CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
LS483410	Legionella pneumophila strain NCTC11404 genome assembly, chromosome: 1	2 crisprs	cas3,csa3,DEDDh,DinG,PD-DExK,WYL,RT	0	0	5	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: LS483410_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

LS483410_1

2326384-2326474

Unclear

Consensus_repeat	Method
GGCTCTTCCCCAAATCCGGGGGCA	CRISPRCasFinder

1 spacers

cas3

The CRISPR arrays of LS483410_1

>merge|LS483410|1|2326384-2326474|CRISPRCasFinder
GGCTCTTCCCCAAATCCGGGGGCACTAATCAAGAACACAAAACTTTAACCCTTAACCTATAGTTTTCGGCTCTTCCCCAAATCCGGGGGCA

>LS483410|1|1|2326384-2326474|CRISPRCasFinder
GGCTCTTCCCCAAATCCGGGGGCA	CTAATCAAGAACACAAAACTTTAACCCTTAACCTATAGTTTTC
GGCTCTTCCCCAAATCCGGGGGCA

Protein	Signature genes	Signature genes Name	Protein_function
LS483410.1\|SQG86214.1\|2324574_2325066_-\|4-diphosphocytidyl-2-methyl-D-erythritol-synthase	unknown	unknown	unknown
LS483410.1\|SQG86219.1\|2329662_2330229_+\|Uncharacterised-protein	unknown	unknown	unknown
LS483410.1\|SQG86220.1\|2330576_2330831_+\|Putative-addiction-module-antidote-protein,-CC2985-family-(containing-the-CopG/Arc/MetJ-DNA-binding-domain)	unknown	unknown	gnl\|CDD\|274227
LS483410.1\|SQG86206.1\|2318409_2318895_+\|Domain-of-uncharacterised-function-(DUF1845)	unknown	unknown	gnl\|CDD\|378089
LS483410.1\|SQG86224.1\|2333303_2334710_+\|ATP-dependent-RNA-helicase-DbpA	cas3	cd09639_cas3_CAS-I	gnl\|CDD\|236977
LS483410.1\|SQG86218.1\|2328979_2329558_+\|Uncharacterised-protein	unknown	unknown	unknown
LS483410.1\|SQG86225.1\|2334866_2335778_+\|Co/Zn/Cd-cation-transporter	unknown	unknown	gnl\|CDD\|226474
LS483410.1\|SQG86221.1\|2330820_2331117_+\|putative-toxin-antitoxin-plasmid-stabilization-system-ParE	unknown	unknown	gnl\|CDD\|226194
LS483410.1\|SQG86217.1\|2327694_2328825_-\|transposase-(IS652)	unknown	unknown	gnl\|CDD\|376574
LS483410.1\|SQG86223.1\|2332854_2333064_+\|Cold-shock-protein	unknown	unknown	gnl\|CDD\|224197
LS483410.1\|SQG86212.1\|2323316_2323823_+\|antirestriction-protein	unknown	unknown	gnl\|CDD\|377800
LS483410.1\|SQG86215.1\|2325076_2325895_-\|dam-methylase	unknown	unknown	gnl\|CDD\|182825
LS483410.1\|SQG86210.1\|2321758_2322658_+\|putative-integrase	unknown	unknown	gnl\|CDD\|372340
LS483410.1\|SQG86211.1\|2323068_2323254_+\|Uncharacterised-protein	unknown	unknown	unknown
LS483410.1\|SQG86209.1\|2320962_2321766_+\|putative-integrase	unknown	unknown	unknown
LS483410.1\|SQG86213.1\|2323924_2324542_-\|Uncharacterised-protein	unknown	unknown	unknown
LS483410.1\|SQG86207.1\|2318979_2319189_-\|Uncharacterised-protein	unknown	unknown	unknown
LS483410.1\|SQG86216.1\|2326480_2327656_-\|transposase-(IS652)	unknown	unknown	gnl\|CDD\|376574
LS483410.1\|SQG86208.1\|2319335_2320304_-\|Protein-of-uncharacterised-function-(DUF3644)	unknown	unknown	gnl\|CDD\|378842
LS483410.1\|SQG86222.1\|2331577_2332531_-\|transposase-(ISmav2)	unknown	unknown	gnl\|CDD\|372671

Protein	Function_ID	Function_description	E-value
LS483410.1\|SQG86224.1\|2333303_2334710_+\|ATP-dependent-RNA-helicase-DbpA	gnl\|CDD\|236977	PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional.	0
LS483410.1\|SQG86206.1\|2318409_2318895_+\|Domain-of-uncharacterised-function-(DUF1845)	gnl\|CDD\|378089	pfam08900, DUF1845, Domain of unknown function (DUF1845). This family of proteins are functionally uncharacterized.	0.000775231
LS483410.1\|SQG86220.1\|2330576_2330831_+\|Putative-addiction-module-antidote-protein,-CC2985-family-(containing-the-CopG/Arc/MetJ-DNA-binding-domain)	gnl\|CDD\|274227	TIGR02606, Antitoxin_ParD, putative addiction module antidote protein, CC2985 family. This bacterial protein family has a very similar seed alignment to that of pfam03693 but is a more stringent model with higher cutoff scores. Proteins that score above the trusted cutoff to this model almost invariably are found adjacent to a ParE family protein (pfam05016), where ParE is the killing partner of an addiction module for plasmid stabilization. Members of this family, therefore, are putative addiction module antidote proteins. Some are encoded on plasmids or in prophage regions, but others appear chromosomal. A genome may contain several identical copies, such as the four in Magnetococcus sp. MC-1. This family is named for one member, CC2985 of Caulobacter crescentus CB15. [Cellular processes, Other, Mobile and extrachromosomal element functions, Plasmid functions].	1.27591e-15
LS483410.1\|SQG86225.1\|2334866_2335778_+\|Co/Zn/Cd-cation-transporter	gnl\|CDD\|226474	COG3965, COG3965, Predicted Co/Zn/Cd cation transporters [Inorganic ion transport and metabolism].	2.15747e-100
LS483410.1\|SQG86217.1\|2327694_2328825_-\|transposase-(IS652)	gnl\|CDD\|376574	pfam01610, DDE_Tnp_ISL3, Transposase. Transposase proteins are necessary for efficient DNA transposition. Contains transposases for IS204, IS1001, IS1096 and IS1165.	2.31561e-49
LS483410.1\|SQG86223.1\|2332854_2333064_+\|Cold-shock-protein	gnl\|CDD\|224197	COG1278, CspC, Cold shock proteins [Transcription].	3.52513e-27
LS483410.1\|SQG86212.1\|2323316_2323823_+\|antirestriction-protein	gnl\|CDD\|377800	pfam07275, ArdA, Antirestriction protein (ArdA). This family consists of several bacterial antirestriction (ArdA) proteins. ArdA functions in bacterial conjugation to allow an unmodified plasmid to evade restriction in the recipient bacterium and yet acquire cognate modification.	6.53039e-40
LS483410.1\|SQG86215.1\|2325076_2325895_-\|dam-methylase	gnl\|CDD\|182825	PRK10904, PRK10904, adenine-specific DNA-methyltransferase.	1.03134e-118
LS483410.1\|SQG86210.1\|2321758_2322658_+\|putative-integrase	gnl\|CDD\|372340	pfam12835, Integrase_1, Integrase. This is a family of DNA-binding prophage integrases found in Proteobacteria.	8.38322e-11
LS483410.1\|SQG86222.1\|2331577_2332531_-\|transposase-(ISmav2)	gnl\|CDD\|372671	pfam13683, rve_3, Integrase core domain.	2.79146e-16
LS483410.1\|SQG86221.1\|2330820_2331117_+\|putative-toxin-antitoxin-plasmid-stabilization-system-ParE	gnl\|CDD\|226194	COG3668, ParE, Plasmid stabilization system protein [General function prediction only].	3.80144e-18
LS483410.1\|SQG86216.1\|2326480_2327656_-\|transposase-(IS652)	gnl\|CDD\|376574	pfam01610, DDE_Tnp_ISL3, Transposase. Transposase proteins are necessary for efficient DNA transposition. Contains transposases for IS204, IS1001, IS1096 and IS1165.	8.4756e-65
LS483410.1\|SQG86208.1\|2319335_2320304_-\|Protein-of-uncharacterised-function-(DUF3644)	gnl\|CDD\|378842	pfam12358, DUF3644, Protein of unknown function (DUF3644). This domain family is found in bacteria, and is typically between 65 and 80 amino acids in length.	2.39606e-26

>LS483410.1|SQG86215.1|2325076_2325895_-|dam-methylase
MDSITRIRPFLKWAGGKFQIISKIRSSLPEGSRLIEPFLGSGSVFLNTNYEQFLLADINADLINLFQHLKVEKSDFIYFCKKFFNTDSNSQSVYLSLRSEFNSTKDSYLKSALFLYLNRHSFNGLIRYNSSGKFNTAFGDYKQPYFPENEMFTFIQKAEKAEFRCADYKVIMKEAVKGDVIYCDPPYAPLSASANFTKYHSTSFGLEDQRQLVELAKELAAKGVPVIISNHDTTFIQSLYQGSRIVSFDVQRNISCNGSARTRAREVLALFD
>LS483410.1|SQG86214.1|2324574_2325066_-|4-diphosphocytidyl-2-methyl-D-erythritol-synthase
MKQGGSYANSSGGVLEGLVEFALTKKGFTVVRYKDWRLNPSSYSEELLLKNVPYEGLYKHASATEFVLMSKAYNLNTRIECKWQQVSGSVDEKLPYLFLNCSEKMVEPHIIILLDGGGAKPGAIEWLRDACEKFNLKEATTSKRKIDLMSMTEFVQWVNSVFK
>LS483410.1|SQG86213.1|2323924_2324542_-|Uncharacterised-protein
MLEDLNAINSGMVEFGCSLLGKSLYDLTFAPMGGECVHPYAYSSLVQALEILMKAAIAEKHPLLIYEKIPKLTSKNDQLNEFFKKARSRSFLDLPDLLALTTNYQIEYNLLEIAWINRCKIIHIGHSFSLDYTYSGLELTFNVIDPFIYKFWNRSSIDETTSFDSETPIYLVEHCLDYNINFKMRKGQIDKDEDIFPRITEQHYY
>LS483410.1|SQG86212.1|2323316_2323823_+|antirestriction-protein
MDTPQIYVACLAAYNNGILHGEWIDATQDANTIYDEIHEMLAKSPIEDAEEFAIHDFEGFGGAQISEYDSINDVAELASFIMKHGELGAELFSYYSIEDAERMLEENYHGAYDNEVDFARALFDDCYSSTIPEDLLFYFDYEAFARDLFISDYLSVEADGQTHVFSNY
>LS483410.1|SQG86211.1|2323068_2323254_+|Uncharacterised-protein
MENVSSTISRKEYVFFDLACCINEFHALHEELSAQDIEEIKRLSKKLHSLLEDQHPRLNLV
>LS483410.1|SQG86210.1|2321758_2322658_+|putative-integrase
MSNTKLRSAKFSINELVKKAYNHSYASQSDMRHMLFRCVKDLHELGYKIGHIKGLKAKHIYVLVEHWKSEGKNTGTIKNYMAKLRKTACLLDNPMLIKPENGAYNIGQRSYVSSINKAIHHIDLSRCTDPYIRLSLEGQMLFGLRREESMKFTLSEAHHGDSLTIKPSWTKGGIGRTLNITNEAQRQWLTKVSQQVKTGESLIPSNRTYKQHLSHYEEQAKIMGVSKLHGLRHAYAQRRYRELTQLFDSKNKGMLCPFEGGKKFQDMNPIEKAMDRKARQMISLELGHSRISITRIYCG
>LS483410.1|SQG86209.1|2320962_2321766_+|putative-integrase
MRKSQLRQQVDQYCKHNHTGSFRAKKHRHFVLHKMIRDLYHIGHVPSKWHAVTHDHMVRLVAHWQKEEIKPKTIMKYMTLIRRFFQSIDHTIDNISNQNLGIKCAQLRSKTILFPNNHLEILKNPIAKIVIEFQIYFGLTLSEAMRLNPAIHIQENSLWITRDIATNSHDRRIPVRNDKQAQANKTLQTLCKEESLILTFGYHSVRGAYSHAIKKIGLSSSRSYRCFYAKSMYPELCQILSPYLAKQTIMREMGLQSRRTLWSYLHE
>LS483410.1|SQG86208.1|2319335_2320304_-|Protein-of-uncharacterised-function-(DUF3644)
MAKQRKRSVFSIKNELIKKSQEAALAAIQLYNNPLITFKSESFIVLMNIAWTYLLHAYFRKNNVEYRYYNSPKSRKLFIKTKHGAYKYWELEKCLNHESCPLEKAIKDNLLFLIGIRHEIEHQMTSKIDSFFSAKFQACCINYNSTLKNLFGNDYGLEKITPIALQLFSFGESQVDELIEKKELPKNLLDFISDYETDCDSLTDSRYSYRVFYMRINTNHENQADRAYRFIDEKSASGMAIDNILFKYKQYKKLTQNEVIDIIKKQGKNFDKTAHQNLWKRLWKDASTRNIQAKQYGELVVNNQWLWYQETWIPKILELLSE
>LS483410.1|SQG86207.1|2318979_2319189_-|Uncharacterised-protein
MKKLIFILLCFPTMIFANPAQESKNIETFKQLCKNGKDVSMREHYCKLLEQQKKAEAIFKDFEKNKSST
>LS483410.1|SQG86206.1|2318409_2318895_+|Domain-of-uncharacterised-function-(DUF1845)
MKAEITLNLRTREVYKLFERKISGDRLFIDVILHKMNIVIGQNRKPNPMALKMLSEMEQQLNSLTNAFSSEIRRFEELLAKKKEFKDKQINFVVQFHPKIIVCNPLSIKLAELIEVYDQLIATLKLLRLAGCFETDQAYFIHMKQKQKLTNQSLSKIILAE
>LS483410.1|SQG86216.1|2326480_2327656_-|transposase-(IS652)
MPKKDCILNLPGYSIKKVSGENPVYIEVSYRNVVRCIYCGNKKLRKKDSFIRRIRHESIGLRRSYLCIKAHKYYCSVCSRYFNQRFPGIGKYQRASESLRKQVFHYHSKGVSQKDLARDLKLGKSTVERWYHYGYELRYKKIATRSCPRVLGLDEHSFNRKVGYATTFCDLAKHKIFDVVEGRSEKDLEGYLNTLEGKEKVQVVCIDLSSSYRKLIRRYFPNAMIVADRFHVIRLLNQFCLQTYQQIDPEMKYQRGLLAALRTNPNNLSVKRLNKRERYLQQQPVIAALYNFKQRLHRLLMRKHRTAKQCTRLIPLFLKLVASLKESPFESLKTLGRTLYQWREEVVRMWRFTKNNGITEGFHRKMKLIQRRAYGFRNFENYRLRVRVLCG
>LS483410.1|SQG86217.1|2327694_2328825_-|transposase-(IS652)
MPKKDCILNLPGYSIKKVSGENPVYIEVSYRNVVRCIYCGNKKLRKKDSFIRRIRHESIGLRRSYLCIKAHKYYCSVCSRYFNQRFPGIGKYQRASESLRKQVFHYHSKGVSQKDLARDLKLGKSTVERWYHYGYELRYKKIATRSCPRVLGLDEHSFNRKVGYATTFCDLAKHKIFDVVEGRSEKDLEGYLNTLEGKEKVQVVCIDLSSSYRKLIRRYFPNAMIVADRFHVIRLLNQFCLQTYQQIDPEMKYQRGLLAALRTNPNNLSVKRLNKRERYLQQQPVIAALYNFKQRLHRLLMRKHRTAKQCTRLIPLFLKLVASLKESPFESLKTLGRTLYQWREEVVRMWRFTKNNGITEGFRLYPNKGGILIKLV
>LS483410.1|SQG86218.1|2328979_2329558_+|Uncharacterised-protein
MVNITGGNINKKIYDEYLFYYQSRLPKDAHRHAPVLANVSVFLSNPSLITQALAVLEQEVKFLWDFENSTRTADKQLKLNQSIQFCRFMNLLWPVPNEELISNKTNNLLSKVLLYREQKHGFNFDENLSQRPVPTFVGFVDKKEADKVLEKNQLWSEENKLSPLFFHGKETHRLQLNLIMIAVELGLLDIGG
>LS483410.1|SQG86219.1|2329662_2330229_+|Uncharacterised-protein
MNLRHPLILRKTPAIITDNMEHNSQYIYGMDPFYFHSYLMSIARKDYPYLAQCVTEKFCKSAFKLNQIENALGYKYGNDELRALGTNERDIMSTLERLAKAYNTNIHVITSEHILQYQQAKKEGKAFNEVTNSKKLEIRAGTIKSNGFTFKDTVGVVLFKKPYQGWQEYKKHKNSHSIMEASEKKRGI
>LS483410.1|SQG86220.1|2330576_2330831_+|Putative-addiction-module-antidote-protein,-CC2985-family-(containing-the-CopG/Arc/MetJ-DNA-binding-domain)
MTRTMTVDLGNELRNYVESLVRSGDYRSNSEVLRESLRLLREKQAESKLEQLRHLIDEGAASGKPETWDAHDFLKKMKKKSHVK
>LS483410.1|SQG86221.1|2330820_2331117_+|putative-toxin-antitoxin-plasmid-stabilization-system-ParE
MSNKTYRLYPKAVEDLESIYLYSTNEFGIKRTEDYILAIDLSFQRLADDPLIARKCDYIRPELRAFNVGSHIIFFKTTDYGISVIRVLHQSMDFNRHL
>LS483410.1|SQG86222.1|2331577_2332531_-|transposase-(ISmav2)
MANKCLLYAKNSVFLERQVIKIYVRYKESGLEGLNDRSRRPHRYANQLPFQLEKEILKVKKEKPSWGTPKIREKILRQYPDVKPPAISTIHTILDKYGLVTKRKRRHYKAEGTKLTNGKSPNELWCADYKGEFQLGSKEYCYPLAITDFNSRYLLACEGLSITKEQYAITVFERVFKEYGLPNAIRTDNGVPFSSVQALFGLSKLSVWWLRLGISIERIRPGNPQENGRHERMHLTLKKETTKPSGENFLQQQEKFDRFIDEYNNERPHQALDMRYPGEVYVPSNKEYKGLPEVDYPFHDKMIAVTHCGRLCLKGKK
>LS483410.1|SQG86223.1|2332854_2333064_+|Cold-shock-protein
MSKTVNGVVKWFNEIKGFGFIEQEGGPDVFAHFKEISSSGFKTLTEGQRVQFIVTQGAKGLQAQNITAL
>LS483410.1|SQG86224.1|2333303_2334710_+|ATP-dependent-RNA-helicase-DbpA
MIQSEHNDQHLSFSQFPLRQELIKSLASSNYENMTPIQMQSLPIILRNEDIIAQAKTGSGKTAAFALCLLNNLKISFFAVQALVLCPTRELAEQVSQAIRRLACLMPNVKIINLSGGIPMQPQLDSLRHGAHIIVGTPGRILKHLKNASLDLSQVKALVLDEADRMLDMGFFDDIKNIISVCPKQRQTLLFSATYPEEIKRLSKQFMKDPKEVHVVTPPEEIDIEQHFYEVSRHTQKFPLLKSLLLHYRPVSVLIFCNTKQETVEVTDQLINEGFSAIALNGDMEQIERDLAVLRFANQSCSILVATDVAARGLDIKELSAVINFDLAFDHDVHIHRIGRTGRAGSKGIALSIVTPADAQRICAIEDNYPHPIHWRNINELENHNTARLVPEMVTLCIASGKKDKIRPGDILGALTKDAGLASNTIGKINITAMYSYVAIHHSQADKAYQYLQSGKLKGRKVNVRKIN
>LS483410.1|SQG86225.1|2334866_2335778_+|Co/Zn/Cd-cation-transporter
MTIQKGLHERRALKISIAVTFLLAVVGILFGLLSGSLAIVFDGMFNMVDTVISILAFFVARLLTSKGNRRFQYGYWHIEPMVLVLNGSILILLCTYALVNAIGSLMSGGHELNFDYAFVFALLVFFLSTGMYFYLVKTNRKIKSEFLRLDIQSWLMSALISTSLLLAFGIAALLHGGAYGYFTPYIDPLILAILTAFLIFVPMAAVRDAMRDIFRMAPVGLDERIREFLDELIKQHDFKTYTSYVAKIGRAQFIEIHIVVPMDYPISSIETLDKIRNEIALAIGEDTPQRWLTIAFTANENWI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: LS483410_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

LS483410_2

2660381-2660547

Orphan

Consensus_repeat	Method
AAATTTACCGCGATAACAGTAATTT	CRISPRCasFinder

2 spacers

The CRISPR arrays of LS483410_2

>merge|LS483410|2|2660381-2660547|CRISPRCasFinder
AAATTTACCGCGATAACAGTAATTTTATGAGTTTAACATAAATAAATACACTGAAAATTAGAAAGCCGAGTAAATTTACCGCCATAACAGTAATTTATGGGGAATTAATGCAAAAAAATGCAATAATAAATTTATTTTAATCATTTTTACTGCTATAACAGTAATAT

>LS483410|2|2|2660381-2660547|CRISPRCasFinder
AAATTTACCGCGATAACAGTAATTT	TATGAGTTTAACATAAATAAATACACTGAAAATTAGAAAGCCGAGT
AAATTTACCGCCATAACAGTAATTT	ATGGGGAATTAATGCAAAAAAATGCAATAATAAATTTATTTTAATC
ATTTTTACTGCTATAACAGTAATAT

Protein	Signature genes	Signature genes Name	Protein_function
LS483410.1\|SQG86492.1\|2658556_2659030_+\|Uncharacterised-protein	unknown	unknown	unknown
LS483410.1\|SQG86485.1\|2651918_2652179_-\|Rieske-[2Fe-2S]-domain	unknown	unknown	gnl\|CDD\|239560
LS483410.1\|SQG86501.1\|2668374_2669274_-\|Uncharacterised-protein	unknown	unknown	unknown
LS483410.1\|SQG86497.1\|2662158_2664726_+\|magnesium-transporting-ATPase,-P-type	unknown	unknown	gnl\|CDD\|319772
LS483410.1\|SQG86495.1\|2660792_2661101_+\|HipA-protein	unknown	unknown	gnl\|CDD\|274416
LS483410.1\|SQG86489.1\|2655720_2656476_-\|Uncharacterized-protein-yabN	unknown	unknown	gnl\|CDD\|381179
LS483410.1\|SQG86491.1\|2656695_2657922_-\|multidrug-resistance-protein,-MFS-family	unknown	unknown	gnl\|CDD\|340887
LS483410.1\|SQG86493.1\|2659208_2660126_+\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|176109
LS483410.1\|SQG86490.1\|2656478_2656676_-\|Uncharacterised-protein	unknown	unknown	unknown
LS483410.1\|SQG86500.1\|2668053_2668347_-\|SNARE-domain	unknown	unknown	gnl\|CDD\|277194
LS483410.1\|SQG86496.1\|2661097_2662030_+\|HipA-protein	unknown	unknown	gnl\|CDD\|377920
LS483410.1\|SQG86503.1\|2671120_2672029_+\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
LS483410.1\|SQG86488.1\|2654384_2655731_+\|Uncharacterised-protein	unknown	unknown	unknown
LS483410.1\|SQG86499.1\|2665882_2667751_+\|Heavy-metal-translocating-P-type-ATPase	unknown	unknown	gnl\|CDD\|319844
LS483410.1\|SQG86498.1\|2664760_2665705_+\|Uncharacterised-protein-family-(UPF0104)	unknown	unknown	gnl\|CDD\|377103
LS483410.1\|SQG86494.1\|2660568_2660796_+\|putative-DNA-binding-transcriptional-regulator	unknown	unknown	gnl\|CDD\|213767
LS483410.1\|SQG86486.1\|2652181_2653576_-\|Uncharacterised-protein	unknown	unknown	gnl\|CDD\|379634
LS483410.1\|SQG86487.1\|2653580_2654216_-\|Flavin-reductase-like-domain	unknown	unknown	gnl\|CDD\|224766
LS483410.1\|SQG86502.1\|2669435_2670875_+\|symporter	unknown	unknown	unknown
LS483410.1\|SQG86484.1\|2650677_2651886_-\|Uncharacterised-protein	unknown	unknown	gnl\|CDD\|340863

Protein	Function_ID	Function_description	E-value
LS483410.1\|SQG86496.1\|2661097_2662030_+\|HipA-protein	gnl\|CDD\|377920	pfam07804, HipA_C, HipA-like C-terminal domain. The members of this family are similar to a region close to the C-terminus of the HipA protein expressed by various bacterial species. This protein is known to be involved in high-frequency persistence to the lethal effects of inhibition of either DNA or peptidoglycan synthesis. When expressed alone, it is toxic to bacterial cells, but it is usually tightly associated with HipB, and the HipA-HipB complex may be involved in autoregulation of the hip operon. The hip proteins may be involved in cell division control and may interact with cell division genes or their products.	1.81154e-59
LS483410.1\|SQG86495.1\|2660792_2661101_+\|HipA-protein	gnl\|CDD\|274416	TIGR03071, couple_hipA, HipA N-terminal domain. Although Pfam models pfam07805 and pfam07804 currently are called HipA-like N-terminal domain and HipA-like C-terminal domain, respectively, those models hit the central and C-terminal regions of E. coli HipA but not the N-terminal region. This model hits the N-terminal region of HipA and its homologs, and also identifies proteins that lack match regions for pfam07804 and pfam07805.	5.37248e-44
LS483410.1\|SQG86497.1\|2662158_2664726_+\|magnesium-transporting-ATPase,-P-type	gnl\|CDD\|319772	cd02077, P-type_ATPase_Mg, magnesium transporting ATPase (MgtA), similar to Escherichia coli MgtA and Salmonella typhimurium MgtA. MgtA is a membrane protein which actively transports Mg(2+) into the cytosol with its electro-chemical gradient rather than against the gradient as other cation transporters do. It may act both as a transporter and as a sensor for Mg(2+). In Salmonella typhimurium and Escherichia coli, the two-component system PhoQ/PhoP regulates the transcription of the mgtA gene by sensing Mg(2+) concentrations in the periplasm. MgtA is activated by cardiolipin and it highly sensitive to free magnesium in vitro. It consists of a transmembrane domain and three cytosolic domains: nucleotide-binding domain, phosphorylation domain and actuator domain, and belongs to the P-type ATPase type III subfamily. The P-type ATPases, are a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.	0
LS483410.1\|SQG86489.1\|2655720_2656476_-\|Uncharacterized-protein-yabN	gnl\|CDD\|381179	cd19916, OphMA_like, tetrapyrrole methylase family protein similar to Omphalotus olearius omphalotin methyltransferase (OphMA) and Dendrothele bispora dbOphMA. OphMA, is the precursor protein of the fungal cyclic peptide Omphalotin A. Omphalotin A is a potent nematicide, having 9 out of 12 of its residues methylated at the backbone amide. Omphalotin A derives from the C-terminus of OphMA (also known as OphA). OphMA catalyzes the automethylation of its own C-terminus using S-adenosyl methionine (SAM); this C terminus is subsequently released and macrocyclized by the protease OphP to give Omphalotin A.	3.47123e-91
LS483410.1\|SQG86491.1\|2656695_2657922_-\|multidrug-resistance-protein,-MFS-family	gnl\|CDD\|340887	cd17329, MFS_MdtH_MDR_like, Multidrug resistance protein MdtH and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This family is composed of Escherichia coli MdtH and similar multidrug resistance (MDR) transporters from bacteria and archaea, many of which remain uncharacterized. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. MdtH confers resistance to norfloxacin and enoxacin. MdtH-like MDR transporters belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	9.6053e-13
LS483410.1\|SQG86485.1\|2651918_2652179_-\|Rieske-[2Fe-2S]-domain	gnl\|CDD\|239560	cd03478, Rieske_AIFL_N, AIFL (apoptosis-inducing factor like) family, N-terminal Rieske domain; members of this family show similarity to human AIFL, containing an N-terminal Rieske domain and a C-terminal pyridine nucleotide-disulfide oxidoreductase domain (Pyr_redox). The Rieske domain is a [2Fe-2S] cluster binding domain involved in electron transfer. AIFL shares 35% homology with human AIF (apoptosis-inducing factor), mainly in the Pyr_redox domain. AIFL is predominantly localized to the mitochondria. AIFL induces apoptosis in a caspase-dependent manner.	1.28129e-10
LS483410.1\|SQG86500.1\|2668053_2668347_-\|SNARE-domain	gnl\|CDD\|277194	cd15841, SNARE_Qc, SNARE motif, subgroup Qc. SNARE (soluble N-ethylmaleimide-sensitive factor attachment protein receptor) proteins consist of coiled-coil helices (called SNARE motifs) which mediate the interactions between SNARE proteins, and a transmembrane domain. The SNARE complex mediates membrane fusion, important for trafficking of newly synthesized proteins, recycling of pre-existing proteins and organelle formation. SNARE proteins are classified into four groups, Qa-, Qb-, Qc- and R-SNAREs, depending on whether the residue in the hydrophilic center layer of the four-helical bundle is a glutamine (Q) or arginine (R). Qc-, as well as Qa- and Qb-SNAREs, are localized to target organelle membranes, while R-SNARE is localized to vesicle membranes. They form unique complexes consisting of one member of each subgroup, that mediate fusion between a specific type of vesicles and their target organelle. Their SNARE motifs form twisted and parallel heterotetrameric helix bundles. Examples for members of the Qc SNAREs are C-terminal domains of SNAP23 and SNAP25, syntaxin 8, syntaxin 6, and Bet1.	1.22334e-13
LS483410.1\|SQG86498.1\|2664760_2665705_+\|Uncharacterised-protein-family-(UPF0104)	gnl\|CDD\|377103	pfam03706, LPG_synthase_TM, Lysylphosphatidylglycerol synthase TM region. LPG_synthase_TM is the N-terminal region of this family of bacterial phosphatidylglycerol lysyltransferases. The function of the family is to add lysyl groups to membrane lipids, and this region is the transmembrane domain of 7xTMs. In order to counteract attack by membrane-damaging external cationic antimicrobial molecules - from host immune systems, bacteriocins, defencins, etc - bacteria modify their anionic membrane phosphatidylglycerol with positively-charged L-lysine; this results in repulsion of the foreign cationic peptides.	6.70438e-18
LS483410.1\|SQG86503.1\|2671120_2672029_+\|transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.67439e-50
LS483410.1\|SQG86499.1\|2665882_2667751_+\|Heavy-metal-translocating-P-type-ATPase	gnl\|CDD\|319844	cd07544, P-type_ATPase_HM, P-type heavy metal-transporting ATPase; uncharacterized subfamily. Uncharacterized subfamily of the heavy metal-transporting ATPases (Type IB ATPases) which transport heavy metal ions (Cu(+), Cu(2+), Zn(2+), Cd(2+), Co(2+), etc.) across biological membranes. The characteristic N-terminal heavy metal associated (HMA) domain of this group is essential for the binding of metal ions. This subclass of P-type ATPase is also referred to as CPx-type ATPases because their amino acid sequences contain a characteristic CPC or CPH motif associated with a stretch of hydrophobic amino acids and N-terminal ion-binding sequences. This subfamily belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.	0
LS483410.1\|SQG86486.1\|2652181_2653576_-\|Uncharacterised-protein	gnl\|CDD\|379634	pfam14518, Haem_oxygenas_2, Iron-containing redox enzyme. The CADD, Chlamydia protein associating with death domains, crystal structure reveals a dimer of seven-helical bundles. Each bundle contains a di-iron centre adjacent to an internal cavity that forms an active site similar to that of methane mono-oxygenase hydrolase.	1.15645e-28
LS483410.1\|SQG86494.1\|2660568_2660796_+\|putative-DNA-binding-transcriptional-regulator	gnl\|CDD\|213767	TIGR03070, couple_hipB, transcriptional regulator, y4mF family. Members of this family belong to a clade of helix-turn-helix DNA-binding proteins, among the larger family pfam01381 (HTH_3; Helix-turn-helix). Members are similar in sequence to the HipB protein of E. coli. Genes for members of the seed alignment for this protein family were found to be closely linked to genes encoding proteins related to HipA. The HibBA operon appears to have some features in common with toxin-antitoxin post-segregational killing systems. [Regulatory functions, DNA interactions].	1.63778e-24
LS483410.1\|SQG86484.1\|2650677_2651886_-\|Uncharacterised-protein	gnl\|CDD\|340863	cd06173, MFS_MefA_like, Macrolide efflux protein A and similar proteins of the Major Facilitator Superfamily of transporters. This family is composed of Streptococcus pyogenes macrolide efflux protein A (MefA) and similar transporters, many of which remain uncharacterized. Some members may be multidrug resistance (MDR) transporters, which are drug/H+ antiporters (DHAs) that mediate the efflux of a variety of drugs and toxic compounds, conferring resistance to these compounds. MefA confers resistance to 14-membered macrolides including erythromycin and to 15-membered macrolides. It functions as an efflux pump to regulate intracellular macrolide levels. The MefA-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.7029e-13
LS483410.1\|SQG86487.1\|2653580_2654216_-\|Flavin-reductase-like-domain	gnl\|CDD\|224766	COG1853, COG1853, Conserved protein/domain typically associated with flavoprotein oxygenases, DIM6/NTAB family [General function prediction only].	5.31538e-37
LS483410.1\|SQG86493.1\|2659208_2660126_+\|transcriptional-regulator	gnl\|CDD\|176109	cd08417, PBP2_Nitroaromatics_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators that involved in the catabolism of nitroaromatic/naphthalene compounds and that of related regulators; contains the type 2 periplasmic binding fold. This CD includes the C-terminal substrate binding domain of LysR-type transcriptional regulators involved in the catabolism of dinitrotoluene and similar compounds, such as DntR, NahR, and LinR. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded. Also included are related LysR-type regulators clustered together in phylogenetic trees, including NodD, ToxR, LeuO, SyrM, TdcA, and PnbR. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	4.68537e-55

>LS483410.1|SQG86493.1|2659208_2660126_+|transcriptional-regulator
MDKLNLNLLRALYALLTCRHLTLASKKMGISQSSMSIYLKQLREHFHDDLLVRGQGNIMQLTPLANSLIGKARQALSLIETLFNTIETFNPLISERSFSIGMTDLMSILLTPSLIKRLEQEAPGVKLNIKHPSYLNTVEVFESGDIDLMIGMFERVPEGLKQQKLFQDEAVIVGGNNHPGIQKGKICIEELFKYPLIQFSLRETPFYNYFDRYLRQLGHDKRVSISLGQGIMPLFVLTDSHYLTLSIRKVAEKLSHLIPLSIASVPFEVDSFNCYQYWHQKDDADPGHRWLREMVLSIAKKSYLK
>LS483410.1|SQG86492.1|2658556_2659030_+|Uncharacterised-protein
MRSRTEKLSSKRSIINHDHLITDEACMIGIYREGGDLSIYAESSEGIEHFSINRGNSLDMVILPHTLVGTWGHHQLLRTVEQAAQIRALRIRSHDYIEQSVTRKELEQFKEVFMLACKEEISNQPEIEDYLQTALGKLHGEPEMTYKPKFTEQCSIL
>LS483410.1|SQG86491.1|2656695_2657922_-|multidrug-resistance-protein,-MFS-family
MRNFFKNISALYLDVPKLTKTLLPIIILEHLVASFCLNISAYFKKVNYFQYEQIGEFISCYYWGCLFGSLIGGALTLYYKTSKISGWGLMLLGVCLFGLMNSISLWLIAISMFLVGFIGTITATANLTSLIRSVKDNEKLKLKVISLDLIIFNLCFSFVTFVLLDLSPLYILKYVQIMICLLVFVGIGSLIFYQDSIFNPPKLGSLGFKIILPERKQEFMLLMSMVLFFGLIFSMVKVVFAPTLIERFGSNMMSVIAASINPWVVFLIQPLIVGRIKNSNSIWFLGIGGLIVGLSYFMFGMVNSFELTAIVLVLLTFGEMMFGPLSKHFNIQLYRSGQEGVATGIWRAVFLGSGAIGPGLSGYVAEYYGTYVVWDCCALLGLLCFVFSLYLRKIQIKMPYSKLVLDNQ
>LS483410.1|SQG86490.1|2656478_2656676_-|Uncharacterised-protein
MNTYEKLVYLATEPIDNKVVLCDKKGSKLKSSLAVQEELKDEFIHADLSIDIRRACETHLSFVLR
>LS483410.1|SQG86489.1|2655720_2656476_-|Uncharacterized-protein-yabN
MSKLFIAGIGIKFLSHMTLEVQSVIQKCDCVIYLVNEPAIKRWIDENSKKAISLDAIYFSFQERKEAYQAICQEVINIVTKNQNTCFIIYGHPLILSNSAEQLIKEIKEESLDLEIEILPGISSIDTLLCDLCIDPGNGGLQAFEATEFINTNYKINTNSHLILWQIGVVGVKSIIQNDKDLVDSIERKIAIFQLQRKLLDWYNETHPIVLYVASIYPQIPCEKFDICLSNLDKVNIPRLATAYIKPDLIP
>LS483410.1|SQG86488.1|2654384_2655731_+|Uncharacterised-protein
MFTTIDNNEGIVQTYWTEVRNKFEKADPYLSKLIDNVSPDKLPIYLLYFPYGMLKGDTKSSYMPLLDGGYIKLSDTGVDKKIVNDLGYGMYSSPLGMVLDKFIEYFIEFDDKIFTYYISGPGTIFNTGMLLKNKNSRNYSPNGVLKATAGARTAFMLPSINSHNGINKLSKLVNQDLTTPRNHNDHFELFKAINQHDNSNWKVCLAYFSEKWVKHLLTDPAWVEIKNYMLEAKNKNDSFSVNSAYYDIFYSKAQKDRNLRTSSPYLTNTAIHLIKIALGEHPGYVPATTANFLPIESIQKFISESFQLKRTPTIMVPHSLVYEKEKEPVYYSLQNPTTPHFLTKKNEKVTANQEIDIIYRILNKFIEEMSKQDSLLAGTVFSDISDHIRFNYFHNYPPKDSNLINNSRQLSKLDPRFNFSSYKNGESEFCFEGQFLRGCIQIQPNVKE
>LS483410.1|SQG86487.1|2653580_2654216_-|Flavin-reductase-like-domain
MFLQTSQKLPKGMFKACVVPRPIAWIGTKDSEGNHNLSPFSFFNIVCEEPPMVMFATTGAHNSGGAKDTLKNVEDTKEFTVNLVSYGSKEAMNITSLDFSRGISEFDMAEVDHLPSRLIQTPRVKESPISLECVYHESIQLPIPIHSNLINRMVIGKVVGIHLKPEILTKDKRIDTNKLNLIARVGYNSYTKVKAHFDLNRPCGCCNKLMD
>LS483410.1|SQG86486.1|2652181_2653576_-|Uncharacterised-protein
MNKIINKLEANTPSKHIQQHFKELLNIYLHNPCFTDAAFLNPPNPYVRPLRTSDTLNINYDSAVALPEVYTNKNLIINKLLLNIYEQDLLFLANGNACEAKKDFANFYNPYYTAIGKALLPKLEQLAFNFLKDEIEIIGNWTKPKLLDYLINTILEQEKETSELCEAIVGSNNPIRAAKMLLIQMAPDFLSEASAMARALPGSFGIEQSELMKVFIDEYGYGVHETKHSTLFEATMLSANLNPTIHYYYNDYLATSLMLVNYFHCICKNKSDWFKYIGTLYYTEASIPHFNKQISKTLKNILPNINTKYFDEHVHIDKHHRRMVLEKIIATSIDKYGEEIIEDILFGFEAFKLLQNLADTDLAKQIQFSDQLDESYFPSNYTLLAESLTFNETELEITSAHLHADDELFQVTRGELIFYPNSLSPIILKANHRIVIPKGRLHSTVSQSANTQYVVQPIEISTGA
>LS483410.1|SQG86485.1|2651918_2652179_-|Rieske-[2Fe-2S]-domain
MINKKHILNNRYFCKNDENYFIVKLNNKRFAIPDKCPHRGGPLSLGNICRESQRIQCPWHDGYFKISSLIKSAIPAVRVKDQIFYI
>LS483410.1|SQG86484.1|2650677_2651886_-|Uncharacterised-protein
MVRHLKLIIILAFTLAGDILFGLALIWRVLALDGSAKTLGLFLCVITLVTFALQKSSVGFRRMLEKTPRRSFMWIRGVGVGFSIIFIPLLWHETTWLLYLVGAIATIINFLSILTLEAMMAHEVLEKRISSNKASRILQIAILTSSFLGASLLGTILALGNIVAVLLFCIATYLVGAICFSTQSDVGIQKISQVQTAKTASNQKMTYGNNLSVLRLAFIGLTLLMTQISAFNFLLPLIAQHEKFWTASQYGFIDAAAELGGLLATIIMFEKGIFSKLWIFAFLGIALVDILFFAVTDIYLISTATLFLGFCVSCFRIKQREYIYDSVSNTEEILEWTGRITAMTAIIKALTPLGLAFFISQPSFDLMIIGIVVGTVMLIVTSVLYFYTNKEFKQQIPSYSAV
>LS483410.1|SQG86494.1|2660568_2660796_+|putative-DNA-binding-transcriptional-regulator
MPTHEIANLVHYYRKQSGLSQQELAHLAGVGKTVIYDIEKGKESVRLNTLLKVLDVLNIQMKFETPFPQTTDNNS
>LS483410.1|SQG86495.1|2660792_2661101_+|HipA-protein
MRKAYVSVNGIKAGILEELQSGKYQFSYFDDYHGAPVSLTMPLTNKVYDFDVFPPFFEGLLPEGIMLEALLRKYKIDKNDYFGQLIIVGQDVVGAVTIEEIR
>LS483410.1|SQG86496.1|2661097_2662030_+|HipA-protein
MKRCPITYEKISDQENYSQRGLRLLSPQLKNLSPLDLSADEQRQEAIARVGKMSIQGVQKKLSAKLKIKEGSFEIVDQNGHYILKPQSDIYPELPENEAITMTLAKTIGLEVPVHGLVYSKDNSLTYFIKRFDRIGHNKKLALEDFAQLSGEDRHTKYKSSMEKVIAIIEQFCTFPKIEFVKLFKLTLFNFLVGNEDMHLKNFSLITRDRKISISPAYDLLNSTIAQKNTKEEIALPLKGKKNNLTKSDFLNYFAVEKLGLNQNVINGIAQEFHQAIPEWRELISFSFLSQPMQEKYLQLLDQRCKRLNF
>LS483410.1|SQG86497.1|2662158_2664726_+|magnesium-transporting-ATPase,-P-type
MKINLDLNDLSTYDQDLLLNELNSSLEGLNNFQAQKRLTQYGTNEILRKPYHLIIIEAISHSINPLVAILFFAALISAFTGNVVNAAIIISIIIISIGLDYFQSHRALVAIKMLQKKIATTVTVLRENQWLEIPAKELVPGDLFRLSAGDMVPADSILLKSKDLHIHQSALTGESMPVEKEAIPLKTKPKNPLDALNVVFSGSSVIGGSATALAINTGSNSLYGHIAESLKKKPPHTEFEQGMMRFSTFIMKMVFLLVIFVFSINIYMHRPLLDSLLFAVALAVGLTPELLPMITTVTLASGAVRMSKKKVIIKNLSAIQNFGSIDILCSDKTGTLTSGEMNLTKYLDFSGKQSEFVMLLAYLNSVYITEIKSPFNIAVLKKARLNPLDLAILKHDHPDIQPYHKVDEIPFDFERRRSSVIVSKNENHLFICKGAPENIMSVCSYYDFAGERELFTEKEQKQCELLFQSLSSEGYRVLAIAYKLMDRQLKYTQSDEKEMIFAGFLAFTDPLLEDIPKVIKDLRHEGINIKILSGDNLIVTQHICQKVGMDTSRILTGEEISKISDDALPPLAEQIDIYARINPMQKQRIISALKKRGHVVGYLGDGINDVPSLHQADVGISVASAVDIAREAADIVLLEHHLKVLLNGIIEGRKSFRNVMKYLMMGTSSNFGNMISMAIAVLFLPFLPMLPRQILLNNLLYDISQITIPTDHVDPSSIHRYKRLDINIIRQFMFYVGPISSVFDFLTFFVMLKIFSANEALFQTGWFVESLATQTLVIFIIRTAKKPWQSMPSLPLTTTVLLIVMVGIWLPFSPFSGLFGFVPLPPLYFLFLVTATFTYLFLVELIKKKIMRKLY
>LS483410.1|SQG86498.1|2664760_2665705_+|Uncharacterised-protein-family-(UPF0104)
MIKWISGFIILVVLIIVIGHFSQLRVFLGLIEQMKFSWLFFAVIFQSGTYMSLAAVWRLALRWFGEQISFFQLFLLSFSQLFVNQTIPTSGLSGVTIMTKFLLGRLITPKAIALAIALNVFSRQVAYLTSFIASIVVFWFYNELNKTLISLSLIFILIMVAVLILAALLWQQALKLKIPKLLNKYTSIRILINEIKKLDPKIVLNFKLFFPAVVFSVAIFIFDSLTLWTILKSLNLDLNFRLIFAAQVIASSIASLSFFPGGLGIFEGSLTGLLTFLGLSIEQAFTATILFRGFTYWLPMLPGFLLTQKELLRI
>LS483410.1|SQG86499.1|2665882_2667751_+|Heavy-metal-translocating-P-type-ATPase
MNYFFDAIKTKWQFWITIYSIIAIVLYIIMKIINVPYINVPLILIIIIGGLPLFIQISIKLVQGDLGADTLAALSLITGVILHEYLAACLIILMLASGQTLEVYARRKASSVLQALISRMPSKVHIRKNEQITDIPLSETQIGDEIIIYPHETCPVDGEVIDGHGTMDESYLTGEPYLIAKAPGVTVLSGAINGEALLVVKASKRPSDSRYAAIVEVLKEAEQKKPTLRRLGDQIGAIFTPIALFFALLAWYFSGDPIRFLSVLVIATPCPLLIAIPITIISAVSMAAKQAIIIKDPTILERLPTCQTAIFDKTGTLTYGKPTLTKIITTETYSHSDILQYAASLERYSKHPLSNSILDAAKERGLTLLQASEVFEKPGQGLLGKINDHSVQVTSRKKFLAKHPEEVGFLPEHSSGLECLILIDEQFAAVLQFHDAPREESHSFIHHLAPSHQFKKIMLVSGDRESEVKYLGKLLELTEIYSSQSPEQKLKIVRDETRKAPTLYMGDGINDAPALTAATVGIAFGQYSNVTAEAAGAVIMENTLNKVDELMHLSINTRKIALQSAIGGMLLSIIGMSFAALGFINPVTGAILQELIDILAIINALQLTWGSRVKIDLPGYKA
>LS483410.1|SQG86500.1|2668053_2668347_-|SNARE-domain
MKKNSSTKKILSSLSDTELQEKQELMMSEQDEQLDILLKTVTRTHEIAEAIQEELTSQNKLIDGLNEHVEKTDGKVKNTTKKVEALIPEVRSSCFLM
>LS483410.1|SQG86501.1|2668374_2669274_-|Uncharacterised-protein
MFSPLQDPWSELEELGFNPEYLKRLKERAATSIEMTKNIEMLADYYEQFKEVGFTDSDLARIVSLVSFTADNRLANIGSRMMITLVCGGLNLVKAPLHFKPHKLTNMMLSLNGLEKLRTLVEMSKESGFTPLKNQAEFKAIFEKRCKKFPMLRVLWCYSDANESYMEYRKQDAIYKDWLSEEELHQLNRLSRISKTRDLHYWKRDTVRPVLLGDNYYSREDFGQTREEFEKAQDNPDAVESWCDSWANPFDQNPDSALTQSQEKSNQRNASKIPFFTVYENNGKSGVVDEQQSSNAFSN
>LS483410.1|SQG86502.1|2669435_2670875_+|symporter
MENKTKALNFLNRIERCLVPQSNPQIMKQLLSALGLDKLTTGNEEYKFFIQTIKKKSIDLNPLISKVKSDILNNDPLWTLLDYIEANELIDDAEIENASSTIQLQINLLCLLEAITITMANSNDFAHDIYNHMMKQRGKGATGNPFYNFLFGIPSRATLFERLKLISIDPGLTSIIFHRQMGENPETQADLDDFVSQNSLSGWNADIELANFDVASTSTLPAMGVNILEAVWEDATGHNKNTGGILNAQAGLGLIRVMEEQEYTTSFKLAETTLPQGTTLHSDFGYSLIPELKVDNSPKKVSQFHIDKQWMNLYNSWNLLFVIGNIDSVFVPLKLLMPSVFSAEPSNYKETRVLTLFLVANLFLNQQTLNNPLFSNNFSFRNGTVIMKKWGEINKNHASELLQQCKELDDLYNHVLGKNPHLNFGLKLFSYFQDSHQFRLTKKAQPSTSIDYSFFSGNTPSENNSEKMGVALHSSLYTK
>LS483410.1|SQG86503.1|2671120_2672029_+|transcriptional-regulator
MNILSCLKGFITTVDCKSFSKAAQKLYISPSKLSKQITWLEEELKVTLLIRSTTRLTVTDSGHRLYEKSLQLFEQLEAVKVIATPDQLELNGVIRLYLTVTPAIPYLTTLSIQFMRQYPKIEVDIIVGSDTKELYSSTFDLAISFDDVKHSKLVCKRLFSIQRKVFASPGYIAQHGLPQTLDELPKHNCLINTLYGLQNKWVFNKKIIHVSGNFKSNNAGVLKQAAVADVGILWAPYFSVYEEIKNETLIPVLPQESSPDINLYAICPKSTVDEQKINLLLNFFCEKALSENIATSFIDGNN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

932336 : 939175

Acinetobacter_phage(42.86%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
SQG84962.1\|932336_933113_-	indole-3-glycerol phosphate synthase	A0A0P0IR83	Acinetobacter_phage	2.5e-57	48.2
SQG84963.1\|933105_934140_-	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	1.2e-75	47.6
SQG84964.1\|934117_934696_-	anthranilate synthase component II	A0A0P0IKJ1	Acinetobacter_phage	1.3e-55	53.2
SQG84965.1\|934729_935455_-	ABC-type transport system protein involved in lipoprotein release, ATPase compnent	G9BWD6	Planktothrix_phage	3.1e-17	28.3
SQG84966.1\|935451_935961_-	lipopolysaccharide export system protein LptA	NA	NA	NA	NA
SQG84967.1\|935941_936511_-	Uncharacterized protein YrbK clustered with lipopolysaccharide transporters	NA	NA	NA	NA
SQG84968.1\|936507_937035_-	hydrolase	A0A140XBD6	Dickeya_phage	1.4e-27	47.7
SQG84969.1\|937048_938011_-	polysialic acid capsule expression protein	A0A2P0VNK5	Tetraselmis_virus	4.2e-38	34.1
SQG84970.1\|938377_939175_+	putative ABC transport system ATP-binding protein	G9BWD6	Planktothrix_phage	1.3e-21	33.8

DBSCAN-SWA_2

1312671 : 1318608

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
SQG85316.1\|1312671_1313745_+	riboflavin biosynthesis protein	A0A2H4PQS8	Staphylococcus_phage	3.6e-30	28.6
SQG85317.1\|1313729_1314344_+	riboflavin synthase subunit alpha	A0A2I2L4R9	Orpheovirus	1.3e-21	38.4
SQG85318.1\|1314340_1315549_+	Riboflavin biosynthesis protein	A0A2H4PQS2	Staphylococcus_phage	4.5e-98	48.5
SQG85319.1\|1315556_1316024_+	riboflavin synthase subunit beta	A0A2H4PQS3	Staphylococcus_phage	9.2e-23	49.1
SQG85320.1\|1316149_1317787_+	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	2.7e-154	52.5
SQG85321.1\|1317783_1318608_+	2-dehydro-3-deoxyphosphooctonate aldolase	E3T537	Cafeteria_roenbergensis_virus	1.8e-53	43.9

DBSCAN-SWA_3

2096351 : 2127366

unidentified_phage(28.57%)

integrase,tRNA,protease,transposase

attL 2111733:2111750|attR 2133425:2133442

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
SQG86003.1\|2096351_2097845_-\|tRNA	glutamate tRNA synthetase catalytic subunit	NA	NA	NA	NA
SQG86004.1\|2097865_2098708_+	sensory box histidine kinase/response regulator	NA	NA	NA	NA
SQG86005.1\|2098745_2100566_+	sensory box histidine kinase/response regulator	A0A1V0SGX0	Hokovirus	1.4e-50	32.6
SQG86006.1\|2100662_2101907_+	6-phosphofructokinase	NA	NA	NA	NA
SQG86007.1\|2101903_2102317_-	fimbrial protein, type IV pilin, PilE	NA	NA	NA	NA
SQG86008.1\|2102509_2102920_-	type IV pilus assembly protein PilA	NA	NA	NA	NA
SQG86009.1\|2103222_2103540_+	putative regulator of murein genes BolA	NA	NA	NA	NA
SQG86010.1\|2103614_2105036_+	Glutamate/gamma-aminobutyrate antiporter	NA	NA	NA	NA
SQG86011.1\|2105133_2106564_-	Dot/Icm secretion system substrate	A0A248SL44	Klebsiella_phage	7.0e-05	31.0
SQG86012.1\|2106811_2107564_-	3-deoxy-manno-octulosonate cytidylyltransferase	NA	NA	NA	NA
SQG86013.1\|2107560_2107740_-	tetraacyldisaccharide-1-P-4'-kinase	NA	NA	NA	NA
SQG86014.1\|2107732_2108404_-\|protease	glycoprotease (O-sialoglycoprotein endopeptidase)	NA	NA	NA	NA
SQG86015.1\|2108381_2110340_-	ATP dependent DNA helicase (DEAD box family) Rad3	A0A127AW80	Bacillus_phage	7.7e-87	31.5
SQG86016.1\|2110327_2110663_-	ferredoxin II (4Fe-4S)	NA	NA	NA	NA
SQG86017.1\|2110945_2113735_+	protein kinase domain containing protein	NA	NA	NA	NA
2111733:2111750	attL	NA	NA	NA	NA
SQG86018.1\|2114037_2116683_+	coiled-coil protein	NA	NA	NA	NA
SQG86019.1\|2116758_2117316_+	type IV pilus assembly PilZ	NA	NA	NA	NA
SQG86020.1\|2117391_2117661_+	protein that protects iron-sulfur proteins against oxidative damage	NA	NA	NA	NA
SQG86021.1\|2117672_2118599_+	indigoidine synthase A-like protein involved in pigment biosynthesis	NA	NA	NA	NA
SQG86022.1\|2118765_2119008_-\|transposase	IS30B/C/D transposase	H7BVY4	unidentified_phage	7.4e-08	37.1
SQG86023.1\|2119044_2120220_-\|transposase	transposase (IS652)	A9YX10	Burkholderia_phage	2.7e-15	23.2
SQG86024.1\|2120258_2121035_-\|integrase	integrase catalytic subunit	H7BUM7	unidentified_phage	2.3e-18	28.4
SQG86025.1\|2121178_2121904_+	Uncharacterised protein	NA	NA	NA	NA
SQG86026.1\|2122336_2124703_+	Ankyrin repeat protein	NA	NA	NA	NA
SQG86027.1\|2124925_2125960_+\|transposase	transposase, ISSod13	A0A077SLK2	Escherichia_phage	1.6e-155	76.8
SQG86028.1\|2126256_2127366_-\|transposase	Putative transposase	NA	NA	NA	NA
2133425:2133442	attR	NA	NA	NA	NA

DBSCAN-SWA_4

2240443 : 2250571

Bacillus_phage(16.67%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
SQG86130.1\|2240443_2242132_-\|protease	AprE, Subtilisin-like serine protease	A0A1B0T6A2	Bacillus_phage	6.1e-16	30.4
SQG86131.1\|2242263_2243271_-	transcriptional regulator OruR, AraC family	NA	NA	NA	NA
SQG86132.1\|2243394_2244720_-	adenosylhomocysteinase	S4VPF6	Pandoravirus	1.8e-47	31.2
SQG86133.1\|2244738_2245887_-	S-adenosylmethionine synthetase	A0A2H4PQS6	Staphylococcus_phage	1.2e-127	58.7
SQG86134.1\|2246100_2247213_-	carbamoyl phosphate synthase, small subunit	R4TGJ8	Halovirus	3.8e-51	35.2
SQG86135.1\|2247308_2248448_-	heat shock protein DnaJ, chaperone protein	A0A1V0SBY2	Catovirus	1.6e-23	26.9
SQG86136.1\|2248636_2250571_-	molecular chaperone DnaK	G8DDB7	Micromonas_pusilla_virus	1.3e-147	49.6

DBSCAN-SWA_5

2280932 : 2332531

Streptococcus_phage(25.0%)

integrase,transposase

attL 2280843:2280889|attR 2326330:2326376

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2280843:2280889	attL	NA	NA	NA	NA
SQG86166.1\|2280932_2282093_-\|integrase	integrase	A0A059VF45	Pseudomonas_phage	1.5e-85	45.8
SQG86167.1\|2282427_2283432_-	protein of uncharacterised function DUF1016	Q9JMP5	Wolbachia_phage	8.0e-48	32.9
SQG86168.1\|2283452_2283935_-	putative Acyl-CoA N-acyltransferase	NA	NA	NA	NA
SQG86169.1\|2283951_2285226_-	proline betaine transport protein like protein	NA	NA	NA	NA
SQG86170.1\|2285203_2285716_-	N-acetyltransferase ats1	NA	NA	NA	NA
SQG86171.1\|2285757_2286441_+	lipolytic protein	NA	NA	NA	NA
SQG86172.1\|2286467_2287271_+	lipolytic enzyme / transcription regulator protein	NA	NA	NA	NA
SQG86173.1\|2287354_2287594_+	Uncharacterised protein	NA	NA	NA	NA
SQG86174.1\|2287719_2287917_+	Uncharacterised protein	NA	NA	NA	NA
SQG86175.1\|2287945_2288341_+	Uncharacterized conserved protein	NA	NA	NA	NA
SQG86176.1\|2288355_2290263_-	cadmium efflux ATPase	E4ZFI9	Streptococcus_phage	6.6e-144	45.5
SQG86177.1\|2290832_2291003_-	Uncharacterised protein	NA	NA	NA	NA
SQG86178.1\|2291267_2293403_-	cadmium translocating P-type ATPase CadA	E4ZFI9	Streptococcus_phage	1.0e-145	42.0
SQG86179.1\|2293479_2296629_-	cobalt/zinc/cadmium efflux RND transporter, permease HelA	NA	NA	NA	NA
SQG86180.1\|2296638_2297895_-	cation efflux system HelB	NA	NA	NA	NA
SQG86181.1\|2297891_2299136_-	cobalt/zinc/cadmium efflux RND transporter, outer membrane protein	NA	NA	NA	NA
SQG86182.1\|2299399_2300062_-	phage repressor	NA	NA	NA	NA
SQG86183.1\|2300246_2301119_+	lvrA	NA	NA	NA	NA
SQG86184.1\|2301063_2301447_+	virB	NA	NA	NA	NA
SQG86185.1\|2301466_2301664_+	vir region protein	NA	NA	NA	NA
SQG86186.1\|2301660_2302095_+	integrating conjugative element protein PilL, PFGI-1 class	NA	NA	NA	NA
SQG86187.1\|2302091_2302706_+	Uncharacterised protein	NA	NA	NA	NA
SQG86188.1\|2302698_2303535_+	bile acid beta-glucosidase	NA	NA	NA	NA
SQG86189.1\|2303536_2303995_+	integrating conjugative element protein, PFL_4695 family	NA	NA	NA	NA
SQG86190.1\|2303985_2304684_+	Fe2+/Zn2+ uptake regulation protein	NA	NA	NA	NA
SQG86191.1\|2304693_2305017_+	Uncharacterised protein	NA	NA	NA	NA
SQG86192.1\|2305019_2305283_+	Uncharacterised protein	NA	NA	NA	NA
SQG86193.1\|2305285_2305672_+	Uncharacterised protein	NA	NA	NA	NA
SQG86194.1\|2305680_2306031_+	conjugative transfer region protein	NA	NA	NA	NA
SQG86195.1\|2306035_2306698_+	integrating conjugative element protein, PFL_4703 family	NA	NA	NA	NA
SQG86196.1\|2306684_2307467_+	integrating conjugative element protein, PFL_4704 family	NA	NA	NA	NA
SQG86197.1\|2307463_2308777_+	membrane protein	NA	NA	NA	NA
SQG86198.1\|2308733_2309123_+	putative lipoprotein	NA	NA	NA	NA
SQG86199.1\|2309133_2311908_+	Type IV secretory protein VirB4 components	NA	NA	NA	NA
SQG86200.1\|2311882_2312878_+	integrating conjugative element protein, PFL_4710 family	NA	NA	NA	NA
SQG86201.1\|2312887_2314270_+	Tfp pilus assembly, pilus retraction ATPase PilT	NA	NA	NA	NA
SQG86202.1\|2314271_2315840_+	membrane protein	NA	NA	NA	NA
SQG86203.1\|2315842_2316052_-	Uncharacterised protein	NA	NA	NA	NA
SQG86204.1\|2316065_2316398_+	Uncharacterised protein	NA	NA	NA	NA
SQG86205.1\|2316401_2318408_+	conjugative coupling factor TraD	NA	NA	NA	NA
SQG86206.1\|2318409_2318895_+	Domain of uncharacterised function (DUF1845)	NA	NA	NA	NA
SQG86207.1\|2318979_2319189_-	Uncharacterised protein	NA	NA	NA	NA
SQG86208.1\|2319335_2320304_-	Protein of uncharacterised function (DUF3644)	NA	NA	NA	NA
SQG86209.1\|2320962_2321766_+\|integrase	putative integrase	NA	NA	NA	NA
SQG86210.1\|2321758_2322658_+\|integrase	putative integrase	NA	NA	NA	NA
SQG86211.1\|2323068_2323254_+	Uncharacterised protein	NA	NA	NA	NA
SQG86212.1\|2323316_2323823_+	antirestriction protein	U5P3Z5	Mycobacterium_phage	4.2e-21	39.5
SQG86213.1\|2323924_2324542_-	Uncharacterised protein	NA	NA	NA	NA
SQG86214.1\|2324574_2325066_-	4-diphosphocytidyl-2-methyl-D-erythritol synthase	NA	NA	NA	NA
SQG86215.1\|2325076_2325895_-	dam methylase	A0A1S6L1V5	Vibrio_phage	1.4e-63	47.1
SQG86216.1\|2326480_2327656_-\|transposase	transposase (IS652)	A9YX10	Burkholderia_phage	2.7e-15	23.2
2326330:2326376	attR	NA	NA	NA	NA
SQG86217.1\|2327694_2328825_-\|transposase	transposase (IS652)	A0A2D1GQC1	Lysinibacillus_phage	1.3e-06	18.5
SQG86218.1\|2328979_2329558_+	Uncharacterised protein	NA	NA	NA	NA
SQG86219.1\|2329662_2330229_+	Uncharacterised protein	NA	NA	NA	NA
SQG86220.1\|2330576_2330831_+	Putative addiction module antidote protein, CC2985 family (containing the CopG/Arc/MetJ DNA-binding domain)	NA	NA	NA	NA
SQG86221.1\|2330820_2331117_+	putative toxin antitoxin plasmid stabilization system ParE	NA	NA	NA	NA
SQG86222.1\|2331577_2332531_-\|transposase	transposase (ISmav2)	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. LS483410

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection