcacgggcgccggg	Protospacer
***** ***************  

233. spacer 17.7|5329044|23|LR130759|CRT matches to NZ_CP044082 (Paracoccus yeei strain FDAARGOS_643 plasmid unnamed4, complete sequence) position: , mismatch: 3, identity: 0.87

ccggcggcagcacgggcgccgtc	CRISPR spacer
ttggcggcggcacgggcgccgtc	Protospacer
..******.**************

234. spacer 17.13|5329407|23|LR130759|CRT matches to NZ_CP016083 (Streptomyces sp. SAT1 plasmid unnamed3, complete sequence) position: , mismatch: 3, identity: 0.87

gcacgggcgccgtcggcgatgcg	CRISPR spacer
acaccggcgccgtcggcgatgcc	Protospacer
.*** ***************** 

235. spacer 17.13|5329407|23|LR130759|CRT matches to NZ_CP046101 (Rhodococcus sp. AQ5-07 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.87

gcacgggcgccgtcggcgatgcg	CRISPR spacer
cgacgggggccgtcggcgatgcg	Protospacer
  ***** ***************

236. spacer 17.13|5329407|23|LR130759|CRT matches to NZ_CP011046 (Clavibacter michiganensis subsp. insidiosus strain R1-1 plasmid pCI3, complete sequence) position: , mismatch: 3, identity: 0.87

gcacgggcgccgtcggcgatgcg	CRISPR spacer
gcacgggcgccgtcgacgatgga	Protospacer
***************.***** .

237. spacer 17.13|5329407|23|LR130759|CRT matches to NZ_CP011045 (Clavibacter michiganensis subsp. insidiosus strain R1-1 plasmid pCI2, complete sequence) position: , mismatch: 3, identity: 0.87

gcacgggcgccgtcggcgatgcg	CRISPR spacer
gcacgggcgccgtcgacgatgga	Protospacer
***************.***** .

238. spacer 17.13|5329407|23|LR130759|CRT matches to NZ_CP021036 (Clavibacter michiganensis subsp. insidiosus strain R1-3 plasmid pCI2, complete sequence) position: , mismatch: 3, identity: 0.87

gcacgggcgccgtcggcgatgcg	CRISPR spacer
gcacgggcgccgtcgacgatgga	Protospacer
***************.***** .

239. spacer 17.13|5329407|23|LR130759|CRT matches to NZ_CP021037 (Clavibacter michiganensis subsp. insidiosus strain R1-3 plasmid pCI3, complete sequence) position: , mismatch: 3, identity: 0.87

gcacgggcgccgtcggcgatgcg	CRISPR spacer
gcacgggcgccgtcgacgatgga	Protospacer
***************.***** .

240. spacer 19.4|5330114|23|LR130759|CRT matches to NZ_CP011046 (Clavibacter michiganensis subsp. insidiosus strain R1-1 plasmid pCI3, complete sequence) position: , mismatch: 3, identity: 0.87

agcacgggcgccgtcggcgatgc	CRISPR spacer
ggcacgggcgccgtcgacgatgg	Protospacer
.***************.***** 

241. spacer 19.4|5330114|23|LR130759|CRT matches to NZ_CP011045 (Clavibacter michiganensis subsp. insidiosus strain R1-1 plasmid pCI2, complete sequence) position: , mismatch: 3, identity: 0.87

agcacgggcgccgtcggcgatgc	CRISPR spacer
ggcacgggcgccgtcgacgatgg	Protospacer
.***************.***** 

242. spacer 19.4|5330114|23|LR130759|CRT matches to NZ_CP021036 (Clavibacter michiganensis subsp. insidiosus strain R1-3 plasmid pCI2, complete sequence) position: , mismatch: 3, identity: 0.87

agcacgggcgccgtcggcgatgc	CRISPR spacer
ggcacgggcgccgtcgacgatgg	Protospacer
.***************.***** 

243. spacer 19.4|5330114|23|LR130759|CRT matches to NZ_CP021037 (Clavibacter michiganensis subsp. insidiosus strain R1-3 plasmid pCI3, complete sequence) position: , mismatch: 3, identity: 0.87

agcacgggcgccgtcggcgatgc	CRISPR spacer
ggcacgggcgccgtcgacgatgg	Protospacer
.***************.***** 

244. spacer 19.4|5330114|23|LR130759|CRT matches to NZ_CP016083 (Streptomyces sp. SAT1 plasmid unnamed3, complete sequence) position: , mismatch: 3, identity: 0.87

agcacgggcgccgtcggcgatgc	CRISPR spacer
gacaccggcgccgtcggcgatgc	Protospacer
..*** *****************

245. spacer 13.2|5303059|24|LR130759|CRISPRCasFinder matches to NZ_AP022611 (Mycolicibacterium madagascariense strain JCM 13574 plasmid pJCM13574) position: , mismatch: 4, identity: 0.833

ccagcccgccggcgccaccggtac	CRISPR spacer
ccagcccaccggcgccaccggcga	Protospacer
*******.*************.. 

246. spacer 17.8|5329098|29|LR130759|CRT matches to MK291445 (Paracoccus phage vB_PyeM_Pyei1, complete genome) position: , mismatch: 4, identity: 0.862

ccggcggtcagggaggccagggcggtcag	CRISPR spacer
tcggcggtcagggaggccagggcgtcccg	Protospacer
.*********************** .* *

247. spacer 17.8|5329098|29|LR130759|CRT matches to NZ_LN832562 (Paracoccus aminovorans isolate JCM7685 plasmid IV, complete sequence) position: , mismatch: 4, identity: 0.862

ccggcggtcagggaggccagggcggtcag	CRISPR spacer
gcggcggtcagggtggccagggtggtcaa	Protospacer
 ************ ********.*****.

248. spacer 17.8|5329098|29|LR130759|CRT matches to KX987127 (Thermus phage G20c, complete genome) position: , mismatch: 4, identity: 0.862

ccggcggtcagggaggccagggcggtcag	CRISPR spacer
ccggcggccagggaggccagggtggccgg	Protospacer
*******.**************.**.*.*

249. spacer 17.10|5329230|32|LR130759|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 4, identity: 0.875

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
ccggcggcgccggcggcacgggcgggaccggc	Protospacer
**..**** ********.**************

250. spacer 17.10|5329230|32|LR130759|CRT matches to NZ_CP029832 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.875

ccaacggc-tccggcggcgcgggcgggaccggc	CRISPR spacer
-tggcggcttccggcggcgcgggcgggaccggc	Protospacer
 ...**** ************************

251. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 4, identity: 0.871

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccggcggcgccggcggcacgggcgggaccgg	Protospacer
**..**** ********.*************

252. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP029832 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.871

ccaacggc-tccggcggcgcgggcgggaccgg	CRISPR spacer
-tggcggcttccggcggcgcgggcgggaccgg	Protospacer
 ...**** ***********************

253. spacer 17.3|5328990|31|LR130759|CRT matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 5, identity: 0.839

ccggcggccaagcaggcgccggcgg--agcagg	CRISPR spacer
cgggcggcgaagcaggagccggcggtcagca--	Protospacer
* ****** ******* ********  ****  

254. spacer 17.3|5328990|31|LR130759|CRT matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 5, identity: 0.839

ccggcggccaagcaggcgccggcgg--agcagg	CRISPR spacer
cgggcggcgaagcaggagccggcggtcagca--	Protospacer
* ****** ******* ********  ****  

255. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP012477 (Arthrobacter sp. ERGS1:01 isolate water plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.839

ccggcggccaagcaggcgccggcggagcagg-	CRISPR spacer
gcggcggccacggaggcgccggc-gatcaggt	Protospacer
 ********* * ********** ** **** 

256. spacer 17.8|5329098|29|LR130759|CRT matches to KT001914 (Caulobacter phage Seuss, complete genome) position: , mismatch: 5, identity: 0.828

ccggcggtcagggaggccagggcggtcag	CRISPR spacer
tcggcggtcagggcggtcagggcggtcga	Protospacer
.************ **.**********..

257. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP016613 (Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
*** **** **************** ..***

258. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP021449 (Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
*** **** **************** ..***

259. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP026091 (Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
*** **** **************** ..***

260. spacer 18.1|5329584|31|LR130759|CRT matches to NC_014309 (Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
*** **** **************** ..***

261. spacer 18.1|5329584|31|LR130759|CRT matches to CP023013 (Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
*** **** **************** ..***

262. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP021653 (Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
*** **** **************** ..***

263. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP049790 (Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggtgtcgg	Protospacer
*** **** **************** ..***

264. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP049794 (Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggtgtcgg	Protospacer
*** **** **************** ..***

265. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP049788 (Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
*** **** **************** ..***

266. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP022766 (Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
*** **** **************** ..***

267. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP021763 (Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
*** **** **************** ..***

268. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP026093 (Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
*** **** **************** ..***

269. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP021767 (Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
*** **** **************** ..***

270. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP015116 (Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
*** **** **************** ..***

271. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP016555 (Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
*** **** **************** ..***

272. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP012688 (Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
*** **** **************** ..***

273. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP049792 (Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggtgtcgg	Protospacer
*** **** **************** ..***

274. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP052069 (Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
*** **** **************** ..***

275. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP016915 (Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggtgtcgg	Protospacer
*** **** **************** ..***

276. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP016905 (Ralstonia solanacearum strain KACC 10709 plasmid unnamed1) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
*** **** **************** ..***

277. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
*** **** **************** ..***

278. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP022769 (Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
*** **** **************** ..***

279. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP015851 (Ralstonia solanacearum strain YC40-M plasmid, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
*** **** **************** ..***

280. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP022773 (Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
*** **** **************** ..***

281. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP022783 (Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
*** **** **************** ..***

282. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP022791 (Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
*** **** **************** ..***

283. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP022795 (Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
*** **** **************** ..***

284. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP052071 (Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
*** **** **************** ..***

285. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP022482 (Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
*** **** **************** ..***

286. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP009763 (Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
*** **** **************** ..***

287. spacer 18.1|5329584|31|LR130759|CRT matches to CP023015 (Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
*** **** **************** ..***

288. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP022779 (Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
*** **** **************** ..***

289. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP052075 (Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
*** **** **************** ..***

290. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP052085 (Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
*** **** **************** ..***

291. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP052095 (Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggtgtcgg	Protospacer
*** **** **************** ..***

292. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP052105 (Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
*** **** **************** ..***

293. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP021765 (Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
*** **** **************** ..***

294. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP052077 (Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
*** **** **************** ..***

295. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP052087 (Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
*** **** **************** ..***

296. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP052097 (Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggtgtcgg	Protospacer
*** **** **************** ..***

297. spacer 18.1|5329584|31|LR130759|CRT matches to CP047139 (Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
*** **** **************** ..***

298. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP052115 (Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
*** **** **************** ..***

299. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP052127 (Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
*** **** **************** ..***

300. spacer 18.1|5329584|31|LR130759|CRT matches to CP047137 (Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
*** **** **************** ..***

301. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP052079 (Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
*** **** **************** ..***

302. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP052089 (Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
*** **** **************** ..***

303. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP052093 (Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggtgtcgg	Protospacer
*** **** **************** ..***

304. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP052101 (Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggtgtcgg	Protospacer
*** **** **************** ..***

305. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP052099 (Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggtgtcgg	Protospacer
*** **** **************** ..***

306. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP052107 (Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
*** **** **************** ..***

307. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP022781 (Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
*** **** **************** ..***

308. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP052117 (Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
*** **** **************** ..***

309. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP052125 (Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
*** **** **************** ..***

310. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP022793 (Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
*** **** **************** ..***

311. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP022785 (Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
*** **** **************** ..***

312. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP022787 (Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
*** **** **************** ..***

313. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP022756 (Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
*** **** **************** ..***

314. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP052129 (Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggtgtcgg	Protospacer
*** **** **************** ..***

315. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP052121 (Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
*** **** **************** ..***

316. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP052123 (Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
*** **** **************** ..***

317. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP052131 (Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
*** **** **************** ..***

318. spacer 18.1|5329584|31|LR130759|CRT matches to CP011998 (Ralstonia solanacearum strain YC45 plasmid, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
*** **** **************** ..***

319. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP052073 (Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
*** **** **************** ..***

320. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP052081 (Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
*** **** **************** ..***

321. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP052083 (Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
*** **** **************** ..***

322. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP052109 (Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
*** **** **************** ..***

323. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP052091 (Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggtgtcgg	Protospacer
*** **** **************** ..***

324. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP052111 (Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggtgtcgg	Protospacer
*** **** **************** ..***

325. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP052103 (Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
*** **** **************** ..***

326. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP052119 (Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
*** **** **************** ..***

327. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP052113 (Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.839

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggcaccggcggcgcgggcggtgtcgg	Protospacer
*** **** **************** ..***

328. spacer 18.3|5329698|31|LR130759|CRT matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 5, identity: 0.839

ccggcggccaagcaggcgccggcgg--agcagg	CRISPR spacer
cgggcggcgaagcaggagccggcggtcagca--	Protospacer
* ****** ******* ********  ****  

329. spacer 18.3|5329698|31|LR130759|CRT matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 5, identity: 0.839

ccggcggccaagcaggcgccggcgg--agcagg	CRISPR spacer
cgggcggcgaagcaggagccggcggtcagca--	Protospacer
* ****** ******* ********  ****  

330. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP012477 (Arthrobacter sp. ERGS1:01 isolate water plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.839

ccggcggccaagcaggcgccggcggagcagg-	CRISPR spacer
gcggcggccacggaggcgccggc-gatcaggt	Protospacer
 ********* * ********** ** **** 

331. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP029832 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.844

accaacggc-tccggcggcgcgggcgggaccgg	CRISPR spacer
-ttggcggcttccggcggcgcgggcgggaccgg	Protospacer
 ....**** ***********************

332. spacer 2.1|587586|33|LR130759|CRISPRCasFinder matches to NZ_CP017563 (Paraburkholderia sprentiae WSM5005 plasmid pl1WSM5005, complete sequence) position: , mismatch: 6, identity: 0.818

---gcgttgaaggtgccggtgttgaagtcgccggcg	CRISPR spacer
agcgcgt---aggtgccgttgttgatgtcgccggtg	Protospacer
   ****   ******** ****** ********.*

333. spacer 4.1|680629|33|LR130759|PILER-CR matches to MF417939 (Uncultured Caudovirales phage clone 7S_2, partial genome) position: , mismatch: 6, identity: 0.818

gtgccgaa--cagctgaccgccgttgccgccgcga	CRISPR spacer
--cccgaaaccagctgcccgccgttgtcgccgcgc	Protospacer
   *****  ****** *********.******* 

334. spacer 17.3|5328990|31|LR130759|CRT matches to NC_012586 (Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence) position: , mismatch: 6, identity: 0.806

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gcccgggccaagctggcggcggcggagcagg	Protospacer
 *   ******** **** ************

335. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP010016 (Burkholderia thailandensis 34 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.806

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
cgagcggccaagcaggcgccggggcagacgg	Protospacer
* .******************* * **  **

336. spacer 17.8|5329098|29|LR130759|CRT matches to NZ_CP018784 (Curtobacterium pusillum strain AA3 plasmid pCPAA3, complete sequence) position: , mismatch: 6, identity: 0.793

ccggcggtcagggaggccagggcggtcag	CRISPR spacer
gtcgcggccagggagggcagggcggtctg	Protospacer
 . ****.******** ********** *

337. spacer 17.10|5329230|32|LR130759|CRT matches to NZ_LN832560 (Paracoccus aminovorans isolate JCM7685 plasmid II, complete sequence) position: , mismatch: 6, identity: 0.812

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
tggtcggcgccggcggcgcggccgggaccggc	Protospacer
. . **** ************ **********

338. spacer 17.10|5329230|32|LR130759|CRT matches to NZ_AP022333 (Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49a, complete sequence) position: , mismatch: 6, identity: 0.812

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
ggggcggctccggcggcgcgggcgggctcggc	Protospacer
  ..********************** .****

339. spacer 17.10|5329230|32|LR130759|CRT matches to MF668280 (Mycobacterium phage Phabba, complete genome) position: , mismatch: 6, identity: 0.812

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
agcacggctccggcggcgcgagcgagaccgcc	Protospacer
   *****************.***.***** *

340. spacer 17.10|5329230|32|LR130759|CRT matches to NC_023316 (Streptomyces sp. 14R-10 plasmid pZL1, complete sequence) position: , mismatch: 6, identity: 0.812

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
cctccggctccggcggcgggggcgggagcttc	Protospacer
**  ************** ******** *  *

341. spacer 17.12|5329344|32|LR130759|CRT matches to NC_012586 (Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence) position: , mismatch: 6, identity: 0.812

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
gcccgggccaagctggcggcggcggagcaggc	Protospacer
 *   ******** **** *************

342. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP012477 (Arthrobacter sp. ERGS1:01 isolate water plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.812

ccggcggccaagcaggcgccggcggagcaggc-	CRISPR spacer
gcggcggccacggaggcgccggc-gatcaggtt	Protospacer
 ********* * ********** ** ****. 

343. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_LN832560 (Paracoccus aminovorans isolate JCM7685 plasmid II, complete sequence) position: , mismatch: 6, identity: 0.806

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
tggtcggcgccggcggcgcggccgggaccgg	Protospacer
. . **** ************ *********

344. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_AP022333 (Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49a, complete sequence) position: , mismatch: 6, identity: 0.806

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ggggcggctccggcggcgcgggcgggctcgg	Protospacer
  ..********************** .***

345. spacer 18.1|5329584|31|LR130759|CRT matches to MF668280 (Mycobacterium phage Phabba, complete genome) position: , mismatch: 6, identity: 0.806

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
agcacggctccggcggcgcgagcgagaccgc	Protospacer
   *****************.***.***** 

346. spacer 18.1|5329584|31|LR130759|CRT matches to NC_023714 (Mycobacterium phage LinStu, complete genome) position: , mismatch: 6, identity: 0.806

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
cgcacggctccggcggggcgggcggcaccac	Protospacer
*  ************* ******** ***. 

347. spacer 18.1|5329584|31|LR130759|CRT matches to GQ303262 (Mycobacterium phage LRRHood, complete genome) position: , mismatch: 6, identity: 0.806

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
cgcacggctccggcggggcgggcggcaccac	Protospacer
*  ************* ******** ***. 

348. spacer 18.1|5329584|31|LR130759|CRT matches to MT889395 (Mycobacterium phage Shifa, complete genome) position: , mismatch: 6, identity: 0.806

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
cgcacggctccggcggggcgggcggcaccac	Protospacer
*  ************* ******** ***. 

349. spacer 18.1|5329584|31|LR130759|CRT matches to MH910040 (Mycobacterium phage Sauce, complete genome) position: , mismatch: 6, identity: 0.806

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
cgcacggctccggcggggcgggcggcaccac	Protospacer
*  ************* ******** ***. 

350. spacer 18.1|5329584|31|LR130759|CRT matches to MN062707 (Mycobacterium phage Grungle, complete genome) position: , mismatch: 6, identity: 0.806

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
cgcacggctccggcggggcgggcggcaccac	Protospacer
*  ************* ******** ***. 

351. spacer 18.1|5329584|31|LR130759|CRT matches to KX831080 (Mycobacterium phage Lukilu, complete genome) position: , mismatch: 6, identity: 0.806

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
cgcacggctccggcggggcgggcggcaccac	Protospacer
*  ************* ******** ***. 

352. spacer 18.1|5329584|31|LR130759|CRT matches to NC_028869 (Mycobacterium phage HyRo, complete genome) position: , mismatch: 6, identity: 0.806

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
cgcacggctccggcggggcgggcggcaccac	Protospacer
*  ************* ******** ***. 

353. spacer 18.1|5329584|31|LR130759|CRT matches to MF919513 (Mycobacterium phage Koguma, complete genome) position: , mismatch: 6, identity: 0.806

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
cgcacggctccggcggggcgggcggcaccac	Protospacer
*  ************* ******** ***. 

354. spacer 18.1|5329584|31|LR130759|CRT matches to JN204348 (Mycobacterium phage Sebata, complete genome) position: , mismatch: 6, identity: 0.806

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
cgcacggctccggcggggcgggcggcaccac	Protospacer
*  ************* ******** ***. 

355. spacer 18.1|5329584|31|LR130759|CRT matches to KX752698 (Mycobacterium phage Tonenili, complete genome) position: , mismatch: 6, identity: 0.806

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
cgcacggctccggcggggcgggcggcaccac	Protospacer
*  ************* ******** ***. 

356. spacer 18.1|5329584|31|LR130759|CRT matches to NC_023316 (Streptomyces sp. 14R-10 plasmid pZL1, complete sequence) position: , mismatch: 6, identity: 0.806

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
cctccggctccggcggcgggggcgggagctt	Protospacer
**  ************** ******** *  

357. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP040824 (Paraoceanicella profunda strain D4M1 plasmid pD4M1F, complete sequence) position: , mismatch: 6, identity: 0.806

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
cccgccgcgccggcggcgcgggcggcaccgc	Protospacer
** .* ** **************** **** 

358. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP040824 (Paraoceanicella profunda strain D4M1 plasmid pD4M1F, complete sequence) position: , mismatch: 6, identity: 0.806

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
cccgccgcgccggcggcgcgggcggcaccgc	Protospacer
** .* ** **************** **** 

359. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP021820 (Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence) position: , mismatch: 6, identity: 0.806

ccaacggctccggcggcgcgggc----gggaccgg	CRISPR spacer
tcaacggctccggcggcgccggccactggga----	Protospacer
.****************** ***    ****    

360. spacer 18.1|5329584|31|LR130759|CRT matches to MT936332 (Streptomyces phage phiRKBJ001, complete genome) position: , mismatch: 6, identity: 0.806

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaacggctccggcggttcgggctcgggcgg	Protospacer
****************. *****  *. ***

361. spacer 18.3|5329698|31|LR130759|CRT matches to NC_012586 (Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence) position: , mismatch: 6, identity: 0.806

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gcccgggccaagctggcggcggcggagcagg	Protospacer
 *   ******** **** ************

362. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP010016 (Burkholderia thailandensis 34 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.806

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
cgagcggccaagcaggcgccggggcagacgg	Protospacer
* .******************* * **  **

363. spacer 19.1|5329937|32|LR130759|CRT matches to NC_023714 (Mycobacterium phage LinStu, complete genome) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
acgcacggctccggcggggcgggcggcaccac	Protospacer
**  ************* ******** ***. 

364. spacer 19.1|5329937|32|LR130759|CRT matches to GQ303262 (Mycobacterium phage LRRHood, complete genome) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
acgcacggctccggcggggcgggcggcaccac	Protospacer
**  ************* ******** ***. 

365. spacer 19.1|5329937|32|LR130759|CRT matches to MT889395 (Mycobacterium phage Shifa, complete genome) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
acgcacggctccggcggggcgggcggcaccac	Protospacer
**  ************* ******** ***. 

366. spacer 19.1|5329937|32|LR130759|CRT matches to MH910040 (Mycobacterium phage Sauce, complete genome) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
acgcacggctccggcggggcgggcggcaccac	Protospacer
**  ************* ******** ***. 

367. spacer 19.1|5329937|32|LR130759|CRT matches to MN062707 (Mycobacterium phage Grungle, complete genome) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
acgcacggctccggcggggcgggcggcaccac	Protospacer
**  ************* ******** ***. 

368. spacer 19.1|5329937|32|LR130759|CRT matches to KX831080 (Mycobacterium phage Lukilu, complete genome) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
acgcacggctccggcggggcgggcggcaccac	Protospacer
**  ************* ******** ***. 

369. spacer 19.1|5329937|32|LR130759|CRT matches to NC_028869 (Mycobacterium phage HyRo, complete genome) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
acgcacggctccggcggggcgggcggcaccac	Protospacer
**  ************* ******** ***. 

370. spacer 19.1|5329937|32|LR130759|CRT matches to MF919513 (Mycobacterium phage Koguma, complete genome) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
acgcacggctccggcggggcgggcggcaccac	Protospacer
**  ************* ******** ***. 

371. spacer 19.1|5329937|32|LR130759|CRT matches to JN204348 (Mycobacterium phage Sebata, complete genome) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
acgcacggctccggcggggcgggcggcaccac	Protospacer
**  ************* ******** ***. 

372. spacer 19.1|5329937|32|LR130759|CRT matches to KX752698 (Mycobacterium phage Tonenili, complete genome) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
acgcacggctccggcggggcgggcggcaccac	Protospacer
**  ************* ******** ***. 

373. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP016613 (Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
.*** **** **************** ..***

374. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP021449 (Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
.*** **** **************** ..***

375. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP026091 (Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
.*** **** **************** ..***

376. spacer 19.1|5329937|32|LR130759|CRT matches to NC_014309 (Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
.*** **** **************** ..***

377. spacer 19.1|5329937|32|LR130759|CRT matches to CP023013 (Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
.*** **** **************** ..***

378. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP021653 (Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
.*** **** **************** ..***

379. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP049790 (Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggtgtcgg	Protospacer
.*** **** **************** ..***

380. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP049794 (Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggtgtcgg	Protospacer
.*** **** **************** ..***

381. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP049788 (Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
.*** **** **************** ..***

382. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP022766 (Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
.*** **** **************** ..***

383. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP021763 (Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
.*** **** **************** ..***

384. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP026093 (Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
.*** **** **************** ..***

385. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP021767 (Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
.*** **** **************** ..***

386. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP015116 (Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
.*** **** **************** ..***

387. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP016555 (Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
.*** **** **************** ..***

388. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP012688 (Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
.*** **** **************** ..***

389. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP049792 (Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggtgtcgg	Protospacer
.*** **** **************** ..***

390. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP052069 (Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
.*** **** **************** ..***

391. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP016915 (Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggtgtcgg	Protospacer
.*** **** **************** ..***

392. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP016905 (Ralstonia solanacearum strain KACC 10709 plasmid unnamed1) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
.*** **** **************** ..***

393. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
.*** **** **************** ..***

394. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP022769 (Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
.*** **** **************** ..***

395. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP015851 (Ralstonia solanacearum strain YC40-M plasmid, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
.*** **** **************** ..***

396. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP022773 (Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
.*** **** **************** ..***

397. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP022783 (Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
.*** **** **************** ..***

398. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP022791 (Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
.*** **** **************** ..***

399. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP022795 (Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
.*** **** **************** ..***

400. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP052071 (Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
.*** **** **************** ..***

401. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP022482 (Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
.*** **** **************** ..***

402. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP009763 (Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
.*** **** **************** ..***

403. spacer 19.1|5329937|32|LR130759|CRT matches to CP023015 (Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
.*** **** **************** ..***

404. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP022779 (Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
.*** **** **************** ..***

405. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP052075 (Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
.*** **** **************** ..***

406. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP052085 (Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
.*** **** **************** ..***

407. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP052095 (Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggtgtcgg	Protospacer
.*** **** **************** ..***

408. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP052105 (Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
.*** **** **************** ..***

409. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP021765 (Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
.*** **** **************** ..***

410. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP052077 (Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
.*** **** **************** ..***

411. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP052087 (Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
.*** **** **************** ..***

412. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP052097 (Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggtgtcgg	Protospacer
.*** **** **************** ..***

413. spacer 19.1|5329937|32|LR130759|CRT matches to CP047139 (Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
.*** **** **************** ..***

414. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP052115 (Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
.*** **** **************** ..***

415. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP052127 (Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
.*** **** **************** ..***

416. spacer 19.1|5329937|32|LR130759|CRT matches to CP047137 (Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
.*** **** **************** ..***

417. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP052079 (Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
.*** **** **************** ..***

418. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP052089 (Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
.*** **** **************** ..***

419. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP052093 (Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggtgtcgg	Protospacer
.*** **** **************** ..***

420. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP052101 (Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggtgtcgg	Protospacer
.*** **** **************** ..***

421. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP052099 (Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggtgtcgg	Protospacer
.*** **** **************** ..***

422. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP052107 (Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
.*** **** **************** ..***

423. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP022781 (Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
.*** **** **************** ..***

424. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP052117 (Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
.*** **** **************** ..***

425. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP052125 (Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
.*** **** **************** ..***

426. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP022793 (Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
.*** **** **************** ..***

427. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP022785 (Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
.*** **** **************** ..***

428. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP022787 (Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
.*** **** **************** ..***

429. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP022756 (Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
.*** **** **************** ..***

430. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP052129 (Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggtgtcgg	Protospacer
.*** **** **************** ..***

431. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP052121 (Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
.*** **** **************** ..***

432. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP052123 (Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
.*** **** **************** ..***

433. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP052131 (Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
.*** **** **************** ..***

434. spacer 19.1|5329937|32|LR130759|CRT matches to CP011998 (Ralstonia solanacearum strain YC45 plasmid, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
.*** **** **************** ..***

435. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP052073 (Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
.*** **** **************** ..***

436. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP052081 (Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
.*** **** **************** ..***

437. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP052083 (Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
.*** **** **************** ..***

438. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP052109 (Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
.*** **** **************** ..***

439. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP052091 (Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggtgtcgg	Protospacer
.*** **** **************** ..***

440. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP052111 (Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggtgtcgg	Protospacer
.*** **** **************** ..***

441. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP052103 (Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
.*** **** **************** ..***

442. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP052119 (Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggcgtcgg	Protospacer
.*** **** **************** ..***

443. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP052113 (Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccaccggcaccggcggcgcgggcggtgtcgg	Protospacer
.*** **** **************** ..***

444. spacer 19.1|5329937|32|LR130759|CRT matches to MT936332 (Streptomyces phage phiRKBJ001, complete genome) position: , mismatch: 6, identity: 0.812

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
accaacggctccggcggttcgggctcgggcgg	Protospacer
*****************. *****  *. ***

445. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP010016 (Burkholderia thailandensis 34 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acgagcggccaagcaggcgccggggcagacgg	Protospacer
** .******************* * **  **

446. spacer 19.3|5330051|32|LR130759|CRT matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 6, identity: 0.812

accggcggccaagcaggcgccggcgg--agcagg	CRISPR spacer
gcgggcggcgaagcaggagccggcggtcagca--	Protospacer
.* ****** ******* ********  ****  

447. spacer 19.3|5330051|32|LR130759|CRT matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 6, identity: 0.812

accggcggccaagcaggcgccggcgg--agcagg	CRISPR spacer
gcgggcggcgaagcaggagccggcggtcagca--	Protospacer
.* ****** ******* ********  ****  

448. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP012477 (Arthrobacter sp. ERGS1:01 isolate water plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.812

accggcggccaagcaggcgccggcggagcagg-	CRISPR spacer
cgcggcggccacggaggcgccggc-gatcaggt	Protospacer
  ********* * ********** ** **** 

449. spacer 21.1|5588868|30|LR130759|CRISPRCasFinder matches to NZ_CP013256 (Kocuria flava strain HO-9041 plasmid 2, complete sequence) position: , mismatch: 6, identity: 0.8

ccggtgagaagcccgacaaatcgggaccac	CRISPR spacer
actgggcgaagcccgacaaatcgtcaccac	Protospacer
 * * * ****************  *****

450. spacer 1.4|586584|33|LR130759|CRISPRCasFinder matches to AP018698 (Arthrobacter sp. MN05-02 plasmid plasmid1 DNA, complete genome) position: , mismatch: 7, identity: 0.788

gagttgaacaggcccgtgttggcgatggccgta--	CRISPR spacer
cagatgaacaggccggtgttggcga--gcaggaac	Protospacer
 ** ********** **********  ** * *  

451. spacer 1.4|586584|33|LR130759|CRISPRCasFinder matches to NC_011984 (Agrobacterium vitis S4 plasmid pAtS4c, complete sequence) position: , mismatch: 7, identity: 0.788

gagttgaacaggcccgtgttggcgatggccgta	CRISPR spacer
aaggtcgacaggcccggattggcgatggccgca	Protospacer
.** * .********* .*************.*

452. spacer 2.1|587586|33|LR130759|CRISPRCasFinder matches to NZ_CP013255 (Kocuria flava strain HO-9041 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.788

gcgttgaaggtgccggtgttgaagtcgccggcg	CRISPR spacer
gcgttgaaggtggcggtgttgatgtcgttctcc	Protospacer
************ ********* ****..  * 

453. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP031163 (Deinococcus wulumuqiensis strain NEB 479 plasmid pDrdI, complete sequence) position: , mismatch: 7, identity: 0.774

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
cagggggccaagcaggcgcaggcggaagccg	Protospacer
* ** ************** ******.   *

454. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP017294 (Pseudomonas aeruginosa strain PA83 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
caggcgcccgagcaggcgccggcggcagagt	Protospacer
* **** **.*************** . ** 

455. spacer 17.3|5328990|31|LR130759|CRT matches to NC_013857 (Azospirillum sp. B510 plasmid pAB510c, complete sequence) position: , mismatch: 7, identity: 0.774

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
tccggtgccaagctggcgccggcggtgcatg	Protospacer
.* *  ******* *********** *** *

456. spacer 17.8|5329098|29|LR130759|CRT matches to AF428260 (Propionibacterium phage phiB5, complete genome) position: , mismatch: 7, identity: 0.759

ccggcggtcagggaggccagggcggtcag	CRISPR spacer
agggcggccagggcggccagggcggcagg	Protospacer
  *****.***** ***********. .*

457. spacer 17.8|5329098|29|LR130759|CRT matches to NC_003460 (Propionibacterium phage B5, complete genome) position: , mismatch: 7, identity: 0.759

ccggcggtcagggaggccagggcggtcag	CRISPR spacer
agggcggccagggcggccagggcggcagg	Protospacer
  *****.***** ***********. .*

458. spacer 17.8|5329098|29|LR130759|CRT matches to NC_023284 (Streptomyces sp. F2 plasmid pFRL4, complete sequence) position: , mismatch: 7, identity: 0.759

ccggcggtcagggaggccagggcggtcag	CRISPR spacer
tgttcggtcagggaggtcatggcggtcac	Protospacer
.   ************.** ******** 

459. spacer 17.8|5329098|29|LR130759|CRT matches to NZ_CP009216 (Corynebacterium ureicelerivorans strain IMMIB RIV-2301 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.759

ccggcggtcagggaggccagggcggtcag	CRISPR spacer
gcggcggccagggcggccagggcggcggc	Protospacer
 ******.***** ***********. . 

460. spacer 17.8|5329098|29|LR130759|CRT matches to NC_017805 (Deinococcus gobiensis I-0 plasmid P1, complete sequence) position: , mismatch: 7, identity: 0.759

ccggcggtcagggaggccagggcggtcag	CRISPR spacer
gcggcggcctgggaggccagggcggcggc	Protospacer
 ******.* ***************. . 

461. spacer 17.8|5329098|29|LR130759|CRT matches to NZ_CP047178 (Rathayibacter sp. VKM Ac-2759 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.759

ccggcggtcagggaggccagggcggtcag	CRISPR spacer
tgcagggtcaggtaggccagggcggtgag	Protospacer
.  . ******* ************* **

462. spacer 17.8|5329098|29|LR130759|CRT matches to NC_023286 (Streptomyces sp. F12 plasmid pFRL6, complete sequence) position: , mismatch: 7, identity: 0.759

ccggcggtcagggaggccagggcggtcag	CRISPR spacer
tgttcggtcagggaggtcatggcggtcac	Protospacer
.   ************.** ******** 

463. spacer 17.8|5329098|29|LR130759|CRT matches to NC_023283 (Streptomyces sp. FR1 plasmid pFRL3, complete sequence) position: , mismatch: 7, identity: 0.759

ccggcggtcagggaggccagggcggtcag	CRISPR spacer
tgttcggtcagggaggtcatggcggtcac	Protospacer
.   ************.** ******** 

464. spacer 17.8|5329098|29|LR130759|CRT matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 7, identity: 0.759

ccggcggtcagggaggccagggcggtcag	CRISPR spacer
ccggcggtcggggcggccagggcctccgc	Protospacer
*********.*** *********  .*. 

465. spacer 17.8|5329098|29|LR130759|CRT matches to NC_016587 (Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence) position: , mismatch: 7, identity: 0.759

ccggcggtcagggaggccagggcggtcag	CRISPR spacer
ccgccggtcagcgaggccagggccgattt	Protospacer
*** ******* *********** * .  

466. spacer 17.10|5329230|32|LR130759|CRT matches to NC_023714 (Mycobacterium phage LinStu, complete genome) position: , mismatch: 7, identity: 0.781

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
cgcacggctccggcggggcgggcggcaccacg	Protospacer
*  ************* ******** ***.  

467. spacer 17.10|5329230|32|LR130759|CRT matches to GQ303262 (Mycobacterium phage LRRHood, complete genome) position: , mismatch: 7, identity: 0.781

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
cgcacggctccggcggggcgggcggcaccacg	Protospacer
*  ************* ******** ***.  

468. spacer 17.10|5329230|32|LR130759|CRT matches to MT889395 (Mycobacterium phage Shifa, complete genome) position: , mismatch: 7, identity: 0.781

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
cgcacggctccggcggggcgggcggcaccacg	Protospacer
*  ************* ******** ***.  

469. spacer 17.10|5329230|32|LR130759|CRT matches to MH910040 (Mycobacterium phage Sauce, complete genome) position: , mismatch: 7, identity: 0.781

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
cgcacggctccggcggggcgggcggcaccacg	Protospacer
*  ************* ******** ***.  

470. spacer 17.10|5329230|32|LR130759|CRT matches to MN062707 (Mycobacterium phage Grungle, complete genome) position: , mismatch: 7, identity: 0.781

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
cgcacggctccggcggggcgggcggcaccacg	Protospacer
*  ************* ******** ***.  

471. spacer 17.10|5329230|32|LR130759|CRT matches to KX831080 (Mycobacterium phage Lukilu, complete genome) position: , mismatch: 7, identity: 0.781

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
cgcacggctccggcggggcgggcggcaccacg	Protospacer
*  ************* ******** ***.  

472. spacer 17.10|5329230|32|LR130759|CRT matches to NC_028869 (Mycobacterium phage HyRo, complete genome) position: , mismatch: 7, identity: 0.781

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
cgcacggctccggcggggcgggcggcaccacg	Protospacer
*  ************* ******** ***.  

473. spacer 17.10|5329230|32|LR130759|CRT matches to MF919513 (Mycobacterium phage Koguma, complete genome) position: , mismatch: 7, identity: 0.781

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
cgcacggctccggcggggcgggcggcaccacg	Protospacer
*  ************* ******** ***.  

474. spacer 17.10|5329230|32|LR130759|CRT matches to JN204348 (Mycobacterium phage Sebata, complete genome) position: , mismatch: 7, identity: 0.781

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
cgcacggctccggcggggcgggcggcaccacg	Protospacer
*  ************* ******** ***.  

475. spacer 17.10|5329230|32|LR130759|CRT matches to KX752698 (Mycobacterium phage Tonenili, complete genome) position: , mismatch: 7, identity: 0.781

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
cgcacggctccggcggggcgggcggcaccacg	Protospacer
*  ************* ******** ***.  

476. spacer 17.10|5329230|32|LR130759|CRT matches to NZ_AP022571 (Mycolicibacterium poriferae strain JCM 12603 plasmid pJCM12603, complete sequence) position: , mismatch: 7, identity: 0.781

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
ctggtggggccggcggcgcgggcggcaccggc	Protospacer
*....**  **************** ******

477. spacer 17.10|5329230|32|LR130759|CRT matches to NZ_CP020445 (Paracoccus yeei strain FDAARGOS_252 plasmid unnamed5, complete sequence) position: , mismatch: 7, identity: 0.781

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
cgctggtcaccggcggcgcgggcgggatcggc	Protospacer
*    * * ******************.****

478. spacer 17.10|5329230|32|LR130759|CRT matches to NZ_CP044079 (Paracoccus yeei strain FDAARGOS_643 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.781

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
cgctggtcaccggcggcgcgggcgggatcggc	Protospacer
*    * * ******************.****

479. spacer 17.10|5329230|32|LR130759|CRT matches to NZ_CP031079 (Paracoccus yeei strain CCUG 32053 plasmid pYEE1, complete sequence) position: , mismatch: 7, identity: 0.781

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
cgctggtcaccggcggcgcgggcgggatcggc	Protospacer
*    * * ******************.****

480. spacer 17.10|5329230|32|LR130759|CRT matches to NZ_CP040824 (Paraoceanicella profunda strain D4M1 plasmid pD4M1F, complete sequence) position: , mismatch: 7, identity: 0.781

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
cccgccgcgccggcggcgcgggcggcaccgcg	Protospacer
** .* ** **************** ****  

481. spacer 17.10|5329230|32|LR130759|CRT matches to NZ_CP040824 (Paraoceanicella profunda strain D4M1 plasmid pD4M1F, complete sequence) position: , mismatch: 7, identity: 0.781

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
cccgccgcgccggcggcgcgggcggcaccgcg	Protospacer
** .* ** **************** ****  

482. spacer 17.10|5329230|32|LR130759|CRT matches to NZ_CP022760 (Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
ccggccggcccggcatcgcgggcgggaccggc	Protospacer
**..* * .*****. ****************

483. spacer 17.10|5329230|32|LR130759|CRT matches to NZ_CP022789 (Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
ccggccggcccggcatcgcgggcgggaccggc	Protospacer
**..* * .*****. ****************

484. spacer 17.10|5329230|32|LR130759|CRT matches to NZ_CP033582 (Streptomyces sp. ADI95-16 plasmid pADI95-16a, complete sequence) position: , mismatch: 7, identity: 0.781

--ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
gggccatgg--ccggcggggccggcgggaccggc	Protospacer
   * *.**  ******* ** ************

485. spacer 17.10|5329230|32|LR130759|CRT matches to NZ_CP033582 (Streptomyces sp. ADI95-16 plasmid pADI95-16a, complete sequence) position: , mismatch: 7, identity: 0.781

-ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
cccggcag-gccggcggcgcggccgggtccggc	Protospacer
 **..*.*  ************ **** *****

486. spacer 17.10|5329230|32|LR130759|CRT matches to NZ_CP053207 (Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1C, complete sequence) position: , mismatch: 7, identity: 0.781

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
cgaccatttccggcggcgcgtgcgggatcggc	Protospacer
* * *. .************ ******.****

487. spacer 17.10|5329230|32|LR130759|CRT matches to NZ_CP022775 (Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
ccggccggcccggcatcgcgggcgggaccggc	Protospacer
**..* * .*****. ****************

488. spacer 17.10|5329230|32|LR130759|CRT matches to NZ_CP022762 (Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
ccggccggcccggcatcgcgggcgggaccggc	Protospacer
**..* * .*****. ****************

489. spacer 17.10|5329230|32|LR130759|CRT matches to NZ_CP045122 (Rubrobacter sp. SCSIO 52915 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

ccaacggctccggcggcgcgggcg--ggaccggc	CRISPR spacer
gcaacggctccggcggttcgggcgacggggcg--	Protospacer
 ***************. ******  **. **  

490. spacer 17.10|5329230|32|LR130759|CRT matches to NZ_CP015065 (Mesorhizobium ciceri biovar biserrulae strain WSM1284 plasmid pMc1284, complete sequence) position: , mismatch: 7, identity: 0.781

--ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
atgcgccgg--ccggcggcgcgggcggcagcggc	Protospacer
   *. ***  **************** * ****

491. spacer 17.10|5329230|32|LR130759|CRT matches to NZ_CP015063 (Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence) position: , mismatch: 7, identity: 0.781

--ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
atgcgccgg--ccggcggcgcgggcggcagcggc	Protospacer
   *. ***  **************** * ****

492. spacer 17.10|5329230|32|LR130759|CRT matches to NZ_CP023017 (Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
ccggccggcccggcatcgcgggcgggaccggc	Protospacer
**..* * .*****. ****************

493. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP022775 (Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

ccggcggccaagcaggcgccggcg---gagcaggc	CRISPR spacer
gcggcggccaagcaggcctcggcgcgcgcgca---	Protospacer
 **************** .*****   * ***   

494. spacer 17.12|5329344|32|LR130759|CRT matches to NC_014310 (Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence) position: , mismatch: 7, identity: 0.781

ccggcggccaagcaggcgccggcg---gagcaggc	CRISPR spacer
gcggcggccaagcaggcctcggcgcgcgcgca---	Protospacer
 **************** .*****   * ***   

495. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP022762 (Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

ccggcggccaagcaggcgccggcg---gagcaggc	CRISPR spacer
gcggcggccaagcaggcctcggcgcgcgcgca---	Protospacer
 **************** .*****   * ***   

496. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP023017 (Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

ccggcggccaagcaggcgccggcg---gagcaggc	CRISPR spacer
gcggcggccaagcaggcctcggcgcgcgcgca---	Protospacer
 **************** .*****   * ***   

497. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP014703 (Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence) position: , mismatch: 7, identity: 0.781

ccggcggccaagcaggcgccggcg---gagcaggc	CRISPR spacer
gcggcggccaagcaggcctcggcgcgcgcgca---	Protospacer
 **************** .*****   * ***   

498. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP022760 (Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

ccggcggccaagcaggcgccggcg---gagcaggc	CRISPR spacer
gcggcggccaagcaggcctcggcgcgcgcgca---	Protospacer
 **************** .*****   * ***   

499. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP022789 (Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

ccggcggccaagcaggcgccggcg---gagcaggc	CRISPR spacer
gcggcggccaagcaggcctcggcgcgcgcgca---	Protospacer
 **************** .*****   * ***   

500. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP022771 (Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

ccggcggccaagcaggcgccggcg---gagcaggc	CRISPR spacer
gcggcggccaagcaggcctcggcgcgcgcgca---	Protospacer
 **************** .*****   * ***   

501. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP022777 (Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

ccggcggccaagcaggcgccggcg---gagcaggc	CRISPR spacer
gcggcggccaagcaggcctcggcgcgcgcgca---	Protospacer
 **************** .*****   * ***   

502. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP022799 (Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

ccggcggccaagcaggcgccggcg---gagcaggc	CRISPR spacer
gcggcggccaagcaggcctcggcgcgcgcgca---	Protospacer
 **************** .*****   * ***   

503. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP022764 (Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

ccggcggccaagcaggcgccggcg---gagcaggc	CRISPR spacer
gcggcggccaagcaggcctcggcgcgcgcgca---	Protospacer
 **************** .*****   * ***   

504. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP022797 (Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

ccggcggccaagcaggcgccggcg---gagcaggc	CRISPR spacer
gcggcggccaagcaggcctcggcgcgcgcgca---	Protospacer
 **************** .*****   * ***   

505. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP022758 (Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

ccggcggccaagcaggcgccggcg---gagcaggc	CRISPR spacer
gcggcggccaagcaggcctcggcgcgcgcgca---	Protospacer
 **************** .*****   * ***   

506. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP017947 (Bosea sp. Tri-49 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gtgacggctccggcggcgggggcaggaccac	Protospacer
 ..*************** ****.*****. 

507. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP016083 (Streptomyces sp. SAT1 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.774

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
tcgacggctccggcggcgcgtgcggtggtgg	Protospacer
.*.***************** **** . .**

508. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_LR134451 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 9, complete sequence) position: , mismatch: 7, identity: 0.774

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
cgacctcgcccggcggcccgggcgggaccgg	Protospacer
* * *   .******** *************

509. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 7, identity: 0.774

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccttgcgctccggcggcgcggccgggagcga	Protospacer
**    *************** ***** **.

510. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_AP022571 (Mycolicibacterium poriferae strain JCM 12603 plasmid pJCM12603, complete sequence) position: , mismatch: 7, identity: 0.774

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ctggtggggccggcggcgcgggcggcaccgg	Protospacer
*....**  **************** *****

511. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP020445 (Paracoccus yeei strain FDAARGOS_252 plasmid unnamed5, complete sequence) position: , mismatch: 7, identity: 0.774

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
cgctggtcaccggcggcgcgggcgggatcgg	Protospacer
*    * * ******************.***

512. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP054621 (Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence) position: , mismatch: 7, identity: 0.774

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
catccggctccggcggcacgggcgggccgag	Protospacer
*   *************.******** * .*

513. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP044079 (Paracoccus yeei strain FDAARGOS_643 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.774

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
cgctggtcaccggcggcgcgggcgggatcgg	Protospacer
*    * * ******************.***

514. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP031079 (Paracoccus yeei strain CCUG 32053 plasmid pYEE1, complete sequence) position: , mismatch: 7, identity: 0.774

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
cgctggtcaccggcggcgcgggcgggatcgg	Protospacer
*    * * ******************.***

515. spacer 18.1|5329584|31|LR130759|CRT matches to NC_016624 (Azospirillum lipoferum 4B plasmid AZO_p5, complete sequence) position: , mismatch: 7, identity: 0.774

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
acgccggcaccggcggcgcggacgggagtgg	Protospacer
 *. **** ************.***** .**

516. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP023064 (Sinorhizobium sp. CCBAU 05631 plasmid pSS05631b, complete sequence) position: , mismatch: 7, identity: 0.774

ccaacggctccggcggcgcgggcgggaccgg--	CRISPR spacer
tgaactgcttcggcggcgcgggcgg--ccagca	Protospacer
. *** ***.***************  **.*  

517. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP021082 (Deinococcus ficus strain CC-FR2-10 plasmid pDFI1, complete sequence) position: , mismatch: 7, identity: 0.774

ccaacggctccggcggcgcgggcgggaccgg--	CRISPR spacer
aggacggcgccggcggcgcggacggg--cggtt	Protospacer
  .***** ************.****  ***  

518. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP053207 (Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1C, complete sequence) position: , mismatch: 7, identity: 0.774

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
cgaccatttccggcggcgcgtgcgggatcgg	Protospacer
* * *. .************ ******.***

519. spacer 18.1|5329584|31|LR130759|CRT matches to MT553347 (Mycobacterium phage Awesomesauce, complete genome) position: , mismatch: 7, identity: 0.774

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggctccggcggcacgggccagttctg	Protospacer
*** *************.***** .* .* *

520. spacer 18.1|5329584|31|LR130759|CRT matches to MH020243 (Mycobacterium phage TootsiePop, complete genome) position: , mismatch: 7, identity: 0.774

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggctccggcggcacgggccagttctg	Protospacer
*** *************.***** .* .* *

521. spacer 18.1|5329584|31|LR130759|CRT matches to MH020242 (Mycobacterium phage Misha28, complete genome) position: , mismatch: 7, identity: 0.774

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggctccggcggcacgggccagttctg	Protospacer
*** *************.***** .* .* *

522. spacer 18.1|5329584|31|LR130759|CRT matches to MK494120 (Mycobacterium phage Piper2020, complete genome) position: , mismatch: 7, identity: 0.774

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaccggctccggcggcacgggccagttctg	Protospacer
*** *************.***** .* .* *

523. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP031163 (Deinococcus wulumuqiensis strain NEB 479 plasmid pDrdI, complete sequence) position: , mismatch: 7, identity: 0.774

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
cagggggccaagcaggcgcaggcggaagccg	Protospacer
* ** ************** ******.   *

524. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP017294 (Pseudomonas aeruginosa strain PA83 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
caggcgcccgagcaggcgccggcggcagagt	Protospacer
* **** **.*************** . ** 

525. spacer 18.3|5329698|31|LR130759|CRT matches to NC_013857 (Azospirillum sp. B510 plasmid pAB510c, complete sequence) position: , mismatch: 7, identity: 0.774

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
tccggtgccaagctggcgccggcggtgcatg	Protospacer
.* *  ******* *********** *** *

526. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_LN832560 (Paracoccus aminovorans isolate JCM7685 plasmid II, complete sequence) position: , mismatch: 7, identity: 0.781

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ctggtcggcgccggcggcgcggccgggaccgg	Protospacer
 . . **** ************ *********

527. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_AP022333 (Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49a, complete sequence) position: , mismatch: 7, identity: 0.781

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
tggggcggctccggcggcgcgggcgggctcgg	Protospacer
   ..********************** .***

528. spacer 19.1|5329937|32|LR130759|CRT matches to MF668280 (Mycobacterium phage Phabba, complete genome) position: , mismatch: 7, identity: 0.781

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gagcacggctccggcggcgcgagcgagaccgc	Protospacer
.   *****************.***.***** 

529. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP017947 (Bosea sp. Tri-49 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
agtgacggctccggcggcgggggcaggaccac	Protospacer
* ..*************** ****.*****. 

530. spacer 19.1|5329937|32|LR130759|CRT matches to NC_023316 (Streptomyces sp. 14R-10 plasmid pZL1, complete sequence) position: , mismatch: 7, identity: 0.781

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
tcctccggctccggcggcgggggcgggagctt	Protospacer
 **  ************** ******** *  

531. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP040824 (Paraoceanicella profunda strain D4M1 plasmid pD4M1F, complete sequence) position: , mismatch: 7, identity: 0.781

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gcccgccgcgccggcggcgcgggcggcaccgc	Protospacer
.** .* ** **************** **** 

532. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP040824 (Paraoceanicella profunda strain D4M1 plasmid pD4M1F, complete sequence) position: , mismatch: 7, identity: 0.781

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gcccgccgcgccggcggcgcgggcggcaccgc	Protospacer
.** .* ** **************** **** 

533. spacer 19.1|5329937|32|LR130759|CRT matches to NC_023286 (Streptomyces sp. F12 plasmid pFRL6, complete sequence) position: , mismatch: 7, identity: 0.781

accaac-ggctccggcggcgcgggcgggaccgg	CRISPR spacer
-tgaacgggcgccggcggcgcgcgcgggactgc	Protospacer
 . *** *** *********** *******.* 

534. spacer 19.1|5329937|32|LR130759|CRT matches to NC_016624 (Azospirillum lipoferum 4B plasmid AZO_p5, complete sequence) position: , mismatch: 7, identity: 0.781

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
aacgccggcaccggcggcgcggacgggagtgg	Protospacer
* *. **** ************.***** .**

535. spacer 19.3|5330051|32|LR130759|CRT matches to NC_012586 (Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence) position: , mismatch: 7, identity: 0.781

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ggcccgggccaagctggcggcggcggagcagg	Protospacer
. *   ******** **** ************

536. spacer 20.1|5490160|31|LR130759|CRISPRCasFinder matches to NZ_CP021071 (Mesorhizobium sp. WSM1497 plasmid pWSM1497, complete sequence) position: , mismatch: 7, identity: 0.774

actctatgaccccggcctcgccggtccgggt	CRISPR spacer
tcttgccgaccccggcctcgccggtcaggat	Protospacer
 **.  .******************* **.*

537. spacer 20.1|5490160|31|LR130759|CRISPRCasFinder matches to NZ_CP015065 (Mesorhizobium ciceri biovar biserrulae strain WSM1284 plasmid pMc1284, complete sequence) position: , mismatch: 7, identity: 0.774

actctatgaccccggcctcgccggtccgggt	CRISPR spacer
tcttgccgaccccggcctcgccggtcaggat	Protospacer
 **.  .******************* **.*

538. spacer 20.1|5490160|31|LR130759|CRISPRCasFinder matches to NZ_CP015063 (Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence) position: , mismatch: 7, identity: 0.774

actctatgaccccggcctcgccggtccgggt	CRISPR spacer
tcttgccgaccccggcctcgccggtcaggat	Protospacer
 **.  .******************* **.*

539. spacer 20.1|5490160|31|LR130759|CRISPRCasFinder matches to NZ_CP015420 (Rhodovulum sulfidophilum DSM 1374 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.774

actctatgaccccggcctcgccggtccgggt	CRISPR spacer
tcttgccgaccccggcctcgccggtcaggat	Protospacer
 **.  .******************* **.*

540. spacer 20.1|5490160|31|LR130759|CRISPRCasFinder matches to NC_014918 (Mesorhizobium ciceri biovar biserrulae WSM1271 plasmid pMESCI01, complete sequence) position: , mismatch: 7, identity: 0.774

actctatgaccccggcctcgccggtccgggt	CRISPR spacer
tcttgccgaccccggcctcgccggtcaggat	Protospacer
 **.  .******************* **.*

541. spacer 20.2|5490220|31|LR130759|CRISPRCasFinder matches to NZ_CP042500 (Enterobacter sp. E76 plasmid pE76_001, complete sequence) position: , mismatch: 7, identity: 0.774

tctgac-cagtccgggtctgaccagtccgggc	CRISPR spacer
-cagtcacagaccgggtctgaccactccggat	Protospacer
 * * * *** ************* *****..

542. spacer 2.1|587586|33|LR130759|CRISPRCasFinder matches to MT522006 (Gordonia phage BBQValindra, complete genome) position: , mismatch: 8, identity: 0.758

gcgttgaaggtgccggtgttgaagtcgccggcg	CRISPR spacer
tcgcgctccgtgccggtcttgaagtcgccggcg	Protospacer
 **.     ******** ***************

543. spacer 2.1|587586|33|LR130759|CRISPRCasFinder matches to NC_010399 (Clavibacter michiganensis subsp. sepedonicus plasmid pCS1, complete sequence) position: , mismatch: 8, identity: 0.758

-gcgttgaaggtgccggtgttgaagtcgccggcg	CRISPR spacer
tacgcc-cgggtgccggtgtggacgtcgccggcg	Protospacer
 .**..  .*********** ** **********

544. spacer 5.1|1423971|33|LR130759|CRISPRCasFinder matches to MN204493 (Streptomyces phage Zuko, complete genome) position: , mismatch: 8, identity: 0.758

tggcgggcggtgaggagctgggcgatgtggtcg	CRISPR spacer
atacggtcgatgaggagctgggcgatgggatgg	Protospacer
  .*** **.***************** *.* *

545. spacer 8.17|3078734|34|LR130759|CRT matches to NZ_CP045074 (Paracoccus kondratievae strain BJQ0001 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.765

ccgacgccacgctctggggcgggaccggcggcgc	CRISPR spacer
gcggcgtggcgctgtggggcgggatcggcggcgt	Protospacer
 **.**. .**** **********.********.

546. spacer 17.1|5328876|31|LR130759|CRT matches to NZ_CP032349 (Azospirillum brasilense strain MTCC4039 plasmid p3, complete sequence) position: , mismatch: 8, identity: 0.742

ccaacggttccgggggtagcggcggagtcgg	CRISPR spacer
ctttcggttccggcggttgcggcggagcaga	Protospacer
*.  ********* *** *********. *.

547. spacer 17.1|5328876|31|LR130759|CRT matches to NZ_CP012918 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p4, complete sequence) position: , mismatch: 8, identity: 0.742

ccaacggttccgggggtagcggcggagtcgg	CRISPR spacer
ctttcggttccggcggttgcggcggagcaga	Protospacer
*.  ********* *** *********. *.

548. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP050092 (Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b6, complete sequence) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
tatccggaaaagcaggcgccggcggagcgga	Protospacer
.   ***  *******************.*.

549. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP050104 (Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b2, complete sequence) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
tatccggaaaagcaggcgccggcggagcgga	Protospacer
.   ***  *******************.*.

550. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP016287 (Rhizobium leguminosarum strain Vaf10 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
tatccggaaaagcaggcgccggcggagcgga	Protospacer
.   ***  *******************.*.

551. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP050109 (Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b2, complete sequence) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
tatccggaaaagcaggcgccggcggagcgga	Protospacer
.   ***  *******************.*.

552. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP048281 (Rhizobium leguminosarum bv. viciae 248 plasmid pRle248e, complete sequence) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
tatccggaaaagcaggcgccggcggagcgga	Protospacer
.   ***  *******************.*.

553. spacer 17.3|5328990|31|LR130759|CRT matches to NC_015727 (Cupriavidus necator N-1 plasmid pBB1, complete sequence) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg---	CRISPR spacer
gcggcgaccaagctggcgccggc---gctagtct	Protospacer
 *****.****** *********   ** .*   

554. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
accacggccaaccaggcgtcggcggaggccg	Protospacer
 * .******* ******.********   *

555. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP021119 (Streptomyces sp. CLI2509 strain CLI2905 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gtggcggccaagccgacgccggcggcgagcg	Protospacer
 .*********** *.********* * . *

556. spacer 17.3|5328990|31|LR130759|CRT matches to MH371116 (Mycobacterium phage DMoney, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

557. spacer 17.3|5328990|31|LR130759|CRT matches to MH045569 (Mycobacterium phage Schiebel, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

558. spacer 17.3|5328990|31|LR130759|CRT matches to MH371119 (Mycobacterium phage OctaviousRex, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

559. spacer 17.3|5328990|31|LR130759|CRT matches to MF919497 (Mycobacterium phage Chance64, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

560. spacer 17.3|5328990|31|LR130759|CRT matches to MH001456 (Mycobacterium phage CLED96, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

561. spacer 17.3|5328990|31|LR130759|CRT matches to GQ303261 (Mycobacterium phage Hope, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

562. spacer 17.3|5328990|31|LR130759|CRT matches to MG099946 (Mycobacterium phage LouisV14, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

563. spacer 17.3|5328990|31|LR130759|CRT matches to KC787112 (Mycobacterium phage Clark, partial genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

564. spacer 17.3|5328990|31|LR130759|CRT matches to MH779513 (Mycobacterium phage Olga, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

565. spacer 17.3|5328990|31|LR130759|CRT matches to MK919475 (Mycobacterium phage Camri, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

566. spacer 17.3|5328990|31|LR130759|CRT matches to MK310146 (Mycobacterium phage Crespo, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

567. spacer 17.3|5328990|31|LR130759|CRT matches to MK524493 (Mycobacterium phage Darionha, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

568. spacer 17.3|5328990|31|LR130759|CRT matches to MH779505 (Mycobacterium phage Grizzly, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

569. spacer 17.3|5328990|31|LR130759|CRT matches to EU568876 (Mycobacterium phage BPs, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

570. spacer 17.3|5328990|31|LR130759|CRT matches to KC787107 (Mycobacterium phage Bo4, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

571. spacer 17.3|5328990|31|LR130759|CRT matches to MF668268 (Mycobacterium phage Aroostook, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

572. spacer 17.3|5328990|31|LR130759|CRT matches to KX588251 (Mycobacterium phage Jane, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

573. spacer 17.3|5328990|31|LR130759|CRT matches to KC787103 (Mycobacterium phage Chy2, partial genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

574. spacer 17.3|5328990|31|LR130759|CRT matches to MH001455 (Mycobacterium phage Remy19, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

575. spacer 17.3|5328990|31|LR130759|CRT matches to KT355472 (Mycobacterium phage Cedasite, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

576. spacer 17.3|5328990|31|LR130759|CRT matches to KX664455 (Mycobacterium phage Zombie, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

577. spacer 17.3|5328990|31|LR130759|CRT matches to MH077584 (Mycobacterium phage Phish, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

578. spacer 17.3|5328990|31|LR130759|CRT matches to KC787108 (Mycobacterium phage DNAIII, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

579. spacer 17.3|5328990|31|LR130759|CRT matches to MN444875 (Mycobacterium phage Jonghyun, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

580. spacer 17.3|5328990|31|LR130759|CRT matches to MK433279 (Mycobacterium phage Kareem, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

581. spacer 17.3|5328990|31|LR130759|CRT matches to KJ725374 (Mycobacterium phage Guo1, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

582. spacer 17.3|5328990|31|LR130759|CRT matches to MT818422 (Mycobacterium phage Periodt, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

583. spacer 17.3|5328990|31|LR130759|CRT matches to MK305884 (Mycobacterium phage BQuat, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

584. spacer 17.3|5328990|31|LR130759|CRT matches to MF668272 (Mycobacterium phage Gideon, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

585. spacer 17.3|5328990|31|LR130759|CRT matches to MH779515 (Mycobacterium phage Sweets, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

586. spacer 17.3|5328990|31|LR130759|CRT matches to MW119570 (Mycobacterium phage Lang, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

587. spacer 17.3|5328990|31|LR130759|CRT matches to KC787111 (Mycobacterium phage Sedge, partial genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

588. spacer 17.3|5328990|31|LR130759|CRT matches to MF612073 (Klebsiella phage SopranoGao, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gagaaggccaagcaggcgcaggcagagctgc	Protospacer
  *. ************** ***.**** * 

589. spacer 17.3|5328990|31|LR130759|CRT matches to KC787104 (Mycobacterium phage Chy3, partial genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

590. spacer 17.3|5328990|31|LR130759|CRT matches to NC_012788 (Mycobacterium phage Angel, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

591. spacer 17.3|5328990|31|LR130759|CRT matches to KX443326 (Mycobacterium phage BruceB, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

592. spacer 17.3|5328990|31|LR130759|CRT matches to MK433277 (Mycobacterium phage Renaissance, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

593. spacer 17.3|5328990|31|LR130759|CRT matches to MH590605 (Mycobacterium phage Cherrybomb426, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

594. spacer 17.3|5328990|31|LR130759|CRT matches to MH779509 (Mycobacterium phage Kasen3, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

595. spacer 17.3|5328990|31|LR130759|CRT matches to JN699002 (Mycobacterium phage Avrafan, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

596. spacer 17.3|5328990|31|LR130759|CRT matches to MH779507 (Mycobacterium phage Hotshotbaby7, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

597. spacer 17.3|5328990|31|LR130759|CRT matches to KT355474 (Mycobacterium phage Frosty24, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

598. spacer 17.3|5328990|31|LR130759|CRT matches to KC787109 (Mycobacterium phage Legendre, partial genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

599. spacer 17.3|5328990|31|LR130759|CRT matches to JN412593 (Mycobacterium phage Liefie, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

600. spacer 17.3|5328990|31|LR130759|CRT matches to MH479920 (Mycobacterium phage Mowgli, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

601. spacer 17.3|5328990|31|LR130759|CRT matches to NC_008202 (Mycobacterium phage Halo, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

602. spacer 17.3|5328990|31|LR130759|CRT matches to KM923970 (Mycobacterium phage Gomashi, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

603. spacer 17.3|5328990|31|LR130759|CRT matches to MH450127 (Mycobacterium phage Plagueis, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

604. spacer 17.3|5328990|31|LR130759|CRT matches to KT347314 (Mycobacterium phage Phreak, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

605. spacer 17.3|5328990|31|LR130759|CRT matches to KT365399 (Mycobacterium phage Annihilator, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

606. spacer 17.3|5328990|31|LR130759|CRT matches to KC787110 (Mycobacterium phage Leo, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

607. spacer 17.8|5329098|29|LR130759|CRT matches to NZ_LR134447 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 5, complete sequence) position: , mismatch: 8, identity: 0.724

ccggcggtcagggaggccagggcggtcag	CRISPR spacer
agggcggtcagggaggccagaacggcggc	Protospacer
  ******************..***. . 

608. spacer 17.8|5329098|29|LR130759|CRT matches to CP021131 (Meiothermus taiwanensis strain WR-220 plasmid pMtWR-220, complete sequence) position: , mismatch: 8, identity: 0.724

ccggcggtcagggaggccagggcggtcag	CRISPR spacer
acggcggtcagggaggctaggccgagggc	Protospacer
 ****************.*** **.  . 

609. spacer 17.8|5329098|29|LR130759|CRT matches to NZ_CP025613 (Niveispirillum cyanobacteriorum strain TH16 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.724

ccggcggtcagggaggccagggcggtcag	CRISPR spacer
tgggcggtcaggtcggccagggcggcatt	Protospacer
. **********  ***********.   

610. spacer 17.10|5329230|32|LR130759|CRT matches to NZ_CP017947 (Bosea sp. Tri-49 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
gtgacggctccggcggcgggggcaggaccaca	Protospacer
 ..*************** ****.*****.  

611. spacer 17.10|5329230|32|LR130759|CRT matches to NC_014310 (Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence) position: , mismatch: 8, identity: 0.75

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
ccgggcggcccggcatcgcgggcgggaccggc	Protospacer
**..  * .*****. ****************

612. spacer 17.10|5329230|32|LR130759|CRT matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 8, identity: 0.75

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
ccttgcgctccggcggcgcggccgggagcgat	Protospacer
**    *************** ***** **..

613. spacer 17.10|5329230|32|LR130759|CRT matches to NZ_CP018236 (Rhizobium leguminosarum strain Vaf-108 plasmid unnamed8) position: , mismatch: 8, identity: 0.75

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
aaagcggccccggcggcgcgggcggcacgccc	Protospacer
  *.****.**************** **   *

614. spacer 17.10|5329230|32|LR130759|CRT matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 8, identity: 0.75

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
gccgcggcaccggcggctcgggcgggacgttc	Protospacer
 * .**** ******** **********   *

615. spacer 17.10|5329230|32|LR130759|CRT matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 8, identity: 0.75

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
gccgcggcaccggcggctcgggcgggacgttc	Protospacer
 * .**** ******** **********   *

616. spacer 17.10|5329230|32|LR130759|CRT matches to NZ_CP020331 (Martelella mediterranea DSM 17316 strain MACL11 plasmid pMM593, complete sequence) position: , mismatch: 8, identity: 0.75

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
cgctcgttaccggcggcgcgggcggcatcggc	Protospacer
*   ** . **************** *.****

617. spacer 17.10|5329230|32|LR130759|CRT matches to NZ_CP010858 (Marinovum algicola DG 898 plasmid pMaD3) position: , mismatch: 8, identity: 0.75

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
gcatcggccccggcggcgcgggcggcaagaac	Protospacer
 ** ****.**************** *  ..*

618. spacer 17.10|5329230|32|LR130759|CRT matches to NZ_CP045074 (Paracoccus kondratievae strain BJQ0001 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
cgcttgtcaccggcggcgcgggcgggattggc	Protospacer
*   .* * ******************..***

619. spacer 17.10|5329230|32|LR130759|CRT matches to NZ_AP017899 (Sphingopyxis sp. FD7 plasmid pSFD01, complete sequence) position: , mismatch: 8, identity: 0.75

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
cgctggtcaccggcggcgcgggcggaatcggc	Protospacer
*    * * ****************.*.****

620. spacer 17.10|5329230|32|LR130759|CRT matches to NC_016624 (Azospirillum lipoferum 4B plasmid AZO_p5, complete sequence) position: , mismatch: 8, identity: 0.75

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
acgccggcaccggcggcgcggacgggagtggt	Protospacer
 *. **** ************.***** .**.

621. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP050092 (Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b6, complete sequence) position: , mismatch: 8, identity: 0.75

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
tatccggaaaagcaggcgccggcggagcggac	Protospacer
.   ***  *******************.*.*

622. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP050104 (Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b2, complete sequence) position: , mismatch: 8, identity: 0.75

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
tatccggaaaagcaggcgccggcggagcggac	Protospacer
.   ***  *******************.*.*

623. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP016287 (Rhizobium leguminosarum strain Vaf10 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
tatccggaaaagcaggcgccggcggagcggac	Protospacer
.   ***  *******************.*.*

624. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP050109 (Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b2, complete sequence) position: , mismatch: 8, identity: 0.75

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
tatccggaaaagcaggcgccggcggagcggac	Protospacer
.   ***  *******************.*.*

625. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP048281 (Rhizobium leguminosarum bv. viciae 248 plasmid pRle248e, complete sequence) position: , mismatch: 8, identity: 0.75

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
tatccggaaaagcaggcgccggcggagcggac	Protospacer
.   ***  *******************.*.*

626. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP031163 (Deinococcus wulumuqiensis strain NEB 479 plasmid pDrdI, complete sequence) position: , mismatch: 8, identity: 0.75

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
cagggggccaagcaggcgcaggcggaagccga	Protospacer
* ** ************** ******.   * 

627. spacer 17.12|5329344|32|LR130759|CRT matches to NC_015727 (Cupriavidus necator N-1 plasmid pBB1, complete sequence) position: , mismatch: 8, identity: 0.75

ccggcggccaagcaggcgccggcggagcaggc--	CRISPR spacer
gcggcgaccaagctggcgccggcg--ctagtctg	Protospacer
 *****.****** **********   .** *  

628. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP017294 (Pseudomonas aeruginosa strain PA83 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
caggcgcccgagcaggcgccggcggcagagtg	Protospacer
* **** **.*************** . **  

629. spacer 17.12|5329344|32|LR130759|CRT matches to NC_013857 (Azospirillum sp. B510 plasmid pAB510c, complete sequence) position: , mismatch: 8, identity: 0.75

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
tccggtgccaagctggcgccggcggtgcatga	Protospacer
.* *  ******* *********** *** * 

630. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP021119 (Streptomyces sp. CLI2509 strain CLI2905 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
gtggcggccaagccgacgccggcggcgagcgc	Protospacer
 .*********** *.********* * . **

631. spacer 17.12|5329344|32|LR130759|CRT matches to MH371116 (Mycobacterium phage DMoney, complete genome) position: , mismatch: 8, identity: 0.75

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgtc	Protospacer
 *. ******** ***********.**  * *

632. spacer 17.12|5329344|32|LR130759|CRT matches to MH045569 (Mycobacterium phage Schiebel, complete genome) position: , mismatch: 8, identity: 0.75

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgtc	Protospacer
 *. ******** ***********.**  * *

633. spacer 17.12|5329344|32|LR130759|CRT matches to MH371119 (Mycobacterium phage OctaviousRex, complete genome) position: , mismatch: 8, identity: 0.75

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgtc	Protospacer
 *. ******** ***********.**  * *

634. spacer 17.12|5329344|32|LR130759|CRT matches to MF919497 (Mycobacterium phage Chance64, complete genome) position: , mismatch: 8, identity: 0.75

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgtc	Protospacer
 *. ******** ***********.**  * *

635. spacer 17.12|5329344|32|LR130759|CRT matches to MH001456 (Mycobacterium phage CLED96, complete genome) position: , mismatch: 8, identity: 0.75

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgtc	Protospacer
 *. ******** ***********.**  * *

636. spacer 17.12|5329344|32|LR130759|CRT matches to GQ303261 (Mycobacterium phage Hope, complete genome) position: , mismatch: 8, identity: 0.75

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgtc	Protospacer
 *. ******** ***********.**  * *

637. spacer 17.12|5329344|32|LR130759|CRT matches to MG099946 (Mycobacterium phage LouisV14, complete genome) position: , mismatch: 8, identity: 0.75

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgtc	Protospacer
 *. ******** ***********.**  * *

638. spacer 17.12|5329344|32|LR130759|CRT matches to KC787112 (Mycobacterium phage Clark, partial genome) position: , mismatch: 8, identity: 0.75

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgtc	Protospacer
 *. ******** ***********.**  * *

639. spacer 17.12|5329344|32|LR130759|CRT matches to MH779513 (Mycobacterium phage Olga, complete genome) position: , mismatch: 8, identity: 0.75

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgtc	Protospacer
 *. ******** ***********.**  * *

640. spacer 17.12|5329344|32|LR130759|CRT matches to MK919475 (Mycobacterium phage Camri, complete genome) position: , mismatch: 8, identity: 0.75

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgtc	Protospacer
 *. ******** ***********.**  * *

641. spacer 17.12|5329344|32|LR130759|CRT matches to MK310146 (Mycobacterium phage Crespo, complete genome) position: , mismatch: 8, identity: 0.75

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgtc	Protospacer
 *. ******** ***********.**  * *

642. spacer 17.12|5329344|32|LR130759|CRT matches to MK524493 (Mycobacterium phage Darionha, complete genome) position: , mismatch: 8, identity: 0.75

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgtc	Protospacer
 *. ******** ***********.**  * *

643. spacer 17.12|5329344|32|LR130759|CRT matches to MH779505 (Mycobacterium phage Grizzly, complete genome) position: , mismatch: 8, identity: 0.75

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgtc	Protospacer
 *. ******** ***********.**  * *

644. spacer 17.12|5329344|32|LR130759|CRT matches to EU568876 (Mycobacterium phage BPs, complete genome) position: , mismatch: 8, identity: 0.75

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgtc	Protospacer
 *. ******** ***********.**  * *

645. spacer 17.12|5329344|32|LR130759|CRT matches to KC787107 (Mycobacterium phage Bo4, complete genome) position: , mismatch: 8, identity: 0.75

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgtc	Protospacer
 *. ******** ***********.**  * *

646. spacer 17.12|5329344|32|LR130759|CRT matches to MF668268 (Mycobacterium phage Aroostook, complete genome) position: , mismatch: 8, identity: 0.75

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgtc	Protospacer
 *. ******** ***********.**  * *

647. spacer 17.12|5329344|32|LR130759|CRT matches to KX588251 (Mycobacterium phage Jane, complete genome) position: , mismatch: 8, identity: 0.75

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgtc	Protospacer
 *. ******** ***********.**  * *

648. spacer 17.12|5329344|32|LR130759|CRT matches to KC787103 (Mycobacterium phage Chy2, partial genome) position: , mismatch: 8, identity: 0.75

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgtc	Protospacer
 *. ******** ***********.**  * *

649. spacer 17.12|5329344|32|LR130759|CRT matches to MH001455 (Mycobacterium phage Remy19, complete genome) position: , mismatch: 8, identity: 0.75

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgtc	Protospacer
 *. ******** ***********.**  * *

650. spacer 17.12|5329344|32|LR130759|CRT matches to KT355472 (Mycobacterium phage Cedasite, complete genome) position: , mismatch: 8, identity: 0.75

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgtc	Protospacer
 *. ******** ***********.**  * *

651. spacer 17.12|5329344|32|LR130759|CRT matches to KX664455 (Mycobacterium phage Zombie, complete genome) position: , mismatch: 8, identity: 0.75

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgtc	Protospacer
 *. ******** ***********.**  * *

652. spacer 17.12|5329344|32|LR130759|CRT matches to MH077584 (Mycobacterium phage Phish, complete genome) position: , mismatch: 8, identity: 0.75

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgtc	Protospacer
 *. ******** ***********.**  * *

653. spacer 17.12|5329344|32|LR130759|CRT matches to KC787108 (Mycobacterium phage DNAIII, complete genome) position: , mismatch: 8, identity: 0.75

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgtc	Protospacer
 *. ******** ***********.**  * *

654. spacer 17.12|5329344|32|LR130759|CRT matches to MN444875 (Mycobacterium phage Jonghyun, complete genome) position: , mismatch: 8, identity: 0.75

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgtc	Protospacer
 *. ******** ***********.**  * *

655. spacer 17.12|5329344|32|LR130759|CRT matches to MK433279 (Mycobacterium phage Kareem, complete genome) position: , mismatch: 8, identity: 0.75

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgtc	Protospacer
 *. ******** ***********.**  * *

656. spacer 17.12|5329344|32|LR130759|CRT matches to KJ725374 (Mycobacterium phage Guo1, complete genome) position: , mismatch: 8, identity: 0.75

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgtc	Protospacer
 *. ******** ***********.**  * *

657. spacer 17.12|5329344|32|LR130759|CRT matches to MT818422 (Mycobacterium phage Periodt, complete genome) position: , mismatch: 8, identity: 0.75

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgtc	Protospacer
 *. ******** ***********.**  * *

658. spacer 17.12|5329344|32|LR130759|CRT matches to MK305884 (Mycobacterium phage BQuat, complete genome) position: , mismatch: 8, identity: 0.75

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgtc	Protospacer
 *. ******** ***********.**  * *

659. spacer 17.12|5329344|32|LR130759|CRT matches to MF668272 (Mycobacterium phage Gideon, complete genome) position: , mismatch: 8, identity: 0.75

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgtc	Protospacer
 *. ******** ***********.**  * *

660. spacer 17.12|5329344|32|LR130759|CRT matches to MH779515 (Mycobacterium phage Sweets, complete genome) position: , mismatch: 8, identity: 0.75

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgtc	Protospacer
 *. ******** ***********.**  * *

661. spacer 17.12|5329344|32|LR130759|CRT matches to MW119570 (Mycobacterium phage Lang, complete genome) position: , mismatch: 8, identity: 0.75

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgtc	Protospacer
 *. ******** ***********.**  * *

662. spacer 17.12|5329344|32|LR130759|CRT matches to KC787111 (Mycobacterium phage Sedge, partial genome) position: , mismatch: 8, identity: 0.75

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgtc	Protospacer
 *. ******** ***********.**  * *

663. spacer 17.12|5329344|32|LR130759|CRT matches to KC787104 (Mycobacterium phage Chy3, partial genome) position: , mismatch: 8, identity: 0.75

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgtc	Protospacer
 *. ******** ***********.**  * *

664. spacer 17.12|5329344|32|LR130759|CRT matches to NC_012788 (Mycobacterium phage Angel, complete genome) position: , mismatch: 8, identity: 0.75

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgtc	Protospacer
 *. ******** ***********.**  * *

665. spacer 17.12|5329344|32|LR130759|CRT matches to KX443326 (Mycobacterium phage BruceB, complete genome) position: , mismatch: 8, identity: 0.75

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgtc	Protospacer
 *. ******** ***********.**  * *

666. spacer 17.12|5329344|32|LR130759|CRT matches to MK433277 (Mycobacterium phage Renaissance, complete genome) position: , mismatch: 8, identity: 0.75

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgtc	Protospacer
 *. ******** ***********.**  * *

667. spacer 17.12|5329344|32|LR130759|CRT matches to MH590605 (Mycobacterium phage Cherrybomb426, complete genome) position: , mismatch: 8, identity: 0.75

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgtc	Protospacer
 *. ******** ***********.**  * *

668. spacer 17.12|5329344|32|LR130759|CRT matches to MH779509 (Mycobacterium phage Kasen3, complete genome) position: , mismatch: 8, identity: 0.75

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgtc	Protospacer
 *. ******** ***********.**  * *

669. spacer 17.12|5329344|32|LR130759|CRT matches to JN699002 (Mycobacterium phage Avrafan, complete genome) position: , mismatch: 8, identity: 0.75

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgtc	Protospacer
 *. ******** ***********.**  * *

670. spacer 17.12|5329344|32|LR130759|CRT matches to MH779507 (Mycobacterium phage Hotshotbaby7, complete genome) position: , mismatch: 8, identity: 0.75

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgtc	Protospacer
 *. ******** ***********.**  * *

671. spacer 17.12|5329344|32|LR130759|CRT matches to KT355474 (Mycobacterium phage Frosty24, complete genome) position: , mismatch: 8, identity: 0.75

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgtc	Protospacer
 *. ******** ***********.**  * *

672. spacer 17.12|5329344|32|LR130759|CRT matches to KC787109 (Mycobacterium phage Legendre, partial genome) position: , mismatch: 8, identity: 0.75

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgtc	Protospacer
 *. ******** ***********.**  * *

673. spacer 17.12|5329344|32|LR130759|CRT matches to JN412593 (Mycobacterium phage Liefie, complete genome) position: , mismatch: 8, identity: 0.75

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgtc	Protospacer
 *. ******** ***********.**  * *

674. spacer 17.12|5329344|32|LR130759|CRT matches to MH479920 (Mycobacterium phage Mowgli, complete genome) position: , mismatch: 8, identity: 0.75

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgtc	Protospacer
 *. ******** ***********.**  * *

675. spacer 17.12|5329344|32|LR130759|CRT matches to NC_008202 (Mycobacterium phage Halo, complete genome) position: , mismatch: 8, identity: 0.75

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgtc	Protospacer
 *. ******** ***********.**  * *

676. spacer 17.12|5329344|32|LR130759|CRT matches to KM923970 (Mycobacterium phage Gomashi, complete genome) position: , mismatch: 8, identity: 0.75

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgtc	Protospacer
 *. ******** ***********.**  * *

677. spacer 17.12|5329344|32|LR130759|CRT matches to MH450127 (Mycobacterium phage Plagueis, complete genome) position: , mismatch: 8, identity: 0.75

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgtc	Protospacer
 *. ******** ***********.**  * *

678. spacer 17.12|5329344|32|LR130759|CRT matches to KT347314 (Mycobacterium phage Phreak, complete genome) position: , mismatch: 8, identity: 0.75

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgtc	Protospacer
 *. ******** ***********.**  * *

679. spacer 17.12|5329344|32|LR130759|CRT matches to KT365399 (Mycobacterium phage Annihilator, complete genome) position: , mismatch: 8, identity: 0.75

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgtc	Protospacer
 *. ******** ***********.**  * *

680. spacer 17.12|5329344|32|LR130759|CRT matches to KC787110 (Mycobacterium phage Leo, complete genome) position: , mismatch: 8, identity: 0.75

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgtc	Protospacer
 *. ******** ***********.**  * *

681. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_LR134445 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 3, complete sequence) position: , mismatch: 8, identity: 0.742

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ggaacggcaccggcggcgcgggcgccggcgc	Protospacer
  ****** ***************  . ** 

682. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP007130 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 2, complete sequence) position: , mismatch: 8, identity: 0.742

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccgacggcaccggcggcgcgggccgcgtggt	Protospacer
**.***** ************** * .. * 

683. spacer 18.1|5329584|31|LR130759|CRT matches to NC_018022 (Mycolicibacterium chubuense NBB4 plasmid pMYCCH.01, complete sequence) position: , mismatch: 8, identity: 0.742

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
tcccgaacgccggcggcgcgggcgggatcgg	Protospacer
.*   ..* ******************.***

684. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP018236 (Rhizobium leguminosarum strain Vaf-108 plasmid unnamed8) position: , mismatch: 8, identity: 0.742

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
aaagcggccccggcggcgcgggcggcacgcc	Protospacer
  *.****.**************** **   

685. spacer 18.1|5329584|31|LR130759|CRT matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 8, identity: 0.742

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccgcggcaccggcggctcgggcgggacgtt	Protospacer
 * .**** ******** **********   

686. spacer 18.1|5329584|31|LR130759|CRT matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 8, identity: 0.742

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccgcggcaccggcggctcgggcgggacgtt	Protospacer
 * .**** ******** **********   

687. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP021820 (Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.742

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
tccgcttctccggcggcgcgatcgggaccgt	Protospacer
.* .*  *************. ******** 

688. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP010858 (Marinovum algicola DG 898 plasmid pMaD3) position: , mismatch: 8, identity: 0.742

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gcatcggccccggcggcgcgggcggcaagaa	Protospacer
 ** ****.**************** *  ..

689. spacer 18.1|5329584|31|LR130759|CRT matches to NC_019849 (Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence) position: , mismatch: 8, identity: 0.742

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
tccgcttctccggcggcgcgatcgggaccgt	Protospacer
.* .*  *************. ******** 

690. spacer 18.1|5329584|31|LR130759|CRT matches to NC_003078 (Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.742

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
tccgcttctccggcggcgcgatcgggaccgt	Protospacer
.* .*  *************. ******** 

691. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_LR134456 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 14, complete sequence) position: , mismatch: 8, identity: 0.742

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
acaacggttccagcggcgcgggcgcctcctc	Protospacer
 ******.***.************   **  

692. spacer 18.1|5329584|31|LR130759|CRT matches to NC_023497 (Amycolatopsis keratiniphila plasmid pXL100, complete sequence) position: , mismatch: 8, identity: 0.742

-----ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gtccctca-----tccggcggcgcgggcgcggccgg	Protospacer
     .**     **************** *.****

693. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP019586 (Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.742

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
tccgcttctccggcggcgcgatcgggaccgt	Protospacer
.* .*  *************. ******** 

694. spacer 18.1|5329584|31|LR130759|CRT matches to NC_017326 (Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence) position: , mismatch: 8, identity: 0.742

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
tccgcttctccggcggcgcgatcgggaccgt	Protospacer
.* .*  *************. ******** 

695. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP021799 (Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.742

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
tccgcttctccggcggcgcgatcgggaccgt	Protospacer
.* .*  *************. ******** 

696. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP008954 (Amycolatopsis japonica strain DSM 44213 plasmid pAmyja1, complete sequence) position: , mismatch: 8, identity: 0.742

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ggaacgggtccggccgcgcgggcggcgtcag	Protospacer
  ***** ****** ********** ..*.*

697. spacer 18.1|5329584|31|LR130759|CRT matches to NC_017323 (Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence) position: , mismatch: 8, identity: 0.742

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
tccgcttctccggcggcgcgatcgggaccgt	Protospacer
.* .*  *************. ******** 

698. spacer 18.1|5329584|31|LR130759|CRT matches to NC_023286 (Streptomyces sp. F12 plasmid pFRL6, complete sequence) position: , mismatch: 8, identity: 0.742

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gaacgggcgccggcggcgcgcgcgggactgc	Protospacer
  *  *** *********** *******.* 

699. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP009146 (Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.742

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
tccgcttctccggcggcgcgatcgggaccgt	Protospacer
.* .*  *************. ******** 

700. spacer 18.1|5329584|31|LR130759|CRT matches to NC_018701 (Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence) position: , mismatch: 8, identity: 0.742

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
tccgcttctccggcggcgcgatcgggaccgt	Protospacer
.* .*  *************. ******** 

701. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP021828 (Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.742

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
tccgcttctccggcggcgcgatcgggaccgt	Protospacer
.* .*  *************. ******** 

702. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP012399 (Chelatococcus sp. CO-6 plasmid pCO-6, complete sequence) position: , mismatch: 8, identity: 0.742

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gtcaggcctccggcggcgcgggcaggatcgt	Protospacer
 . * * ****************.***.** 

703. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP021802 (Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.742

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
tccgcttctccggcggcgcgatcgggaccgt	Protospacer
.* .*  *************. ******** 

704. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP021831 (Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.742

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
tccgcttctccggcggcgcgatcgggaccgt	Protospacer
.* .*  *************. ******** 

705. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP021823 (Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.742

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
tccgcttctccggcggcgcgatcgggaccgt	Protospacer
.* .*  *************. ******** 

706. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP021814 (Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.742

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
tccgcttctccggcggcgcgatcgggaccgt	Protospacer
.* .*  *************. ******** 

707. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP021795 (Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.742

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
tccgcttctccggcggcgcgatcgggaccgt	Protospacer
.* .*  *************. ******** 

708. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP021810 (Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.742

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
tccgcttctccggcggcgcgatcgggaccgt	Protospacer
.* .*  *************. ******** 

709. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP021806 (Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.742

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
tccgcttctccggcggcgcgatcgggaccgt	Protospacer
.* .*  *************. ******** 

710. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP021218 (Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.742

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
tccgcttctccggcggcgcgatcgggaccgt	Protospacer
.* .*  *************. ******** 

711. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP026527 (Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.742

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
tccgcttctccggcggcgcgatcgggaccgt	Protospacer
.* .*  *************. ******** 

712. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP019484 (Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.742

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
tccgcttctccggcggcgcgatcgggaccgt	Protospacer
.* .*  *************. ******** 

713. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP019487 (Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence) position: , mismatch: 8, identity: 0.742

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
tccgcttctccggcggcgcgatcgggaccgt	Protospacer
.* .*  *************. ******** 

714. spacer 18.1|5329584|31|LR130759|CRT matches to NC_020560 (Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.742

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
tccgcttctccggcggcgcgatcgggaccgt	Protospacer
.* .*  *************. ******** 

715. spacer 18.1|5329584|31|LR130759|CRT matches to KY092482 (Streptomyces phage Mojorita, complete genome) position: , mismatch: 8, identity: 0.742

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
cggcgggcgccggcggcgcggccgggacggt	Protospacer
* .  *** ************ ****** * 

716. spacer 18.1|5329584|31|LR130759|CRT matches to KY092480 (Streptomyces phage Picard, complete genome) position: , mismatch: 8, identity: 0.742

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
cggcgggcgccggcggcgcggccgggacggt	Protospacer
* .  *** ************ ****** * 

717. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP050092 (Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b6, complete sequence) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
tatccggaaaagcaggcgccggcggagcgga	Protospacer
.   ***  *******************.*.

718. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP050104 (Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b2, complete sequence) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
tatccggaaaagcaggcgccggcggagcgga	Protospacer
.   ***  *******************.*.

719. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP016287 (Rhizobium leguminosarum strain Vaf10 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
tatccggaaaagcaggcgccggcggagcgga	Protospacer
.   ***  *******************.*.

720. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP050109 (Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b2, complete sequence) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
tatccggaaaagcaggcgccggcggagcgga	Protospacer
.   ***  *******************.*.

721. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP048281 (Rhizobium leguminosarum bv. viciae 248 plasmid pRle248e, complete sequence) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
tatccggaaaagcaggcgccggcggagcgga	Protospacer
.   ***  *******************.*.

722. spacer 18.3|5329698|31|LR130759|CRT matches to NC_015727 (Cupriavidus necator N-1 plasmid pBB1, complete sequence) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg---	CRISPR spacer
gcggcgaccaagctggcgccggc---gctagtct	Protospacer
 *****.****** *********   ** .*   

723. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
accacggccaaccaggcgtcggcggaggccg	Protospacer
 * .******* ******.********   *

724. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP021119 (Streptomyces sp. CLI2509 strain CLI2905 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gtggcggccaagccgacgccggcggcgagcg	Protospacer
 .*********** *.********* * . *

725. spacer 18.3|5329698|31|LR130759|CRT matches to MH371116 (Mycobacterium phage DMoney, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

726. spacer 18.3|5329698|31|LR130759|CRT matches to MH045569 (Mycobacterium phage Schiebel, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

727. spacer 18.3|5329698|31|LR130759|CRT matches to MH371119 (Mycobacterium phage OctaviousRex, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

728. spacer 18.3|5329698|31|LR130759|CRT matches to MF919497 (Mycobacterium phage Chance64, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

729. spacer 18.3|5329698|31|LR130759|CRT matches to MH001456 (Mycobacterium phage CLED96, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

730. spacer 18.3|5329698|31|LR130759|CRT matches to GQ303261 (Mycobacterium phage Hope, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

731. spacer 18.3|5329698|31|LR130759|CRT matches to MG099946 (Mycobacterium phage LouisV14, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

732. spacer 18.3|5329698|31|LR130759|CRT matches to KC787112 (Mycobacterium phage Clark, partial genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

733. spacer 18.3|5329698|31|LR130759|CRT matches to MH779513 (Mycobacterium phage Olga, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

734. spacer 18.3|5329698|31|LR130759|CRT matches to MK919475 (Mycobacterium phage Camri, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

735. spacer 18.3|5329698|31|LR130759|CRT matches to MK310146 (Mycobacterium phage Crespo, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

736. spacer 18.3|5329698|31|LR130759|CRT matches to MK524493 (Mycobacterium phage Darionha, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

737. spacer 18.3|5329698|31|LR130759|CRT matches to MH779505 (Mycobacterium phage Grizzly, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

738. spacer 18.3|5329698|31|LR130759|CRT matches to EU568876 (Mycobacterium phage BPs, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

739. spacer 18.3|5329698|31|LR130759|CRT matches to KC787107 (Mycobacterium phage Bo4, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

740. spacer 18.3|5329698|31|LR130759|CRT matches to MF668268 (Mycobacterium phage Aroostook, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

741. spacer 18.3|5329698|31|LR130759|CRT matches to KX588251 (Mycobacterium phage Jane, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

742. spacer 18.3|5329698|31|LR130759|CRT matches to KC787103 (Mycobacterium phage Chy2, partial genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

743. spacer 18.3|5329698|31|LR130759|CRT matches to MH001455 (Mycobacterium phage Remy19, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

744. spacer 18.3|5329698|31|LR130759|CRT matches to KT355472 (Mycobacterium phage Cedasite, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

745. spacer 18.3|5329698|31|LR130759|CRT matches to KX664455 (Mycobacterium phage Zombie, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

746. spacer 18.3|5329698|31|LR130759|CRT matches to MH077584 (Mycobacterium phage Phish, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

747. spacer 18.3|5329698|31|LR130759|CRT matches to KC787108 (Mycobacterium phage DNAIII, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

748. spacer 18.3|5329698|31|LR130759|CRT matches to MN444875 (Mycobacterium phage Jonghyun, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

749. spacer 18.3|5329698|31|LR130759|CRT matches to MK433279 (Mycobacterium phage Kareem, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

750. spacer 18.3|5329698|31|LR130759|CRT matches to KJ725374 (Mycobacterium phage Guo1, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

751. spacer 18.3|5329698|31|LR130759|CRT matches to MT818422 (Mycobacterium phage Periodt, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

752. spacer 18.3|5329698|31|LR130759|CRT matches to MK305884 (Mycobacterium phage BQuat, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

753. spacer 18.3|5329698|31|LR130759|CRT matches to MF668272 (Mycobacterium phage Gideon, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

754. spacer 18.3|5329698|31|LR130759|CRT matches to MH779515 (Mycobacterium phage Sweets, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

755. spacer 18.3|5329698|31|LR130759|CRT matches to MW119570 (Mycobacterium phage Lang, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

756. spacer 18.3|5329698|31|LR130759|CRT matches to KC787111 (Mycobacterium phage Sedge, partial genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

757. spacer 18.3|5329698|31|LR130759|CRT matches to MF612073 (Klebsiella phage SopranoGao, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gagaaggccaagcaggcgcaggcagagctgc	Protospacer
  *. ************** ***.**** * 

758. spacer 18.3|5329698|31|LR130759|CRT matches to KC787104 (Mycobacterium phage Chy3, partial genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

759. spacer 18.3|5329698|31|LR130759|CRT matches to NC_012788 (Mycobacterium phage Angel, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

760. spacer 18.3|5329698|31|LR130759|CRT matches to KX443326 (Mycobacterium phage BruceB, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

761. spacer 18.3|5329698|31|LR130759|CRT matches to MK433277 (Mycobacterium phage Renaissance, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

762. spacer 18.3|5329698|31|LR130759|CRT matches to MH590605 (Mycobacterium phage Cherrybomb426, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

763. spacer 18.3|5329698|31|LR130759|CRT matches to MH779509 (Mycobacterium phage Kasen3, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

764. spacer 18.3|5329698|31|LR130759|CRT matches to JN699002 (Mycobacterium phage Avrafan, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

765. spacer 18.3|5329698|31|LR130759|CRT matches to MH779507 (Mycobacterium phage Hotshotbaby7, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

766. spacer 18.3|5329698|31|LR130759|CRT matches to KT355474 (Mycobacterium phage Frosty24, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

767. spacer 18.3|5329698|31|LR130759|CRT matches to KC787109 (Mycobacterium phage Legendre, partial genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

768. spacer 18.3|5329698|31|LR130759|CRT matches to JN412593 (Mycobacterium phage Liefie, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

769. spacer 18.3|5329698|31|LR130759|CRT matches to MH479920 (Mycobacterium phage Mowgli, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

770. spacer 18.3|5329698|31|LR130759|CRT matches to NC_008202 (Mycobacterium phage Halo, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

771. spacer 18.3|5329698|31|LR130759|CRT matches to KM923970 (Mycobacterium phage Gomashi, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

772. spacer 18.3|5329698|31|LR130759|CRT matches to MH450127 (Mycobacterium phage Plagueis, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

773. spacer 18.3|5329698|31|LR130759|CRT matches to KT347314 (Mycobacterium phage Phreak, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

774. spacer 18.3|5329698|31|LR130759|CRT matches to KT365399 (Mycobacterium phage Annihilator, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

775. spacer 18.3|5329698|31|LR130759|CRT matches to KC787110 (Mycobacterium phage Leo, complete genome) position: , mismatch: 8, identity: 0.742

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
acaccggccaagaaggcgccggcgaagacgt	Protospacer
 *. ******** ***********.**  * 

776. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 8, identity: 0.75

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
tccttgcgctccggcggcgcggccgggagcga	Protospacer
 **    *************** ***** **.

777. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP021820 (Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
atccgcttctccggcggcgcgatcgggaccgt	Protospacer
*.* .*  *************. ******** 

778. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP010858 (Marinovum algicola DG 898 plasmid pMaD3) position: , mismatch: 8, identity: 0.75

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
agcatcggccccggcggcgcgggcggcaagaa	Protospacer
* ** ****.**************** *  ..

779. spacer 19.1|5329937|32|LR130759|CRT matches to NC_019849 (Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence) position: , mismatch: 8, identity: 0.75

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
atccgcttctccggcggcgcgatcgggaccgt	Protospacer
*.* .*  *************. ******** 

780. spacer 19.1|5329937|32|LR130759|CRT matches to NC_003078 (Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
atccgcttctccggcggcgcgatcgggaccgt	Protospacer
*.* .*  *************. ******** 

781. spacer 19.1|5329937|32|LR130759|CRT matches to NC_023497 (Amycolatopsis keratiniphila plasmid pXL100, complete sequence) position: , mismatch: 8, identity: 0.75

accaacggc-----tccggcggcgcgggcgggaccgg	CRISPR spacer
-----cgtccctcatccggcggcgcgggcgcggccgg	Protospacer
     ** *     **************** *.****

782. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP019586 (Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
atccgcttctccggcggcgcgatcgggaccgt	Protospacer
*.* .*  *************. ******** 

783. spacer 19.1|5329937|32|LR130759|CRT matches to NC_017326 (Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence) position: , mismatch: 8, identity: 0.75

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
atccgcttctccggcggcgcgatcgggaccgt	Protospacer
*.* .*  *************. ******** 

784. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP021799 (Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
atccgcttctccggcggcgcgatcgggaccgt	Protospacer
*.* .*  *************. ******** 

785. spacer 19.1|5329937|32|LR130759|CRT matches to NC_017323 (Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence) position: , mismatch: 8, identity: 0.75

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
atccgcttctccggcggcgcgatcgggaccgt	Protospacer
*.* .*  *************. ******** 

786. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP009146 (Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
atccgcttctccggcggcgcgatcgggaccgt	Protospacer
*.* .*  *************. ******** 

787. spacer 19.1|5329937|32|LR130759|CRT matches to NC_018701 (Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence) position: , mismatch: 8, identity: 0.75

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
atccgcttctccggcggcgcgatcgggaccgt	Protospacer
*.* .*  *************. ******** 

788. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP021828 (Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
atccgcttctccggcggcgcgatcgggaccgt	Protospacer
*.* .*  *************. ******** 

789. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP021802 (Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
atccgcttctccggcggcgcgatcgggaccgt	Protospacer
*.* .*  *************. ******** 

790. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP021831 (Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
atccgcttctccggcggcgcgatcgggaccgt	Protospacer
*.* .*  *************. ******** 

791. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP021823 (Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
atccgcttctccggcggcgcgatcgggaccgt	Protospacer
*.* .*  *************. ******** 

792. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP021814 (Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
atccgcttctccggcggcgcgatcgggaccgt	Protospacer
*.* .*  *************. ******** 

793. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP021795 (Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
atccgcttctccggcggcgcgatcgggaccgt	Protospacer
*.* .*  *************. ******** 

794. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP021810 (Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
atccgcttctccggcggcgcgatcgggaccgt	Protospacer
*.* .*  *************. ******** 

795. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP021806 (Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
atccgcttctccggcggcgcgatcgggaccgt	Protospacer
*.* .*  *************. ******** 

796. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP021218 (Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
atccgcttctccggcggcgcgatcgggaccgt	Protospacer
*.* .*  *************. ******** 

797. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP026527 (Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
atccgcttctccggcggcgcgatcgggaccgt	Protospacer
*.* .*  *************. ******** 

798. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP023064 (Sinorhizobium sp. CCBAU 05631 plasmid pSS05631b, complete sequence) position: , mismatch: 8, identity: 0.75

accaacggctccggcggcgcgggcgggaccgg--	CRISPR spacer
ctgaactgcttcggcggcgcgggcgg--ccagca	Protospacer
 . *** ***.***************  **.*  

799. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP021082 (Deinococcus ficus strain CC-FR2-10 plasmid pDFI1, complete sequence) position: , mismatch: 8, identity: 0.75

accaacggctccggcggcgcgggcgggaccgg--	CRISPR spacer
caggacggcgccggcggcgcggacggg--cggtt	Protospacer
   .***** ************.****  ***  

800. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP019484 (Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
atccgcttctccggcggcgcgatcgggaccgt	Protospacer
*.* .*  *************. ******** 

801. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP053207 (Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1C, complete sequence) position: , mismatch: 8, identity: 0.75

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccgaccatttccggcggcgcgtgcgggatcgg	Protospacer
 * * *. .************ ******.***

802. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP019487 (Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence) position: , mismatch: 8, identity: 0.75

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
atccgcttctccggcggcgcgatcgggaccgt	Protospacer
*.* .*  *************. ******** 

803. spacer 19.1|5329937|32|LR130759|CRT matches to NC_020560 (Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
atccgcttctccggcggcgcgatcgggaccgt	Protospacer
*.* .*  *************. ******** 

804. spacer 19.1|5329937|32|LR130759|CRT matches to MT553347 (Mycobacterium phage Awesomesauce, complete genome) position: , mismatch: 8, identity: 0.75

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
tccaccggctccggcggcacgggccagttctg	Protospacer
 *** *************.***** .* .* *

805. spacer 19.1|5329937|32|LR130759|CRT matches to MH020243 (Mycobacterium phage TootsiePop, complete genome) position: , mismatch: 8, identity: 0.75

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
tccaccggctccggcggcacgggccagttctg	Protospacer
 *** *************.***** .* .* *

806. spacer 19.1|5329937|32|LR130759|CRT matches to MH020242 (Mycobacterium phage Misha28, complete genome) position: , mismatch: 8, identity: 0.75

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
tccaccggctccggcggcacgggccagttctg	Protospacer
 *** *************.***** .* .* *

807. spacer 19.1|5329937|32|LR130759|CRT matches to MK494120 (Mycobacterium phage Piper2020, complete genome) position: , mismatch: 8, identity: 0.75

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
tccaccggctccggcggcacgggccagttctg	Protospacer
 *** *************.***** .* .* *

808. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP031163 (Deinococcus wulumuqiensis strain NEB 479 plasmid pDrdI, complete sequence) position: , mismatch: 8, identity: 0.75

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
tcagggggccaagcaggcgcaggcggaagccg	Protospacer
 * ** ************** ******.   *

809. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP015090 (Pelagibaca abyssi strain JLT2014 plasmid pPABY2, complete sequence) position: , mismatch: 8, identity: 0.75

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
accggcggccatgcaggcgtcggtcacggaag	Protospacer
*********** *******.***. . * *.*

810. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP017294 (Pseudomonas aeruginosa strain PA83 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gcaggcgcccgagcaggcgccggcggcagagt	Protospacer
.* **** **.*************** . ** 

811. spacer 19.3|5330051|32|LR130759|CRT matches to NC_013857 (Azospirillum sp. B510 plasmid pAB510c, complete sequence) position: , mismatch: 8, identity: 0.75

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ttccggtgccaagctggcgccggcggtgcatg	Protospacer
 .* *  ******* *********** *** *

812. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP021119 (Streptomyces sp. CLI2509 strain CLI2905 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
agtggcggccaagccgacgccggcggcgagcg	Protospacer
* .*********** *.********* * . *

813. spacer 20.1|5490160|31|LR130759|CRISPRCasFinder matches to NZ_CP032346 (Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.742

actctatgaccccggcctcgccggtccgggt	CRISPR spacer
tcgccgtgaccccggcctcggcggtcaggcg	Protospacer
 * *..************** ***** **  

814. spacer 2.1|587586|33|LR130759|CRISPRCasFinder matches to NZ_CP030372 (Salinibacter ruber strain RM158 plasmid pSR67, complete sequence) position: , mismatch: 9, identity: 0.727

gcgttgaaggtgccggtgttgaagtcgccggcg	CRISPR spacer
tgagtgacggtgacggtgttgaagtcgccctca	Protospacer
  . *** **** ****************  *.

815. spacer 2.1|587586|33|LR130759|CRISPRCasFinder matches to NC_014157 (Salinibacter ruber M8 plasmid pSR84, complete sequence) position: , mismatch: 9, identity: 0.727

gcgttgaaggtgccggtgttgaagtcgccggcg	CRISPR spacer
tgagtgacggtgacggtgttgaagtcgccctca	Protospacer
  . *** **** ****************  *.

816. spacer 5.1|1423971|33|LR130759|CRISPRCasFinder matches to MF477236 (Nocardia phage NTR1, complete genome) position: , mismatch: 9, identity: 0.727

tggcgggcggtgaggagctgggcgatgtggtcg	CRISPR spacer
ccggactcggtgaggagctgtgcgatgtcgtgg	Protospacer
. * .  ************* ******* ** *

817. spacer 8.17|3078734|34|LR130759|CRT matches to NZ_CP030264 (Ensifer adhaerens strain Corn53 plasmid AB, complete sequence) position: , mismatch: 9, identity: 0.735

ccgacgccacgctctggggcgggaccggcggcgc	CRISPR spacer
gtggcgtggcgctctggggcggcatcggcggcgt	Protospacer
 .*.**. .************* *.********.

818. spacer 8.17|3078734|34|LR130759|CRT matches to NZ_CP015882 (Ensifer adhaerens strain Casida A plasmid pCasidaAB, complete sequence) position: , mismatch: 9, identity: 0.735

ccgacgccacgctctggggcgggaccggcggcgc	CRISPR spacer
gtggcgtggcgctctggggcggcatcggcggcgt	Protospacer
 .*.**. .************* *.********.

819. spacer 16.3|5306652|41|LR130759|CRISPRCasFinder matches to NZ_CP015203 (Rhodococcus sp. 008 plasmid pR8L1, complete sequence) position: , mismatch: 9, identity: 0.78

cggtagtagcgccgacggcggtgccggcgggaccgccgggc	CRISPR spacer
ctgtaccggcgccgacggcggttccggcgagaccgcctgct	Protospacer
* *** ..************** ******.******* * .

820. spacer 16.3|5306652|41|LR130759|CRISPRCasFinder matches to NZ_CP046100 (Rhodococcus sp. AQ5-07 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.78

cggtagtagcgccgacggcggtgccggcgggaccgccgggc	CRISPR spacer
ccgtaccggcgccgacggcggttccggcgagaccgcccgct	Protospacer
* *** ..************** ******.******* * .

821. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP018348 (Klebsiella pneumoniae strain CAV1417 plasmid pCAV1417-9294, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

822. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP018672 (Klebsiella pneumoniae strain CAV1217 plasmid pCAV1217-9294, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

823. spacer 17.3|5328990|31|LR130759|CRT matches to CP052171 (Klebsiella pneumoniae strain F16KP0075 plasmid pF16KP0075-4, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

824. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP032199 (Klebsiella pneumoniae strain AR_0097 plasmid unnamed5, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

825. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP022775 (Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gcggcggccaagcaggcctcggcgcgcgcgc	Protospacer
 **************** .***** .   * 

826. spacer 17.3|5328990|31|LR130759|CRT matches to CP052486 (Klebsiella pneumoniae strain C16KP0036 plasmid pC16KP0036-2, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

827. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP021756 (Klebsiella pneumoniae strain AR_0113 plasmid unitig_5, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

828. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP023852 (Escherichia coli strain 4/0 plasmid p4_0.3, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

829. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP018433 (Klebsiella pneumoniae strain MNCRE53 plasmid pMNCRE53_1, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

830. spacer 17.3|5328990|31|LR130759|CRT matches to CP052166 (Klebsiella pneumoniae strain F16KP0082 plasmid pF16KP0082-4, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

831. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP018445 (Klebsiella pneumoniae strain Kp_Goe_822917 plasmid pKp_Goe_917-4, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

832. spacer 17.3|5328990|31|LR130759|CRT matches to CP052411 (Klebsiella pneumoniae strain C17KP0008 plasmid pC17KP0008-4, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

833. spacer 17.3|5328990|31|LR130759|CRT matches to CP052161 (Klebsiella pneumoniae strain F16KP0084 plasmid pF16KP0084-3, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

834. spacer 17.3|5328990|31|LR130759|CRT matches to NC_014310 (Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gcggcggccaagcaggcctcggcgcgcgcgc	Protospacer
 **************** .***** .   * 

835. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP014648 (Klebsiella pneumoniae strain KPNIH36 plasmid pKPN-821, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

836. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP011979 (Klebsiella pneumoniae DMC1097 plasmid pDMC1097-20.222kb, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

837. spacer 17.3|5328990|31|LR130759|CRT matches to CP052402 (Klebsiella pneumoniae strain C17KP0039 plasmid pC17KP0039-3, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

838. spacer 17.3|5328990|31|LR130759|CRT matches to CP052312 (Klebsiella pneumoniae strain E16KP0102 plasmid pE16KP0102-3, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

839. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP010394 (Klebsiella pneumoniae strain 34618 plasmid p34618-13.841kb, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

840. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP022762 (Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gcggcggccaagcaggcctcggcgcgcgcgc	Protospacer
 **************** .***** .   * 

841. spacer 17.3|5328990|31|LR130759|CRT matches to NC_009793 (Citrobacter koseri ATCC BAA-895 plasmid pCKO3, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

842. spacer 17.3|5328990|31|LR130759|CRT matches to CP052146 (Klebsiella pneumoniae strain F17KP0012 plasmid pF17KP0012-3, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

843. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_LS992179 (Citrobacter freundii isolate Citrobacter freundii str. E2614 plasmid 5, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

844. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP024884 (Klebsiella aerogenes strain AR_0009 plasmid tig00000054_pilon, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

845. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP033630 (Klebsiella pneumoniae strain 4743 plasmid unnamed5) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

846. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP033630 (Klebsiella pneumoniae strain 4743 plasmid unnamed5) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

847. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP011988 (Klebsiella pneumoniae UHKPC07 plasmid pUHKPC07-13.841kb, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

848. spacer 17.3|5328990|31|LR130759|CRT matches to CP052360 (Klebsiella pneumoniae strain D16KP0144 plasmid pD16KP0144-4, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

849. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP011982 (Klebsiella pneumoniae 500_1420 plasmid p500_1420-51.662kb, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

850. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP011982 (Klebsiella pneumoniae 500_1420 plasmid p500_1420-51.662kb, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

851. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP011984 (Klebsiella pneumoniae 500_1420 plasmid p500_1420-13.838kb, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

852. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP020840 (Klebsiella pneumoniae strain BK13043 plasmid pBK13043-3, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

853. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP011993 (Klebsiella pneumoniae UHKPC33 plasmid pUHKPC33-13.841kb, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

854. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP027058 (Klebsiella pneumoniae strain 2_GR_12 plasmid ColRNAI, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

855. spacer 17.3|5328990|31|LR130759|CRT matches to CP052447 (Klebsiella pneumoniae strain C16KP0098 plasmid pC16KP0098-4, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

856. spacer 17.3|5328990|31|LR130759|CRT matches to NC_018953 (Klebsiella pneumoniae plasmid pIGMS32, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

857. spacer 17.3|5328990|31|LR130759|CRT matches to NC_019156 (Klebsiella pneumoniae plasmid pAAC154, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

858. spacer 17.3|5328990|31|LR130759|CRT matches to NC_019159 (Klebsiella pneumoniae plasmid ColEST258, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

859. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP018425 (Klebsiella pneumoniae strain MNCRE69 plasmid pMNCRE69_1, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

860. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP032930 (Klebsiella aerogenes strain AR_0062 plasmid unnamed5, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

861. spacer 17.3|5328990|31|LR130759|CRT matches to NC_021656 (Klebsiella pneumoniae plasmid pKpQIL-SC29, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

862. spacer 17.3|5328990|31|LR130759|CRT matches to NC_021666 (Klebsiella pneumoniae plasmid ColE-LS6, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

863. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP024651 (Escherichia coli strain BH100 substr. MG2014 plasmid pAp, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

864. spacer 17.3|5328990|31|LR130759|CRT matches to CP052418 (Klebsiella pneumoniae strain C16KP0189 plasmid pC16KP0189-4, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

865. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP021837 (Klebsiella pneumoniae strain AR_0120 plasmid tig00000601_pilon, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

866. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP045796 (Klebsiella pneumoniae subsp. pneumoniae strain AUSMDU00008079 plasmid pAUSMDU00008079_04, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

867. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP007796 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p3, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ccggctgccaagccggcgccggccacctgag	Protospacer
***** ******* ********* .  ...*

868. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP022921 (Klebsiella pneumoniae strain ST307PT03 plasmid pJYC03B, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

869. spacer 17.3|5328990|31|LR130759|CRT matches to CP052234 (Klebsiella pneumoniae strain E17KP0033 plasmid pE17KP0033-3, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

870. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP046275 (Enterobacter hormaechei strain E70 plasmid pE70-TEM1, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

871. spacer 17.3|5328990|31|LR130759|CRT matches to CP052555 (Klebsiella pneumoniae strain A17KP0038 plasmid pA17KP0038-4, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

872. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP014122 (Klebsiella pneumoniae strain FDAARGOS_156 plasmid unnamed4, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

873. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP014122 (Klebsiella pneumoniae strain FDAARGOS_156 plasmid unnamed4, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

874. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP031807 (Klebsiella pneumoniae strain MSB1_8A-sc-2280397 plasmid unnamed7, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

875. spacer 17.3|5328990|31|LR130759|CRT matches to CP052210 (Klebsiella pneumoniae strain E17KP0085 plasmid pE17KP0085-3, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

876. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP023528 (Citrobacter koseri strain FDAARGOS_393 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

877. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP018353 (Klebsiella pneumoniae strain CAV1453 plasmid pCAV1453-14, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

878. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP021548 (Klebsiella pneumoniae strain AR_0112 plasmid tig00000005, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

879. spacer 17.3|5328990|31|LR130759|CRT matches to CP052529 (Klebsiella pneumoniae strain B16KP0177 plasmid pB16KP0177-5, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

880. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP021543 (Klebsiella pneumoniae strain AR_0047 plasmid tig00000004, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

881. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP009877 (Klebsiella pneumoniae subsp. pneumoniae strain KPNIH31 plasmid pAAC154-a9e, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

882. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP009772 (Klebsiella pneumoniae subsp. pneumoniae strain KPNIH33 plasmid pEA1509_B, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

883. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP009778 (Klebsiella pneumoniae subsp. pneumoniae strain KPNIH32 plasmid pKPN-c8b, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

884. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP008832 (Klebsiella pneumoniae subsp. pneumoniae KPR0928 plasmid pKPN-294, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

885. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP008799 (Klebsiella pneumoniae subsp. pneumoniae KPNIH24 plasmid pKPN-819, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

886. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP006928 (Klebsiella pneumoniae 30660/NJST258_1 plasmid pNJST258N4, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

887. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP007728 (Klebsiella pneumoniae subsp. pneumoniae KPNIH10 plasmid pAAC154-a50, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

888. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP006919 (Klebsiella pneumoniae 30684/NJST258_2 plasmid pNJST258C2, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

889. spacer 17.3|5328990|31|LR130759|CRT matches to CP052283 (Klebsiella pneumoniae strain E16KP0224 plasmid pE16KP0224-3, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

890. spacer 17.3|5328990|31|LR130759|CRT matches to CP052428 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-1, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

891. spacer 17.3|5328990|31|LR130759|CRT matches to CP052548 (Klebsiella pneumoniae strain B16KP0089 plasmid pB16KP0089-2, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

892. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP036449 (Klebsiella pneumoniae strain KPNIH45 plasmid pKPC-610e, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

893. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP020066 (Klebsiella pneumoniae strain AR_0117 plasmid unitig_5, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

894. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP020075 (Klebsiella pneumoniae strain AR_0115 plasmid tig00000005, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

895. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP020112 (Klebsiella pneumoniae strain AR_0098 plasmid tig00000004, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

896. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP015391 (Klebsiella pneumoniae strain NY9 plasmid pNY9_6, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

897. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP023017 (Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gcggcggccaagcaggcctcggcgcgcgcgc	Protospacer
 **************** .***** .   * 

898. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP036445 (Klebsiella pneumoniae strain ABFPV plasmid tig00001273_pilon, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

899. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP050378 (Klebsiella pneumoniae strain 51015 plasmid p51015_COL_RNAI, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

900. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP050378 (Klebsiella pneumoniae strain 51015 plasmid p51015_COL_RNAI, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

901. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP031757 (Klebsiella aerogenes strain FDAARGOS_327 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

902. spacer 17.3|5328990|31|LR130759|CRT matches to CP052424 (Klebsiella pneumoniae strain C16KP0164 plasmid pC16KP0164-2, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

903. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_LR130551 (Klebsiella pneumoniae strain KPC2 isolate KPC2 plasmid 4) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

904. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP022576 (Klebsiella pneumoniae strain BIC-1 plasmid pBIC-1c, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

905. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP024463 (Klebsiella pneumoniae strain QS17-0161 plasmid pMRSN480738_10.0, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

906. spacer 17.3|5328990|31|LR130759|CRT matches to CP052191 (Klebsiella pneumoniae strain F16KP0019 plasmid pF16KP0019-2, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

907. spacer 17.3|5328990|31|LR130759|CRT matches to CP052541 (Klebsiella pneumoniae strain B16KP0141 plasmid pB16KP0141-4, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

908. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP021717 (Klebsiella pneumoniae strain AR_0129 plasmid tig00000004, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

909. spacer 17.3|5328990|31|LR130759|CRT matches to CP052536 (Klebsiella pneumoniae strain B16KP0157 plasmid pB16KP0157-3, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

910. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP014703 (Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gcggcggccaagcaggcctcggcgcgcgcgc	Protospacer
 **************** .***** .   * 

911. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP021860 (Klebsiella pneumoniae strain AR_0125 plasmid tig00000007_pilon, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

912. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP022760 (Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gcggcggccaagcaggcctcggcgcgcgcgc	Protospacer
 **************** .***** .   * 

913. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP022789 (Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gcggcggccaagcaggcctcggcgcgcgcgc	Protospacer
 **************** .***** .   * 

914. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP032835 (Klebsiella pneumoniae strain INF237 plasmid pINF237_02, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

915. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP027052 (Klebsiella pneumoniae strain 20_GR_12 plasmid ColRNAI, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

916. spacer 17.3|5328990|31|LR130759|CRT matches to CP052305 (Klebsiella pneumoniae strain E16KP0172 plasmid pE16KP0172-2, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

917. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP022771 (Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gcggcggccaagcaggcctcggcgcgcgcgc	Protospacer
 **************** .***** .   * 

918. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP022777 (Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gcggcggccaagcaggcctcggcgcgcgcgc	Protospacer
 **************** .***** .   * 

919. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP022799 (Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gcggcggccaagcaggcctcggcgcgcgcgc	Protospacer
 **************** .***** .   * 

920. spacer 17.3|5328990|31|LR130759|CRT matches to CP052206 (Klebsiella pneumoniae strain F16KP0002 plasmid pF16KP0002-3, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

921. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP036436 (Citrobacter sp. ABFQG plasmid pKPC-5fbf, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

922. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP036441 (Klebsiella pneumoniae strain ABFQB plasmid pKPC-5fbf, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

923. spacer 17.3|5328990|31|LR130759|CRT matches to NC_011382 (Klebsiella pneumoniae plasmid 15S, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

924. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP025009 (Klebsiella pneumoniae strain AUSMDU00008119 plasmid pAUSMDU8119-1, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

925. spacer 17.3|5328990|31|LR130759|CRT matches to NC_022083 (Klebsiella pneumoniae JM45 plasmid p2, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

926. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP022918 (Klebsiella pneumoniae strain ST307PT04 plasmid pJYC04B) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

927. spacer 17.3|5328990|31|LR130759|CRT matches to CP052238 (Klebsiella pneumoniae strain E17KP0029 plasmid pE17KP0029-3, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

928. spacer 17.3|5328990|31|LR130759|CRT matches to CP052180 (Klebsiella pneumoniae strain F16KP0045 plasmid pF16KP0045-2, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

929. spacer 17.3|5328990|31|LR130759|CRT matches to CP052439 (Klebsiella pneumoniae strain C16KP0108 plasmid pC16KP0108-5, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

930. spacer 17.3|5328990|31|LR130759|CRT matches to CP052355 (Klebsiella pneumoniae strain D16KP0146 plasmid pD17KP0032-3, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

931. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP022764 (Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gcggcggccaagcaggcctcggcgcgcgcgc	Protospacer
 **************** .***** .   * 

932. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP054267 (Klebsiella pneumoniae strain 39427 plasmid pKPN39427.3, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

933. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP026710 (Citrobacter koseri strain AR_0024 plasmid unitig_1_pilon, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

934. spacer 17.3|5328990|31|LR130759|CRT matches to CP052396 (Klebsiella pneumoniae strain C17KP0040 plasmid pC17KP0040-3, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

935. spacer 17.3|5328990|31|LR130759|CRT matches to CP052481 (Klebsiella pneumoniae strain C16KP0050 plasmid pC16KP0050-5, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

936. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP032177 (Klebsiella pneumoniae strain AR_0135 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

937. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP018431 (Klebsiella pneumoniae strain MNCRE78 plasmid pMNCRE78_1, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

938. spacer 17.3|5328990|31|LR130759|CRT matches to CP052318 (Klebsiella pneumoniae strain E16KP0093 plasmid pE16KP0093-3, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

939. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP025252 (Escherichia coli strain BH100 substr. MG2017 plasmid pApR, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

940. spacer 17.3|5328990|31|LR130759|CRT matches to CP052473 (Klebsiella pneumoniae strain C16KP0053 plasmid pC16KP0053-5, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

941. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP015384 (Klebsiella pneumoniae strain CN1 plasmid pCN1_2, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

942. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP033818 (Klebsiella aerogenes strain FDAARGOS_513 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

943. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP037930 (Klebsiella pneumoniae subsp. pneumoniae strain KP-8788 plasmid p8788-IT, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

944. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP019010 (Escherichia coli strain Ecol_AZ161 plasmid pECAZ161_KPC, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

945. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP022797 (Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gcggcggccaagcaggcctcggcgcgcgcgc	Protospacer
 **************** .***** .   * 

946. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP021779 (UNVERIFIED_ORG: Enterobacter cloacae strain AR_0053 plasmid unitig_4, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

947. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP015396 (Klebsiella pneumoniae strain CR14 plasmid pCR14_4, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

948. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP027698 (Klebsiella pneumoniae strain KP30835 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

949. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_LT985216 (Escherichia coli strain 533 plasmid RCS12TR533_p, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

950. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_LT985257 (Escherichia coli strain 580 plasmid RCS49_pIV, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

951. spacer 17.3|5328990|31|LR130759|CRT matches to LC505458 (Klebsiella pneumoniae A1-1 plasmid pColRNAI-Kp1-1 DNA, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

952. spacer 17.3|5328990|31|LR130759|CRT matches to CP052497 (Klebsiella pneumoniae strain B17KP0067 plasmid pB17KP0067-3, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

953. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_MH909340 (Klebsiella pneumoniae strain A1763 plasmid pA1763-KPC, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

954. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_MH909332 (Klebsiella pneumoniae strain A1731 plasmid pA1731-KPC, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

955. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_MH909338 (Klebsiella pneumoniae strain A1759 plasmid pA1759-KPC, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

956. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_MF150119 (Klebsiella pneumoniae strain A64477 plasmid pKP64477e, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

957. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_MF150124 (Klebsiella pneumoniae strain A64216 plasmid pKP64216c, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

958. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP022075 (Citrobacter koseri strain FDAARGOS_287 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

959. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP022758 (Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gcggcggccaagcaggcctcggcgcgcgcgc	Protospacer
 **************** .***** .   * 

960. spacer 17.10|5329230|32|LR130759|CRT matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 9, identity: 0.719

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
ctccgcccaccggcggcgcgggctggcccggc	Protospacer
*.     * ************** ** *****

961. spacer 17.10|5329230|32|LR130759|CRT matches to NZ_CP032322 (Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence) position: , mismatch: 9, identity: 0.719

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
tcgcgcgacccggcggctcgggcaggaccggc	Protospacer
.*.   * .******** *****.********

962. spacer 17.10|5329230|32|LR130759|CRT matches to NC_019849 (Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence) position: , mismatch: 9, identity: 0.719

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
tccgcttctccggcggcgcgatcgggaccgtg	Protospacer
.* .*  *************. ********  

963. spacer 17.10|5329230|32|LR130759|CRT matches to NC_003078 (Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence) position: , mismatch: 9, identity: 0.719

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
tccgcttctccggcggcgcgatcgggaccgtg	Protospacer
.* .*  *************. ********  

964. spacer 17.10|5329230|32|LR130759|CRT matches to NZ_LR134456 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 14, complete sequence) position: , mismatch: 9, identity: 0.719

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
acaacggttccagcggcgcgggcgcctcctcg	Protospacer
 ******.***.************   **   

965. spacer 17.10|5329230|32|LR130759|CRT matches to NZ_CP019586 (Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence) position: , mismatch: 9, identity: 0.719

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
tccgcttctccggcggcgcgatcgggaccgtg	Protospacer
.* .*  *************. ********  

966. spacer 17.10|5329230|32|LR130759|CRT matches to NZ_CP007130 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 2, complete sequence) position: , mismatch: 9, identity: 0.719

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
ccgacggcaccggcggcgcgggccgcgtggtg	Protospacer
**.***** ************** * .. *  

967. spacer 17.10|5329230|32|LR130759|CRT matches to NC_017326 (Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence) position: , mismatch: 9, identity: 0.719

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
tccgcttctccggcggcgcgatcgggaccgtg	Protospacer
.* .*  *************. ********  

968. spacer 17.10|5329230|32|LR130759|CRT matches to NZ_CP021799 (Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.719

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
tccgcttctccggcggcgcgatcgggaccgtg	Protospacer
.* .*  *************. ********  

969. spacer 17.10|5329230|32|LR130759|CRT matches to NC_017323 (Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence) position: , mismatch: 9, identity: 0.719

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
tccgcttctccggcggcgcgatcgggaccgtg	Protospacer
.* .*  *************. ********  

970. spacer 17.10|5329230|32|LR130759|CRT matches to NZ_CP009146 (Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence) position: , mismatch: 9, identity: 0.719

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
tccgcttctccggcggcgcgatcgggaccgtg	Protospacer
.* .*  *************. ********  

971. spacer 17.10|5329230|32|LR130759|CRT matches to NZ_CP021828 (Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.719

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
tccgcttctccggcggcgcgatcgggaccgtg	Protospacer
.* .*  *************. ********  

972. spacer 17.10|5329230|32|LR130759|CRT matches to NZ_CP021802 (Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.719

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
tccgcttctccggcggcgcgatcgggaccgtg	Protospacer
.* .*  *************. ********  

973. spacer 17.10|5329230|32|LR130759|CRT matches to NZ_CP021820 (Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.719

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
tccgcttctccggcggcgcgatcgggaccgtg	Protospacer
.* .*  *************. ********  

974. spacer 17.10|5329230|32|LR130759|CRT matches to NZ_CP021831 (Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.719

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
tccgcttctccggcggcgcgatcgggaccgtg	Protospacer
.* .*  *************. ********  

975. spacer 17.10|5329230|32|LR130759|CRT matches to NZ_CP021823 (Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.719

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
tccgcttctccggcggcgcgatcgggaccgtg	Protospacer
.* .*  *************. ********  

976. spacer 17.10|5329230|32|LR130759|CRT matches to NZ_CP032054 (Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence) position: , mismatch: 9, identity: 0.719

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
ctccgcccaccggcggcgcgggctggcccggc	Protospacer
*.     * ************** ** *****

977. spacer 17.10|5329230|32|LR130759|CRT matches to NZ_CP021814 (Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.719

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
tccgcttctccggcggcgcgatcgggaccgtg	Protospacer
.* .*  *************. ********  

978. spacer 17.10|5329230|32|LR130759|CRT matches to NZ_CP021795 (Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.719

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
tccgcttctccggcggcgcgatcgggaccgtg	Protospacer
.* .*  *************. ********  

979. spacer 17.10|5329230|32|LR130759|CRT matches to NZ_CP021806 (Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.719

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
tccgcttctccggcggcgcgatcgggaccgtg	Protospacer
.* .*  *************. ********  

980. spacer 17.10|5329230|32|LR130759|CRT matches to NZ_CP021218 (Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence) position: , mismatch: 9, identity: 0.719

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
tccgcttctccggcggcgcgatcgggaccgtg	Protospacer
.* .*  *************. ********  

981. spacer 17.10|5329230|32|LR130759|CRT matches to NZ_CP026527 (Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence) position: , mismatch: 9, identity: 0.719

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
tccgcttctccggcggcgcgatcgggaccgtg	Protospacer
.* .*  *************. ********  

982. spacer 17.10|5329230|32|LR130759|CRT matches to NZ_CP016560 (Streptomyces clavuligerus strain F613-1 plasmid pSCL4, complete sequence) position: , mismatch: 9, identity: 0.719

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
ctccgcccaccggcggcgcgggctggcccggc	Protospacer
*.     * ************** ** *****

983. spacer 17.10|5329230|32|LR130759|CRT matches to NZ_CP019484 (Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence) position: , mismatch: 9, identity: 0.719

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
tccgcttctccggcggcgcgatcgggaccgtg	Protospacer
.* .*  *************. ********  

984. spacer 17.10|5329230|32|LR130759|CRT matches to NZ_CP019487 (Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence) position: , mismatch: 9, identity: 0.719

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
tccgcttctccggcggcgcgatcgggaccgtg	Protospacer
.* .*  *************. ********  

985. spacer 17.10|5329230|32|LR130759|CRT matches to NC_020560 (Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence) position: , mismatch: 9, identity: 0.719

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
tccgcttctccggcggcgcgatcgggaccgtg	Protospacer
.* .*  *************. ********  

986. spacer 17.10|5329230|32|LR130759|CRT matches to NC_023497 (Amycolatopsis keratiniphila plasmid pXL100, complete sequence) position: , mismatch: 9, identity: 0.719

-----ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
gtccctca-----tccggcggcgcgggcgcggccggg	Protospacer
     .**     **************** *.**** 

987. spacer 17.10|5329230|32|LR130759|CRT matches to NZ_CP008954 (Amycolatopsis japonica strain DSM 44213 plasmid pAmyja1, complete sequence) position: , mismatch: 9, identity: 0.719

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
ggaacgggtccggccgcgcgggcggcgtcagt	Protospacer
  ***** ****** ********** ..*.*.

988. spacer 17.10|5329230|32|LR130759|CRT matches to NC_023286 (Streptomyces sp. F12 plasmid pFRL6, complete sequence) position: , mismatch: 9, identity: 0.719

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
gaacgggcgccggcggcgcgcgcgggactgct	Protospacer
  *  *** *********** *******.* .

989. spacer 17.10|5329230|32|LR130759|CRT matches to NZ_CP020539 (Sphingobium herbicidovorans strain MH plasmid pMSHV, complete sequence) position: , mismatch: 9, identity: 0.719

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
gcaacggcttcggcggcgctggcgcagcgaac	Protospacer
 ********.********* **** ..* ..*

990. spacer 17.10|5329230|32|LR130759|CRT matches to NZ_CP045223 (Achromobacter xylosoxidans strain DN002 plasmid unnamed) position: , mismatch: 9, identity: 0.719

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
tcctgatcaccggcggcgcgggcggcatcggc	Protospacer
.*   . * **************** *.****

991. spacer 17.10|5329230|32|LR130759|CRT matches to NC_018701 (Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence) position: , mismatch: 9, identity: 0.719

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
tccgcttctccggcggcgcgatcgggaccgtg	Protospacer
.* .*  *************. ********  

992. spacer 17.10|5329230|32|LR130759|CRT matches to NZ_CP012399 (Chelatococcus sp. CO-6 plasmid pCO-6, complete sequence) position: , mismatch: 9, identity: 0.719

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
gtcaggcctccggcggcgcgggcaggatcgtg	Protospacer
 . * * ****************.***.**  

993. spacer 17.12|5329344|32|LR130759|CRT matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 9, identity: 0.719

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
cgggcggcgaagcaggagccggcggtcagcac	Protospacer
* ****** ******* ********   . .*

994. spacer 17.12|5329344|32|LR130759|CRT matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 9, identity: 0.719

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
cgggcggcgaagcaggagccggcggtcagcac	Protospacer
* ****** ******* ********   . .*

995. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 9, identity: 0.719

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
accacggccaaccaggcgtcggcggaggccgg	Protospacer
 * .******* ******.********   * 

996. spacer 17.12|5329344|32|LR130759|CRT matches to MF612073 (Klebsiella phage SopranoGao, complete genome) position: , mismatch: 9, identity: 0.719

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
gagaaggccaagcaggcgcaggcagagctgca	Protospacer
  *. ************** ***.**** *  

997. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP028971 (Aminobacter sp. MSH1 plasmid pUSP3, complete sequence) position: , mismatch: 9, identity: 0.71

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ccaacggctacggcggcgcgggttttcatgc	Protospacer
********* ************.     .* 

998. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP020371 (Candidatus Thiodictyon syntrophicum strain Cad16T plasmid pTs417, complete sequence) position: , mismatch: 9, identity: 0.71

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ggcctggttccggcggcgcggccgggacctc	Protospacer
    .**.************* *******  

999. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP045122 (Rubrobacter sp. SCSIO 52915 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.71

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gcaacggctccggcggttcgggcgacggggc	Protospacer
 ***************. ******. .  * 

1000. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP020539 (Sphingobium herbicidovorans strain MH plasmid pMSHV, complete sequence) position: , mismatch: 9, identity: 0.71

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gcaacggcttcggcggcgctggcgcagcgaa	Protospacer
 ********.********* **** ..* ..

1001. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP032347 (Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence) position: , mismatch: 9, identity: 0.71

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
cgggcggcttcggcggcgcgggcaggatttc	Protospacer
* ..*****.*************.***..  

1002. spacer 18.1|5329584|31|LR130759|CRT matches to HM486077 (Tsukamurella phage TPA2, complete sequence) position: , mismatch: 9, identity: 0.71

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gtggcggcggcggcggcgcgggcgggatctt	Protospacer
 ...****  *****************.*  

1003. spacer 18.1|5329584|31|LR130759|CRT matches to NC_015210 (Tsukamurella phage TPA2, complete genome) position: , mismatch: 9, identity: 0.71

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gtggcggcggcggcggcgcgggcgggatctt	Protospacer
 ...****  *****************.*  

1004. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP018348 (Klebsiella pneumoniae strain CAV1417 plasmid pCAV1417-9294, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1005. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP018672 (Klebsiella pneumoniae strain CAV1217 plasmid pCAV1217-9294, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1006. spacer 18.3|5329698|31|LR130759|CRT matches to CP052171 (Klebsiella pneumoniae strain F16KP0075 plasmid pF16KP0075-4, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1007. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP032199 (Klebsiella pneumoniae strain AR_0097 plasmid unnamed5, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1008. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP022775 (Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gcggcggccaagcaggcctcggcgcgcgcgc	Protospacer
 **************** .***** .   * 

1009. spacer 18.3|5329698|31|LR130759|CRT matches to CP052486 (Klebsiella pneumoniae strain C16KP0036 plasmid pC16KP0036-2, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1010. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP021756 (Klebsiella pneumoniae strain AR_0113 plasmid unitig_5, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1011. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP023852 (Escherichia coli strain 4/0 plasmid p4_0.3, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1012. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP018433 (Klebsiella pneumoniae strain MNCRE53 plasmid pMNCRE53_1, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1013. spacer 18.3|5329698|31|LR130759|CRT matches to CP052166 (Klebsiella pneumoniae strain F16KP0082 plasmid pF16KP0082-4, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1014. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP018445 (Klebsiella pneumoniae strain Kp_Goe_822917 plasmid pKp_Goe_917-4, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1015. spacer 18.3|5329698|31|LR130759|CRT matches to CP052411 (Klebsiella pneumoniae strain C17KP0008 plasmid pC17KP0008-4, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1016. spacer 18.3|5329698|31|LR130759|CRT matches to CP052161 (Klebsiella pneumoniae strain F16KP0084 plasmid pF16KP0084-3, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1017. spacer 18.3|5329698|31|LR130759|CRT matches to NC_014310 (Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gcggcggccaagcaggcctcggcgcgcgcgc	Protospacer
 **************** .***** .   * 

1018. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP014648 (Klebsiella pneumoniae strain KPNIH36 plasmid pKPN-821, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1019. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP011979 (Klebsiella pneumoniae DMC1097 plasmid pDMC1097-20.222kb, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1020. spacer 18.3|5329698|31|LR130759|CRT matches to CP052402 (Klebsiella pneumoniae strain C17KP0039 plasmid pC17KP0039-3, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1021. spacer 18.3|5329698|31|LR130759|CRT matches to CP052312 (Klebsiella pneumoniae strain E16KP0102 plasmid pE16KP0102-3, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1022. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP010394 (Klebsiella pneumoniae strain 34618 plasmid p34618-13.841kb, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1023. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP022762 (Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gcggcggccaagcaggcctcggcgcgcgcgc	Protospacer
 **************** .***** .   * 

1024. spacer 18.3|5329698|31|LR130759|CRT matches to NC_009793 (Citrobacter koseri ATCC BAA-895 plasmid pCKO3, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1025. spacer 18.3|5329698|31|LR130759|CRT matches to CP052146 (Klebsiella pneumoniae strain F17KP0012 plasmid pF17KP0012-3, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1026. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_LS992179 (Citrobacter freundii isolate Citrobacter freundii str. E2614 plasmid 5, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1027. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP024884 (Klebsiella aerogenes strain AR_0009 plasmid tig00000054_pilon, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1028. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP033630 (Klebsiella pneumoniae strain 4743 plasmid unnamed5) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1029. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP033630 (Klebsiella pneumoniae strain 4743 plasmid unnamed5) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1030. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP011988 (Klebsiella pneumoniae UHKPC07 plasmid pUHKPC07-13.841kb, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1031. spacer 18.3|5329698|31|LR130759|CRT matches to CP052360 (Klebsiella pneumoniae strain D16KP0144 plasmid pD16KP0144-4, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1032. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP011982 (Klebsiella pneumoniae 500_1420 plasmid p500_1420-51.662kb, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1033. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP011982 (Klebsiella pneumoniae 500_1420 plasmid p500_1420-51.662kb, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1034. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP011984 (Klebsiella pneumoniae 500_1420 plasmid p500_1420-13.838kb, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1035. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP020840 (Klebsiella pneumoniae strain BK13043 plasmid pBK13043-3, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1036. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP011993 (Klebsiella pneumoniae UHKPC33 plasmid pUHKPC33-13.841kb, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1037. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP027058 (Klebsiella pneumoniae strain 2_GR_12 plasmid ColRNAI, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1038. spacer 18.3|5329698|31|LR130759|CRT matches to CP052447 (Klebsiella pneumoniae strain C16KP0098 plasmid pC16KP0098-4, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1039. spacer 18.3|5329698|31|LR130759|CRT matches to NC_018953 (Klebsiella pneumoniae plasmid pIGMS32, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1040. spacer 18.3|5329698|31|LR130759|CRT matches to NC_019156 (Klebsiella pneumoniae plasmid pAAC154, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1041. spacer 18.3|5329698|31|LR130759|CRT matches to NC_019159 (Klebsiella pneumoniae plasmid ColEST258, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1042. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP018425 (Klebsiella pneumoniae strain MNCRE69 plasmid pMNCRE69_1, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1043. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP032930 (Klebsiella aerogenes strain AR_0062 plasmid unnamed5, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1044. spacer 18.3|5329698|31|LR130759|CRT matches to NC_021656 (Klebsiella pneumoniae plasmid pKpQIL-SC29, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1045. spacer 18.3|5329698|31|LR130759|CRT matches to NC_021666 (Klebsiella pneumoniae plasmid ColE-LS6, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1046. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP024651 (Escherichia coli strain BH100 substr. MG2014 plasmid pAp, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1047. spacer 18.3|5329698|31|LR130759|CRT matches to CP052418 (Klebsiella pneumoniae strain C16KP0189 plasmid pC16KP0189-4, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1048. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP021837 (Klebsiella pneumoniae strain AR_0120 plasmid tig00000601_pilon, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1049. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP045796 (Klebsiella pneumoniae subsp. pneumoniae strain AUSMDU00008079 plasmid pAUSMDU00008079_04, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1050. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP007796 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p3, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ccggctgccaagccggcgccggccacctgag	Protospacer
***** ******* ********* .  ...*

1051. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP022921 (Klebsiella pneumoniae strain ST307PT03 plasmid pJYC03B, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1052. spacer 18.3|5329698|31|LR130759|CRT matches to CP052234 (Klebsiella pneumoniae strain E17KP0033 plasmid pE17KP0033-3, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1053. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP046275 (Enterobacter hormaechei strain E70 plasmid pE70-TEM1, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1054. spacer 18.3|5329698|31|LR130759|CRT matches to CP052555 (Klebsiella pneumoniae strain A17KP0038 plasmid pA17KP0038-4, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1055. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP014122 (Klebsiella pneumoniae strain FDAARGOS_156 plasmid unnamed4, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1056. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP014122 (Klebsiella pneumoniae strain FDAARGOS_156 plasmid unnamed4, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1057. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP031807 (Klebsiella pneumoniae strain MSB1_8A-sc-2280397 plasmid unnamed7, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1058. spacer 18.3|5329698|31|LR130759|CRT matches to CP052210 (Klebsiella pneumoniae strain E17KP0085 plasmid pE17KP0085-3, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1059. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP023528 (Citrobacter koseri strain FDAARGOS_393 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1060. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP018353 (Klebsiella pneumoniae strain CAV1453 plasmid pCAV1453-14, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1061. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP021548 (Klebsiella pneumoniae strain AR_0112 plasmid tig00000005, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1062. spacer 18.3|5329698|31|LR130759|CRT matches to CP052529 (Klebsiella pneumoniae strain B16KP0177 plasmid pB16KP0177-5, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1063. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP021543 (Klebsiella pneumoniae strain AR_0047 plasmid tig00000004, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1064. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP009877 (Klebsiella pneumoniae subsp. pneumoniae strain KPNIH31 plasmid pAAC154-a9e, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1065. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP009772 (Klebsiella pneumoniae subsp. pneumoniae strain KPNIH33 plasmid pEA1509_B, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1066. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP009778 (Klebsiella pneumoniae subsp. pneumoniae strain KPNIH32 plasmid pKPN-c8b, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1067. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP008832 (Klebsiella pneumoniae subsp. pneumoniae KPR0928 plasmid pKPN-294, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1068. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP008799 (Klebsiella pneumoniae subsp. pneumoniae KPNIH24 plasmid pKPN-819, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1069. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP006928 (Klebsiella pneumoniae 30660/NJST258_1 plasmid pNJST258N4, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1070. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP007728 (Klebsiella pneumoniae subsp. pneumoniae KPNIH10 plasmid pAAC154-a50, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1071. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP006919 (Klebsiella pneumoniae 30684/NJST258_2 plasmid pNJST258C2, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1072. spacer 18.3|5329698|31|LR130759|CRT matches to CP052283 (Klebsiella pneumoniae strain E16KP0224 plasmid pE16KP0224-3, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1073. spacer 18.3|5329698|31|LR130759|CRT matches to CP052428 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-1, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1074. spacer 18.3|5329698|31|LR130759|CRT matches to CP052548 (Klebsiella pneumoniae strain B16KP0089 plasmid pB16KP0089-2, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1075. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP036449 (Klebsiella pneumoniae strain KPNIH45 plasmid pKPC-610e, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1076. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP020066 (Klebsiella pneumoniae strain AR_0117 plasmid unitig_5, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1077. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP020075 (Klebsiella pneumoniae strain AR_0115 plasmid tig00000005, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1078. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP020112 (Klebsiella pneumoniae strain AR_0098 plasmid tig00000004, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1079. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP015391 (Klebsiella pneumoniae strain NY9 plasmid pNY9_6, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1080. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP023017 (Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gcggcggccaagcaggcctcggcgcgcgcgc	Protospacer
 **************** .***** .   * 

1081. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP036445 (Klebsiella pneumoniae strain ABFPV plasmid tig00001273_pilon, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1082. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP050378 (Klebsiella pneumoniae strain 51015 plasmid p51015_COL_RNAI, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1083. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP050378 (Klebsiella pneumoniae strain 51015 plasmid p51015_COL_RNAI, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1084. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP031757 (Klebsiella aerogenes strain FDAARGOS_327 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1085. spacer 18.3|5329698|31|LR130759|CRT matches to CP052424 (Klebsiella pneumoniae strain C16KP0164 plasmid pC16KP0164-2, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1086. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_LR130551 (Klebsiella pneumoniae strain KPC2 isolate KPC2 plasmid 4) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1087. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP022576 (Klebsiella pneumoniae strain BIC-1 plasmid pBIC-1c, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1088. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP024463 (Klebsiella pneumoniae strain QS17-0161 plasmid pMRSN480738_10.0, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1089. spacer 18.3|5329698|31|LR130759|CRT matches to CP052191 (Klebsiella pneumoniae strain F16KP0019 plasmid pF16KP0019-2, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1090. spacer 18.3|5329698|31|LR130759|CRT matches to CP052541 (Klebsiella pneumoniae strain B16KP0141 plasmid pB16KP0141-4, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1091. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP021717 (Klebsiella pneumoniae strain AR_0129 plasmid tig00000004, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1092. spacer 18.3|5329698|31|LR130759|CRT matches to CP052536 (Klebsiella pneumoniae strain B16KP0157 plasmid pB16KP0157-3, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1093. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP014703 (Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gcggcggccaagcaggcctcggcgcgcgcgc	Protospacer
 **************** .***** .   * 

1094. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP021860 (Klebsiella pneumoniae strain AR_0125 plasmid tig00000007_pilon, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1095. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP022760 (Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gcggcggccaagcaggcctcggcgcgcgcgc	Protospacer
 **************** .***** .   * 

1096. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP022789 (Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gcggcggccaagcaggcctcggcgcgcgcgc	Protospacer
 **************** .***** .   * 

1097. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP032835 (Klebsiella pneumoniae strain INF237 plasmid pINF237_02, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1098. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP027052 (Klebsiella pneumoniae strain 20_GR_12 plasmid ColRNAI, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1099. spacer 18.3|5329698|31|LR130759|CRT matches to CP052305 (Klebsiella pneumoniae strain E16KP0172 plasmid pE16KP0172-2, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1100. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP022771 (Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gcggcggccaagcaggcctcggcgcgcgcgc	Protospacer
 **************** .***** .   * 

1101. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP022777 (Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gcggcggccaagcaggcctcggcgcgcgcgc	Protospacer
 **************** .***** .   * 

1102. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP022799 (Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gcggcggccaagcaggcctcggcgcgcgcgc	Protospacer
 **************** .***** .   * 

1103. spacer 18.3|5329698|31|LR130759|CRT matches to CP052206 (Klebsiella pneumoniae strain F16KP0002 plasmid pF16KP0002-3, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1104. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP036436 (Citrobacter sp. ABFQG plasmid pKPC-5fbf, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1105. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP036441 (Klebsiella pneumoniae strain ABFQB plasmid pKPC-5fbf, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1106. spacer 18.3|5329698|31|LR130759|CRT matches to NC_011382 (Klebsiella pneumoniae plasmid 15S, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1107. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP025009 (Klebsiella pneumoniae strain AUSMDU00008119 plasmid pAUSMDU8119-1, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1108. spacer 18.3|5329698|31|LR130759|CRT matches to NC_022083 (Klebsiella pneumoniae JM45 plasmid p2, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1109. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP022918 (Klebsiella pneumoniae strain ST307PT04 plasmid pJYC04B) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1110. spacer 18.3|5329698|31|LR130759|CRT matches to CP052238 (Klebsiella pneumoniae strain E17KP0029 plasmid pE17KP0029-3, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1111. spacer 18.3|5329698|31|LR130759|CRT matches to CP052180 (Klebsiella pneumoniae strain F16KP0045 plasmid pF16KP0045-2, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1112. spacer 18.3|5329698|31|LR130759|CRT matches to CP052439 (Klebsiella pneumoniae strain C16KP0108 plasmid pC16KP0108-5, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1113. spacer 18.3|5329698|31|LR130759|CRT matches to CP052355 (Klebsiella pneumoniae strain D16KP0146 plasmid pD17KP0032-3, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1114. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP022764 (Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gcggcggccaagcaggcctcggcgcgcgcgc	Protospacer
 **************** .***** .   * 

1115. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP054267 (Klebsiella pneumoniae strain 39427 plasmid pKPN39427.3, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1116. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP026710 (Citrobacter koseri strain AR_0024 plasmid unitig_1_pilon, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1117. spacer 18.3|5329698|31|LR130759|CRT matches to CP052396 (Klebsiella pneumoniae strain C17KP0040 plasmid pC17KP0040-3, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1118. spacer 18.3|5329698|31|LR130759|CRT matches to CP052481 (Klebsiella pneumoniae strain C16KP0050 plasmid pC16KP0050-5, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1119. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP032177 (Klebsiella pneumoniae strain AR_0135 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1120. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP018431 (Klebsiella pneumoniae strain MNCRE78 plasmid pMNCRE78_1, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1121. spacer 18.3|5329698|31|LR130759|CRT matches to CP052318 (Klebsiella pneumoniae strain E16KP0093 plasmid pE16KP0093-3, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1122. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP025252 (Escherichia coli strain BH100 substr. MG2017 plasmid pApR, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1123. spacer 18.3|5329698|31|LR130759|CRT matches to CP052473 (Klebsiella pneumoniae strain C16KP0053 plasmid pC16KP0053-5, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1124. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP015384 (Klebsiella pneumoniae strain CN1 plasmid pCN1_2, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1125. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP033818 (Klebsiella aerogenes strain FDAARGOS_513 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1126. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP037930 (Klebsiella pneumoniae subsp. pneumoniae strain KP-8788 plasmid p8788-IT, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1127. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP019010 (Escherichia coli strain Ecol_AZ161 plasmid pECAZ161_KPC, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1128. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP022797 (Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gcggcggccaagcaggcctcggcgcgcgcgc	Protospacer
 **************** .***** .   * 

1129. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP021779 (UNVERIFIED_ORG: Enterobacter cloacae strain AR_0053 plasmid unitig_4, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1130. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP015396 (Klebsiella pneumoniae strain CR14 plasmid pCR14_4, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1131. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP027698 (Klebsiella pneumoniae strain KP30835 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1132. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_LT985216 (Escherichia coli strain 533 plasmid RCS12TR533_p, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1133. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_LT985257 (Escherichia coli strain 580 plasmid RCS49_pIV, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1134. spacer 18.3|5329698|31|LR130759|CRT matches to LC505458 (Klebsiella pneumoniae A1-1 plasmid pColRNAI-Kp1-1 DNA, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1135. spacer 18.3|5329698|31|LR130759|CRT matches to CP052497 (Klebsiella pneumoniae strain B17KP0067 plasmid pB17KP0067-3, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1136. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_MH909340 (Klebsiella pneumoniae strain A1763 plasmid pA1763-KPC, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1137. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_MH909332 (Klebsiella pneumoniae strain A1731 plasmid pA1731-KPC, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1138. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_MH909338 (Klebsiella pneumoniae strain A1759 plasmid pA1759-KPC, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1139. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_MF150119 (Klebsiella pneumoniae strain A64477 plasmid pKP64477e, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1140. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_MF150124 (Klebsiella pneumoniae strain A64216 plasmid pKP64216c, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1141. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP022075 (Citrobacter koseri strain FDAARGOS_287 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ataacggccatgcaggcgctggcggagttgt	Protospacer
 ...****** ********.*******. * 

1142. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP022758 (Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gcggcggccaagcaggcctcggcgcgcgcgc	Protospacer
 **************** .***** .   * 

1143. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP007130 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 2, complete sequence) position: , mismatch: 9, identity: 0.719

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gccgacggcaccggcggcgcgggccgcgtggt	Protospacer
.**.***** ************** * .. * 

1144. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP018236 (Rhizobium leguminosarum strain Vaf-108 plasmid unnamed8) position: , mismatch: 9, identity: 0.719

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
caaagcggccccggcggcgcgggcggcacgcc	Protospacer
   *.****.**************** **   

1145. spacer 19.1|5329937|32|LR130759|CRT matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 9, identity: 0.719

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
tgccgcggcaccggcggctcgggcgggacgtt	Protospacer
  * .**** ******** **********   

1146. spacer 19.1|5329937|32|LR130759|CRT matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 9, identity: 0.719

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
tgccgcggcaccggcggctcgggcgggacgtt	Protospacer
  * .**** ******** **********   

1147. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP020371 (Candidatus Thiodictyon syntrophicum strain Cad16T plasmid pTs417, complete sequence) position: , mismatch: 9, identity: 0.719

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
aggcctggttccggcggcgcggccgggacctc	Protospacer
*    .**.************* *******  

1148. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_LR134456 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 14, complete sequence) position: , mismatch: 9, identity: 0.719

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gacaacggttccagcggcgcgggcgcctcctc	Protospacer
. ******.***.************   **  

1149. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP008954 (Amycolatopsis japonica strain DSM 44213 plasmid pAmyja1, complete sequence) position: , mismatch: 9, identity: 0.719

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
cggaacgggtccggccgcgcgggcggcgtcag	Protospacer
   ***** ****** ********** ..*.*

1150. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP012399 (Chelatococcus sp. CO-6 plasmid pCO-6, complete sequence) position: , mismatch: 9, identity: 0.719

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
tgtcaggcctccggcggcgcgggcaggatcgt	Protospacer
  . * * ****************.***.** 

1151. spacer 19.1|5329937|32|LR130759|CRT matches to KY092482 (Streptomyces phage Mojorita, complete genome) position: , mismatch: 9, identity: 0.719

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
tcggcgggcgccggcggcgcggccgggacggt	Protospacer
 * .  *** ************ ****** * 

1152. spacer 19.1|5329937|32|LR130759|CRT matches to KY092480 (Streptomyces phage Picard, complete genome) position: , mismatch: 9, identity: 0.719

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
tcggcgggcgccggcggcgcggccgggacggt	Protospacer
 * .  *** ************ ****** * 

1153. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP050092 (Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b6, complete sequence) position: , mismatch: 9, identity: 0.719

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ctatccggaaaagcaggcgccggcggagcgga	Protospacer
 .   ***  *******************.*.

1154. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP050104 (Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b2, complete sequence) position: , mismatch: 9, identity: 0.719

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ctatccggaaaagcaggcgccggcggagcgga	Protospacer
 .   ***  *******************.*.

1155. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP016287 (Rhizobium leguminosarum strain Vaf10 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ctatccggaaaagcaggcgccggcggagcgga	Protospacer
 .   ***  *******************.*.

1156. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP050109 (Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b2, complete sequence) position: , mismatch: 9, identity: 0.719

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ctatccggaaaagcaggcgccggcggagcgga	Protospacer
 .   ***  *******************.*.

1157. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP048281 (Rhizobium leguminosarum bv. viciae 248 plasmid pRle248e, complete sequence) position: , mismatch: 9, identity: 0.719

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ctatccggaaaagcaggcgccggcggagcgga	Protospacer
 .   ***  *******************.*.

1158. spacer 19.3|5330051|32|LR130759|CRT matches to NC_015727 (Cupriavidus necator N-1 plasmid pBB1, complete sequence) position: , mismatch: 9, identity: 0.719

accggcggccaagcaggcgccggcggagcagg---	CRISPR spacer
ggcggcgaccaagctggcgccggc---gctagtct	Protospacer
. *****.****** *********   ** .*   

1159. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 9, identity: 0.719

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
caccacggccaaccaggcgtcggcggaggccg	Protospacer
  * .******* ******.********   *

1160. spacer 19.3|5330051|32|LR130759|CRT matches to MH371116 (Mycobacterium phage DMoney, complete genome) position: , mismatch: 9, identity: 0.719

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gacaccggccaagaaggcgccggcgaagacgt	Protospacer
. *. ******** ***********.**  * 

1161. spacer 19.3|5330051|32|LR130759|CRT matches to MH045569 (Mycobacterium phage Schiebel, complete genome) position: , mismatch: 9, identity: 0.719

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gacaccggccaagaaggcgccggcgaagacgt	Protospacer
. *. ******** ***********.**  * 

1162. spacer 19.3|5330051|32|LR130759|CRT matches to MH371119 (Mycobacterium phage OctaviousRex, complete genome) position: , mismatch: 9, identity: 0.719

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gacaccggccaagaaggcgccggcgaagacgt	Protospacer
. *. ******** ***********.**  * 

1163. spacer 19.3|5330051|32|LR130759|CRT matches to MF919497 (Mycobacterium phage Chance64, complete genome) position: , mismatch: 9, identity: 0.719

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gacaccggccaagaaggcgccggcgaagacgt	Protospacer
. *. ******** ***********.**  * 

1164. spacer 19.3|5330051|32|LR130759|CRT matches to MH001456 (Mycobacterium phage CLED96, complete genome) position: , mismatch: 9, identity: 0.719

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gacaccggccaagaaggcgccggcgaagacgt	Protospacer
. *. ******** ***********.**  * 

1165. spacer 19.3|5330051|32|LR130759|CRT matches to GQ303261 (Mycobacterium phage Hope, complete genome) position: , mismatch: 9, identity: 0.719

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gacaccggccaagaaggcgccggcgaagacgt	Protospacer
. *. ******** ***********.**  * 

1166. spacer 19.3|5330051|32|LR130759|CRT matches to MG099946 (Mycobacterium phage LouisV14, complete genome) position: , mismatch: 9, identity: 0.719

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gacaccggccaagaaggcgccggcgaagacgt	Protospacer
. *. ******** ***********.**  * 

1167. spacer 19.3|5330051|32|LR130759|CRT matches to KC787112 (Mycobacterium phage Clark, partial genome) position: , mismatch: 9, identity: 0.719

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gacaccggccaagaaggcgccggcgaagacgt	Protospacer
. *. ******** ***********.**  * 

1168. spacer 19.3|5330051|32|LR130759|CRT matches to MH779513 (Mycobacterium phage Olga, complete genome) position: , mismatch: 9, identity: 0.719

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gacaccggccaagaaggcgccggcgaagacgt	Protospacer
. *. ******** ***********.**  * 

1169. spacer 19.3|5330051|32|LR130759|CRT matches to MK919475 (Mycobacterium phage Camri, complete genome) position: , mismatch: 9, identity: 0.719

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gacaccggccaagaaggcgccggcgaagacgt	Protospacer
. *. ******** ***********.**  * 

1170. spacer 19.3|5330051|32|LR130759|CRT matches to MK310146 (Mycobacterium phage Crespo, complete genome) position: , mismatch: 9, identity: 0.719

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gacaccggccaagaaggcgccggcgaagacgt	Protospacer
. *. ******** ***********.**  * 

1171. spacer 19.3|5330051|32|LR130759|CRT matches to MK524493 (Mycobacterium phage Darionha, complete genome) position: , mismatch: 9, identity: 0.719

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gacaccggccaagaaggcgccggcgaagacgt	Protospacer
. *. ******** ***********.**  * 

1172. spacer 19.3|5330051|32|LR130759|CRT matches to MH779505 (Mycobacterium phage Grizzly, complete genome) position: , mismatch: 9, identity: 0.719

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gacaccggccaagaaggcgccggcgaagacgt	Protospacer
. *. ******** ***********.**  * 

1173. spacer 19.3|5330051|32|LR130759|CRT matches to EU568876 (Mycobacterium phage BPs, complete genome) position: , mismatch: 9, identity: 0.719

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gacaccggccaagaaggcgccggcgaagacgt	Protospacer
. *. ******** ***********.**  * 

1174. spacer 19.3|5330051|32|LR130759|CRT matches to KC787107 (Mycobacterium phage Bo4, complete genome) position: , mismatch: 9, identity: 0.719

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gacaccggccaagaaggcgccggcgaagacgt	Protospacer
. *. ******** ***********.**  * 

1175. spacer 19.3|5330051|32|LR130759|CRT matches to MF668268 (Mycobacterium phage Aroostook, complete genome) position: , mismatch: 9, identity: 0.719

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gacaccggccaagaaggcgccggcgaagacgt	Protospacer
. *. ******** ***********.**  * 

1176. spacer 19.3|5330051|32|LR130759|CRT matches to KX588251 (Mycobacterium phage Jane, complete genome) position: , mismatch: 9, identity: 0.719

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gacaccggccaagaaggcgccggcgaagacgt	Protospacer
. *. ******** ***********.**  * 

1177. spacer 19.3|5330051|32|LR130759|CRT matches to KC787103 (Mycobacterium phage Chy2, partial genome) position: , mismatch: 9, identity: 0.719

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gacaccggccaagaaggcgccggcgaagacgt	Protospacer
. *. ******** ***********.**  * 

1178. spacer 19.3|5330051|32|LR130759|CRT matches to MH001455 (Mycobacterium phage Remy19, complete genome) position: , mismatch: 9, identity: 0.719

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gacaccggccaagaaggcgccggcgaagacgt	Protospacer
. *. ******** ***********.**  * 

1179. spacer 19.3|5330051|32|LR130759|CRT matches to KT355472 (Mycobacterium phage Cedasite, complete genome) position: , mismatch: 9, identity: 0.719

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gacaccggccaagaaggcgccggcgaagacgt	Protospacer
. *. ******** ***********.**  * 

1180. spacer 19.3|5330051|32|LR130759|CRT matches to KX664455 (Mycobacterium phage Zombie, complete genome) position: , mismatch: 9, identity: 0.719

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gacaccggccaagaaggcgccggcgaagacgt	Protospacer
. *. ******** ***********.**  * 

1181. spacer 19.3|5330051|32|LR130759|CRT matches to MH077584 (Mycobacterium phage Phish, complete genome) position: , mismatch: 9, identity: 0.719

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gacaccggccaagaaggcgccggcgaagacgt	Protospacer
. *. ******** ***********.**  * 

1182. spacer 19.3|5330051|32|LR130759|CRT matches to KC787108 (Mycobacterium phage DNAIII, complete genome) position: , mismatch: 9, identity: 0.719

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gacaccggccaagaaggcgccggcgaagacgt	Protospacer
. *. ******** ***********.**  * 

1183. spacer 19.3|5330051|32|LR130759|CRT matches to MN444875 (Mycobacterium phage Jonghyun, complete genome) position: , mismatch: 9, identity: 0.719

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gacaccggccaagaaggcgccggcgaagacgt	Protospacer
. *. ******** ***********.**  * 

1184. spacer 19.3|5330051|32|LR130759|CRT matches to MK433279 (Mycobacterium phage Kareem, complete genome) position: , mismatch: 9, identity: 0.719

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gacaccggccaagaaggcgccggcgaagacgt	Protospacer
. *. ******** ***********.**  * 

1185. spacer 19.3|5330051|32|LR130759|CRT matches to KJ725374 (Mycobacterium phage Guo1, complete genome) position: , mismatch: 9, identity: 0.719

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gacaccggccaagaaggcgccggcgaagacgt	Protospacer
. *. ******** ***********.**  * 

1186. spacer 19.3|5330051|32|LR130759|CRT matches to MT818422 (Mycobacterium phage Periodt, complete genome) position: , mismatch: 9, identity: 0.719

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gacaccggccaagaaggcgccggcgaagacgt	Protospacer
. *. ******** ***********.**  * 

1187. spacer 19.3|5330051|32|LR130759|CRT matches to MK305884 (Mycobacterium phage BQuat, complete genome) position: , mismatch: 9, identity: 0.719

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gacaccggccaagaaggcgccggcgaagacgt	Protospacer
. *. ******** ***********.**  * 

1188. spacer 19.3|5330051|32|LR130759|CRT matches to MF668272 (Mycobacterium phage Gideon, complete genome) position: , mismatch: 9, identity: 0.719

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gacaccggccaagaaggcgccggcgaagacgt	Protospacer
. *. ******** ***********.**  * 

1189. spacer 19.3|5330051|32|LR130759|CRT matches to MH779515 (Mycobacterium phage Sweets, complete genome) position: , mismatch: 9, identity: 0.719

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gacaccggccaagaaggcgccggcgaagacgt	Protospacer
. *. ******** ***********.**  * 

1190. spacer 19.3|5330051|32|LR130759|CRT matches to MW119570 (Mycobacterium phage Lang, complete genome) position: , mismatch: 9, identity: 0.719

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gacaccggccaagaaggcgccggcgaagacgt	Protospacer
. *. ******** ***********.**  * 

1191. spacer 19.3|5330051|32|LR130759|CRT matches to KC787111 (Mycobacterium phage Sedge, partial genome) position: , mismatch: 9, identity: 0.719

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gacaccggccaagaaggcgccggcgaagacgt	Protospacer
. *. ******** ***********.**  * 

1192. spacer 19.3|5330051|32|LR130759|CRT matches to MF612073 (Klebsiella phage SopranoGao, complete genome) position: , mismatch: 9, identity: 0.719

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
cgagaaggccaagcaggcgcaggcagagctgc	Protospacer
   *. ************** ***.**** * 

1193. spacer 19.3|5330051|32|LR130759|CRT matches to KC787104 (Mycobacterium phage Chy3, partial genome) position: , mismatch: 9, identity: 0.719

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gacaccggccaagaaggcgccggcgaagacgt	Protospacer
. *. ******** ***********.**  * 

1194. spacer 19.3|5330051|32|LR130759|CRT matches to NC_012788 (Mycobacterium phage Angel, complete genome) position: , mismatch: 9, identity: 0.719

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gacaccggccaagaaggcgccggcgaagacgt	Protospacer
. *. ******** ***********.**  * 

1195. spacer 19.3|5330051|32|LR130759|CRT matches to KX443326 (Mycobacterium phage BruceB, complete genome) position: , mismatch: 9, identity: 0.719

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gacaccggccaagaaggcgccggcgaagacgt	Protospacer
. *. ******** ***********.**  * 

1196. spacer 19.3|5330051|32|LR130759|CRT matches to MK433277 (Mycobacterium phage Renaissance, complete genome) position: , mismatch: 9, identity: 0.719

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gacaccggccaagaaggcgccggcgaagacgt	Protospacer
. *. ******** ***********.**  * 

1197. spacer 19.3|5330051|32|LR130759|CRT matches to MH590605 (Mycobacterium phage Cherrybomb426, complete genome) position: , mismatch: 9, identity: 0.719

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gacaccggccaagaaggcgccggcgaagacgt	Protospacer
. *. ******** ***********.**  * 

1198. spacer 19.3|5330051|32|LR130759|CRT matches to MH779509 (Mycobacterium phage Kasen3, complete genome) position: , mismatch: 9, identity: 0.719

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gacaccggccaagaaggcgccggcgaagacgt	Protospacer
. *. ******** ***********.**  * 

1199. spacer 19.3|5330051|32|LR130759|CRT matches to JN699002 (Mycobacterium phage Avrafan, complete genome) position: , mismatch: 9, identity: 0.719

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gacaccggccaagaaggcgccggcgaagacgt	Protospacer
. *. ******** ***********.**  * 

1200. spacer 19.3|5330051|32|LR130759|CRT matches to MH779507 (Mycobacterium phage Hotshotbaby7, complete genome) position: , mismatch: 9, identity: 0.719

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gacaccggccaagaaggcgccggcgaagacgt	Protospacer
. *. ******** ***********.**  * 

1201. spacer 19.3|5330051|32|LR130759|CRT matches to KT355474 (Mycobacterium phage Frosty24, complete genome) position: , mismatch: 9, identity: 0.719

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gacaccggccaagaaggcgccggcgaagacgt	Protospacer
. *. ******** ***********.**  * 

1202. spacer 19.3|5330051|32|LR130759|CRT matches to KC787109 (Mycobacterium phage Legendre, partial genome) position: , mismatch: 9, identity: 0.719

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gacaccggccaagaaggcgccggcgaagacgt	Protospacer
. *. ******** ***********.**  * 

1203. spacer 19.3|5330051|32|LR130759|CRT matches to JN412593 (Mycobacterium phage Liefie, complete genome) position: , mismatch: 9, identity: 0.719

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gacaccggccaagaaggcgccggcgaagacgt	Protospacer
. *. ******** ***********.**  * 

1204. spacer 19.3|5330051|32|LR130759|CRT matches to MH479920 (Mycobacterium phage Mowgli, complete genome) position: , mismatch: 9, identity: 0.719

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gacaccggccaagaaggcgccggcgaagacgt	Protospacer
. *. ******** ***********.**  * 

1205. spacer 19.3|5330051|32|LR130759|CRT matches to NC_008202 (Mycobacterium phage Halo, complete genome) position: , mismatch: 9, identity: 0.719

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gacaccggccaagaaggcgccggcgaagacgt	Protospacer
. *. ******** ***********.**  * 

1206. spacer 19.3|5330051|32|LR130759|CRT matches to KM923970 (Mycobacterium phage Gomashi, complete genome) position: , mismatch: 9, identity: 0.719

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gacaccggccaagaaggcgccggcgaagacgt	Protospacer
. *. ******** ***********.**  * 

1207. spacer 19.3|5330051|32|LR130759|CRT matches to MH450127 (Mycobacterium phage Plagueis, complete genome) position: , mismatch: 9, identity: 0.719

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gacaccggccaagaaggcgccggcgaagacgt	Protospacer
. *. ******** ***********.**  * 

1208. spacer 19.3|5330051|32|LR130759|CRT matches to KT347314 (Mycobacterium phage Phreak, complete genome) position: , mismatch: 9, identity: 0.719

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gacaccggccaagaaggcgccggcgaagacgt	Protospacer
. *. ******** ***********.**  * 

1209. spacer 19.3|5330051|32|LR130759|CRT matches to KT365399 (Mycobacterium phage Annihilator, complete genome) position: , mismatch: 9, identity: 0.719

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gacaccggccaagaaggcgccggcgaagacgt	Protospacer
. *. ******** ***********.**  * 

1210. spacer 19.3|5330051|32|LR130759|CRT matches to KC787110 (Mycobacterium phage Leo, complete genome) position: , mismatch: 9, identity: 0.719

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gacaccggccaagaaggcgccggcgaagacgt	Protospacer
. *. ******** ***********.**  * 

1211. spacer 20.1|5490160|31|LR130759|CRISPRCasFinder matches to NZ_CP038238 (Leisingera sp. NJS201 plasmid unnamed4, complete sequence) position: , mismatch: 9, identity: 0.71

actctatgaccccggcctcgccggtccgggt	CRISPR spacer
cccaggccacgccggcctcgccggtgcgggt	Protospacer
 *.  .. ** ************** *****

1212. spacer 20.1|5490160|31|LR130759|CRISPRCasFinder matches to MH588544 (Caulobacter phage CcrBL10, complete genome) position: , mismatch: 9, identity: 0.71

actctatgaccccggcctcgccggtccgggt	CRISPR spacer
gctcgatgaccccgccctcgccggactacca	Protospacer
.*** ********* ********* *..   

1213. spacer 1.4|586584|33|LR130759|CRISPRCasFinder matches to NZ_CP039697 (Novosphingobium sp. ABRDHK2 plasmid pABRDHK22, complete sequence) position: , mismatch: 10, identity: 0.697

gagttgaacaggcccgtgttggcgatggccgta	CRISPR spacer
ggaatgaacaggctcgagttggcgatggtgacg	Protospacer
*.. *********.** ***********. ...

1214. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP013003 (Caulobacter henricii strain CB4 plasmid pCB4, complete sequence) position: , mismatch: 10, identity: 0.677

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
atcgccgccaagcaggcgccggcggtcgttt	Protospacer
 . ** *******************      

1215. spacer 17.3|5328990|31|LR130759|CRT matches to NZ_CP022306 (Thalassococcus sp. S3 plasmid pS3C, complete sequence) position: , mismatch: 10, identity: 0.677

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gtcacgcccaagcaggagccggcggaggtca	Protospacer
 . .** ********* **********   .

1216. spacer 17.10|5329230|32|LR130759|CRT matches to NZ_CP020371 (Candidatus Thiodictyon syntrophicum strain Cad16T plasmid pTs417, complete sequence) position: , mismatch: 10, identity: 0.688

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
ggcctggttccggcggcgcggccgggacctcg	Protospacer
    .**.************* *******   

1217. spacer 17.10|5329230|32|LR130759|CRT matches to NC_015184 (Agrobacterium sp. H13-3 plasmid pAspH13-3a, complete sequence) position: , mismatch: 10, identity: 0.688

ccaacggctccggcggcgcgggcgggaccggc	CRISPR spacer
atgctgcagccggcggcgaaggcgggaccggc	Protospacer
 .. .*   ********* .************

1218. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP018348 (Klebsiella pneumoniae strain CAV1417 plasmid pCAV1417-9294, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1219. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP018672 (Klebsiella pneumoniae strain CAV1217 plasmid pCAV1217-9294, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1220. spacer 17.12|5329344|32|LR130759|CRT matches to CP052171 (Klebsiella pneumoniae strain F16KP0075 plasmid pF16KP0075-4, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1221. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP032199 (Klebsiella pneumoniae strain AR_0097 plasmid unnamed5, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1222. spacer 17.12|5329344|32|LR130759|CRT matches to CP052486 (Klebsiella pneumoniae strain C16KP0036 plasmid pC16KP0036-2, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1223. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP021756 (Klebsiella pneumoniae strain AR_0113 plasmid unitig_5, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1224. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP023852 (Escherichia coli strain 4/0 plasmid p4_0.3, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1225. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP018433 (Klebsiella pneumoniae strain MNCRE53 plasmid pMNCRE53_1, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1226. spacer 17.12|5329344|32|LR130759|CRT matches to CP052166 (Klebsiella pneumoniae strain F16KP0082 plasmid pF16KP0082-4, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1227. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP018445 (Klebsiella pneumoniae strain Kp_Goe_822917 plasmid pKp_Goe_917-4, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1228. spacer 17.12|5329344|32|LR130759|CRT matches to CP052411 (Klebsiella pneumoniae strain C17KP0008 plasmid pC17KP0008-4, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1229. spacer 17.12|5329344|32|LR130759|CRT matches to CP052161 (Klebsiella pneumoniae strain F16KP0084 plasmid pF16KP0084-3, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1230. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP014648 (Klebsiella pneumoniae strain KPNIH36 plasmid pKPN-821, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1231. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP011979 (Klebsiella pneumoniae DMC1097 plasmid pDMC1097-20.222kb, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1232. spacer 17.12|5329344|32|LR130759|CRT matches to CP052402 (Klebsiella pneumoniae strain C17KP0039 plasmid pC17KP0039-3, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1233. spacer 17.12|5329344|32|LR130759|CRT matches to CP052312 (Klebsiella pneumoniae strain E16KP0102 plasmid pE16KP0102-3, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1234. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP010394 (Klebsiella pneumoniae strain 34618 plasmid p34618-13.841kb, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1235. spacer 17.12|5329344|32|LR130759|CRT matches to NC_009793 (Citrobacter koseri ATCC BAA-895 plasmid pCKO3, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1236. spacer 17.12|5329344|32|LR130759|CRT matches to CP052146 (Klebsiella pneumoniae strain F17KP0012 plasmid pF17KP0012-3, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1237. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_LS992179 (Citrobacter freundii isolate Citrobacter freundii str. E2614 plasmid 5, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1238. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP024884 (Klebsiella aerogenes strain AR_0009 plasmid tig00000054_pilon, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1239. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP033630 (Klebsiella pneumoniae strain 4743 plasmid unnamed5) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1240. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP033630 (Klebsiella pneumoniae strain 4743 plasmid unnamed5) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1241. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP011988 (Klebsiella pneumoniae UHKPC07 plasmid pUHKPC07-13.841kb, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1242. spacer 17.12|5329344|32|LR130759|CRT matches to CP052360 (Klebsiella pneumoniae strain D16KP0144 plasmid pD16KP0144-4, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1243. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP011982 (Klebsiella pneumoniae 500_1420 plasmid p500_1420-51.662kb, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1244. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP011982 (Klebsiella pneumoniae 500_1420 plasmid p500_1420-51.662kb, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1245. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP011984 (Klebsiella pneumoniae 500_1420 plasmid p500_1420-13.838kb, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1246. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP020840 (Klebsiella pneumoniae strain BK13043 plasmid pBK13043-3, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1247. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP011993 (Klebsiella pneumoniae UHKPC33 plasmid pUHKPC33-13.841kb, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1248. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP027058 (Klebsiella pneumoniae strain 2_GR_12 plasmid ColRNAI, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1249. spacer 17.12|5329344|32|LR130759|CRT matches to CP052447 (Klebsiella pneumoniae strain C16KP0098 plasmid pC16KP0098-4, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1250. spacer 17.12|5329344|32|LR130759|CRT matches to NC_018953 (Klebsiella pneumoniae plasmid pIGMS32, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1251. spacer 17.12|5329344|32|LR130759|CRT matches to NC_019156 (Klebsiella pneumoniae plasmid pAAC154, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1252. spacer 17.12|5329344|32|LR130759|CRT matches to NC_019159 (Klebsiella pneumoniae plasmid ColEST258, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1253. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP018425 (Klebsiella pneumoniae strain MNCRE69 plasmid pMNCRE69_1, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1254. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP032930 (Klebsiella aerogenes strain AR_0062 plasmid unnamed5, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1255. spacer 17.12|5329344|32|LR130759|CRT matches to NC_021656 (Klebsiella pneumoniae plasmid pKpQIL-SC29, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1256. spacer 17.12|5329344|32|LR130759|CRT matches to NC_021666 (Klebsiella pneumoniae plasmid ColE-LS6, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1257. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP024651 (Escherichia coli strain BH100 substr. MG2014 plasmid pAp, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1258. spacer 17.12|5329344|32|LR130759|CRT matches to CP052418 (Klebsiella pneumoniae strain C16KP0189 plasmid pC16KP0189-4, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1259. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP021837 (Klebsiella pneumoniae strain AR_0120 plasmid tig00000601_pilon, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1260. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP045796 (Klebsiella pneumoniae subsp. pneumoniae strain AUSMDU00008079 plasmid pAUSMDU00008079_04, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1261. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP007796 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p3, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ccggctgccaagccggcgccggccacctgagg	Protospacer
***** ******* ********* .  ...* 

1262. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP022921 (Klebsiella pneumoniae strain ST307PT03 plasmid pJYC03B, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1263. spacer 17.12|5329344|32|LR130759|CRT matches to CP052234 (Klebsiella pneumoniae strain E17KP0033 plasmid pE17KP0033-3, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1264. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP046275 (Enterobacter hormaechei strain E70 plasmid pE70-TEM1, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1265. spacer 17.12|5329344|32|LR130759|CRT matches to CP052555 (Klebsiella pneumoniae strain A17KP0038 plasmid pA17KP0038-4, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1266. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP014122 (Klebsiella pneumoniae strain FDAARGOS_156 plasmid unnamed4, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1267. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP014122 (Klebsiella pneumoniae strain FDAARGOS_156 plasmid unnamed4, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1268. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP031807 (Klebsiella pneumoniae strain MSB1_8A-sc-2280397 plasmid unnamed7, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1269. spacer 17.12|5329344|32|LR130759|CRT matches to CP052210 (Klebsiella pneumoniae strain E17KP0085 plasmid pE17KP0085-3, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1270. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP023528 (Citrobacter koseri strain FDAARGOS_393 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1271. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP018353 (Klebsiella pneumoniae strain CAV1453 plasmid pCAV1453-14, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1272. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP021548 (Klebsiella pneumoniae strain AR_0112 plasmid tig00000005, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1273. spacer 17.12|5329344|32|LR130759|CRT matches to CP052529 (Klebsiella pneumoniae strain B16KP0177 plasmid pB16KP0177-5, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1274. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP021543 (Klebsiella pneumoniae strain AR_0047 plasmid tig00000004, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1275. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP009877 (Klebsiella pneumoniae subsp. pneumoniae strain KPNIH31 plasmid pAAC154-a9e, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1276. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP009772 (Klebsiella pneumoniae subsp. pneumoniae strain KPNIH33 plasmid pEA1509_B, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1277. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP009778 (Klebsiella pneumoniae subsp. pneumoniae strain KPNIH32 plasmid pKPN-c8b, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1278. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP008832 (Klebsiella pneumoniae subsp. pneumoniae KPR0928 plasmid pKPN-294, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1279. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP008799 (Klebsiella pneumoniae subsp. pneumoniae KPNIH24 plasmid pKPN-819, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1280. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP006928 (Klebsiella pneumoniae 30660/NJST258_1 plasmid pNJST258N4, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1281. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP007728 (Klebsiella pneumoniae subsp. pneumoniae KPNIH10 plasmid pAAC154-a50, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1282. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP006919 (Klebsiella pneumoniae 30684/NJST258_2 plasmid pNJST258C2, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1283. spacer 17.12|5329344|32|LR130759|CRT matches to CP052283 (Klebsiella pneumoniae strain E16KP0224 plasmid pE16KP0224-3, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1284. spacer 17.12|5329344|32|LR130759|CRT matches to CP052428 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-1, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1285. spacer 17.12|5329344|32|LR130759|CRT matches to CP052548 (Klebsiella pneumoniae strain B16KP0089 plasmid pB16KP0089-2, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1286. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP036449 (Klebsiella pneumoniae strain KPNIH45 plasmid pKPC-610e, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1287. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP020066 (Klebsiella pneumoniae strain AR_0117 plasmid unitig_5, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1288. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP020075 (Klebsiella pneumoniae strain AR_0115 plasmid tig00000005, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1289. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP020112 (Klebsiella pneumoniae strain AR_0098 plasmid tig00000004, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1290. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP015391 (Klebsiella pneumoniae strain NY9 plasmid pNY9_6, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1291. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP036445 (Klebsiella pneumoniae strain ABFPV plasmid tig00001273_pilon, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1292. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP050378 (Klebsiella pneumoniae strain 51015 plasmid p51015_COL_RNAI, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1293. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP050378 (Klebsiella pneumoniae strain 51015 plasmid p51015_COL_RNAI, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1294. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP031757 (Klebsiella aerogenes strain FDAARGOS_327 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1295. spacer 17.12|5329344|32|LR130759|CRT matches to CP052424 (Klebsiella pneumoniae strain C16KP0164 plasmid pC16KP0164-2, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1296. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_LR130551 (Klebsiella pneumoniae strain KPC2 isolate KPC2 plasmid 4) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1297. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP022576 (Klebsiella pneumoniae strain BIC-1 plasmid pBIC-1c, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1298. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP024463 (Klebsiella pneumoniae strain QS17-0161 plasmid pMRSN480738_10.0, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1299. spacer 17.12|5329344|32|LR130759|CRT matches to CP052191 (Klebsiella pneumoniae strain F16KP0019 plasmid pF16KP0019-2, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1300. spacer 17.12|5329344|32|LR130759|CRT matches to CP052541 (Klebsiella pneumoniae strain B16KP0141 plasmid pB16KP0141-4, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1301. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP021717 (Klebsiella pneumoniae strain AR_0129 plasmid tig00000004, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1302. spacer 17.12|5329344|32|LR130759|CRT matches to CP052536 (Klebsiella pneumoniae strain B16KP0157 plasmid pB16KP0157-3, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1303. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP021860 (Klebsiella pneumoniae strain AR_0125 plasmid tig00000007_pilon, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1304. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP032835 (Klebsiella pneumoniae strain INF237 plasmid pINF237_02, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1305. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP027052 (Klebsiella pneumoniae strain 20_GR_12 plasmid ColRNAI, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1306. spacer 17.12|5329344|32|LR130759|CRT matches to CP052305 (Klebsiella pneumoniae strain E16KP0172 plasmid pE16KP0172-2, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1307. spacer 17.12|5329344|32|LR130759|CRT matches to CP052206 (Klebsiella pneumoniae strain F16KP0002 plasmid pF16KP0002-3, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1308. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP036436 (Citrobacter sp. ABFQG plasmid pKPC-5fbf, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1309. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP036441 (Klebsiella pneumoniae strain ABFQB plasmid pKPC-5fbf, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1310. spacer 17.12|5329344|32|LR130759|CRT matches to NC_011382 (Klebsiella pneumoniae plasmid 15S, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1311. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP025009 (Klebsiella pneumoniae strain AUSMDU00008119 plasmid pAUSMDU8119-1, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1312. spacer 17.12|5329344|32|LR130759|CRT matches to NC_022083 (Klebsiella pneumoniae JM45 plasmid p2, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1313. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP022918 (Klebsiella pneumoniae strain ST307PT04 plasmid pJYC04B) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1314. spacer 17.12|5329344|32|LR130759|CRT matches to CP052238 (Klebsiella pneumoniae strain E17KP0029 plasmid pE17KP0029-3, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1315. spacer 17.12|5329344|32|LR130759|CRT matches to CP052180 (Klebsiella pneumoniae strain F16KP0045 plasmid pF16KP0045-2, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1316. spacer 17.12|5329344|32|LR130759|CRT matches to CP052439 (Klebsiella pneumoniae strain C16KP0108 plasmid pC16KP0108-5, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1317. spacer 17.12|5329344|32|LR130759|CRT matches to CP052355 (Klebsiella pneumoniae strain D16KP0146 plasmid pD17KP0032-3, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1318. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP054267 (Klebsiella pneumoniae strain 39427 plasmid pKPN39427.3, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1319. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP026710 (Citrobacter koseri strain AR_0024 plasmid unitig_1_pilon, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1320. spacer 17.12|5329344|32|LR130759|CRT matches to CP052396 (Klebsiella pneumoniae strain C17KP0040 plasmid pC17KP0040-3, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1321. spacer 17.12|5329344|32|LR130759|CRT matches to CP052481 (Klebsiella pneumoniae strain C16KP0050 plasmid pC16KP0050-5, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1322. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP032177 (Klebsiella pneumoniae strain AR_0135 plasmid unnamed2, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1323. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP018431 (Klebsiella pneumoniae strain MNCRE78 plasmid pMNCRE78_1, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1324. spacer 17.12|5329344|32|LR130759|CRT matches to CP052318 (Klebsiella pneumoniae strain E16KP0093 plasmid pE16KP0093-3, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1325. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP025252 (Escherichia coli strain BH100 substr. MG2017 plasmid pApR, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1326. spacer 17.12|5329344|32|LR130759|CRT matches to CP052473 (Klebsiella pneumoniae strain C16KP0053 plasmid pC16KP0053-5, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1327. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP015384 (Klebsiella pneumoniae strain CN1 plasmid pCN1_2, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1328. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP033818 (Klebsiella aerogenes strain FDAARGOS_513 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1329. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP037930 (Klebsiella pneumoniae subsp. pneumoniae strain KP-8788 plasmid p8788-IT, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1330. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP019010 (Escherichia coli strain Ecol_AZ161 plasmid pECAZ161_KPC, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1331. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP021779 (UNVERIFIED_ORG: Enterobacter cloacae strain AR_0053 plasmid unitig_4, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1332. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP015396 (Klebsiella pneumoniae strain CR14 plasmid pCR14_4, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1333. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP027698 (Klebsiella pneumoniae strain KP30835 plasmid unnamed3, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1334. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_LT985216 (Escherichia coli strain 533 plasmid RCS12TR533_p, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1335. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_LT985257 (Escherichia coli strain 580 plasmid RCS49_pIV, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1336. spacer 17.12|5329344|32|LR130759|CRT matches to LC505458 (Klebsiella pneumoniae A1-1 plasmid pColRNAI-Kp1-1 DNA, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1337. spacer 17.12|5329344|32|LR130759|CRT matches to CP052497 (Klebsiella pneumoniae strain B17KP0067 plasmid pB17KP0067-3, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1338. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_MH909340 (Klebsiella pneumoniae strain A1763 plasmid pA1763-KPC, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1339. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_MH909332 (Klebsiella pneumoniae strain A1731 plasmid pA1731-KPC, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1340. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_MH909338 (Klebsiella pneumoniae strain A1759 plasmid pA1759-KPC, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1341. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_MF150119 (Klebsiella pneumoniae strain A64477 plasmid pKP64477e, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1342. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_MF150124 (Klebsiella pneumoniae strain A64216 plasmid pKP64216c, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1343. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP022075 (Citrobacter koseri strain FDAARGOS_287 plasmid unnamed2, complete sequence) position: , mismatch: 10, identity: 0.688

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
ataacggccatgcaggcgctggcggagttgtt	Protospacer
 ...****** ********.*******. * .

1344. spacer 18.1|5329584|31|LR130759|CRT matches to NZ_CP026093 (Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.677

ccaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ggggcggctcsggcggcacgggcggggagcg	Protospacer
  ..****** ******.********.   *

1345. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP013003 (Caulobacter henricii strain CB4 plasmid pCB4, complete sequence) position: , mismatch: 10, identity: 0.677

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
atcgccgccaagcaggcgccggcggtcgttt	Protospacer
 . ** *******************      

1346. spacer 18.3|5329698|31|LR130759|CRT matches to NZ_CP022306 (Thalassococcus sp. S3 plasmid pS3C, complete sequence) position: , mismatch: 10, identity: 0.677

ccggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gtcacgcccaagcaggagccggcggaggtca	Protospacer
 . .** ********* **********   .

1347. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP045122 (Rubrobacter sp. SCSIO 52915 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.688

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ggcaacggctccggcggttcgggcgacggggc	Protospacer
. ***************. ******. .  * 

1348. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP020539 (Sphingobium herbicidovorans strain MH plasmid pMSHV, complete sequence) position: , mismatch: 10, identity: 0.688

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ggcaacggcttcggcggcgctggcgcagcgaa	Protospacer
. ********.********* **** ..* ..

1349. spacer 19.1|5329937|32|LR130759|CRT matches to NZ_CP032347 (Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence) position: , mismatch: 10, identity: 0.688

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
gcgggcggcttcggcggcgcgggcaggatttc	Protospacer
.* ..*****.*************.***..  

1350. spacer 19.1|5329937|32|LR130759|CRT matches to HM486077 (Tsukamurella phage TPA2, complete sequence) position: , mismatch: 10, identity: 0.688

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ggtggcggcggcggcggcgcgggcgggatctt	Protospacer
. ...****  *****************.*  

1351. spacer 19.1|5329937|32|LR130759|CRT matches to NC_015210 (Tsukamurella phage TPA2, complete genome) position: , mismatch: 10, identity: 0.688

accaacggctccggcggcgcgggcgggaccgg	CRISPR spacer
ggtggcggcggcggcggcgcgggcgggatctt	Protospacer
. ...****  *****************.*  

1352. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP023017 (Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
cgcggcggccaagcaggcctcggcgcgcgcgc	Protospacer
  **************** .***** .   * 

1353. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP018348 (Klebsiella pneumoniae strain CAV1417 plasmid pCAV1417-9294, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1354. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP018672 (Klebsiella pneumoniae strain CAV1217 plasmid pCAV1217-9294, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1355. spacer 19.3|5330051|32|LR130759|CRT matches to CP052171 (Klebsiella pneumoniae strain F16KP0075 plasmid pF16KP0075-4, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1356. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP032199 (Klebsiella pneumoniae strain AR_0097 plasmid unnamed5, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1357. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP022775 (Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
cgcggcggccaagcaggcctcggcgcgcgcgc	Protospacer
  **************** .***** .   * 

1358. spacer 19.3|5330051|32|LR130759|CRT matches to CP052486 (Klebsiella pneumoniae strain C16KP0036 plasmid pC16KP0036-2, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1359. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP021756 (Klebsiella pneumoniae strain AR_0113 plasmid unitig_5, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1360. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP023852 (Escherichia coli strain 4/0 plasmid p4_0.3, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1361. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP018433 (Klebsiella pneumoniae strain MNCRE53 plasmid pMNCRE53_1, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1362. spacer 19.3|5330051|32|LR130759|CRT matches to CP052166 (Klebsiella pneumoniae strain F16KP0082 plasmid pF16KP0082-4, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1363. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP018445 (Klebsiella pneumoniae strain Kp_Goe_822917 plasmid pKp_Goe_917-4, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1364. spacer 19.3|5330051|32|LR130759|CRT matches to CP052411 (Klebsiella pneumoniae strain C17KP0008 plasmid pC17KP0008-4, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1365. spacer 19.3|5330051|32|LR130759|CRT matches to CP052161 (Klebsiella pneumoniae strain F16KP0084 plasmid pF16KP0084-3, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1366. spacer 19.3|5330051|32|LR130759|CRT matches to NC_014310 (Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
cgcggcggccaagcaggcctcggcgcgcgcgc	Protospacer
  **************** .***** .   * 

1367. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP014648 (Klebsiella pneumoniae strain KPNIH36 plasmid pKPN-821, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1368. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP011979 (Klebsiella pneumoniae DMC1097 plasmid pDMC1097-20.222kb, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1369. spacer 19.3|5330051|32|LR130759|CRT matches to CP052402 (Klebsiella pneumoniae strain C17KP0039 plasmid pC17KP0039-3, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1370. spacer 19.3|5330051|32|LR130759|CRT matches to CP052312 (Klebsiella pneumoniae strain E16KP0102 plasmid pE16KP0102-3, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1371. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP010394 (Klebsiella pneumoniae strain 34618 plasmid p34618-13.841kb, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1372. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP022762 (Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
tgcggcggccaagcaggcctcggcgcgcgcgc	Protospacer
  **************** .***** .   * 

1373. spacer 19.3|5330051|32|LR130759|CRT matches to NC_009793 (Citrobacter koseri ATCC BAA-895 plasmid pCKO3, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1374. spacer 19.3|5330051|32|LR130759|CRT matches to CP052146 (Klebsiella pneumoniae strain F17KP0012 plasmid pF17KP0012-3, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1375. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_LS992179 (Citrobacter freundii isolate Citrobacter freundii str. E2614 plasmid 5, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1376. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP024884 (Klebsiella aerogenes strain AR_0009 plasmid tig00000054_pilon, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1377. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP033630 (Klebsiella pneumoniae strain 4743 plasmid unnamed5) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1378. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP033630 (Klebsiella pneumoniae strain 4743 plasmid unnamed5) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1379. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP011988 (Klebsiella pneumoniae UHKPC07 plasmid pUHKPC07-13.841kb, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1380. spacer 19.3|5330051|32|LR130759|CRT matches to CP052360 (Klebsiella pneumoniae strain D16KP0144 plasmid pD16KP0144-4, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1381. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP011982 (Klebsiella pneumoniae 500_1420 plasmid p500_1420-51.662kb, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1382. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP011982 (Klebsiella pneumoniae 500_1420 plasmid p500_1420-51.662kb, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1383. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP011984 (Klebsiella pneumoniae 500_1420 plasmid p500_1420-13.838kb, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1384. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP020840 (Klebsiella pneumoniae strain BK13043 plasmid pBK13043-3, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1385. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP011993 (Klebsiella pneumoniae UHKPC33 plasmid pUHKPC33-13.841kb, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1386. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP027058 (Klebsiella pneumoniae strain 2_GR_12 plasmid ColRNAI, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1387. spacer 19.3|5330051|32|LR130759|CRT matches to CP052447 (Klebsiella pneumoniae strain C16KP0098 plasmid pC16KP0098-4, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1388. spacer 19.3|5330051|32|LR130759|CRT matches to NC_018953 (Klebsiella pneumoniae plasmid pIGMS32, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1389. spacer 19.3|5330051|32|LR130759|CRT matches to NC_019156 (Klebsiella pneumoniae plasmid pAAC154, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1390. spacer 19.3|5330051|32|LR130759|CRT matches to NC_019159 (Klebsiella pneumoniae plasmid ColEST258, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1391. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP018425 (Klebsiella pneumoniae strain MNCRE69 plasmid pMNCRE69_1, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1392. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP032930 (Klebsiella aerogenes strain AR_0062 plasmid unnamed5, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1393. spacer 19.3|5330051|32|LR130759|CRT matches to NC_021656 (Klebsiella pneumoniae plasmid pKpQIL-SC29, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1394. spacer 19.3|5330051|32|LR130759|CRT matches to NC_021666 (Klebsiella pneumoniae plasmid ColE-LS6, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1395. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP024651 (Escherichia coli strain BH100 substr. MG2014 plasmid pAp, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1396. spacer 19.3|5330051|32|LR130759|CRT matches to CP052418 (Klebsiella pneumoniae strain C16KP0189 plasmid pC16KP0189-4, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1397. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP021837 (Klebsiella pneumoniae strain AR_0120 plasmid tig00000601_pilon, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1398. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP045796 (Klebsiella pneumoniae subsp. pneumoniae strain AUSMDU00008079 plasmid pAUSMDU00008079_04, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1399. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP007796 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p3, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
cccggctgccaagccggcgccggccacctgag	Protospacer
 ***** ******* ********* .  ...*

1400. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP022921 (Klebsiella pneumoniae strain ST307PT03 plasmid pJYC03B, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1401. spacer 19.3|5330051|32|LR130759|CRT matches to CP052234 (Klebsiella pneumoniae strain E17KP0033 plasmid pE17KP0033-3, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1402. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP046275 (Enterobacter hormaechei strain E70 plasmid pE70-TEM1, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1403. spacer 19.3|5330051|32|LR130759|CRT matches to CP052555 (Klebsiella pneumoniae strain A17KP0038 plasmid pA17KP0038-4, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1404. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP014122 (Klebsiella pneumoniae strain FDAARGOS_156 plasmid unnamed4, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1405. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP014122 (Klebsiella pneumoniae strain FDAARGOS_156 plasmid unnamed4, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1406. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP031807 (Klebsiella pneumoniae strain MSB1_8A-sc-2280397 plasmid unnamed7, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1407. spacer 19.3|5330051|32|LR130759|CRT matches to CP052210 (Klebsiella pneumoniae strain E17KP0085 plasmid pE17KP0085-3, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1408. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP023528 (Citrobacter koseri strain FDAARGOS_393 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1409. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP018353 (Klebsiella pneumoniae strain CAV1453 plasmid pCAV1453-14, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1410. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP021548 (Klebsiella pneumoniae strain AR_0112 plasmid tig00000005, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1411. spacer 19.3|5330051|32|LR130759|CRT matches to CP052529 (Klebsiella pneumoniae strain B16KP0177 plasmid pB16KP0177-5, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1412. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP021543 (Klebsiella pneumoniae strain AR_0047 plasmid tig00000004, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1413. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP009877 (Klebsiella pneumoniae subsp. pneumoniae strain KPNIH31 plasmid pAAC154-a9e, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1414. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP009772 (Klebsiella pneumoniae subsp. pneumoniae strain KPNIH33 plasmid pEA1509_B, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1415. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP009778 (Klebsiella pneumoniae subsp. pneumoniae strain KPNIH32 plasmid pKPN-c8b, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1416. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP008832 (Klebsiella pneumoniae subsp. pneumoniae KPR0928 plasmid pKPN-294, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1417. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP008799 (Klebsiella pneumoniae subsp. pneumoniae KPNIH24 plasmid pKPN-819, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1418. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP006928 (Klebsiella pneumoniae 30660/NJST258_1 plasmid pNJST258N4, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1419. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP007728 (Klebsiella pneumoniae subsp. pneumoniae KPNIH10 plasmid pAAC154-a50, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1420. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP006919 (Klebsiella pneumoniae 30684/NJST258_2 plasmid pNJST258C2, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1421. spacer 19.3|5330051|32|LR130759|CRT matches to CP052283 (Klebsiella pneumoniae strain E16KP0224 plasmid pE16KP0224-3, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1422. spacer 19.3|5330051|32|LR130759|CRT matches to CP052428 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-1, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1423. spacer 19.3|5330051|32|LR130759|CRT matches to CP052548 (Klebsiella pneumoniae strain B16KP0089 plasmid pB16KP0089-2, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1424. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP036449 (Klebsiella pneumoniae strain KPNIH45 plasmid pKPC-610e, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1425. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP020066 (Klebsiella pneumoniae strain AR_0117 plasmid unitig_5, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1426. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP020075 (Klebsiella pneumoniae strain AR_0115 plasmid tig00000005, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1427. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP020112 (Klebsiella pneumoniae strain AR_0098 plasmid tig00000004, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1428. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP015391 (Klebsiella pneumoniae strain NY9 plasmid pNY9_6, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1429. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP036445 (Klebsiella pneumoniae strain ABFPV plasmid tig00001273_pilon, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1430. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP050378 (Klebsiella pneumoniae strain 51015 plasmid p51015_COL_RNAI, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1431. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP050378 (Klebsiella pneumoniae strain 51015 plasmid p51015_COL_RNAI, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1432. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP031757 (Klebsiella aerogenes strain FDAARGOS_327 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1433. spacer 19.3|5330051|32|LR130759|CRT matches to CP052424 (Klebsiella pneumoniae strain C16KP0164 plasmid pC16KP0164-2, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1434. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_LR130551 (Klebsiella pneumoniae strain KPC2 isolate KPC2 plasmid 4) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1435. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP022576 (Klebsiella pneumoniae strain BIC-1 plasmid pBIC-1c, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1436. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP024463 (Klebsiella pneumoniae strain QS17-0161 plasmid pMRSN480738_10.0, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1437. spacer 19.3|5330051|32|LR130759|CRT matches to CP052191 (Klebsiella pneumoniae strain F16KP0019 plasmid pF16KP0019-2, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1438. spacer 19.3|5330051|32|LR130759|CRT matches to CP052541 (Klebsiella pneumoniae strain B16KP0141 plasmid pB16KP0141-4, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1439. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP021717 (Klebsiella pneumoniae strain AR_0129 plasmid tig00000004, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1440. spacer 19.3|5330051|32|LR130759|CRT matches to CP052536 (Klebsiella pneumoniae strain B16KP0157 plasmid pB16KP0157-3, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1441. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP014703 (Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
tgcggcggccaagcaggcctcggcgcgcgcgc	Protospacer
  **************** .***** .   * 

1442. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP021860 (Klebsiella pneumoniae strain AR_0125 plasmid tig00000007_pilon, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1443. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP022760 (Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
cgcggcggccaagcaggcctcggcgcgcgcgc	Protospacer
  **************** .***** .   * 

1444. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP022789 (Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
cgcggcggccaagcaggcctcggcgcgcgcgc	Protospacer
  **************** .***** .   * 

1445. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP032835 (Klebsiella pneumoniae strain INF237 plasmid pINF237_02, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1446. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP027052 (Klebsiella pneumoniae strain 20_GR_12 plasmid ColRNAI, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1447. spacer 19.3|5330051|32|LR130759|CRT matches to CP052305 (Klebsiella pneumoniae strain E16KP0172 plasmid pE16KP0172-2, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1448. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP022771 (Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
tgcggcggccaagcaggcctcggcgcgcgcgc	Protospacer
  **************** .***** .   * 

1449. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP022777 (Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
tgcggcggccaagcaggcctcggcgcgcgcgc	Protospacer
  **************** .***** .   * 

1450. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP022799 (Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
tgcggcggccaagcaggcctcggcgcgcgcgc	Protospacer
  **************** .***** .   * 

1451. spacer 19.3|5330051|32|LR130759|CRT matches to CP052206 (Klebsiella pneumoniae strain F16KP0002 plasmid pF16KP0002-3, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1452. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP036436 (Citrobacter sp. ABFQG plasmid pKPC-5fbf, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1453. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP036441 (Klebsiella pneumoniae strain ABFQB plasmid pKPC-5fbf, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1454. spacer 19.3|5330051|32|LR130759|CRT matches to NC_011382 (Klebsiella pneumoniae plasmid 15S, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1455. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP025009 (Klebsiella pneumoniae strain AUSMDU00008119 plasmid pAUSMDU8119-1, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1456. spacer 19.3|5330051|32|LR130759|CRT matches to NC_022083 (Klebsiella pneumoniae JM45 plasmid p2, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1457. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP022918 (Klebsiella pneumoniae strain ST307PT04 plasmid pJYC04B) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1458. spacer 19.3|5330051|32|LR130759|CRT matches to CP052238 (Klebsiella pneumoniae strain E17KP0029 plasmid pE17KP0029-3, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1459. spacer 19.3|5330051|32|LR130759|CRT matches to CP052180 (Klebsiella pneumoniae strain F16KP0045 plasmid pF16KP0045-2, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1460. spacer 19.3|5330051|32|LR130759|CRT matches to CP052439 (Klebsiella pneumoniae strain C16KP0108 plasmid pC16KP0108-5, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1461. spacer 19.3|5330051|32|LR130759|CRT matches to CP052355 (Klebsiella pneumoniae strain D16KP0146 plasmid pD17KP0032-3, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1462. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP022764 (Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
cgcggcggccaagcaggcctcggcgcgcgcgc	Protospacer
  **************** .***** .   * 

1463. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP054267 (Klebsiella pneumoniae strain 39427 plasmid pKPN39427.3, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1464. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP026710 (Citrobacter koseri strain AR_0024 plasmid unitig_1_pilon, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1465. spacer 19.3|5330051|32|LR130759|CRT matches to CP052396 (Klebsiella pneumoniae strain C17KP0040 plasmid pC17KP0040-3, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1466. spacer 19.3|5330051|32|LR130759|CRT matches to CP052481 (Klebsiella pneumoniae strain C16KP0050 plasmid pC16KP0050-5, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1467. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP032177 (Klebsiella pneumoniae strain AR_0135 plasmid unnamed2, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1468. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP018431 (Klebsiella pneumoniae strain MNCRE78 plasmid pMNCRE78_1, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1469. spacer 19.3|5330051|32|LR130759|CRT matches to CP052318 (Klebsiella pneumoniae strain E16KP0093 plasmid pE16KP0093-3, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1470. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP025252 (Escherichia coli strain BH100 substr. MG2017 plasmid pApR, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1471. spacer 19.3|5330051|32|LR130759|CRT matches to CP052473 (Klebsiella pneumoniae strain C16KP0053 plasmid pC16KP0053-5, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1472. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP015384 (Klebsiella pneumoniae strain CN1 plasmid pCN1_2, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1473. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP033818 (Klebsiella aerogenes strain FDAARGOS_513 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1474. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP037930 (Klebsiella pneumoniae subsp. pneumoniae strain KP-8788 plasmid p8788-IT, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1475. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP019010 (Escherichia coli strain Ecol_AZ161 plasmid pECAZ161_KPC, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1476. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP022797 (Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
cgcggcggccaagcaggcctcggcgcgcgcgc	Protospacer
  **************** .***** .   * 

1477. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP021779 (UNVERIFIED_ORG: Enterobacter cloacae strain AR_0053 plasmid unitig_4, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1478. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP015396 (Klebsiella pneumoniae strain CR14 plasmid pCR14_4, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1479. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP027698 (Klebsiella pneumoniae strain KP30835 plasmid unnamed3, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1480. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_LT985216 (Escherichia coli strain 533 plasmid RCS12TR533_p, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1481. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_LT985257 (Escherichia coli strain 580 plasmid RCS49_pIV, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1482. spacer 19.3|5330051|32|LR130759|CRT matches to LC505458 (Klebsiella pneumoniae A1-1 plasmid pColRNAI-Kp1-1 DNA, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1483. spacer 19.3|5330051|32|LR130759|CRT matches to CP052497 (Klebsiella pneumoniae strain B17KP0067 plasmid pB17KP0067-3, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1484. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_MH909340 (Klebsiella pneumoniae strain A1763 plasmid pA1763-KPC, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1485. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_MH909332 (Klebsiella pneumoniae strain A1731 plasmid pA1731-KPC, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1486. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_MH909338 (Klebsiella pneumoniae strain A1759 plasmid pA1759-KPC, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1487. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_MF150119 (Klebsiella pneumoniae strain A64477 plasmid pKP64477e, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1488. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_MF150124 (Klebsiella pneumoniae strain A64216 plasmid pKP64216c, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1489. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP022075 (Citrobacter koseri strain FDAARGOS_287 plasmid unnamed2, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
gataacggccatgcaggcgctggcggagttgt	Protospacer
. ...****** ********.*******. * 

1490. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP022758 (Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
cgcggcggccaagcaggcctcggcgcgcgcgc	Protospacer
  **************** .***** .   * 

1491. spacer 20.1|5490160|31|LR130759|CRISPRCasFinder matches to NZ_LR594692 (Variovorax sp. WDL1 plasmid 4) position: , mismatch: 10, identity: 0.677

actctatgaccccggcctcgccggtccgggt	CRISPR spacer
cgcagatgaccccggcctcgccgatacgctg	Protospacer
  .  ******************.* **   

1492. spacer 12.3|4362478|37|LR130759|CRT matches to NZ_CP016613 (Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence) position: , mismatch: 11, identity: 0.703

tctgatgggctgggctggcggagccggcgggacaggt	CRISPR spacer
gatcggcggcagcgctggcggagccggcgggacggcg	Protospacer
  * .  *** * ********************.*  

1493. spacer 12.3|4362478|37|LR130759|CRT matches to NZ_CP022781 (Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.703

tctgatgggctgggctggcggagccggcgggacaggt	CRISPR spacer
gatcggcggcagcgctggcggagccggcgggacggcg	Protospacer
  * .  *** * ********************.*  

1494. spacer 12.3|4362478|37|LR130759|CRT matches to NZ_CP022766 (Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.703

tctgatgggctgggctggcggagccggcgggacaggt	CRISPR spacer
gatcggcggcagcgctggcggagccggcgggacggcg	Protospacer
  * .  *** * ********************.*  

1495. spacer 12.3|4362478|37|LR130759|CRT matches to NZ_CP052069 (Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence) position: , mismatch: 11, identity: 0.703

tctgatgggctgggctggcggagccggcgggacaggt	CRISPR spacer
gatcggcggcagcgctggcggagccggcgggacggcg	Protospacer
  * .  *** * ********************.*  

1496. spacer 12.3|4362478|37|LR130759|CRT matches to NZ_CP016905 (Ralstonia solanacearum strain KACC 10709 plasmid unnamed1) position: , mismatch: 11, identity: 0.703

tctgatgggctgggctggcggagccggcgggacaggt	CRISPR spacer
gatcggcggcagcgctggcggagccggcgggacggcg	Protospacer
  * .  *** * ********************.*  

1497. spacer 12.3|4362478|37|LR130759|CRT matches to NZ_CP022769 (Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.703

tctgatgggctgggctggcggagccggcgggacaggt	CRISPR spacer
gatcggcggcagcgctggcggagccggcgggacggcg	Protospacer
  * .  *** * ********************.*  

1498. spacer 12.3|4362478|37|LR130759|CRT matches to NZ_CP022773 (Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.703

tctgatgggctgggctggcggagccggcgggacaggt	CRISPR spacer
gatcggcggcagcgctggcggagccggcgggacggcg	Protospacer
  * .  *** * ********************.*  

1499. spacer 12.3|4362478|37|LR130759|CRT matches to NZ_CP022791 (Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.703

tctgatgggctgggctggcggagccggcgggacaggt	CRISPR spacer
gatcggcggcagcgctggcggagccggcgggacggcg	Protospacer
  * .  *** * ********************.*  

1500. spacer 12.3|4362478|37|LR130759|CRT matches to NZ_CP022779 (Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.703

tctgatgggctgggctggcggagccggcgggacaggt	CRISPR spacer
gatcggcggcagcgctggcggagccggcgggacggcg	Protospacer
  * .  *** * ********************.*  

1501. spacer 12.3|4362478|37|LR130759|CRT matches to NZ_CP022793 (Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.703

tctgatgggctgggctggcggagccggcgggacaggt	CRISPR spacer
gatcggcggcagcgctggcggagccggcgggacggcg	Protospacer
  * .  *** * ********************.*  

1502. spacer 12.3|4362478|37|LR130759|CRT matches to NZ_CP022785 (Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.703

tctgatgggctgggctggcggagccggcgggacaggt	CRISPR spacer
gatcggcggcagcgctggcggagccggcgggacggcg	Protospacer
  * .  *** * ********************.*  

1503. spacer 12.3|4362478|37|LR130759|CRT matches to NZ_CP022787 (Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.703

tctgatgggctgggctggcggagccggcgggacaggt	CRISPR spacer
gatcggcggcagcgctggcggagccggcgggacggcg	Protospacer
  * .  *** * ********************.*  

1504. spacer 12.3|4362478|37|LR130759|CRT matches to NZ_CP022756 (Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.703

tctgatgggctgggctggcggagccggcgggacaggt	CRISPR spacer
gatcggcggcagcgctggcggagccggcgggacggcg	Protospacer
  * .  *** * ********************.*  

1505. spacer 17.5|5329107|37|LR130759|CRT matches to NZ_CP023976 (Streptomyces alboflavus strain MDJK44 plasmid pMDJK44.1, complete sequence) position: , mismatch: 11, identity: 0.703

-----agggaggccagggcggtcagggcgcggccggagccga	CRISPR spacer
ttctccgg-----ttgggcggtcagggcgcggcgggggccgg	Protospacer
      **     . ****************** **.****.

1506. spacer 17.12|5329344|32|LR130759|CRT matches to NZ_CP022306 (Thalassococcus sp. S3 plasmid pS3C, complete sequence) position: , mismatch: 11, identity: 0.656

ccggcggccaagcaggcgccggcggagcaggc	CRISPR spacer
gtcacgcccaagcaggagccggcggaggtcaa	Protospacer
 . .** ********* **********   . 

1507. spacer 18.5|5329815|37|LR130759|CRT matches to NZ_CP023976 (Streptomyces alboflavus strain MDJK44 plasmid pMDJK44.1, complete sequence) position: , mismatch: 11, identity: 0.703

-----agggaggccagggcggtcagggcgcggccggagccga	CRISPR spacer
ttctccgg-----ttgggcggtcagggcgcggcgggggccgg	Protospacer
      **     . ****************** **.****.

1508. spacer 19.3|5330051|32|LR130759|CRT matches to NZ_CP022306 (Thalassococcus sp. S3 plasmid pS3C, complete sequence) position: , mismatch: 11, identity: 0.656

accggcggccaagcaggcgccggcggagcagg	CRISPR spacer
ggtcacgcccaagcaggagccggcggaggtca	Protospacer
. . .** ********* **********   .

1509. spacer 14.4|5303641|39|LR130759|CRISPRCasFinder matches to NC_016586 (Azospirillum lipoferum 4B plasmid AZO_p2, complete sequence) position: , mismatch: 12, identity: 0.692

gcagcccggcccgaccggcgacaccaccgaccccaccgc	CRISPR spacer
cacgcccagcccgaccggctacaccaccgacgtggtccg	Protospacer
   ****.*********** *********** . ..*  

1510. spacer 14.4|5303641|39|LR130759|CRISPRCasFinder matches to NZ_CP029832 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence) position: , mismatch: 12, identity: 0.692

gcagcccggcccgaccggcgacaccaccgaccccaccgc	CRISPR spacer
cacgcccagcccgaccggccacaccaccgacgtggtccg	Protospacer
   ****.*********** *********** . ..*  

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site
DBSCAN-SWA_1	926562 : 933954	7	Tupanvirus(66.67%)	NA	NA
DBSCAN-SWA_2	5398027 : 5404781	9	Mycobacterium_phage(50.0%)	NA	NA

Sequences of DBSCAN-SWA_1

Nucleotide sequences of DBSCAN-SWA_1

>LR130759|926562:933954|DBSCAN-SWA
GCTAGGCCGCCGCGCCCGGCTTCAGATAGGTCACCAGGCTGCAGTCGAGCATCTCGTCGGTGAAGTAGTGCTCACAGCCGCGCAGATACTTGATGTACCGGTTGTACACCTCTTCGGAGGTGACCTCGATGGCCTTTTCCTTGTTGGACTCCAGCGTGTTGCCCCAGATGTGCAGCGTCTTGATGTAGTGCGGTCGCAGTGAAAGGGGTTCGGGGACAACGAATCCCGCTTTTTCGCCGTGTTCGATCATCATCTCGGTAGACGGCAGGCGCCCGCCCGGAAAGATCTCGGTGATGATGAACTTGATGAAGCGCGCCGTCTCGAAGCTCAGCTTCTTACCTCGGGCCGCCATCTCGAACGGGTGATAGCCGACGCTGCTTTGCACGGTCATCCGACCGTCCTCGGGCATGATGTTGAAACAGCGCTTGAAGAAGTCGTCGTAGTTCTCGTGGCCGAAGTGCTCGAAGGCCTCGATGGACACGATCCGGTCGACCGGCTCGGTGAAATCCTCCCACCCCTGCAGCAGCACCCGGCGTGAGCGATTCGTGTCGATCGAGCCCAGCACCTGCTCAGAGCGCGCGTGCTGGTTCCTCGACAGGGTCAGGCCGATGACGTTGACGTCGAAGCGCTCAACCGCGCGCCTCAGCGTGGTGCCCCAGCCGCAACCGATGTCCAGCAGCGTCATACCCGGTTGGAGGTCCAGCTTGTCCAGGTTGAGGTCGATCTTGGCGTATTGGGCTTCTTCGAGCGTGAGGTTCGGTGGCTCGAAGTAGGCGCAGCTGTACGTACGGGTTGGGTCCTGGAACAAGGCGAAGAAATCGTCGGAGACGTCGTAGTGCGCCTGGATATCTTCCGAGCGCGTCCGAGTCTTCGTCTCTGTCGGCGGTTTCTCAACCATTGTCGTCCTGTTCTCCTGAGTAGTGTTCACCGCTCCAACGCACACGCGGCACCTCTGCTTGCCCGTGCAAGCGTACGAATTCTCGAAGCATTACCCACCCGCGCGAGGATTGCACGCGTCGTTCATCTGTGGCACGAAAGTCTACTTGGCCAGTGTGAACTGGTTGCAGTCGATATAGCCCATCCGAAATGCCTTGGCGCAACCGGTCAAATACTTCATGTAGCGCTCGTAGACCTCTTCTGACTGGATCTTGATGGCTTCGTCCCTGCGTGCCTCCAGCGTCTCGGACCAAAAATCAAGAGTCCTGGCGAAGTCCAGCTGCAGAGACTGCCGGCGGGTCACCGTGAAGCCCACCTTCGCGGTGTGCTCTTCGACCTTCTCGACCATCGGCAGTCGGCCGCCGGGGAAGATGTCGGTGACGATGAACCTGATGAATTTCGCCATTTCCATGGTCAACGGTATGCCGCGTTCGATGACCTGCTTGACGTGTAACGCGGTGATCGCGTGCAGCAGCATCAGCCCGTTGGCGGGCAGGGCTTCGTAGGCGAACTTGAAGAAATCGTCGTAACGATGAAAGCCGAAGTGCTCCAGCGCCTCAATGGTGACGATACGGTCCGCGGGCTCGTCGAATTCCGCCCAGTCGCGCAGCAGTACCCGGTGCGAGCGGTTGGTGTCGACGTCGCCGAGCAAGCGCTGGCAGTAGTTGTGCTGGTTCTTCGACAGCGTCAGCCCCACGACGTTGACGTCGTATTTCTCGATCGCGCGTTTGAGGACGGAGCCCCAGCCGCAGCCAATGTCGAGCAGAGTCATCCCGGGCTGCAGTTCCAGCTTGTCCAGCGTCAGATCGATCTTGGCGACTTGGGCTTCGTGCAGCGTCATGTCGTCACGAGGAAAGTACGCGCAGCTGTAGGTGCGCGTCGGATCGACAAACAGCGCGAAGAACTCGTCGGAAAGGTCGTAATGTGCCTGCACGTCGTCGGCGTTGGACCGCGTCGATGACAGGGATGTCGTCGTGTCAGGCATATGTCCTCCTGTGATGGTCCCCCTCAGCGGGTGACCATCCCCGGCACCCTACACGCAATGAGGCTCGTCCTTCGCATTTGAGCCCGCGCAGACTGGTCTTTCTTGATCGGGACACGACCGGCGCAATCACTACTTCTCCAGCGTGAATTGGTTGACGTCGATGTAGCCGACGCGGAAAGCGTTGGCGCAGCCGGTCAGATACTTCATGTACCGCTCGTAGACCTCTTCGGACTGAATCGCGATGGCCTCGTCCTTGTGCGCCTCGAGCGCTTCGGCCCACAGGTCGAGGGTCCTGGCATAGTGCGGCTGCAGCGACTGGCGGCGGGTCAGCGTGAAGCCGGCCTTGGCGGCATGCTCCTCGACCTTTTCGATCGACGGTAACCGGCCGCCGGGGAAGATCTCGGTGACGATGAACTTGATGAAGCGAGCCATCTCAAAAGTCATCGGCATCCCGCGCTCGATAATCTGCGGTCCCGTCAACCCGGTGATCGTGTGCAGCAGCATCACCCCGTCGTCGGGCAAGATCTTGTTGGCGAGGGCAAAGAAGTCGTCGTAGCGGTCGTGGCCGAAATGCTCGAATGCGCCGATCGACACGATTCGGTCGACGGGTTCATCGAATTGCTCCCAGCCCTGCAGCAGCACGCGCCGGCTGCGCGGCGTGTCCAACTCGTCGAACGAGTTCTGCACGTGCACGGCCTGGTTTTTCGACAGGGTCAGGCCAACGACGTTGACGTCATATTTTTCGATCGCGCGCCGCATGGTGGCGCCCCAGCCGCAGCCGACGTCGAGCAACGTCATCCCGGGCTGTAGGCCCAGCTTGCCCAGCGCCAGGTCGACCTTGGCGATCTGGGCCTGCTCCAGCGTCATGTCGGCGCGCTCGAAGTAGGCGCAACTGTAGGTCTGGGTGGGGTCCAGAAACAGCCGGAAGAAGTCGTCGGATAAGTCGTAATGCGCCTGTACGTCGTCAAAATGTGGCGTGAGTTCTTTGGCCATGACCTGAAATGCCTTTCCGGGCCGAGGCAACGGCCCTACGGTGCTAGCACCGGCGCACAAGAGCGCCAGAGCACCGAAAACGTCCCCCCAAGCGTGTTCGAGGCATGCTATCCGATTCAACGACGCAGCACTAAACTGCGACCGAATCTGCCCAGGTCACCCTACTTGGTAAGGGTGAACTGGGCCACGTTGATCAAGCCCCGGCGGAACCGCTCCGCGCATCCGGTCAGATAGTGCAGGAAGTTGTTGTACACCTCTTCGGACTGGATTTTGACGGCGTGTTCTCGCGCGGACTCCAGGTTGGTCGCCCACGTGTCCAGGGTGCGTGCATAATGCTGCTGCATCAGCTGGGTGTCCGCGACGGCGAAGCCGGCCGCCTGCGCGTTGTCGACGATATCGGGCTGGGACGGCAGTTCCCCGCCCGGGAAGATCGACTCCCGAAGGAACTTCAGGAACCGAATGTCGCTCATCGTCAGCGCAATGCCCTGCTCGTGCAACCACCTGCGGTCGTAGGTGAACAAGCTGTGCAGCAACATCCGGCCGTCGCCGGGGAGCATGTCGTATGAGCGGTCAAAGAATGCGCGGTACCGCTCTTTGTGGAAAGCGTCGAACGCCTCGAAGCTGACGATCCGGTCAACCTTTTCGTCGAACTCTTCCCAGCCCTGCAGCCGCGCCTCGGCACGCCGGGTGGTGGTGAGCGCGGCCAGCCGGTCATTGCTGCGCTGACAATGGTTCCTACTCAAAGTGAGGCCGATGACGTTGACGTCGTACTTTTCCACGGCCCGGACCAGCGCCCCGCCCCAGCCGCATCCGACGTCGAGCACCGTCATGCCGGGTTCGAGGTGCAGCTTGTCCAGCGCCAGGTCCAGCTTGGCGAGCTGTGCTTCCTCGAGGGTCATGTCCTCGCGCTCGAAGTATGCGCAGGTGTAGACCCAGGTTGGGTCCAGGAACAATCCGAAGAAGTCGTCCGAGATGTCGTACGCCGCTTGTGAGTCTTCGTAATACGGTGTCAGTTTGGCCATGTGACACAACCTCCTCCGCCAACGGTACAACCCGGTGCCCGTCACCCGAAAATTCCGGGGGAGAGTACCTACCTACTGCGGTTGGCCTCAACTTGCCGGGCGAAGTTGCTCGTCAGCACATCGATAATCTGGTCCCACAGTTGCTGTGGCAGATCATGTCCCATCCCGTCGAACATCACCAATCGGGCGTCGTTGATGGCCCTGGCGACGGCCCGGCCACCGAACGGCCGCATCAGCTTGTCAGCACGGCCGTGGATCACCACGGTGGGTGCGACGGTCCGGCGGTTGTAGTGCAGCAGGCTGCCACTGCCCAGGACCGCGCTGAAGTGGCGGGGGATACCCCACGGGTAGTAGCTGCGGTCGTAGTTCTCGGCGGCGTCGGCGCGGATCCATTCCTCGGTGGGTTGGTACCGCGGACTGCCGGTGATCCTGGTGACCCGCACGACGTTGTCGATGATCACCTCGCGTGGCGAGCCCGGCGGCGGACCCTTGAGCACCGCGAGCAAGGCGCGGGGTGCGGGTGGTGGCAGGAACGGGCGATTGTTGCTGGAGAAGATCACCGCCAGCGATTGAGTCCGTTCGGCAAATCGCGCCGCAAAGATCTGGGCGATCATGCCGCCCATCGAAGCCCCGACGATGTGTGCGCGCTGGATGTCGAGGTGGTCCAGCACGGCCGCGGCATCGTCGGTCATGTCCTCCAGCGTGTATTGCGCCTGGCTGCGCAGGCCCAGCCACGATCGCAGCAACCGCGTCGCTAGGGGCCGCCTGGCGGTGCGGTGTTCGATCTTGGTGGACAGTCCGACATCCCGGTTGTCGAAACGAATGACCCGTAGGCCCTGCTCAACCAGCTTCTCGCAAAACCCGGTCCGCCACAGCAGCAGCTGGGCGCCCAGCCCCATGATCAGCAGCACAGGCGGATCATTGATGTCGCCCATGTCCTCGTAGTACAGCTCCACCGGGCCCGCGGTCCGGCCCGGCTTGGGCCGCGATACGGCCAGGCCGCTGCGGATTTCCATAGCCAGACCCTAGACCCTCGGAGCCATCGGACGACCCTCAGACTTCTACGTCGGTCTGATGCTCGCGGCTCACCTCGACCATGAAGTTGGCGAAGTATCCGGTCAGCTGCGGATCCGACATCATCTGCCACTTCGGGGCCAGCAGCTTCATATACCGCTCCACGTAGAGGAACTGCTTGCCGATCAACACCAGCTCCCGCGGCAACTTGACGTCGTAGGCGTCGGCCAGCGTGGACAGTTGGCGGCCGATGTCGGCATACGACATGTCGCCCAGCGTTTGCATGGTGAGTGGGGTGGCGAACCTCTCCAGATCCTTGGCCGCCTGGGCCTCTGGCTTCATGGTCCCCACGGCACCCATCAGCACGACGATCTTGCCCGCCGCGGCGTGGTCCTTCTTGACCAGCAGCGCATACACCAGTTCACGCAGCAGCCAGCGGGTGCGGGGATCAATGCGGCCCATGATGCCGAAGTCGAAGAAGACGATGCGGCCTTGGTCATCGACGTAGAGATTGCCCGCGTGCAGGTCGCCGTGGAACAAGCCGTGTCGCAGTCCGCCTTCGAACACGCTGAACAGTAGCGCCTTTACCAGCTCGGTCCCGTCGAACCCGGCCTTGCGGATGGCGGCAGCGTTGTCGATGCGGATGCCGTGCACCCGTTCCATCGTCAAGACCCGCTTGGTGGTGAAGTCCCAGTGCACATGGGGCACCCGGATGTTGCGGCCCAGCGGCGATGCGTGCAGGTGGGAGACCCACGCTTCCATCGACTGTGCCTCCAGACCGAAGTCCAGCTCCTCGGCCAGGTTCTCGGAAAAGTCGGCGACCACGTCTCGGGCCGACAGCCGACGGCCCAGCTTGGCCAATTCGACCGCCTGAGCGAATCTCTTGAGGATCTGCAGGTCGGCGGCGACTCGGCGGCGGATACCCGGCCGCTGGATCTTGACCACGACGTCTTCGCCGGTCTTCAGCGTTGCGTAGTGAACCTGGGCGATCGATGCCGACGCGAACGGCTCTTCCTCGAAGGTGGCAAACAACTCGGCCGGATCGGCACCCAGTTCTTCGACAAAGAGCTTGTGCACCTCGTCGGTATTGGCCGGCGGCACCCGGTCGAGCAGACCCCGGAATTCGCGCGACAGGGATTCGCCGAACGCCCCGGGGCTGGACGCAATAATCTGCCCGAACTTCACATATGTGGGGCCGAGGTCTGCGAAGGTCTGGGGGATTTCCTTGATGATTTTCTGCTGCCATGGACCTTTGCGCGGCAATCGGGCAACGACGCGCGCCGCGGTGCGGGTGACCTGCCAGCCAGTGACGGCTACCCGGGCCGCTTCGACCGGCAAAGGCACCCGATCAAGCCTGGACACCTCGCGGTGTTTGGTAGATGTCATTTCTGCAGTGTGCCAAACGGACACTGTCAAGTCCCAATTGCTGTGAGCCCATTCACGCGCGGGGTATTGCTTCCCGAGTCCGCCTCCATTGCGAAAATCCGGCCCACTGCGGCCGAAATTCTTGCATTGCTTACCCGCCAGGCGGAGTCTGCGAGAAATTTTCCGTAAGCGCTTCCAATATCGGCCGCCACACCGGTCGCGGCAGGTCGTGACCCATTCCATCGACCACGACAAAGCGTGCGCCGGGGATGGCCGCGGCGACCGCACGCCCGTTGCGCGGCCGCACCATCGGGTCGGCCGAACCGTGCAACACCACCGTCGGTGCGGTGATCGCCCTGCTGTAGCCGAGCAGGCTCCCGGTGCCCAGCACAGCATCGAACTGGCGCAGCATGCCGGGCGGGTAATTGCACCGGTCGGCGAGTTGCTGCACCCGCTGTCGTAGTTCGCCGCGGGACGGCAGAAAGTTGGGCCCGTTGAATACCTCGACGTTGCGCACCTCGAAGGCCAGCTTCTCCTCGGTCGAGGCATCCCTGGCTGGCTGGTCGAACGCCAGCTTGAGGACGCGCCAGGCCGGCGGCGCCGAGAGCGGTTTGCCCGTTGTCGACATGATGATGCCCAGCGACGCCACCCGGCCCGGTTCGGTGGCGGCCAGGATCTGCGCGAGCATGCCGCCCAGCGAGGCGCCGACCACGTGTGCCCGCGCAACGCCGAGATGATCGAGCAGCGCGACCACGTCCCCGGTCATGTCGACCAACGTGTACGGCACCGGACTGGACCGGCCCAACAGATAGCGGCCTATCCGTCGGTAGACCGAGCCCCGGGCCCGCAGGCCGTGCATCTTGGCCGACAATCCGGTGTCGCGATGGTCGAATCGGATGACCCGGTAGCCGGCGTCAACGAGCTGGCCGCAGAAGCCGTCCGGCCACATGGGAAGTTGGGCGCCCAGGCCCATGATGAGCAGCACCGGCGCGTCGGCCGGGTCGCCGAGGTCTTCGTAGAAGAGCTCGACGGGGCCGTGTGGCGTCCCGCGGCGAGCGACGCCGCTGCTGGTGCGCAC

Protein sequences of DBSCAN-SWA_1

>LR130759|926562:933954|927600_928482_-|VDM87297.1|DBSCAN-SWA
MPDTTTSLSSTRSNADDVQAHYDLSDEFFALFVDPTRTYSCAYFPRDDMTLHEAQVAKIDLTLDKLELQPGMTLLDIGCGWGSVLKRAIEKYDVNVVGLTLSKNQHNYCQRLLGDVDTNRSHRVLLRDWAEFDEPADRIVTIEALEHFGFHRYDDFFKFAYEALPANGLMLLHAITALHVKQVIERGIPLTMEMAKFIRFIVTDIFPGGRLPMVEKVEEHTAKVGFTVTRRQSLQLDFARTLDFWSETLEARRDEAIKIQSEEVYERYMKYLTGCAKAFRMGYIDCNQFTLAK
>LR130759|926562:933954|931550_932855_-|VDM87301.1|DBSCAN-SWA
MPLPVEAARVAVTGWQVTRTAARVVARLPRKGPWQQKIIKEIPQTFADLGPTYVKFGQIIASSPGAFGESLSREFRGLLDRVPPANTDEVHKLFVEELGADPAELFATFEEEPFASASIAQVHYATLKTGEDVVVKIQRPGIRRRVAADLQILKRFAQAVELAKLGRRLSARDVVADFSENLAEELDFGLEAQSMEAWVSHLHASPLGRNIRVPHVHWDFTTKRVLTMERVHGIRIDNAAAIRKAGFDGTELVKALLFSVFEGGLRHGLFHGDLHAGNLYVDDQGRIVFFDFGIMGRIDPRTRWLLRELVYALLVKKDHAAAGKIVVLMGAVGTMKPEAQAAKDLERFATPLTMQTLGDMSYADIGRQLSTLADAYDVKLPRELVLIGKQFLYVERYMKLLAPKWQMMSDPQLTGYFANFMVEVSREHQTDVEV
>LR130759|926562:933954|930565_931513_-|VDM87300.1|DBSCAN-SWA
MEIRSGLAVSRPKPGRTAGPVELYYEDMGDINDPPVLLIMGLGAQLLLWRTGFCEKLVEQGLRVIRFDNRDVGLSTKIEHRTARRPLATRLLRSWLGLRSQAQYTLEDMTDDAAAVLDHLDIQRAHIVGASMGGMIAQIFAARFAERTQSLAVIFSSNNRPFLPPPAPRALLAVLKGPPPGSPREVIIDNVVRVTRITGSPRYQPTEEWIRADAAENYDRSYYPWGIPRHFSAVLGSGSLLHYNRRTVAPTVVIHGRADKLMRPFGGRAVARAINDARLVMFDGMGHDLPQQLWDQIIDVLTSNFARQVEANRSR
>LR130759|926562:933954|929636_930497_-|VDM87299.1|DBSCAN-SWA
MAKLTPYYEDSQAAYDISDDFFGLFLDPTWVYTCAYFEREDMTLEEAQLAKLDLALDKLHLEPGMTVLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHCQRSNDRLAALTTTRRAEARLQGWEEFDEKVDRIVSFEAFDAFHKERYRAFFDRSYDMLPGDGRMLLHSLFTYDRRWLHEQGIALTMSDIRFLKFLRESIFPGGELPSQPDIVDNAQAAGFAVADTQLMQQHYARTLDTWATNLESAREHAVKIQSEEVYNNFLHYLTGCAERFRRGLINVAQFTLTK
>LR130759|926562:933954|928611_929475_-|VDM87298.1|DBSCAN-SWA
MAKELTPHFDDVQAHYDLSDDFFRLFLDPTQTYSCAYFERADMTLEQAQIAKVDLALGKLGLQPGMTLLDVGCGWGATMRRAIEKYDVNVVGLTLSKNQAVHVQNSFDELDTPRSRRVLLQGWEQFDEPVDRIVSIGAFEHFGHDRYDDFFALANKILPDDGVMLLHTITGLTGPQIIERGMPMTFEMARFIKFIVTEIFPGGRLPSIEKVEEHAAKAGFTLTRRQSLQPHYARTLDLWAEALEAHKDEAIAIQSEEVYERYMKYLTGCANAFRVGYIDVNQFTLEK
>LR130759|926562:933954|926562_927459_-|VDM87296.1|DBSCAN-SWA
MVEKPPTETKTRTRSEDIQAHYDVSDDFFALFQDPTRTYSCAYFEPPNLTLEEAQYAKIDLNLDKLDLQPGMTLLDIGCGWGTTLRRAVERFDVNVIGLTLSRNQHARSEQVLGSIDTNRSRRVLLQGWEDFTEPVDRIVSIEAFEHFGHENYDDFFKRCFNIMPEDGRMTVQSSVGYHPFEMAARGKKLSFETARFIKFIITEIFPGGRLPSTEMMIEHGEKAGFVVPEPLSLRPHYIKTLHIWGNTLESNKEKAIEVTSEEVYNRYIKYLRGCEHYFTDEMLDCSLVTYLKPGAAA
>LR130759|926562:933954|933027_933954_-|VDM87302.1|DBSCAN-SWA
MRTSSGVARRGTPHGPVELFYEDLGDPADAPVLLIMGLGAQLPMWPDGFCGQLVDAGYRVIRFDHRDTGLSAKMHGLRARGSVYRRIGRYLLGRSSPVPYTLVDMTGDVVALLDHLGVARAHVVGASLGGMLAQILAATEPGRVASLGIIMSTTGKPLSAPPAWRVLKLAFDQPARDASTEEKLAFEVRNVEVFNGPNFLPSRGELRQRVQQLADRCNYPPGMLRQFDAVLGTGSLLGYSRAITAPTVVLHGSADPMVRPRNGRAVAAAIPGARFVVVDGMGHDLPRPVWRPILEALTENFSQTPPGG

Homologous phage analysis in the prophage region

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
VDM87296.1|926562_927459_-	Hydroxymycolate synthase MmaA4	A0A2K9L4K8	Tupanvirus	2.1e-23	29.0
VDM87297.1|927600_928482_-	Methoxy mycolic acid synthase MmaA3	A0A2K9L4K8	Tupanvirus	5.2e-27	29.7
VDM87298.1|928611_929475_-	Cyclopropane mycolic acid synthase MmaA2	A0A2K9L4K8	Tupanvirus	3.1e-32	31.9
VDM87299.1|929636_930497_-	Mycolic acid methyltransferase MmaA1	A0A2K9L4K8	Tupanvirus	1.4e-24	27.7
VDM87300.1|930565_931513_-	Putative non-heme bromoperoxidase BpoC	NA	NA	NA	NA
VDM87301.1|931550_932855_-	putative ubiquinone biosynthesis protein UbiB	A9YVW0	Ostreococcus_tauri_virus	1.4e-31	26.8
VDM87302.1|933027_933954_-	Putative non-heme bromoperoxidase BpoC	A0A2D1GCA0	Mycobacterium_phage	3.5e-05	28.5

Sequences of DBSCAN-SWA_2

Nucleotide sequences of DBSCAN-SWA_2

>LR130759|5398027:5404781|DBSCAN-SWA
GCTAAGGGACGATGATGTTGAAACTTGGGTTGGGTTCGTCGAGCACGCCGGCCAGGGCCTGCAACACCGCCTGGTCACCGGAGACCTCGATCCCGGGTGAACTGAAATCACCCATGGCCACCGCCAGCAGCCGAGACTTGCTGTGCAGCTTGACGGTAACTGACGCCGTCGCTTCGTCGGCAGCGATCTTGCGATGAATCAGCACACCGTTACGCAGTGCGAGGCGGTAGTTGGCGTTGAGGTCCTCGAACGTCACGTCGATGGTGATGTCGAGATCCCAGCTGCGCGGGCCGTTGATGCGGATGGCAAGGCTGTCGAAGATCTGCTCCGGCGTGAGCTGGGTGAGCAGCGCAGGCGAGGTCGCCTGAACGGCGGTGCCCATGACGCCGTCGCGCAATTCGGCTGCCCCACACATGAAAAAGTTGCGCCAGGTCGCGTTCTCGGCACCGTACCCCATCTGTTCGAGGGTGTCGGCATAGAGGGCGCGGGCGGCGGGGTGCTCACTGTCAGCGAATACCGCGTGATCGAGTAGCGTAGCCGCCCAACGGAAGTCGCCGGAGTCGAACGCATCCTGGGCGAGTTCTACCACACGGTCAATCCCACCCATTGCCTCGACGTAACGTGGTGCGAGCGCTTCGGGAGGATGGGGCCACAGCCGCCCGGGGTTGCCGTCGAACCAGCCCATGTAGCGCTGGTAAACCGCCTTTACATTGTGACTGACCGACCCGTAATACCCATGGGTGTGCCAGGCCTGCTCCAATGCCGGTGGCATCTGGAACATTTCGGCGATCTCCACACCTGTGTAACCGTGGTTGAGCAGCCGCAATGTCTGGTCGTGCAAATAGGCGTACAAATCCCTTTGCAGCGAGAGGAATTCGACGATGCGGTCGCGCCCCCAGGTGGGCCAATGGTGGGAGGCGAACACCACATCGGTGCGTTGCGCGAAGGTGTCAATCGCCTCGGTGAGGTAGCCCGACCAGCCATGCGGGTCGCGCACCAGCGCGCCGCGCAGCGTCAGCAGATTGTGCAGGTTATGGGTGGCGTTCTCGGCCATGCACAACGCGCGGAATTTCGGGAAATAGAAGTGCATCTCGGCGGGGGCCTCGGTGCCCGGTGCCATCTGGAATTCGATCTCAACCCCGTCGATGGTGTGCCGCTCACCCGTCGTCCGGATGTCGACTGTCGGGTTAATGATGGCGACCTCACCCGTCGACGGGGTTTGACCAAGCCCACAGCCCACCTGCTCTTGCGGACCGCGGGCCAGCAGGGTCCCGTACATATAGGTCGCGCGGCGAGTCATGGCCGGGCCGGCGTAGACGTTCTCCTGGACGGCGTGCTCGGTGAACCCTTCCGGAGCCAGGATCTGGACTCTTCCCGCGTCCACATCGTGCTGTGAGGTAACGCCCAGCACGCCACCAAAATGGTCGACGTGGCTGTGCGTGTAGATCACCGCCACGACGGGACGGTCACCACCGCGGTGGGTCCGATACAAGCTCAACGCGGCGGCGGCCACCTCGGTGGACACCAATGGATCGATGACGATAATTCCGGTGTCGCCCTCAATGAAGCTGATGTTGGACAGGTCGAATCCGCGGACCTGGTAGATGCCCGGCACCACTTCGTAGAGCCCTTGTTTGGCAGCCAGCGTCGATTGTCGCCACAGGCTGGGATGCACCGATGTGGGCGCGGGGCCTCCGAGAAACGAATAGACGTCGTTGTCCCATACCACTCGACCATCGGCCGCCTTGATGACACAGGGGCTCAGAGCGGCAATGAATCCGCGGTCGGCGTCGTCAAAATCTCGCGTGTCCTGGAATGGCAGGGAGTGTTGGCCGTGAGCCGATTCGATCGCCGCGGTAGGAGGTTTGTGGTCCACTGGCACTACCTTGCCATTAGCCTCGCGGCCTCCGGTAGGCCCCATCGCATCGCCAGCTGGCAGCTGGCTAACCGGAAAATAATTTGCACGGTCCCTAGACCTCGGGTCCAGTTAACCCGCATACTGCCGGGGCGGTCCTCAATGCCGAGAACCGCTACAACGGGCAAAGGAGCACAGGTGAAGCGTGGACTGACGGTCGCAGTAGCCGGAGCGGCGATTTTGGTCGCGGGTCTTTCCGGATGTTCGAGCAACAAGTCGACCACGAGCAGTAGCGGGACCTCAAGCACAGGCGCGACATCGGCAAGCACGGGAGGTGGCAGCGGCGCCTCCGGAACAAAGGTCACCATCGACGGCCAGGACCAACACGTAACCGGCTCAGTTGTCTGCACGACGGCCGCCGGCAATGTCAACATCGCAATCGGTGGGGCGGCCACCGGCATCGCCGCGGTGCTCACCGACGCCAACCCGCCCGAGGTGAAGTCCGTCGGGCTGGGCAATGTCAACGGTGTGACGCTTGGCTACACATCCGGCACCGGCCAGGGCAAAGCCGAGGCAAGCAAGGACGGCAGCACCTACAAGATCACCGGCACGGCCACCGGGGTGGACATGGCCAACCCGATGTCTCCGGTGAATAAGCCGTTCGAAATCGACGTCACCTGCCCCTGACTCGCGGGGGCGAGCCGGACACGCTAACCGACCGAGGATGCGGGCGGTTGCCACCCATTGAGCGGCAACCGCACCGCAAACTCGGTATGACCGGGCGCGCTATTGAGCGTGATAGTCCCGTGATGGGCCCTGACCACAGCGGAGACGATCGCCAAGCCCAACCCGGTGCTGCCGCCTCTGCGCGAACGGGACGAATCCCCACGGGCGAACCGCTCGAACACCTCCGATTGCAGCTCTGCCGGAATGCCAGGCCCGTTGTCGATCACCTGTAACACGGTGTGCGCCGGTTCGGTGCTTAGCCGCGTGGTCACGACGGTGCCGGCGCCGGTGTGGATCCGGGCGTTGGCAAGCAGATTGGCTACCACCTGATGTAGCCGTGCCGCATCACCGGGGACCACCACCGGCTCGGCCGGCAGGTCGAGTTCCCACTGGTGATCTGGACCGGCGATGTGTGCATCGCTGACCGCGTCGACCGCCAGCCGGGATAGGTCCACGGGTTCGCGTTCCAGCGGACGGCCCGAGTCCAGCCGGGCAAGCAACAAAAGGTCCTCGACGAGGCGAGTCATCCGCTCGGTTTCCGATGCGACCCGGCTCATGGCCTGCGCCACCGCCTCACGGTCGTCACCCATGCGCTGTGTGAGTTCGGTGTAGCCACGGATCGCGGCCAGCGGGGTGCGCAATTCGTGGCTCGCATCGGCAACGAACTGGCGCACTCGAGTTTCACTTGCCTGCCGGGTCGACAGTGCGGTTGCGATGTGGTCGAGCATCCGATTCACCGCCGAACCGAGTTGGCCCACTTCCGTATACGGGTTTGCTTCCGGTTCGGGCACCCGGACCGGAAGTTCGACCTCGCCGCGGTCCAACGGCAGATCAGCGACTTCCCTTGCGGTTTGCGCAACGCGCCGCAGCGGCGCCAGCGCACGCTTGATGATGACGACACCGGCCGTTGTTGCGGCGGCCAATGCAATCGCGGTGACGATGCCGAAGATGATCAAGATCCGAAACATGGTGGTGTCCACGTTCGACATCGACAGACCGGTGACAATCACTTCGTCTCCGTGCCGGCTCGGCGCGGCCACAACGCGGTATCGGCCCAAGCCGTCGAGGTCCAGAGTCCTCGGCGTGCGGCTGTCGGCGATGGCCGCCAGCTGTGCCTGCGCGGCTGCACTCACCTCGGCCCGGGCTCCACTGCCGGTCAGGTAGCCGGCCTCGGCCGTCTTGCCATCGTCGACGACCGCGCCAACCATACCGGCCGGCTGTCCCGGGGCATCCAGGAATCTTGGTCCAGGGCCTGACATGTGGCGAGGCTTGATGTGCCGCCACCACCACCGGTGTCCCTCCGGGTTCATCAGCGAGGAGCGGTACGACGTTCCGGCCAACTGATTGTCGAGCTGTGCCACCAAGTGATGGCGCAGCGCCAGTTCGGTTGCCACGGTGATGCCGACACACACGACGGCGAGGACCACCACCTGGCCGATCAACAACCGCAGCCGAAGCGACCAAAATCGCGGACTGCTAGCGGGCCGGCTTGAGGACATAGCCTGCGCCACGCAGCGTGTGAATCATGGGTTCGCGGCCGTTGTCGATCTTCTTGCGCAGGTAGGAAATGTAGAGCTCAACGATGTTGGACCGGCCGCCGAAGTCATAGCTCCATACCCGATCCAGGATCTGCGCCTTGCTCAGCACTCGTTTGGAGTTGCGCATCATGAACCGCAGCAGTTCGAATTCGGTGGAGGTCAACGCGATAAGTTCGCCCGCGCGGGTCACCTCATGACTGTCCTCGTCGAGAACCAGATCTCCGACCACGAGCTGCGCGCCGCTGTCCACCGTTGTTACCCCGGTGCGCCGCAATAGCGCTCGCAGCCGCAGCACTACCTCCTCGATGCTGAAAGGCTTGGTGACGTAGTCATCGCCGCCGGCCGTCAACCCGGCGATCCGGTCTTCGACGGCATCCTTGGCAGTCAGCAGCAACACCGGCAGGTGAGGATTCTCTTTGCGTAACTTGTGCAGTACGTCCAAACCGCTCATATCGGGCAACATCACGTCCAACACCACGACATCGGGCCGCTCAGTACGGGCGGCGGCGATAGCCGACGAGCCATCCGCGGCGGTCGTGATATTCCAGCCCTCATAGCGCAGGGCCATCGATACCATCTCGGCCAGCACGGGTTCGTCGTCCACAACCAGCACGCTGACCGGTTGGCCGTCGGCTCGGCACATGACAACTCGCTCAACCGAGGTTCGGGGCGCCGTCACGATTTCCAGTATCCCCACCGGACTAGGCCGACGCTATGCCCTTCCTATGCGCGAGCTGTGAAAACCCAGATGACCTGCACAGCTCCGGGCGTTAGTACCAGTAGCGCCGGCCGGCGACCGGGCGCCCCATGGATCCCATGATCCACAGCACCGCGCCGATCACCAGCAAGATGACTCCGAGCACGGTCAGCAAATGGATGCCAAAGACAAATCCGAGGATAAGCAAGACAGCACCGACGACAACCATGACAACTTCCTTCTAGATTACGGAGGCGTGATCAATTGACGACATTGAGCTGGGCTGCGGCAAATGACAATCCCTTACTTTCGGATTGACGCCGAAGTAATTAAGCGGCCCAGCGAGCACCGTCACCGCAACGGTTCCCACTGAGGCACAACTTGTTTGCTGGCCTTTGAAGTAGCCTCGCTGCCACGTTGCGAAGACTCCAATAAGCAACCACACGAGCACAATAGCCCCGACAACTCCGCGACCACGCATGGCGACCTCCAATGTGTCCGAGAAAAAATCTCGCAAATCCGTACATACCCGTTGTACTCGTGTCCAAACATCTTCGGGCCGATACGGAGCGCCCGAATAGACGCGCACAATGTGCGAGCGCCCGCGGCTACGGTTTCTGGGTGTCAAGCCATGCCGCTCCCCGCTTCTTGGAAGCGCGGGACAGCCAGGCATCCTGAATCAGCTCAGCCAATTCCGTCGTACCGATCTCAGCCAATCGACTGGCCCGCACCAGAACCGACGGATGGCCATCGAAGTGGGCCGTGGTGAAAAATGGCGAGGCAGGGTCTTGGGTCAGCGCCAGTTTGTCGCTCTCTGACTCCACCCACAACATGATCACGTCGGCGTATCGTTGGCCGGTGACCGGATCGGCGGCATCGGGCTGCGGCGTACGAAAGAACACGAACGACTTGCCACCCACCTGGTAGACGGGATTCCCCTTCGGTCCTTCCAATCGCTTGACGTGCGGCATCGACGCAGCAATCCGATGCACATCGGCGACCCGGGCGGGTCTGTCAGCCATAGCGGCAACAATACCGACTAGATTGGCACCAGGGCGGGCCGCTACCCTGCACGACAAGTATTGCGGTGAACGAGGATTGGGGAAACATGCCTGATACATTGTTCGCCGACGTATCAGAATATCAAGTGCCGGTGGATAACTCGTATCCCTACCGGGTTCTGTCGATTCGTGTCTGCGACGGCACCTATCGGGACCACAACTTTGCGCGCAACTATGCCTGGATGCGTGCCGCATTGGACAGCGGGCGCTTGACTTTCGGCATCGTCTACACCTATGTACGGCCCAATTGGCTGGCCAATGCGAATACCGTGCGTTCGATGATCGATGCCGAGGGCGGCTTGCACCAACGGATCGCATTGATGCTCGACGTCGAGTCGGGCGGAAACCCGCCGGGCGATGGGTCGGCTTGGATCAATCAGCTGTACTGGAACCTGGCCGCATTTGCCGGCTCACCCGCGCGAATCATTGGTTATGCCAATGCCTATGACTTTTTCAATATGTGGCGCGTGCGCCCGCCGGGCCTGCGGGTGATCGCCGCGGGGTATGGGTCCAATCCGAATCTTCCCGGCCAGGTCGCCCACCAATACACCGACGGCAACGGCTACAGCCCCAACCTGCCACAGGGGTGCCCACCGTTCGGTCGCTAAGACATGAACTCCGCCGACGGACTGACACCGCACCAGTTTGCCGCCGAATGCGGCATCAGCACGAACAGAGGACCCCTGATGGCACTTTCCGACGAAGAGCAAGCCGAGCTGTTGACCAAGGTGCGCGAGATCTGGGATCAGCTGCGTGGGCCCAACGGTGCCGGGTGGCCTCAGCTCGGTCAGAACGCGGCCGGACAGAACCTCACCCCCGTCGACGCGATCGCGGCGATCAAGGACGACGTGGAGAACATGGTCGCCGGAGACACCTGA

Protein sequences of DBSCAN-SWA_2

>LR130759|5398027:5404781|5403950_5404511_+|VDM91137.1|DBSCAN-SWA
MPDTLFADVSEYQVPVDNSYPYRVLSIRVCDGTYRDHNFARNYAWMRAALDSGRLTFGIVYTYVRPNWLANANTVRSMIDAEGGLHQRIALMLDVESGGNPPGDGSAWINQLYWNLAAFAGSPARIIGYANAYDFFNMWRVRPPGLRVIAAGYGSNPNLPGQVAHQYTDGNGYSPNLPQGCPPFGR
>LR130759|5398027:5404781|5398027_5399947_-|VDM91130.1|DBSCAN-SWA
MGPTGGREANGKVVPVDHKPPTAAIESAHGQHSLPFQDTRDFDDADRGFIAALSPCVIKAADGRVVWDNDVYSFLGGPAPTSVHPSLWRQSTLAAKQGLYEVVPGIYQVRGFDLSNISFIEGDTGIIVIDPLVSTEVAAAALSLYRTHRGGDRPVVAVIYTHSHVDHFGGVLGVTSQHDVDAGRVQILAPEGFTEHAVQENVYAGPAMTRRATYMYGTLLARGPQEQVGCGLGQTPSTGEVAIINPTVDIRTTGERHTIDGVEIEFQMAPGTEAPAEMHFYFPKFRALCMAENATHNLHNLLTLRGALVRDPHGWSGYLTEAIDTFAQRTDVVFASHHWPTWGRDRIVEFLSLQRDLYAYLHDQTLRLLNHGYTGVEIAEMFQMPPALEQAWHTHGYYGSVSHNVKAVYQRYMGWFDGNPGRLWPHPPEALAPRYVEAMGGIDRVVELAQDAFDSGDFRWAATLLDHAVFADSEHPAARALYADTLEQMGYGAENATWRNFFMCGAAELRDGVMGTAVQATSPALLTQLTPEQIFDSLAIRINGPRSWDLDITIDVTFEDLNANYRLALRNGVLIHRKIAADEATASVTVKLHSKSRLLAVAMGDFSSPGIEVSGDQAVLQALAGVLDEPNPSFNIIVP
>LR130759|5398027:5404781|5404514_5404781_+|VDM91138.1|DBSCAN-SWA
MNSADGLTPHQFAAECGISTNRGPLMALSDEEQAELLTKVREIWDQLRGPNGAGWPQLGQNAAGQNLTPVDAIAAIKDDVENMVAGDT
>LR130759|5398027:5404781|5403450_5403813_-|VDM91136.1|DBSCAN-SWA
MPHVKRLEGPKGNPVYQVGGKSFVFFRTPQPDAADPVTGQRYADVIMLWVESESDKLALTQDPASPFFTTAHFDGHPSVLVRASRLAEIGTTELAELIQDAWLSRASKKRGAAWLDTQKP
>LR130759|5398027:5404781|5402915_5403071_-|VDM91134.1|DBSCAN-SWA
MVVVGAVLLILGFVFGIHLLTVLGVILLVIGAVLWIMGSMGRPVAGRRYWY
>LR130759|5398027:5404781|5403083_5403323_-|VDM91135.1|DBSCAN-SWA
MRGRGVVGAIVLVWLLIGVFATWQRGYFKGQQTSCASVGTVAVTVLAGPLNYFGVNPKVRDCHLPQPSSMSSIDHASVI
>LR130759|5398027:5404781|5400079_5400568_+|VDM91131.1|DBSCAN-SWA
MKRGLTVAVAGAAILVAGLSGCSSNKSTTSSSGTSSTGATSASTGGGSGASGTKVTIDGQDQHVTGSVVCTTAAGNVNIAIGGAATGIAAVLTDANPPEVKSVGLGNVNGVTLGYTSGTGQGKAEASKDGSTYKITGTATGVDMANPMSPVNKPFEIDVTCP
>LR130759|5398027:5404781|5400591_5402106_-|VDM91132.1|DBSCAN-SWA
MSSSRPASSPRFWSLRLRLLIGQVVVLAVVCVGITVATELALRHHLVAQLDNQLAGTSYRSSLMNPEGHRWWWRHIKPRHMSGPGPRFLDAPGQPAGMVGAVVDDGKTAEAGYLTGSGARAEVSAAAQAQLAAIADSRTPRTLDLDGLGRYRVVAAPSRHGDEVIVTGLSMSNVDTTMFRILIIFGIVTAIALAAATTAGVVIIKRALAPLRRVAQTAREVADLPLDRGEVELPVRVPEPEANPYTEVGQLGSAVNRMLDHIATALSTRQASETRVRQFVADASHELRTPLAAIRGYTELTQRMGDDREAVAQAMSRVASETERMTRLVEDLLLLARLDSGRPLEREPVDLSRLAVDAVSDAHIAGPDHQWELDLPAEPVVVPGDAARLHQVVANLLANARIHTGAGTVVTTRLSTEPAHTVLQVIDNGPGIPAELQSEVFERFARGDSSRSRRGGSTGLGLAIVSAVVRAHHGTITLNSAPGHTEFAVRLPLNGWQPPASSVG
>LR130759|5398027:5404781|5402083_5402788_-|VDM91133.1|DBSCAN-SWA
MCRADGQPVSVLVVDDEPVLAEMVSMALRYEGWNITTAADGSSAIAAARTERPDVVVLDVMLPDMSGLDVLHKLRKENPHLPVLLLTAKDAVEDRIAGLTAGGDDYVTKPFSIEEVVLRLRALLRRTGVTTVDSGAQLVVGDLVLDEDSHEVTRAGELIALTSTEFELLRFMMRNSKRVLSKAQILDRVWSYDFGGRSNIVELYISYLRKKIDNGREPMIHTLRGAGYVLKPAR

Homologous phage analysis in the prophage region

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
VDM91130.1|5398027_5399947_-	Metallo-beta-lactamase superfamily protein	A0A2P0VMX1	Tetraselmis_virus	1.3e-142	43.6
VDM91131.1|5400079_5400568_+	Mycobacterium 19 kDa lipoprotein antigen	NA	NA	NA	NA
VDM91132.1|5400591_5402106_-	putative sensor histidine kinase TcrY	Q8QKV7	Ectocarpus_siliculosus_virus	8.4e-09	27.0
VDM91133.1|5402083_5402788_-	putative transcriptional regulatory protein TcrX	W8CYM9	Bacillus_phage	2.9e-36	37.3
VDM91134.1|5402915_5403071_-	hypothetical protein	A0A1C9EH86	Mycobacterium_phage	9.8e-06	51.0
VDM91135.1|5403083_5403323_-	hypothetical protein	NA	NA	NA	NA
VDM91136.1|5403450_5403813_-	hypothetical protein	NA	NA	NA	NA
VDM91137.1|5403950_5404511_+	hypothetical protein	A0A2P1CG82	Mycobacterium_phage	4.6e-61	62.3
VDM91138.1|5404514_5404781_+	hypothetical protein	H6U5F7	Mycobacterium_phage	5.1e-10	76.3