CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
LR130534	Pseudomonas aeruginosa isolate paerg005 genome assembly, chromosome: 0	2 crisprs	csa3,DEDDh,cas3,PD-DExK,DinG,WYL	0	1	10	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: LR130534_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

LR130534_1

417864-417977

Orphan

Consensus_repeat	Method
GGCCAAAGAACTGGAGGGCAAGGTATGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of LR130534_1

>merge|LR130534|1|417864-417977|CRISPRCasFinder
GGCCAAAGAACTGGAGGGCAAGGTATGAGCCAGCACAGCGTATCCCGCTCCGTATCCCGTTCAACAGGCTCTCCATCCAGAAGCGTGGCCAAAGAACTGGAGGGCAAGGTATGA

>LR130534|1|1|417864-417977|CRISPRCasFinder
GGCCAAAGAACTGGAGGGCAAGGTATGA	GCCAGCACAGCGTATCCCGCTCCGTATCCCGTTCAACAGGCTCTCCATCCAGAAGCGT
GGCCAAAGAACTGGAGGGCAAGGTATGA

Protein	Signature genes	Signature genes Name	Protein_function
LR130534.1\|VDL23789.1\|426944_427034_+\|hypothetical-protein	unknown	unknown	unknown
LR130534.1\|VDL23739.1\|410244_411603_+\|Gamma-glutamylputrescine-synthetase-PuuA	unknown	unknown	gnl\|CDD\|223252
LR130534.1\|VDL23792.1\|427147_427642_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224597
LR130534.1\|VDL23744.1\|411668_413039_+\|putative-aminotransferase	unknown	unknown	gnl\|CDD\|180994
LR130534.1\|VDL23768.1\|421518_422571_+\|HTH-type-transcriptional-regulator-GadX	unknown	unknown	gnl\|CDD\|378890
LR130534.1\|VDL23724.1\|405754_406276_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|380058
LR130534.1\|VDL23781.1\|424806_425559_-\|hypothetical-protein	unknown	unknown	unknown
LR130534.1\|VDL23786.1\|426327_426882_-\|hypothetical-protein	unknown	unknown	unknown
LR130534.1\|VDL23778.1\|423845_424787_+\|Monoacylglycerol-lipase	unknown	unknown	gnl\|CDD\|225176
LR130534.1\|VDL23774.1\|423157_423769_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|239267
LR130534.1\|VDL23730.1\|407796_409173_-\|Gamma-glutamylputrescine-synthetase-PuuA	unknown	unknown	gnl\|CDD\|223252
LR130534.1\|VDL23747.1\|413154_414258_+\|Putrescine-binding-periplasmic-protein-SpuD	unknown	unknown	gnl\|CDD\|270377
LR130534.1\|VDL23753.1\|415828_416983_+\|ole(C)_1_L06249	unknown	unknown	gnl\|CDD\|183226
LR130534.1\|VDL23750.1\|414676_415774_+\|Spermidine-binding-periplasmic-protein-SpuE	unknown	unknown	gnl\|CDD\|270377
LR130534.1\|VDL23727.1\|406295_407540_-\|Putrescine-binding-periplasmic-protein-SpuD	unknown	unknown	gnl\|CDD\|270377
LR130534.1\|VDL23721.1\|404713_405592_-\|N-carbamoyl-D-amino-acid-hydrolase	unknown	unknown	gnl\|CDD\|274553
LR130534.1\|VDL23771.1\|422549_423053_-\|hypothetical-protein	unknown	unknown	unknown
LR130534.1\|VDL23765.1\|419020_421408_-\|Acyl-homoserine-lactone-acylase-QuiP	unknown	unknown	gnl\|CDD\|225241
LR130534.1\|VDL23734.1\|409451_410204_+\|Gamma-glutamyl-gamma-aminobutyrate-hydrolase-PuuD	unknown	unknown	gnl\|CDD\|336781
LR130534.1\|VDL23783.1\|425676_426306_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226274

Protein	Function_ID	Function_description	E-value
LR130534.1\|VDL23739.1\|410244_411603_+\|Gamma-glutamylputrescine-synthetase-PuuA	gnl\|CDD\|223252	COG0174, GlnA, Glutamine synthetase [Amino acid transport and metabolism].	5.71424e-158
LR130534.1\|VDL23744.1\|411668_413039_+\|putative-aminotransferase	gnl\|CDD\|180994	PRK07480, PRK07480, putative aminotransferase; Validated.	0
LR130534.1\|VDL23768.1\|421518_422571_+\|HTH-type-transcriptional-regulator-GadX	gnl\|CDD\|378890	pfam12625, Arabinose_bd, Arabinose-binding domain of AraC transcription regulator, N-term. AraC is a bacterial transcriptional regulatory protein with a DNA-binding domain at the C-terminus, HTH_AraC, pfam00165, and this dimerization domain which harbours the arabinose-binding pocket at the N-terminus. AraC positively and negatively regulates expression of the proteins required for the uptake and catabolism of the sugar L-arabinose 1,2,3].	3.71146e-31
LR130534.1\|VDL23724.1\|405754_406276_-\|hypothetical-protein	gnl\|CDD\|380058	pfam17928, TetR_C_22, Tetracyclin repressor-like, C-terminal domain. TetR family regulators are involved in the transcriptional control of multidrug efflux pumps, pathways for the biosynthesis of antibiotics, response to osmotic stress and toxic chemicals, control of catabolic pathways, differentiation processes, and pathogenicity. The TetR proteins identified in overm ultiple genera of bacteria and archaea share a common helix-turn-helix (HTH) structure in their DNA-binding domain. However, TetR proteins can work in different ways: they can bind a target operator directly to exert their effect (e.g. TetR binds Tet(A) gene to repress it in the absence of tetracycline), or they can be involved in complex regulatory cascades in which the TetR protein can either be modulated by another regulator or TetR can trigger the cellular response. TetR regulates the expression of the membrane-associated tetracycline resistance protein, TetA, which exports the tetracycline antibiotic out of the cell before it can attach to the ribosomes and inhibit protein synthesis. TetR blocks transcription from the genes encoding both TetA and TetR in the absence of antibiotic. The C-terminal domain is multi-helical and is interlocked in the homodimer with the helix-turn-helix (HTH) DNA-binding domain. This entry represents the C-terminal domain present the TetR Transcriptional Repressor present in sco1712 proteins from Streptomyces coelicolo which act as a regulator of antibiotic production.	0.000170133
LR130534.1\|VDL23778.1\|423845_424787_+\|Monoacylglycerol-lipase	gnl\|CDD\|225176	COG2267, PldB, Lysophospholipase [Lipid metabolism].	8.35254e-56
LR130534.1\|VDL23774.1\|423157_423769_-\|hypothetical-protein	gnl\|CDD\|239267	cd02969, PRX_like1, Peroxiredoxin (PRX)-like 1 family; hypothetical proteins that show sequence similarity to PRXs. Members of this group contain a conserved cysteine that aligns to the first cysteine in the CXXC motif of TRX. This does not correspond to the peroxidatic cysteine found in PRXs, which aligns to the second cysteine in the CXXC motif of TRX. In addition, these proteins do not contain the other two conserved residues of the catalytic triad of PRX. PRXs confer a protective antioxidant role in cells through their peroxidase activity in which hydrogen peroxide, peroxynitrate, and organic hydroperoxides are reduced and detoxified using reducing equivalents derived from either thioredoxin, glutathione, trypanothione and AhpF.	0.0067766
LR130534.1\|VDL23730.1\|407796_409173_-\|Gamma-glutamylputrescine-synthetase-PuuA	gnl\|CDD\|223252	COG0174, GlnA, Glutamine synthetase [Amino acid transport and metabolism].	1.09186e-161
LR130534.1\|VDL23747.1\|413154_414258_+\|Putrescine-binding-periplasmic-protein-SpuD	gnl\|CDD\|270377	cd13659, PBP2_PotF, The periplasmic substrate-binding component of an ABC putrescine transport system and related proteins; contains the type 2 periplasmic-binding fold. This group represents the periplasmic substrate-binding domain that serves as the primary polyamine receptor of ABC-type putrescine-preferential transporter from gram-negative bacteria. Polyamine transport plays an essential role in the regulation of intracellular polyamine levels which are known to be elevated in rapidly proliferating cells and tumors. Natural polyamines are putrescine, spermindine, and spermine. They are polycations that play multiple roles in cell growth, survival and proliferation, and plant stress and disease resistance. They can interact with negatively charged molecules, such as nucleic acids, to modulate their functions. Members of this family belong to the type 2 periplasmic-binding fold superfamily. PBP2 is comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	0
LR130534.1\|VDL23753.1\|415828_416983_+\|ole(C)_1_L06249	gnl\|CDD\|183226	PRK11607, potG, putrescine ABC transporter ATP-binding subunit PotG.	0
LR130534.1\|VDL23750.1\|414676_415774_+\|Spermidine-binding-periplasmic-protein-SpuE	gnl\|CDD\|270377	cd13659, PBP2_PotF, The periplasmic substrate-binding component of an ABC putrescine transport system and related proteins; contains the type 2 periplasmic-binding fold. This group represents the periplasmic substrate-binding domain that serves as the primary polyamine receptor of ABC-type putrescine-preferential transporter from gram-negative bacteria. Polyamine transport plays an essential role in the regulation of intracellular polyamine levels which are known to be elevated in rapidly proliferating cells and tumors. Natural polyamines are putrescine, spermindine, and spermine. They are polycations that play multiple roles in cell growth, survival and proliferation, and plant stress and disease resistance. They can interact with negatively charged molecules, such as nucleic acids, to modulate their functions. Members of this family belong to the type 2 periplasmic-binding fold superfamily. PBP2 is comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	0
LR130534.1\|VDL23727.1\|406295_407540_-\|Putrescine-binding-periplasmic-protein-SpuD	gnl\|CDD\|270377	cd13659, PBP2_PotF, The periplasmic substrate-binding component of an ABC putrescine transport system and related proteins; contains the type 2 periplasmic-binding fold. This group represents the periplasmic substrate-binding domain that serves as the primary polyamine receptor of ABC-type putrescine-preferential transporter from gram-negative bacteria. Polyamine transport plays an essential role in the regulation of intracellular polyamine levels which are known to be elevated in rapidly proliferating cells and tumors. Natural polyamines are putrescine, spermindine, and spermine. They are polycations that play multiple roles in cell growth, survival and proliferation, and plant stress and disease resistance. They can interact with negatively charged molecules, such as nucleic acids, to modulate their functions. Members of this family belong to the type 2 periplasmic-binding fold superfamily. PBP2 is comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	6.92869e-161
LR130534.1\|VDL23721.1\|404713_405592_-\|N-carbamoyl-D-amino-acid-hydrolase	gnl\|CDD\|274553	TIGR03381, putative_carbon-nitrogen_hydrolase, N-carbamoylputrescine amidase. Members of this family are N-carbamoylputrescine amidase (3.5.1.53). Bacterial genes are designated AguB. The AguAB pathway replaces SpeB for conversion of agmatine to putrescine in two steps rather than one. [Central intermediary metabolism, Polyamine biosynthesis].	0
LR130534.1\|VDL23792.1\|427147_427642_+\|hypothetical-protein	gnl\|CDD\|224597	COG1683, COG1683, Uncharacterized conserved protein [Function unknown].	1.65548e-66
LR130534.1\|VDL23765.1\|419020_421408_-\|Acyl-homoserine-lactone-acylase-QuiP	gnl\|CDD\|225241	COG2366, COG2366, Protein related to penicillin acylase [General function prediction only].	0
LR130534.1\|VDL23734.1\|409451_410204_+\|Gamma-glutamyl-gamma-aminobutyrate-hydrolase-PuuD	gnl\|CDD\|336781	pfam07722, Peptidase_C26, Peptidase C26. These peptidases have gamma-glutamyl hydrolase activity; that is they catalyze the cleavage of the gamma-glutamyl bond in poly-gamma-glutamyl substrates. They are structurally related to pfam00117, but contain extensions in four loops and at the C-terminus.	1.81471e-108
LR130534.1\|VDL23783.1\|425676_426306_+\|hypothetical-protein	gnl\|CDD\|226274	COG3751, EGL-9, Predicted proline hydroxylase [Posttranslational modification, protein turnover, chaperones].	3.27136e-68

>LR130534.1|VDL23753.1|415828_416983_+|ole(C)_1_L06249
MAIASGAYKKALEGNQQPKEVLVKIDRVTKQFDETLAVDTVSLTINKGEIFALLGGSGSGKSTLLRMLAGFERPTEGRIFLDGQDITDLPPYERPINMMFQSYALFPHMSVAQNIAFGLKQDGLPKAEIDERVAEMLKLVHMTQYAKRKPHQLSGGQRQRVALARSLAKRPKLLLLDEPMGALDKKLRSQMQLELVEIIERVGVTCVMVTHDQEEAMTMAQRIAIMHLGCIEQIGSPMDIYETPASRLVCEFIGNVNLFDGVLVEDVQDHAVIACPQLENPIYIGHGISTRAEDKRITYALRPEKVMISAQKPDNLEHAGHNWAQGTVYDIAYLGGHSVYYIKLASGMIVQAFMANAERHVARPTWDQSVYISWYDDSGVVLQS
>LR130534.1|VDL23750.1|414676_415774_+|Spermidine-binding-periplasmic-protein-SpuE
MQHSIGKTLLVAALATAIAGPVQAEKKSLHIYNWTDYIAPTTLKDFTKESGIDVSYDVFDSNETLEGKLVSGHSGYDIVVPSNNFLGKQIQAGAFQKLDKSKLPNWKNLDPALLKQLEVSDPGNQYAVPYLWGTNGIGYNVAKVKEVLGDQPIDSWAILFEPENMKKLAKCGVAFMDSGDEMLPAALNYLGLDPNTHDPKDYKKAEEVLTKVRPYVSYFHSSKYISDLANGNICVAFGYSGDVFQAAARAEEAGKGIDIQYVIPKEGANLWFDLMAIPADAKAADNAYAFIDYLLRPEVIAKVSDYVGYANVIPGARPLMDKSVSDSEEVYPPQAVLDKLYVSAVLPAKVLRLQTRTWTRIKTGK
>LR130534.1|VDL23747.1|413154_414258_+|Putrescine-binding-periplasmic-protein-SpuD
MMKRFGKTLLALTLAGSVAGMAQAADNKVLHVYNWSDYIAPDTLEKFTKETGIKVVYDVYDSNEVLEAKLLAGKSGYDVVVPSNSFLAKQIKAGVYQKLDKSKLPNWKNLNKDLMHTLEVSDPGNEHAIPYMWGTIGIGYNPDKVKAAFGDNAPVDSWDLVFKPENIQKLKQCGVSFLDSPTEILPAALHYLGYKPDTDNPKELKAAEELFLKIRPYVTYFHSSKYISDLANGNICVAIGYSGDIYQAKSRAEEAKNKVTVKYNIPKEGAGSFFDMVAIPKDAENTEGALAFVNFLMKPEIMAEITDVVQFPNGNAAATPLVSEAIRNDPGIYPSEEVMKKLYTFPDLPAKTQRAMTRSWTKIKSGK
>LR130534.1|VDL23744.1|411668_413039_+|putative-aminotransferase
MNSQITNAKTREWQALSRDHHLPPFTDYKQLNEKGARIITKAEGVYIWDSEGNKILDAMAGLWCVNVGYGREELVQAATRQMRELPFYNLFFQTAHPPVVELAKAIADVAPEGMNHVFFTGSGSEANDTVLRMVRHYWATKGQPQKKVVIGRWNGYHGSTVAGVSLGGMKALHEQGDFPIPGIVHIAQPYWYGEGGDMSPDEFGVWAAEQLEKKILEVGEENVAAFIAEPIQGAGGVIVPPDTYWPKIREILAKYDILFIADEVICGFGRTGEWFGSQYYGNAPDLMPIAKGLTSGYIPMGGVVVRDEIVEVLNQGGEFYHGFTYSGHPVAAAVALENIRILREEKIIEKVKAETAPYLQKRWQELADHPLVGEARGVGMVAALELVKNKKTRERFTDKGVGMLCREHCFRNGLIMRAVGDTMIISPPLVIDPSQIDELITLARKCLDQTAAAVLA
>LR130534.1|VDL23739.1|410244_411603_+|Gamma-glutamylputrescine-synthetase-PuuA
MTTKLDQLTSWLKERKITEVECLISDLTGIARGKISPTNKFIAEKGMRLPESVLLQTVTGDYVEDDIYYDLLDPADIDMVCRPDENAVFLVPWAIEPTAMVIHDTFDKLGNPIELSPRNILKRVLKMYADKGWRPIVAPEMEFYLTKRSDDPDYPLQAPVGRSGRQETGRQSFSIDAANEFDPLFEDMYDWCEAQGLDLDTLIHEEGTAQMEINFRHGDALDLADQILVFKRTMREAALKHNVAATFMAKPMTGEPGSAMHLHQSIVDVKTGKNIFSNADGTMSELFLHHIGGLQKFIPEVLPLFAPNVNSFRRFLPDTSAPVNVEWGEENRTVGLRVPDSSPENRRVENRLAGADANPYLALAASLLCGYIGMVEGIKPSAQVKGRGYERRNLRLPLTIEAALERMENCKPLEQYLGSKFISGYVAVKRAEHENFKRVISSWEREFLLLSV
>LR130534.1|VDL23734.1|409451_410204_+|Gamma-glutamyl-gamma-aminobutyrate-hydrolase-PuuD
MSRLPLIGVTACTKQIGLHPYHIAGDKYLRAVVNGAGGLPLIIPALGESIDQAALLDSVDGLLFTGSPSNVEPRHYSGPASEPGTLHDSDRDATTLPLVRAAIDAGIPVLGICRGFQEMNVAFGGSLHQKVHEVGTFMDHREPADQPLEVQYAPRHAMHVQPGGVLAGIGLPSEFQVNSIHGQGVDRLAPGLRVEALAPDGLVEAISVEGAKAFALGVQWHPEWQVLTNPNYLAIFQAFGKACSKRAGQR
>LR130534.1|VDL23730.1|407796_409173_-|Gamma-glutamylputrescine-synthetase-PuuA
MSVPQRAVQLTEPSEFLKEHPEVQFVDLLIADMNGVVRGKRIERNSLNKVFEKGINLPASLFALDITGSTVESTGLGLDIGDADRICYPIPGTLSMEPWQKRPTAQLLMTMHELEGEPFFADPREVLRQVVARFTEMELTIVAAFELEFYLIDQENVNGRPQPPRSPISGKRPQSVQVYSIDDLDEYVECLQDIIDGARAQGIPADAIVAESAPAQFEVNLNHVNDALKACDHAVLLKRLVKNIAYDHEMDTTFMAKPYPGQAGNGLHVHISLLDKHGNNIFTSEDPEQNAALRHAIGGVLETLPASMAFLCPNVNSYRRFGSQFYVPNAPSWGLDNRTVALRVPTGSPDAVRLEHRVAGADANPYLLLAAVLAGVHHGLTNKVEPGAPIEGNSYEQMEPSLPNNLRDALRELDESEIMAKYIDPKYIDIFVACKESELEEFEHSISDLEYNWYLHTV
>LR130534.1|VDL23727.1|406295_407540_-|Putrescine-binding-periplasmic-protein-SpuD
MPRLSVLLFLALAPWLAQAEETLRVYNWNDYIDPQVLESFQKDTGIRVEYHTFATAEELDKALRSGEAIDVAVPSHDTLPALLKDNLLRPLDFTQLPNRSHLDRQLLSKLAAVDPDNRHAVPYLWGAVGLAINTPQAEAAYGGPLPNSWSLLFDASQSQRLKSCGISLLDAPDETLAILLNYQGRNLGRTAPSQVRRAAEALHGLRPNLRYVDSERYIADLEGGRLCLAMAWVGDALRAAKAGQPVSFEVPQEGSVLFIDNLVIPASAQHPRQAHRFIDYLMQPKIAAQITAATLYPSGNADAAGFLDPALRQQPGLYPDRDTSRRLFALETPPEKTPAGGRRDLEGLPRRQPLSGLPRSRELASNSRSRPETRHAAHLVHPQAPRQQPGPDRRDPRRRPRPARQRRHRRPDHL
>LR130534.1|VDL23724.1|405754_406276_-|hypothetical-protein
MPPSSVYHFFPSVPALLQLTGEVHAAFRACLEQPVDHAGLRCWRDLSRIVEERMLAVYARDAAARQLILASHGLAEVTQADRQHDVQLGQAMRALFERHFLLPPLPTDIEIFSLAMELGDRVYALSVQRHGIIDARLAEEGMRVFDAYLGLYLPPILEKRSEPLTGFISDLNR
>LR130534.1|VDL23721.1|404713_405592_-|N-carbamoyl-D-amino-acid-hydrolase
MTRNVTVAATQMACSWDRPANIARAEKLVRQAAARGAQIILIQELFETPYFCQKPNPDYLQLATTVEENAAIAHFQALARELQVVLPISFFERAGRARFNSIAVIDADGGNLGVYRKSHIPDGPGYHEKYYFNPGDTGFKVWQTRYARIGVGICWDQWFPESARSMALLGAELLFYPTAIGSEPHDASISSRDHWQRVQQGHAGANLMPLVASNRIGREEQDGYDITFYGSSFIADPFGEKVEELNRTEEGILVHTFDLDALERTRSAWGVFRDRRPNLYGPLKTLDGSLES
>LR130534.1|VDL23765.1|419020_421408_-|Acyl-homoserine-lactone-acylase-QuiP
MKRTLTVIAVAVAAAAAGGAWYLHAKQPLRNGSLALAHLQAPVDVRYDERGVPHLYAQNQTDLYRALGYVHAQDRLFQMEMLRRLARGELAEVLGPKLVDTDRLFRTLRIRDHAAEYSARQDKQSQPWKVLEAYLDGVNQFQENNPAPLEFDLLGIPRRPFTPEDTLSIAGYMAYSFAAAFRTEPVLTYIRDELGSDYLRIFDLDWHPQGVLTPSGALGAGDWKDLGTLARISQQALEDAGLPQFEGSNAWVVAGSRTASGKPLLAGDPHIRFAAPAVWYEAQLSAPGFELYGHHQALNPFASLGHNRAFGWSLTMFQNDDLDLVAEKVNPDNPNQVWYQGKWVDLQSEEQEIAVKGAAPVKLTLRRSPHGPIVNDALGASSGKTPIAMWWAFLETENPVLDAFYQLNRADTLAKARAAASKIHSPGLNLVWANAAGDIGWWASAALPKRPEGVNPSFILDGSKGEADKSGFYPFADNPQEENPARGYIVSANFQPVPANGRPIPGYYNLADRGQWLDTQLADRGTKWNLDNSRALQLGNRTGYAPRLLAPLLPVLREVVDDAEGKRLVEQLAAWNGDYPVDSTAATLFNQLLFQIAESALHDELGDAFFDSLIATRAIDSALPRLAGDADSPWWDDRRTERRETRADIVRAAWNASLAHLRGTLGNDPSGWLWGKAHTLTHEHALGQQALLKRLLNVGPFAAPGTHEVPNNLSAKIGPAPWAVTYGPSTRRLVDFADPTHSLGINPVGQSGVPFDGHYDDQAEAYIEGHYLPQHYEENEVKANSKGVLVLEPKR
>LR130534.1|VDL23768.1|421518_422571_+|HTH-type-transcriptional-regulator-GadX
MQDDPSTSPLTHSATLRRLLYEALDALGLDPTRVYRSVYRRIPLPPPTLGGRLVHDNAPLFWTELAAVTGDADIGLHLGEAMKPRLLDVVGYLLLSARDLEEALRSFVRFQHILSGGFAARLEVKGETARLILDINYLGYASLRQQIECLMLLFLKLLALISDDEFVAERIEFRHRAPPRLGEHRRLFGRLPLFSRPHDALVFSVALLRRPSRNANPDMHGVLTRHAEEQTRELSENRLLNRVRYLIELRLGEGYGLRQCAAELGLGSGALQRALAAGGASFRQVRDEVRRQRASEMLLAGRAIREVAKACGFAELSPFYRAFRRWHAAPPEQYRARLAKREEGYSTSGT
>LR130534.1|VDL23771.1|422549_423053_-|hypothetical-protein
MSLRPTLALLALVSLPLMAAQNDPQPSSKELMKEHQAQIQNDLADVDYKRKRIVEANMNLTDQEGEKFWPIYNTYRTESDKLSKETLRLLLDYAQAYNSGNVSDDQASKLIERVDDLQEDRLELRDKYVKRIAKNVSPKRAMRFLQIEIQLDAIATLEIGRQVPLVE
>LR130534.1|VDL23774.1|423157_423769_-|hypothetical-protein
MASLAPVFRVNAMTPRRKTLLVSLVGLLWAGGLLAAYWWFEIRYIRPFSEQTTLFSGDSLRLPAELAGPGAIRLVHFWDPACPCNVGNQQHLGELIERFAGKGVEFHVLQKPGSQGRLPDNLAALRPLAGLPGSEQLPASPAVAIWNRDGRLAYFGPYSEGAVCTSSNSFIEPILEALLQGRPVDATHTLAVGCYCPWPPEKG
>LR130534.1|VDL23778.1|423845_424787_+|Monoacylglycerol-lipase
MSEAFNPDYLRQHLRPLAAAEADAAVLAYQAYYGLDLRSRHPRLQARLGSMAVDGRRLAVQAWLLPEARGSLLLMHGYYDHMGLYRHVVDWALGMGFSVLACDLPGHGLSEGERASIRDFAEYQAVFEGLLGQAAELDLAAPWHLCGQSTGGAILLDYLLHGGERPELGETILLAPLVRPRAWGWSKLSYRLLSPFVDSIPRRFSENSSDPQFLDFLREHDPLQPRTLPTAWVGALTRWVPRIERAPRRALSPLVVQGESDETVDWRHGLKVLREKFDEPRILLLEEARHHLANESEGLRRRYFDFLSDALGA
>LR130534.1|VDL23781.1|424806_425559_-|hypothetical-protein
MRALLAFALLLVGLPALADPYQRLYQAAGWPDQRAHFSDALDAAQKRYQDKLPPALYQTLVDNSNRRFAPAEVDQRALNGLRENLPDSASPLNFFESPLGRKVVAAEVLATRRDQLLQHSNGLPRQTASEPRRALVKRLAQVLPAREAGAEVSLALAGVAADSLSQMLPGLPGLLGGGQTGQLLEGQRQRLVQQIGADLENTLLYVYRDLSDTELTQYVNFAESPAGRSYYQAALAALKAGLAVDQAVAH
>LR130534.1|VDL23783.1|425676_426306_+|hypothetical-protein
MHINVNHPLLHRIVDELVDQGWSHQSIFMPERLTTRLAEECRTRAVAGDLTPAAIGRGDGQVIREGIRGDLTQWLEPGESEACDEYLGVMDSLRQALNASLFLGLEDFECHFALYPPGAYYQKHVDRFRDDDARTVSAVLYLNDAWLPEHGGALRLHLPQRQVDIQPTGGSLVVFMSAGTEHEVLPASRDRLSLTGWFRRRNESLLQLS
>LR130534.1|VDL23786.1|426327_426882_-|hypothetical-protein
MLPTRSLLPFFLAPALLASAASQAAMEALDNDSLSQVTGQAGISLRLDLRAGAARVAWVDDGGSLSLRNLVIDNGCVKAGDCPDGRGGNIPLGAAQLGLSLPIFGVEQPTLALDVTTGSGGGQQLAISLPDLATINDQLIASGLPAQRIRLRVASDLYIGDNSIGRIELRDITDLRGTIKVWGH
>LR130534.1|VDL23789.1|426944_427034_+|hypothetical-protein
MGRPQFYPKDRQEIALVPAIRALERYREA
>LR130534.1|VDL23792.1|427147_427642_+|hypothetical-protein
MQKVLVSRCLLGHLVRYDGGSHGPFDLLSRWHAQGRIVALCPEVAGGLPTPRPPAEIPGGQGGEVLDRLNRVFTVDGEDVSEAFLLGAEAAVELVRRHDIRMAVLKARSPSCGNLENYDGRFNGSRVAGEGVTAAALKRMGVLVFNEDELDRAAVCLAGLDAGG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: LR130534_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

LR130534_3

5473525-5473624

Orphan

Consensus_repeat	Method
CCCCGCTAACCCAACGTGGTGTACGGCGAATAAC	CRISPRCasFinder

1 spacers

The CRISPR arrays of LR130534_3

>merge|LR130534|3|5473525-5473624|CRISPRCasFinder
CCCCGCTAACCCAACGTGGTGTACGGCGAATAACGCCTATGGCGTTATCCGCCCTACGGACCGGCGCCCCGCTAACCCAACGTGGTGTAGGGCGAATAAC

>LR130534|3|3|5473525-5473624|CRISPRCasFinder
CCCCGCTAACCCAACGTGGTGTACGGCGAATAAC	GCCTATGGCGTTATCCGCCCTACGGACCGGCG
CCCCGCTAACCCAACGTGGTGTAGGGCGAATAAC

Protein	Signature genes	Signature genes Name	Protein_function
LR130534.1\|VDL47310.1\|5474524_5475451_-\|Ferredoxin--NAD(P)(+)-reductase-(naphthalene-dioxygenase-ferredoxin-specific)	unknown	unknown	gnl\|CDD\|235575
LR130534.1\|VDL47316.1\|5475443_5476571_-\|putative-diguanylate-cyclase-YdaM	unknown	unknown	gnl\|CDD\|143635
LR130534.1\|VDL47347.1\|5481581_5482862_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224748
LR130534.1\|VDL47271.1\|5468711_5469071_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|274060
LR130534.1\|VDL47304.1\|5473685_5474459_-\|2,3-dehydroadipyl-CoA-hydratase	unknown	unknown	gnl\|CDD\|235852
LR130534.1\|VDL47294.1\|5471022_5471937_+\|Universal-stress-protein-E	unknown	unknown	gnl\|CDD\|236871
LR130534.1\|VDL47288.1\|5470131_5470938_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|274513
LR130534.1\|VDL47283.1\|5469654_5470032_-\|hypothetical-protein	unknown	unknown	unknown
LR130534.1\|VDL47265.1\|5467375_5468707_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224635
LR130534.1\|VDL47352.1\|5482961_5484119_-\|putative-cardiolipin-synthase-YwiE	unknown	unknown	gnl\|CDD\|224419
LR130534.1\|VDL47255.1\|5465097_5466375_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379527
LR130534.1\|VDL47325.1\|5478468_5479788_-\|Divalent-metal-cation-transporter-MntH	unknown	unknown	gnl\|CDD\|234815
LR130534.1\|VDL47342.1\|5480876_5481488_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|378537
LR130534.1\|VDL47277.1\|5469131_5469554_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379230
LR130534.1\|VDL47336.1\|5480188_5480770_-\|General-stress-protein-18	unknown	unknown	gnl\|CDD\|153243
LR130534.1\|VDL47249.1\|5463529_5465101_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379261
LR130534.1\|VDL47299.1\|5472019_5473471_+\|Pyruvate-kinase-II	unknown	unknown	gnl\|CDD\|235619
LR130534.1\|VDL47260.1\|5466371_5467379_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|223786
LR130534.1\|VDL47320.1\|5476848_5478372_+\|Fumarate-hydratase-class-I,-aerobic	unknown	unknown	gnl\|CDD\|224862
LR130534.1\|VDL47330.1\|5479859_5480168_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226771

Protein	Function_ID	Function_description	E-value
LR130534.1\|VDL47310.1\|5474524_5475451_-\|Ferredoxin--NAD(P)(+)-reductase-(naphthalene-dioxygenase-ferredoxin-specific)	gnl\|CDD\|235575	PRK05713, PRK05713, iron-sulfur-binding ferredoxin reductase.	0
LR130534.1\|VDL47316.1\|5475443_5476571_-\|putative-diguanylate-cyclase-YdaM	gnl\|CDD\|143635	cd01949, GGDEF, Diguanylate-cyclase (DGC) or GGDEF domain. Diguanylate-cyclase (DGC) or GGDEF domain: Originally named after a conserved residue pattern, and initially described as a domain of unknown function 1 (DUF1). This domain is widely present in bacteria, linked to a wide range of non-homologous domains in a variety of cell signaling proteins. The domain shows homology to the adenylyl cyclase catalytic domain. This correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate. Together with the EAL domain, GGDEF might be involved in regulating cell surface adhesion in bacteria.	1.89838e-61
LR130534.1\|VDL47347.1\|5481581_5482862_-\|hypothetical-protein	gnl\|CDD\|224748	COG1835, COG1835, Predicted acyltransferases [Lipid metabolism].	1.33638e-33
LR130534.1\|VDL47271.1\|5468711_5469071_-\|hypothetical-protein	gnl\|CDD\|274060	TIGR02266, gmx_TIGR02266, Myxococcus xanthus paralogous domain TIGR02266. This domain is related to Type IV pilus assembly protein PilZ (pfam07238). It is found in at least 12 copies in Myxococcus xanthus DK 1622.	0.00176063
LR130534.1\|VDL47304.1\|5473685_5474459_-\|2,3-dehydroadipyl-CoA-hydratase	gnl\|CDD\|235852	PRK06688, PRK06688, enoyl-CoA hydratase; Provisional.	6.08309e-90
LR130534.1\|VDL47294.1\|5471022_5471937_+\|Universal-stress-protein-E	gnl\|CDD\|236871	PRK11175, PRK11175, universal stress protein UspE; Provisional.	1.35277e-40
LR130534.1\|VDL47288.1\|5470131_5470938_+\|hypothetical-protein	gnl\|CDD\|274513	TIGR03302, OM_YfiO, outer membrane assembly lipoprotein YfiO. Members of this protein family include YfiO, a near-essential protein of the outer membrane, part of a complex involved in protein insertion into the bacterial outer membrane. Many proteins in this family are annotated as ComL, based on the involvement of this protein in natural transformation with exogenous DNA in Neisseria gonorrhoeae. This protein family shows sequence similarity to, but is distinct from, the tol-pal system protein YbgF (TIGR02795). [Protein fate, Protein and peptide secretion and trafficking].	2.08959e-05
LR130534.1\|VDL47336.1\|5480188_5480770_-\|General-stress-protein-18	gnl\|CDD\|153243	cd03169, GATase1_PfpI_1, Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus. Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus. PfpI is an ATP-independent intracellular proteases which may hydrolyze small peptides to provide a nutritional source. Only Cys of the catalytic triad typical of GATase1 domains is conserved in this group. This Cys residue is found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow.	1.08845e-110
LR130534.1\|VDL47265.1\|5467375_5468707_+\|hypothetical-protein	gnl\|CDD\|224635	COG1721, COG1721, Uncharacterized conserved protein (some members contain a von Willebrand factor type A (vWA) domain) [General function prediction only].	1.11353e-86
LR130534.1\|VDL47352.1\|5482961_5484119_-\|putative-cardiolipin-synthase-YwiE	gnl\|CDD\|224419	COG1502, Cls, Phosphatidylserine/phosphatidylglycerophosphate/cardiolipin synthases and related enzymes [Lipid metabolism].	4.88176e-86
LR130534.1\|VDL47255.1\|5465097_5466375_+\|hypothetical-protein	gnl\|CDD\|379527	pfam14258, DUF4350, Domain of unknown function (DUF4350). This domain family is found in bacteria, archaea and eukaryotes, and is approximately 70 amino acids in length.	1.89806e-10
LR130534.1\|VDL47325.1\|5478468_5479788_-\|Divalent-metal-cation-transporter-MntH	gnl\|CDD\|234815	PRK00701, PRK00701, divalent metal cation transporter MntH.	0
LR130534.1\|VDL47342.1\|5480876_5481488_-\|hypothetical-protein	gnl\|CDD\|378537	pfam11008, DUF2846, Protein of unknown function (DUF2846). Some members in this family of proteins with unknown function are annotated as lipoproteins however this cannot be confirmed.	1.20717e-26
LR130534.1\|VDL47277.1\|5469131_5469554_-\|hypothetical-protein	gnl\|CDD\|379230	pfam13511, DUF4124, Domain of unknown function (DUF4124). This presumed domain is found in a variety of bacterial proteins. It is found associated at the N-terminus associated with other domains such as the SLT domain and glutaredoxin domains in some proteins. The function of this domain is unknown, but it may have an Ig-like fold.	3.21933e-10
LR130534.1\|VDL47249.1\|5463529_5465101_+\|hypothetical-protein	gnl\|CDD\|379261	pfam13559, DUF4129, Domain of unknown function (DUF4129). This presumed domain is found at the C-terminus of proteins that contain a transglutaminase core domain. The function of this domain is unknown. The domain has a conserved TXXE motif.	0.00172176
LR130534.1\|VDL47299.1\|5472019_5473471_+\|Pyruvate-kinase-II	gnl\|CDD\|235619	PRK05826, PRK05826, pyruvate kinase; Provisional.	0
LR130534.1\|VDL47260.1\|5466371_5467379_+\|hypothetical-protein	gnl\|CDD\|223786	COG0714, COG0714, MoxR-like ATPases [General function prediction only].	3.28278e-100
LR130534.1\|VDL47320.1\|5476848_5478372_+\|Fumarate-hydratase-class-I,-aerobic	gnl\|CDD\|224862	COG1951, TtdA, Tartrate dehydratase alpha subunit/Fumarate hydratase class I, N-terminal domain [Energy production and conversion].	1.05118e-147
LR130534.1\|VDL47330.1\|5479859_5480168_-\|hypothetical-protein	gnl\|CDD\|226771	COG4321, COG4321, Uncharacterized protein related to arylsulfate sulfotransferase involved in siderophore biosynthesis [General function prediction only].	5.41035e-40

>LR130534.1|VDL47299.1|5472019_5473471_+|Pyruvate-kinase-II
MSVRRTKIVATLGPASNSPEVLEQLILAGIDVARLNFSHGTPDEHRARARLVRELAAKHGRFVALLGDLQGPKIRIAKFANKRIELQVGDKFRFSTSHARDAGTQEVVGIDYPDLVKDCGVGDELLLDDGRVVMVVEEVAADELRCRVLIGGPLSDHKGINRRGGGLTAPALTDKDKADIKLAADMDLDYVAVSFPRDAKDMEYARRLLTEAGGKAWLVAKIERAEAVADDDALDGLIRASDAVMVARGDLGVEIGDAELVGIQKKIILHARRNNKVVITATQMMESMIHSPMPTRAEVSDVANAVLDYTDAVMLSAESAAGEYPVEAVQAMARVCQGAEKHPTSQKSSHRLGQTFDRCDESIALASMYTANHFPGIKAIICLTESGFTPLIMSRIRSSVPIYAYSPHRETQARVAMFRGVETIPFDPAALPAEKVSQAAVDELLKRGVVTKGDWVILTKGDSYTAQGGTNTMKVLHVGDLLV
>LR130534.1|VDL47294.1|5471022_5471937_+|Universal-stress-protein-E
MNLHNLLVVVDPSSDEQPALTRAQWIAERSGASVELLLCDFNPALDGGLFFDSHSLQRARDLYLDERVTWLEQLSMPLQQAGIRTQVEAQWGKPLDRMVLQRVGETRPDLVLKSTRKHNLLRRLLLGNSDWQLIRHCPQPLWLVHHDAWRGQRLCAALDPLHASDKPAALDHRLIAAARQLEASLGLRADYLHTHAAMPRSLLFDAEMLAGYERFVLQHEERHRQAFDDLLAAYPEIAAERRHLLAGYAEQAIPDFVRANDIDLLLMGAVARGHLDNALIGQTAERVLEEVECDLLVLKPTNDI
>LR130534.1|VDL47288.1|5470131_5470938_+|hypothetical-protein
MRFARRLVLLPLLSLLAACSPTTPLFVAQVTTGEVAEYKQMKSNRMTAAIEEEGDLLTYSAMAIRDNRSAEAEKLYLTGYDNSRYSAEVRGISLYQIGLIYMSRYNDQRDDAKATDYFQRVVREFPGTHAAEHAQARLLAMRQRAREPVQKSARELLATWKPQQNLDLYKTSLDPDMTLLSRRAVLKDRVDEAAELYLLAVNDPAIPAGIKEKALYQLGLMYLAPDNPHPNRDKAIEYLRRQLLDYPEGELSNKASRHLDQALNVQPR
>LR130534.1|VDL47283.1|5469654_5470032_-|hypothetical-protein
MRSLIVACLALSATGCNSWSLNSDLNGAYRAYDKGDCAQVMLDLSRAERRIRARPYLQPEISLLRGQCLERQSLFVDAAQTYHFIIARYPTSEYAYRAKARLETLRQLGRLNETPASASAVPTRL
>LR130534.1|VDL47277.1|5469131_5469554_-|hypothetical-protein
MRALWFCVALMPVLAQADIYRWTDAQGKVHFSATPPAGAQRVEVRPQVVERDAATRQREQRTQEYFDARREERTAAAERAGQRQAALAEECGRLRQQLSQLERGGRFYRQDAGGGPVYLSDAELDAIRRELASRESERCR
>LR130534.1|VDL47271.1|5468711_5469071_-|hypothetical-protein
MGLQRHIQRHQLPSYLKVFNRITDKPMGYIGNVSEDGLLLISQLPMLVGARFELRLKVPGLGGRPQCIDFSADCRWTCEDVTPGHFDSGFHLLAPPAEFLELVEALRRYFSFPRQPQSV
>LR130534.1|VDL47265.1|5467375_5468707_+|hypothetical-protein
MKPSRALLALFAALLLLAIGLGSLSALGQRLPAQLHTFWWAALAALLLLGLLDALWARRQAVPKLSRQLSGNLPLGRWSEVRLHLQHTYRRPVRLTLFDHLPAGMDFEYLPQEVELRPGESTEVGYRVRPLNRGHFVFPRCELELPSPLRLWRQRRYLEARGETRVYPDFARLYGAELMAVDHWLNQIGVRGGQRRGLGLEFHQLREFRDGDTLRQIDWKATARKRTPIAREYQDERDQQILFLLDCGRRMRSQDGDLSHFDHALNASLLLAYVALRQGDAVGAMTFAGDDRRHLPPGKGSAQLGALLNTVYDLQTSQRPADFPEAVQAVLSRQRRRALVILVTNLRDEDDEELLGAVKRLGRQHRVLVASLREEVLDTLRQEPVARYEQALAYTGTIDYLNARNGLHEKLAAHGVPVLDARPSELGPELISRYLGWKRAGVL
>LR130534.1|VDL47260.1|5466371_5467379_+|hypothetical-protein
MSEQTPEQPSTTPNPALQRQRASQLAQALRSELQKALIGQGAVIDDVLTALLAGGHVLVEGVPGLGKTLLVRALARCFDGGFARIQFTPDLMPSDVTGHAVYDLASEQFKLRKGPVFTHLLLADEINRAPAKTQAALLEVMQERQVTLEGRALPVPQPFMVLATQNPIEQEGTYPLPEAELDRFMLKLRIDYPAEAEEQTLVRQVTRSARSDMLDVANLRPLLKDKDVLALQRIASDLPIDDQVLDYAVRLARTTRNWPGLALGAGPRASIALVRCGRARALLRGGEFVVPDDIKGCALAVLRHRVRLSPELDIEGLSVDQVLQQLLDQVPAPRV
>LR130534.1|VDL47255.1|5465097_5466375_+|hypothetical-protein
MMSRRARFLLLAVLLLLAGLLAIFLASRLQPYTETIDLGPSPEARRNPYLAAELFLRKQGVTVSRADGLEVLKELPPSGHTLLLLGSRSGMTPGQARRLLQWSEQGGHLVLIAERLWDEDEKKSGDLLLDSLDIRQYLTEDFDDSQDRASEETADADADADEGSVDDHAAEAPPEEAAGEEEEPADSVPDYSALTRLYLENERSPAYIGFDPDYHLYDPQNHAYAWANSGDATHLLQMQHGKGLVTVLTDAWIWQNRNIEQYDNAWLLWYLTQDNQVTLLYRAERDSLATLLARHFPEALAAALLLLLAGLWRAGLRQGPLQPVASRSRRQLEEHLRAGADFLLRQRGHVALLHGLQRDILRRARRRHPGFEQLGVAEQWQILGRMTRLPPSAISQAMRPYPAQRLSAADFTRQVAHLQSLRNAL
>LR130534.1|VDL47249.1|5463529_5465101_+|hypothetical-protein
MRLTDASVAIRPRSAWEALDLGILLAHRHARLLMGSWALLTLPLFAVLSLLLWQHPTLAILIFWWLKPAFERLPLYILSHALFGDTPTLKQALRAYPALLRKQLPASLLWRRFSPTRSFDLPVLQLEGLAGEPRSQRLIVLSQRNAGGATWLTVVGVHLEMALWAGFAMLLYLLIPAQNEIDWNWQSLLDPEAGEWLWLEHLSNLLYVLVLVVWEPIYVACGFTLYLNRRTELEAWDIELVFRRLRQRLVGSAYVLLLGLAASLAWLPAPSAYAEPAAAASAGDAELPPEQARLLRQKLNSEQAGKQIRAIVDGAPFKNSETVTGWRFGDKTEKKDSRKEDEERLKAFFEALANWVPFRHAAQVIEVLLWALLFSAVFLLVWRYREWLRLFVGNLGLPQRARREAPTVMFGLDLSPESLPDDIAGNAERLWNEKPREALGLLYRGLLSRLLHDYRLPLKGSHTEGEVLRLVEGLEQQRPLLHYSQLLTAQWQALAYGHRLPADDARQRLCDGWRSLFAAGAKP
>LR130534.1|VDL47304.1|5473685_5474459_-|2,3-dehydroadipyl-CoA-hydratase
MSELIRVERETGLLTLRLDRQDKKNALTRAMYSRMAEALLEAQADTAVRVVLITGGDACFTSGNDILDFLEQPPSLRDSPVGRFMSALLEFPKPVIAAVNGPAVGIGTTLLLHCDLVFVGRNARLKMPFVNLGLTPEFGSSLILPRMLGHAKAAELLMLGQDFSGEQAAAWGLANAALEDGATVLEHARDAARRFLHLAPSAVVESKRLMKAPFIEELRRVIAEEGDIFSTRLRSPEAIEALSAFMHRRQPDFSRFA
>LR130534.1|VDL47310.1|5474524_5475451_-|Ferredoxin--NAD(P)(+)-reductase-(naphthalene-dioxygenase-ferredoxin-specific)
MPDIRVGERRLAVAAGSNLLDALLAGGIAVPHSCRAGSCHACLVHCLQGEVEDTLPEALDPVRREAGWRLACQCRVLGDLVLQPFDPERDGLPARVVACHWLGDVLRLRLEPERPLRYRAGQHLLLWSDDGVARPYSLASLPHEDPWLEFHIDCSAPGAFCDRARRLAPGALLRLGELRGGALRYEPDWQERPLLLMAAGTGLAPLWGILREALRAEHQAPIQLLHLARNHYLASELAELAGRHPQLRVNLVSAAQLPSALADLRLVPRRSMALLCGQPASVERFARHLYLAGVPRSQTLADLFLPHA
>LR130534.1|VDL47316.1|5475443_5476571_-|putative-diguanylate-cyclase-YdaM
MRTDKPPLKQRALQKLLLRRFGMAAGTYLLGLVLLWLALLSGFYRAAPTTAAASTTLVVACQLAFLWLFASGRNLRYADPSLTEPQVLVAIAWLTYFLYHVDSLRGTFMVFYVLALLFGVFQLPPRVFARCAALAFIAFSGIYLVEALQQRLELPGRAALQVLVMFIVMVWLSLFASYIQAMRQRMRQRRYALQAHQDTLRGMMRQLEDLVATDELTGLFNRRHFMRLASRALEDLLPNRQHGLALIDLDHFKRINDRHGHAAGDRVLQTFAAVARSCLRDGDVLARYGGEEFVLLLPHADAEQLESCCERLRLAFEQAEPVGVTVDTLSLSVGMTLLYADDDLDEALQRADQALYRAKRGGRNRCDATWEVTSA
>LR130534.1|VDL47320.1|5476848_5478372_+|Fumarate-hydratase-class-I,-aerobic
MAVIKQDDLIQSVADALQFISYYHPVDFIQAMHEAYLREESPAARDSMAQILINSRMCATGHRPICQDTGIVTVFVRVGMDVRWDGATMSVDDMINEGVRRAYNLPENVLRASILADPAGARKNTKDNTPAVIHYSIVPGDKVEVDVAAKGGGSENKSKMAMLNPSDSIVDWVLKTVPTMGAGWCPPGMLGIGIGGTAEKAAVMAKEVLMDPIDIHELKARGPQNRIEELRLELFEKVNQLGIGAQGLGGLTTVLDVKIMDYPTHAASLPVCMIPNCAATRHAHFVLDGSGPAELEAPSLDAYPEIVWEAGPSARRVDLDKITPEEVQSWKPGETLLLNGKMLTGRDAAHKRMVDMLNKGETLPVDLKGRFIYYVGPVDPVGDEVVGPAGPTTATRMDKFTRQILEQTGLLGMIGKSERGPIAIEAIKDNKAVYLMAVGGAAYLVAQAIKKSKVLAFAELGMEAIYEFEVKDMPVTVAVDTNGESVHITGPAVWQKKIAESLAIEVK
>LR130534.1|VDL47325.1|5478468_5479788_-|Divalent-metal-cation-transporter-MntH
MKYSLPTTATAPFCPSAVSHSVAVPADASPLRKLALFVGPGLLVSVGYMDPGNWATAIEAGSRFGYALLFVVVLASFSGMLLQSLCSRLGIATGRDLAQLSRERYRPGVARGQWLLAELSIVATDLAEVLGAALAFHLLLGVSITTGVVLTAFDTLIVLALQGANFRRLEAIVLGLIATIGACFFVELVLIGPYWPDVAAGLRPSWDTLSSQEPLYLAIGILGATVMPHNLYLHSSVVQTRVSGDDAASKRSAIRFSRLDTIGSLSLALLVNAAILILAAAAFHGSGHTEVVEIQDAYHLLDPLVGGALASFLFGFALLAAGQSSTFTGTIAGQVVMEGFLRAKIPCWQRRLITRGLALVPALIGVLWLGEGAVGKLLVLSQVVLSLQLPFALWPLIRFSSDRGLMGEFVNPRWVSALAWSLFGLISAANLTLLYFWFG
>LR130534.1|VDL47330.1|5479859_5480168_-|hypothetical-protein
MCELYVKADPILYESRSRSLRIRGVVTTLRLENQFWDILREIAEGEGLSTNQLITKLYEEVMDYRGEVLNFASFLRVSCTRYLAQRREKVAELSLVGQRAQA
>LR130534.1|VDL47336.1|5480188_5480770_-|General-stress-protein-18
MAAKKILMLVGDYAEDYETMVPFQALQMVGHQVHAVCPDKRAGQSVRTAIHDFEGDQTYSEKPGHNFTLNADFAQARAEDYDALLIPGGRAPEYLRLNEQVLALVRAFDAARKPIAAVCHGAQLLAAAGVLQGRACSAYPACAPEVRLAGGEYVDIPSDQAHVDGHLVTAPAWPAHPAWLARFLEVLGTRISH
>LR130534.1|VDL47342.1|5480876_5481488_-|hypothetical-protein
MLRSLSLALSIVASLVGCSTPGAFFGAVDGPAFVAHPSADASHATVYLYRPRSQWADEELEAPGIFLNNELIGSLPSNGYLAFEFETGSYKLEMRRPLAGSFWTLFADGPMDFTRIASFMLEARAGSVYYLRYDELNPPPKSEHPAGEGDGPLQLVAADLGAAEIGATHQVQEPMQFAASGYRKRVQRSFWEGVGRALDKIGI
>LR130534.1|VDL47347.1|5481581_5482862_-|hypothetical-protein
MATPDSKERFIGLEWLRFLLGLYVVVYHTLHTYPKEQKFPGLDELTSLGFFATSTFFVLSGFLLAHVYARSGRLRESARSFWTKRLSNLYPLHLFSLLLSILVLLALSHLGIGPELDKATPRFVIYDTNEVLGRTHPELFLHWMSNTELFVNSILQILLLQAWNPYYLTFNAPLWSLSTLMFFYLAFPFVAPRLMRSRHKWKVLALVWLVYLIPPVLVVASESYGIPWTGLLHRNPLLRLPEFLGGILAYGLFRGYRDRGMVPGRGLLAALVALVVAAFLVADYLFTQGAKHWYFLLHNGLLLPAQLLLVCLCALPADPKSAFVRHWSPRLGAASLSLFALHVPMFTLFSRSERLIAVPGRCLDDWRACTEAAAALPSSLLYYPLFLVLLVAFCVLFQERGVVPVRKWLVRRLMPAPALAKVPRPA
>LR130534.1|VDL47352.1|5482961_5484119_-|putative-cardiolipin-synthase-YwiE
MSGPVFPWRSDNRFALLNDGVRFFPRMLLAIEAAQRSIELELYLVEDGHCAELFLVALLDARRRGVAVRCLFDGFGCLGLGSAWIQRLREAGGELRLYNPLRWKLTGGNLYRDHRKLLLVDGRLGYVGGAGITDEFWEPVSDVSAWREVMVEMDGPVVADWAALFERQWLACLEEKAWKPREGMTLTRLPPQPGAARGLGRVAYADARQHRDILQSLVRALNGSRRRIWLATPYFLPTWKVRRALRKAAQRGVEVRLLLAGRLTDHAPVRYAGQRYYPRLLRAGVRIHEYQPRFLHLKMVMVDDWVSVGSCNFDHWNLRFNLDANLEALDPDFTNEAAASLLADFADSREVTLAMWRARPLWMRLHQRLWGWLDRVVVNFLDRRR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Identity
LR130534_2	2.1\|5222613\|60\|LR130534\|CRISPRCasFinder	5222613-5222672	60	MK510989	Pseudomonas phage BR322, partial genome	31234-31293	1.0
LR130534_2	2.1\|5222613\|60\|LR130534\|CRISPRCasFinder	5222613-5222672	60	MK510966	Pseudomonas phage CF53, partial genome	31235-31294	1.0
LR130534_2	2.1\|5222613\|60\|LR130534\|CRISPRCasFinder	5222613-5222672	60	KY707339	Pseudomonas phage JBD68, complete genome	33757-33816	1.0
LR130534_2	2.1\|5222613\|60\|LR130534\|CRISPRCasFinder	5222613-5222672	60	MK510981	Pseudomonas phage BR143, partial genome	31255-31314	1.0
LR130534_2	2.1\|5222613\|60\|LR130534\|CRISPRCasFinder	5222613-5222672	60	MK510967	Pseudomonas phage CF54, partial genome	4952-5011	1.0
LR130534_2	2.1\|5222613\|60\|LR130534\|CRISPRCasFinder	5222613-5222672	60	MK510991	Pseudomonas phage BR141, partial genome	31216-31275	1.0
LR130534_2	2.1\|5222613\|60\|LR130534\|CRISPRCasFinder	5222613-5222672	60	MK510980	Pseudomonas phage BR123, partial genome	31234-31293	1.0
LR130534_2	2.1\|5222613\|60\|LR130534\|CRISPRCasFinder	5222613-5222672	60	MK510983	Pseudomonas phage BR178, partial genome	31235-31294	1.0

1. spacer 2.1|5222613|60|LR130534|CRISPRCasFinder matches to MK510989 (Pseudomonas phage BR322, partial genome) position: , mismatch: 0, identity: 1.0

gtgtcgtcagttgcaccccgttacgtcgtggtttgcaccccgttacgtcgtcatttgcac	CRISPR spacer
gtgtcgtcagttgcaccccgttacgtcgtggtttgcaccccgttacgtcgtcatttgcac	Protospacer
************************************************************

2. spacer 2.1|5222613|60|LR130534|CRISPRCasFinder matches to MK510966 (Pseudomonas phage CF53, partial genome) position: , mismatch: 0, identity: 1.0

gtgtcgtcagttgcaccccgttacgtcgtggtttgcaccccgttacgtcgtcatttgcac	CRISPR spacer
gtgtcgtcagttgcaccccgttacgtcgtggtttgcaccccgttacgtcgtcatttgcac	Protospacer
************************************************************

3. spacer 2.1|5222613|60|LR130534|CRISPRCasFinder matches to KY707339 (Pseudomonas phage JBD68, complete genome) position: , mismatch: 0, identity: 1.0

gtgtcgtcagttgcaccccgttacgtcgtggtttgcaccccgttacgtcgtcatttgcac	CRISPR spacer
gtgtcgtcagttgcaccccgttacgtcgtggtttgcaccccgttacgtcgtcatttgcac	Protospacer
************************************************************

4. spacer 2.1|5222613|60|LR130534|CRISPRCasFinder matches to MK510981 (Pseudomonas phage BR143, partial genome) position: , mismatch: 0, identity: 1.0

gtgtcgtcagttgcaccccgttacgtcgtggtttgcaccccgttacgtcgtcatttgcac	CRISPR spacer
gtgtcgtcagttgcaccccgttacgtcgtggtttgcaccccgttacgtcgtcatttgcac	Protospacer
************************************************************

5. spacer 2.1|5222613|60|LR130534|CRISPRCasFinder matches to MK510967 (Pseudomonas phage CF54, partial genome) position: , mismatch: 0, identity: 1.0

gtgtcgtcagttgcaccccgttacgtcgtggtttgcaccccgttacgtcgtcatttgcac	CRISPR spacer
gtgtcgtcagttgcaccccgttacgtcgtggtttgcaccccgttacgtcgtcatttgcac	Protospacer
************************************************************

6. spacer 2.1|5222613|60|LR130534|CRISPRCasFinder matches to MK510991 (Pseudomonas phage BR141, partial genome) position: , mismatch: 0, identity: 1.0

gtgtcgtcagttgcaccccgttacgtcgtggtttgcaccccgttacgtcgtcatttgcac	CRISPR spacer
gtgtcgtcagttgcaccccgttacgtcgtggtttgcaccccgttacgtcgtcatttgcac	Protospacer
************************************************************

7. spacer 2.1|5222613|60|LR130534|CRISPRCasFinder matches to MK510980 (Pseudomonas phage BR123, partial genome) position: , mismatch: 0, identity: 1.0

gtgtcgtcagttgcaccccgttacgtcgtggtttgcaccccgttacgtcgtcatttgcac	CRISPR spacer
gtgtcgtcagttgcaccccgttacgtcgtggtttgcaccccgttacgtcgtcatttgcac	Protospacer
************************************************************

8. spacer 2.1|5222613|60|LR130534|CRISPRCasFinder matches to MK510983 (Pseudomonas phage BR178, partial genome) position: , mismatch: 0, identity: 1.0

gtgtcgtcagttgcaccccgttacgtcgtggtttgcaccccgttacgtcgtcatttgcac	CRISPR spacer
gtgtcgtcagttgcaccccgttacgtcgtggtttgcaccccgttacgtcgtcatttgcac	Protospacer
************************************************************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

743565 : 762460

Pseudomonas_phage(30.0%)

tail

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
VDL24782.1\|743565_744336_-	HTH-type transcriptional regulator PrtR	A0A1B0Z078	Pseudomonas_phage	1.4e-71	59.1
VDL24785.1\|744420_744591_-	hypothetical protein	NA	NA	NA	NA
VDL24788.1\|744793_744994_+	RNA polymerase-binding transcription factor DksA	W6ATC1	Enterobacter_phage	3.7e-05	58.3
VDL24792.1\|745041_745401_+	hypothetical protein	NA	NA	NA	NA
VDL24795.1\|745860_746214_+	hypothetical protein	B5TK61	Pseudomonas_phage	3.9e-26	53.3
VDL24798.1\|746235_746751_+	hypothetical protein	A0A2H4J881	uncultured_Caudovirales_phage	1.8e-32	43.4
VDL24801.1\|746747_747305_+	hypothetical protein	A0A2H4JG06	uncultured_Caudovirales_phage	4.6e-45	71.1
VDL24804.1\|747457_747784_+	hypothetical protein	A0A2H4JA09	uncultured_Caudovirales_phage	3.2e-30	60.2
VDL24807.1\|747780_748668_+	hypothetical protein	S4TNY7	Salmonella_phage	5.3e-88	59.8
VDL24810.1\|748660_749194_+	hypothetical protein	Q9ZXK7	Pseudomonas_virus	1.1e-61	64.0
VDL24813.1\|749195_751304_+	hypothetical protein	Q9ZXK6	Pseudomonas_virus	5.5e-224	52.0
VDL24816.1\|751312_751753_+	hypothetical protein	NA	NA	NA	NA
VDL24819.1\|751795_752956_+\|tail	Putative prophage major tail sheath protein	Q38068	Phage_PS17	1.2e-188	83.4
VDL24822.1\|752968_753472_+	hypothetical protein	Q7M2A5	Pseudomonas_phage	8.0e-65	73.5
VDL24825.1\|753486_753831_+	hypothetical protein	NA	NA	NA	NA
VDL24828.1\|754000_756238_+	hypothetical protein	NA	NA	NA	NA
VDL24831.1\|756247_757120_+	hypothetical protein	A0A2H4J875	uncultured_Caudovirales_phage	3.9e-75	51.7
VDL24835.1\|757094_757301_+	hypothetical protein	A0A2H4J9Z9	uncultured_Caudovirales_phage	2.3e-18	64.2
VDL24839.1\|757358_758348_+	hypothetical protein	A0A2H4JBF6	uncultured_Caudovirales_phage	2.2e-106	55.8
VDL24842.1\|758380_759010_+	hypothetical protein	A0A125RNP1	Pseudomonas_phage	1.6e-86	78.0
VDL24845.1\|759006_759369_+	hypothetical protein	H2BDA0	Pseudomonas_phage	4.2e-15	47.9
VDL24848.1\|759365_759623_+	hypothetical protein	A0A125RNP3	Pseudomonas_phage	6.4e-18	64.6
VDL24851.1\|759970_760576_+	Anthranilate synthase component 2	A0A0P0IKJ1	Acinetobacter_phage	3.5e-75	66.3
VDL24855.1\|760577_761627_+	Anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	1.8e-111	57.8
VDL24858.1\|761623_762460_+	Indole-3-glycerol phosphate synthase	A0A0P0IR83	Acinetobacter_phage	1.2e-70	56.9

DBSCAN-SWA_2

1466754 : 1512438

Pseudomonas_phage(91.07%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
VDL27218.1\|1466754_1467960_-	Cysteine desulfurase SufS	Q2XUY6	environmental_halophage	2.3e-73	39.2
VDL27223.1\|1468054_1469089_-	2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase	NA	NA	NA	NA
VDL27228.1\|1469118_1469742_-	Leucine efflux protein	NA	NA	NA	NA
VDL27232.1\|1469754_1470102_-	Regulatory protein Spx	NA	NA	NA	NA
VDL27234.1\|1470168_1471272_-	hypothetical protein	A0A0U4JIT5	Pseudomonas_phage	8.1e-203	98.6
VDL27239.1\|1471710_1472001_-	hypothetical protein	A0A0U4JVQ0	Pseudomonas_phage	2.4e-45	93.8
VDL27247.1\|1472072_1472270_-	hypothetical protein	A0A125RNQ4	Pseudomonas_phage	1.2e-27	87.7
VDL27255.1\|1472272_1472698_-	hypothetical protein	A0A125RNQ6	Pseudomonas_phage	2.7e-37	86.9
VDL27259.1\|1472700_1473282_-	hypothetical protein	D4FUM1	Pseudomonas_phage	1.8e-23	45.7
VDL27263.1\|1473274_1473454_-	hypothetical protein	NA	NA	NA	NA
VDL27267.1\|1473453_1474980_-	hypothetical protein	A0A1B0YZX1	Pseudomonas_phage	2.0e-82	96.1
VDL27271.1\|1474976_1475183_-	hypothetical protein	H2BDF2	Pseudomonas_virus	7.9e-27	84.1
VDL27276.1\|1475146_1475395_-	hypothetical protein	H2BD39	Pseudomonas_phage	1.1e-38	95.1
VDL27282.1\|1475477_1476569_-	hypothetical protein	A0A291L9Z9	Bordetella_phage	2.5e-79	45.7
VDL27286.1\|1476597_1477134_-	hypothetical protein	A0A0U4IBL4	Pseudomonas_phage	2.2e-97	94.9
VDL27290.1\|1477130_1478810_-	putative BsuMI modification methylase subunit YdiP	A0A2I7QRH3	Vibrio_phage	1.1e-94	41.1
VDL27294.1\|1478874_1479177_-	hypothetical protein	A0A0U4ISH7	Pseudomonas_phage	7.0e-40	95.0
VDL27298.1\|1479176_1479851_-	hypothetical protein	NA	NA	NA	NA
VDL27302.1\|1480064_1480313_-	hypothetical protein	A0A0U3TGX2	Pseudomonas_phage	8.5e-36	93.9
VDL27306.1\|1480323_1480710_-	hypothetical protein	A0A1B0YZX7	Pseudomonas_phage	2.0e-63	97.6
VDL27310.1\|1480914_1481874_-	hypothetical protein	A0A1B0YZX8	Pseudomonas_phage	8.4e-63	46.9
VDL27319.1\|1482118_1482277_-	hypothetical protein	NA	NA	NA	NA
VDL27323.1\|1482319_1482508_-	hypothetical protein	A0A0U4B0L2	Pseudomonas_phage	1.1e-30	98.4
VDL27327.1\|1482525_1482732_-	hypothetical protein	A0A0U4IJ22	Pseudomonas_phage	9.6e-33	92.6
VDL27329.1\|1483423_1483690_-	HTH-type transcriptional regulator PrtR	A0A059VA53	Pseudomonas_phage	4.4e-30	70.8
VDL27334.1\|1484260_1484467_+	hypothetical protein	F8TUK2	EBPR_podovirus	1.3e-05	46.3
VDL27339.1\|1484586_1485291_+	hypothetical protein	A0A1B0YZY9	Pseudomonas_phage	1.6e-124	97.9
VDL27344.1\|1485888_1486188_+	hypothetical protein	A0A1B0VME0	Pseudomonas_phage	4.2e-21	54.6
VDL27349.1\|1486174_1486972_+	hypothetical protein	A0A1B0VMD9	Pseudomonas_phage	3.4e-49	49.8
VDL27352.1\|1486968_1487175_+	hypothetical protein	A0A1B0YZY8	Pseudomonas_phage	1.6e-27	83.8
VDL27356.1\|1487171_1487753_+	hypothetical protein	A0A0U4KL68	Pseudomonas_phage	2.4e-105	98.4
VDL27360.1\|1487749_1488046_+	hypothetical protein	A0A1B0YZZ2	Pseudomonas_phage	7.3e-42	85.7
VDL27364.1\|1488083_1488758_+	hypothetical protein	A0A1B0YZZ3	Pseudomonas_phage	2.6e-119	99.6
VDL27368.1\|1488981_1489332_+	hypothetical protein	A0A0U4ISD3	Pseudomonas_phage	5.4e-60	98.3
VDL27373.1\|1489689_1490022_+	hypothetical protein	A0A1B0YZZ1	Pseudomonas_phage	1.1e-43	99.1
VDL27377.1\|1490018_1490636_+	hypothetical protein	A0A0U4JP23	Pseudomonas_phage	1.5e-105	92.2
VDL27382.1\|1490839_1491073_-	hypothetical protein	NA	NA	NA	NA
VDL27386.1\|1491102_1491846_+	hypothetical protein	A0A1B0Z000	Pseudomonas_phage	2.7e-133	98.0
VDL27390.1\|1491965_1492511_+	hypothetical protein	A0A1B0Z033	Pseudomonas_phage	2.1e-95	98.9
VDL27394.1\|1492482_1494447_+	hypothetical protein	A0A1B0Z2K0	Pseudomonas_phage	0.0e+00	98.3
VDL27399.1\|1494437_1494653_+	hypothetical protein	A0A1W6JT66	Pseudomonas_phage	6.5e-32	100.0
VDL27404.1\|1494652_1496299_+	hypothetical protein	A0A1W6JTB6	Pseudomonas_phage	0.0e+00	99.8
VDL27409.1\|1496270_1498352_+\|protease	ATP-dependent Clp protease proteolytic subunit	A0A1W6JT88	Pseudomonas_phage	0.0e+00	99.3
VDL27414.1\|1498418_1498736_+	hypothetical protein	A0A1W6JT93	Pseudomonas_phage	4.6e-50	100.0
VDL27419.1\|1498732_1499062_+	hypothetical protein	A0A1B0YZU3	Pseudomonas_phage	6.8e-57	99.1
VDL27424.1\|1499058_1499529_+	hypothetical protein	A0A1W6JT75	Pseudomonas_phage	7.7e-86	98.1
VDL27428.1\|1499532_1499727_+	hypothetical protein	A0A1W6JT79	Pseudomonas_phage	2.8e-26	93.8
VDL27432.1\|1499728_1500481_+	hypothetical protein	A0A1B0YZT8	Pseudomonas_phage	9.9e-136	98.4
VDL27436.1\|1501210_1501513_+	hypothetical protein	A0A1B0YZV7	Pseudomonas_phage	5.3e-40	86.0
VDL27442.1\|1501615_1504099_+	hypothetical protein	A0A1B0YZV6	Pseudomonas_phage	0.0e+00	97.6
VDL27444.1\|1504138_1504660_+	hypothetical protein	A0A1W6JT98	Pseudomonas_phage	3.1e-96	96.5
VDL27448.1\|1504659_1506357_+	hypothetical protein	A0A1W6JTA3	Pseudomonas_phage	0.0e+00	96.6
VDL27452.1\|1506359_1506770_+	hypothetical protein	A0A1B0YZV0	Pseudomonas_phage	5.2e-62	92.6
VDL27459.1\|1506769_1507315_+	hypothetical protein	A0A1B0YZV4	Pseudomonas_phage	5.0e-97	96.1
VDL27463.1\|1507325_1507730_+	hypothetical protein	A0A0A0YR47	Pseudomonas_phage	2.6e-66	98.5
VDL27467.1\|1507726_1509397_+	hypothetical protein	A0A0A0YRR5	Pseudomonas_phage	1.1e-203	60.7
VDL27472.1\|1509424_1510012_+	hypothetical protein	A0A1B0Z051	Pseudomonas_phage	5.3e-100	91.8
VDL27478.1\|1510004_1510196_+	hypothetical protein	A0A1B0Z2L3	Pseudomonas_phage	7.8e-29	96.8
VDL27482.1\|1510200_1510761_+	hypothetical protein	A0A1W6JT84	Pseudomonas_phage	2.9e-100	99.5
VDL27486.1\|1510761_1511043_+	hypothetical protein	A0A1W6JTD4	Pseudomonas_phage	7.9e-46	98.9
VDL27490.1\|1511598_1511901_+	hypothetical protein	A0A0A0YUD8	Pseudomonas_phage	3.7e-49	99.0
VDL27495.1\|1511897_1512137_+	hypothetical protein	A0A0A0YQ17	Pseudomonas_phage	5.9e-34	97.3
VDL27500.1\|1512165_1512438_+	hypothetical protein	A0A0U4JEI3	Pseudomonas_phage	2.6e-46	98.9

DBSCAN-SWA_3

1555719 : 1564781

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
VDL27672.1\|1555719_1556388_+	Protein-L-isoaspartate O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	3.0e-43	53.1
VDL27676.1\|1556433_1557327_+	Murein hydrolase activator NlpD	A0A0S2SXL7	Bacillus_phage	3.0e-06	34.3
VDL27680.1\|1557431_1558436_+	RNA polymerase sigma factor RpoS	G8CLC7	Synechococcus_phage	7.0e-36	37.3
VDL27684.1\|1558862_1559186_-	Ferredoxin-1	NA	NA	NA	NA
VDL27688.1\|1559252_1561820_-	DNA mismatch repair protein MutS	A0A1V0SGG8	Hokovirus	2.4e-24	22.1
VDL27692.1\|1561945_1562953_-	Protein TolB	NA	NA	NA	NA
VDL27697.1\|1563100_1563607_+	Nicotinamide-nucleotide amidohydrolase PncC	B5TK85	Pseudomonas_phage	8.1e-57	76.0
VDL27702.1\|1563740_1564781_+	Protein RecA	A0A0S2MVG1	Bacillus_phage	1.5e-113	59.5

DBSCAN-SWA_4

2561879 : 2573957

uncultured_Caudovirales_phage(50.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
VDL32387.1\|2561879_2562149_-	HTH-type transcriptional regulator PrtR	A0A1B0Z078	Pseudomonas_phage	7.6e-30	65.9
VDL32393.1\|2563243_2563798_+	hypothetical protein	NA	NA	NA	NA
VDL32400.1\|2563790_2564000_+	hypothetical protein	NA	NA	NA	NA
VDL32408.1\|2563996_2566210_+	DNA primase TraC	A0A2D1GN57	Marinobacter_phage	2.1e-189	48.2
VDL32415.1\|2566206_2566578_+	hypothetical protein	NA	NA	NA	NA
VDL32422.1\|2567149_2567500_+	hypothetical protein	B5TK61	Pseudomonas_phage	2.8e-16	48.6
VDL32429.1\|2567496_2568234_+	hypothetical protein	A0A1B0Z000	Pseudomonas_phage	5.1e-44	47.1
VDL32435.1\|2568489_2569080_+	hypothetical protein	A0A2H4JG15	uncultured_Caudovirales_phage	5.7e-46	53.9
VDL32441.1\|2569083_2571099_+	hypothetical protein	A0A2H4J898	uncultured_Caudovirales_phage	5.0e-259	64.0
VDL32447.1\|2571110_2571335_+	hypothetical protein	NA	NA	NA	NA
VDL32454.1\|2571334_2572801_+	hypothetical protein	A0A2H4JFL5	uncultured_Caudovirales_phage	7.3e-175	64.4
VDL32461.1\|2572784_2573957_+\|protease	ATP-dependent Clp protease proteolytic subunit	A0A2H4JDI2	uncultured_Caudovirales_phage	1.3e-86	49.6

DBSCAN-SWA_5

2582045 : 2592753

Pseudomonas_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
VDL32527.1\|2582045_2585597_+	hypothetical protein	A0A0M4U447	Ralstonia_phage	3.4e-178	35.0
VDL32530.1\|2585596_2586598_+	hypothetical protein	NA	NA	NA	NA
VDL32537.1\|2586594_2587455_+	hypothetical protein	NA	NA	NA	NA
VDL32543.1\|2587451_2589212_+	hypothetical protein	A0A2I7S8R8	Vibrio_phage	7.5e-25	24.4
VDL32546.1\|2589211_2589448_+	hypothetical protein	NA	NA	NA	NA
VDL32552.1\|2589693_2590323_+	hypothetical protein	J7I4M6	Pseudomonas_phage	1.9e-100	87.6
VDL32558.1\|2590319_2590682_+	hypothetical protein	A0A0S2SY58	Pseudomonas_phage	8.7e-37	71.3
VDL32564.1\|2590678_2590942_+	hypothetical protein	H2BDD7	Pseudomonas_virus	5.9e-27	73.3
VDL32570.1\|2591052_2592753_+	hypothetical protein	D0UIM0	Aggregatibacter_phage	1.2e-06	34.4

DBSCAN-SWA_6

2793035 : 2799929

uncultured_Caudovirales_phage(83.33%)

protease,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
VDL33856.1\|2793035_2794316_+\|tRNA	Serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	8.2e-98	45.4
VDL33863.1\|2794317_2795715_+	Siroheme synthase	NA	NA	NA	NA
VDL33869.1\|2795719_2796694_-	Glutathionyl-hydroquinone reductase YqjG	NA	NA	NA	NA
VDL33875.1\|2796781_2797765_-	Anthranilate phosphoribosyltransferase	A0A2H4JBY5	uncultured_Caudovirales_phage	1.2e-141	74.0
VDL33880.1\|2797761_2798097_-	Sulfurtransferase TusE	A0A2H4J8B6	uncultured_Caudovirales_phage	1.2e-37	68.5
VDL33886.1\|2798093_2798399_-	Protein TusB	NA	NA	NA	NA
VDL33893.1\|2798398_2798758_-	Intracellular sulfur oxidation protein DsrF	A0A2H4J8C0	uncultured_Caudovirales_phage	1.4e-34	61.7
VDL33900.1\|2798754_2799150_-	Putative sulfurtransferase DsrE	A0A2H4JA39	uncultured_Caudovirales_phage	2.7e-47	72.1
VDL33906.1\|2799260_2799929_-\|protease	Modulator of FtsH protease YccA	A0A2H4JFM9	uncultured_Caudovirales_phage	1.5e-90	82.1

DBSCAN-SWA_7

3415104 : 3467662

Leptospira_phage(23.08%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
VDL36941.1\|3415104_3416445_+\|transposase	Putative transposase (identified by ISEscan HMM)	A0A2D1GQC1	Lysinibacillus_phage	1.7e-69	36.0
VDL36947.1\|3416670_3419787_-	oqxB_1_EU370913	S5VTK5	Leptospira_phage	1.7e-48	21.8
VDL36957.1\|3419796_3421035_-	oqxA_1_EU370913	S5VL44	Leptospira_phage	1.2e-05	23.9
VDL36963.1\|3421231_3422827_-	optrA_10_KT862776	G9BWD6	Planktothrix_phage	5.0e-20	33.5
VDL36970.1\|3422826_3423852_-	Inner membrane ABC transporter permease protein YejE	NA	NA	NA	NA
VDL36976.1\|3423851_3424922_-	Inner membrane ABC transporter permease protein YejB	NA	NA	NA	NA
VDL36983.1\|3424921_3426847_-	HTH-type transcriptional regulator SgrR	NA	NA	NA	NA
VDL36989.1\|3426967_3429661_-	Colicin I receptor	A0A0P0I887	Acinetobacter_phage	2.9e-36	24.0
VDL36995.1\|3429828_3430230_-	Biopolymer transport protein ExbD	NA	NA	NA	NA
VDL37001.1\|3430231_3430939_-	Biopolymer transport protein ExbB	NA	NA	NA	NA
VDL37007.1\|3430984_3431788_-	hypothetical protein	NA	NA	NA	NA
VDL37014.1\|3432576_3434403_-	ole(C)_1_L06249	W8CYL7	Bacillus_phage	1.4e-26	29.7
VDL37021.1\|3434486_3435830_-\|protease	Metalloprotease PmbA	NA	NA	NA	NA
VDL37027.1\|3435826_3437266_-\|protease	Metalloprotease TldD	NA	NA	NA	NA
VDL37033.1\|3437977_3438793_-	Diacetyl reductase [(S)-acetoin forming]	F2NZ12	Diadromus_pulchellus_ascovirus	1.4e-05	27.4
VDL37039.1\|3438844_3439279_-	Mercuric resistance operon regulatory protein	NA	NA	NA	NA
VDL37046.1\|3439350_3439701_+	hypothetical protein	NA	NA	NA	NA
VDL37053.1\|3439713_3439989_+	Mercuric transport protein periplasmic component	NA	NA	NA	NA
VDL37059.1\|3440060_3441746_+	Mercuric reductase	A0A2K5B2C5	Erysipelothrix_phage	5.5e-41	29.3
VDL37064.1\|3441763_3442129_+	hypothetical protein	NA	NA	NA	NA
VDL37070.1\|3442125_3442362_+	hypothetical protein	NA	NA	NA	NA
VDL37076.1\|3442358_3443348_+	Phytochrome-like protein cph2	NA	NA	NA	NA
VDL37082.1\|3443478_3444039_+	DNA-invertase hin	A0A1B0V7I5	Salmonella_phage	2.1e-50	88.6
VDL37088.1\|3444041_3447008_+\|transposase	Putative transposase (identified by ISEscan HMM)	A0A1B0V7H9	Salmonella_phage	0.0e+00	72.9
VDL37095.1\|3448032_3448362_-	hypothetical protein	NA	NA	NA	NA
VDL37101.1\|3448522_3449695_+	hypothetical protein	NA	NA	NA	NA
VDL37105.1\|3449696_3449930_+	hypothetical protein	NA	NA	NA	NA
VDL37111.1\|3450000_3450189_+	hypothetical protein	NA	NA	NA	NA
VDL37117.1\|3450176_3450413_+	hypothetical protein	NA	NA	NA	NA
VDL37123.1\|3450412_3450676_+	hypothetical protein	NA	NA	NA	NA
VDL37130.1\|3450675_3450984_+	hypothetical protein	NA	NA	NA	NA
VDL37136.1\|3451176_3451311_+	hypothetical protein	Q858R0	Vibrio_phage	8.2e-09	72.7
VDL37141.1\|3451434_3452811_+	hypothetical protein	NA	NA	NA	NA
VDL37148.1\|3453069_3453891_-	hypothetical protein	NA	NA	NA	NA
VDL37154.1\|3454035_3454311_+	hypothetical protein	NA	NA	NA	NA
VDL37161.1\|3454629_3455097_-	hypothetical protein	NA	NA	NA	NA
VDL37168.1\|3455627_3455957_-	hypothetical protein	NA	NA	NA	NA
VDL37175.1\|3456117_3457290_+	hypothetical protein	NA	NA	NA	NA
VDL37181.1\|3457291_3457525_+	hypothetical protein	NA	NA	NA	NA
VDL37188.1\|3457595_3457784_+	hypothetical protein	NA	NA	NA	NA
VDL37194.1\|3457771_3458008_+	hypothetical protein	NA	NA	NA	NA
VDL37200.1\|3458007_3458271_+	hypothetical protein	NA	NA	NA	NA
VDL37204.1\|3458270_3458579_+	hypothetical protein	NA	NA	NA	NA
VDL37210.1\|3458771_3458906_+	hypothetical protein	Q858R0	Vibrio_phage	8.2e-09	72.7
VDL37217.1\|3459029_3460406_+	hypothetical protein	NA	NA	NA	NA
VDL37224.1\|3460664_3461486_-	hypothetical protein	NA	NA	NA	NA
VDL37232.1\|3461630_3461906_+	hypothetical protein	NA	NA	NA	NA
VDL37239.1\|3462982_3463477_-	RNA pyrophosphohydrolase	NA	NA	NA	NA
VDL37245.1\|3463492_3464143_-	hypothetical protein	NA	NA	NA	NA
VDL37252.1\|3464146_3465823_-	Adenylosuccinate synthetase	NA	NA	NA	NA
VDL37258.1\|3466516_3467035_+\|transposase	Putative transposase (identified by ISEscan HMM)	NA	NA	NA	NA
VDL37264.1\|3467146_3467662_+\|transposase	Putative transposase (identified by ISEscan HMM)	S5WIU1	Leptospira_phage	6.8e-35	46.5

DBSCAN-SWA_8

4698554 : 4732631

Shigella_phage(30.0%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
VDL43302.1\|4698554_4699238_-\|tRNA	tRNA 2-thiocytidine biosynthesis protein TtcA	A0A0U2S5Z2	Escherichia_phage	7.3e-85	71.8
VDL43308.1\|4699422_4700316_-\|tRNA	tRNA 2-thiocytidine biosynthesis protein TtcA	A0A0U2S5Z2	Escherichia_phage	1.2e-90	61.4
VDL43314.1\|4701041_4701152_+	hypothetical protein	NA	NA	NA	NA
VDL43319.1\|4701577_4702420_-	RCS-specific HTH-type transcriptional activator RclR	NA	NA	NA	NA
VDL43324.1\|4702537_4703071_+	hypothetical protein	NA	NA	NA	NA
VDL43330.1\|4703098_4703647_+	hypothetical protein	NA	NA	NA	NA
VDL43334.1\|4704057_4704279_+	hypothetical protein	NA	NA	NA	NA
VDL43340.1\|4704285_4704843_-	DNA-invertase hin	A0A0C4UR34	Shigella_phage	3.3e-59	63.2
VDL43345.1\|4704836_4705208_-	hypothetical protein	NA	NA	NA	NA
VDL43350.1\|4705204_4705705_-	hypothetical protein	NA	NA	NA	NA
VDL43357.1\|4705701_4706028_-	hypothetical protein	NA	NA	NA	NA
VDL43362.1\|4706875_4707262_-	hypothetical protein	NA	NA	NA	NA
VDL43369.1\|4707258_4707549_-	hypothetical protein	NA	NA	NA	NA
VDL43374.1\|4707733_4708132_-	Mercuric resistance operon regulatory protein	NA	NA	NA	NA
VDL43380.1\|4708206_4708557_+	hypothetical protein	NA	NA	NA	NA
VDL43386.1\|4708569_4708845_+	Mercuric transport protein periplasmic component	NA	NA	NA	NA
VDL43391.1\|4708852_4709065_+	hypothetical protein	NA	NA	NA	NA
VDL43396.1\|4709077_4712071_-\|transposase	Putative transposase (identified by ISEscan HMM)	Q1MVP5	Enterobacteria_phage	5.7e-259	47.6
VDL43401.1\|4712074_4712485_-	hypothetical protein	NA	NA	NA	NA
VDL43407.1\|4712484_4712724_-	hypothetical protein	NA	NA	NA	NA
VDL43412.1\|4712821_4713436_+	DNA-invertase hin	A0A0C4UR34	Shigella_phage	1.3e-37	51.9
VDL43418.1\|4713488_4713725_-	hypothetical protein	NA	NA	NA	NA
VDL43423.1\|4713721_4714087_-	hypothetical protein	NA	NA	NA	NA
VDL43429.1\|4714103_4715750_-	Mercuric reductase	A0A2K5B2C5	Erysipelothrix_phage	1.0e-39	28.3
VDL43434.1\|4715746_4715992_-	hypothetical protein	NA	NA	NA	NA
VDL43439.1\|4715994_4716270_-	Mercuric transport protein periplasmic component	NA	NA	NA	NA
VDL43445.1\|4716285_4716636_-	hypothetical protein	NA	NA	NA	NA
VDL43449.1\|4716707_4717142_+	Mercuric resistance operon regulatory protein	NA	NA	NA	NA
VDL43457.1\|4717416_4717935_+	Inner membrane protein RclC	NA	NA	NA	NA
VDL43462.1\|4717964_4718810_-	RCS-specific HTH-type transcriptional activator RclR	NA	NA	NA	NA
VDL43467.1\|4719046_4722076_-\|transposase	Putative transposase (identified by ISEscan HMM)	NA	NA	NA	NA
VDL43472.1\|4722059_4722662_-	DNA-invertase hin	A0A0C4UR34	Shigella_phage	1.6e-40	50.3
VDL43478.1\|4722853_4723231_+	hypothetical protein	NA	NA	NA	NA
VDL43483.1\|4723211_4723547_+	hypothetical protein	NA	NA	NA	NA
VDL43489.1\|4723561_4723867_+	hypothetical protein	NA	NA	NA	NA
VDL43495.1\|4723919_4724246_+	hypothetical protein	NA	NA	NA	NA
VDL43499.1\|4724242_4724623_+	hypothetical protein	NA	NA	NA	NA
VDL43504.1\|4725125_4726040_+	Cyclic di-GMP phosphodiesterase response regulator RpfG	NA	NA	NA	NA
VDL43509.1\|4726449_4726689_+	hypothetical protein	NA	NA	NA	NA
VDL43514.1\|4726688_4727099_+	hypothetical protein	NA	NA	NA	NA
VDL43519.1\|4727102_4729259_+\|transposase	Putative transposase (identified by ISEscan HMM)	Q1MVP5	Enterobacteria_phage	2.8e-159	43.8
VDL43524.1\|4729306_4730095_+\|transposase	Putative transposase (identified by ISEscan HMM)	A0A125RQ78	Bacillus_phage	9.6e-81	56.4
VDL43529.1\|4730143_4730881_-	Carbonic anhydrase 2	NA	NA	NA	NA
VDL43535.1\|4731016_4732273_-\|transposase	Putative transposase (identified by ISEscan HMM)	A0A218MNE7	uncultured_virus	2.2e-39	39.1
VDL43540.1\|4732292_4732631_-\|transposase	Putative transposase (identified by ISEscan HMM)	NA	NA	NA	NA

DBSCAN-SWA_9

4776019 : 4784199

Pseudomonas_phage(90.91%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
VDL43769.1\|4776019_4776154_-\|tRNA	tRNA 2-thiocytidine biosynthesis protein TtcA	A0A0U2S5Z2	Escherichia_phage	5.6e-10	81.1
VDL43775.1\|4776259_4777276_-	Tyrosine recombinase XerD	Q56VN7	Pseudomonas_phage	5.0e-191	99.7
VDL43780.1\|4777275_4778568_-	hypothetical protein	Q56VN8	Pseudomonas_phage	1.0e-252	96.5
VDL43784.1\|4778698_4778800_-	hypothetical protein	NA	NA	NA	NA
VDL43789.1\|4778796_4780071_-	Zona occludens toxin	Q56VN9	Pseudomonas_phage	4.4e-200	87.3
VDL43795.1\|4780074_4780431_-	hypothetical protein	Q56VP0	Pseudomonas_phage	7.9e-59	100.0
VDL43800.1\|4780435_4781626_-	hypothetical protein	Q56VP1	Pseudomonas_phage	1.3e-49	57.6
VDL43807.1\|4781894_4782143_-	hypothetical protein	Q56VP2	Pseudomonas_phage	2.0e-32	92.7
VDL43813.1\|4782155_4782407_-	hypothetical protein	NA	NA	NA	NA
VDL43819.1\|4782419_4782512_-	hypothetical protein	Q56VP4	Pseudomonas_phage	7.3e-09	100.0
VDL43824.1\|4782528_4782963_-	hypothetical protein	Q56VP5	Pseudomonas_phage	7.1e-62	98.6
VDL43829.1\|4783086_4783470_-	hypothetical protein	Q56VP6	Pseudomonas_phage	1.7e-27	97.1
VDL43834.1\|4783459_4783984_-	hypothetical protein	NA	NA	NA	NA
VDL43839.1\|4783983_4784199_-	hypothetical protein	Q56VP9	Pseudomonas_phage	1.4e-34	93.0

DBSCAN-SWA_10

5191734 : 5246869

Pseudomonas_phage(87.5%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
VDL45902.1\|5191734_5192676_-	2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase	A0A1D8EUH4	Mycobacterium_phage	4.4e-08	33.3
VDL45908.1\|5192784_5193468_-	HTH-type transcriptional repressor NicS	NA	NA	NA	NA
VDL45913.1\|5193555_5194434_+	hypothetical protein	NA	NA	NA	NA
VDL45918.1\|5195083_5195308_-	hypothetical protein	A0A1W6JT95	Pseudomonas_phage	4.7e-33	98.6
VDL45924.1\|5195380_5195620_-	hypothetical protein	A0A0S2SY98	Pseudomonas_phage	2.9e-33	91.0
VDL45929.1\|5195616_5195919_-	hypothetical protein	A0A0A0YUD8	Pseudomonas_phage	2.6e-42	89.0
VDL45935.1\|5196474_5196756_-	hypothetical protein	A0A0A0YR51	Pseudomonas_phage	7.4e-44	95.7
VDL45937.1\|5196756_5197317_-	hypothetical protein	A0A0A0YWE7	Pseudomonas_phage	3.2e-99	98.9
VDL45943.1\|5197319_5197511_-	hypothetical protein	A0A1W6JT89	Pseudomonas_phage	2.0e-29	100.0
VDL45949.1\|5197503_5198091_-	hypothetical protein	A0A1W6JT86	Pseudomonas_phage	3.4e-99	93.3
VDL45954.1\|5198113_5199607_-	hypothetical protein	A0A1B0YZU9	Pseudomonas_phage	4.8e-283	97.6
VDL45959.1\|5199596_5200016_-	hypothetical protein	A0A1W6JT91	Pseudomonas_phage	1.3e-68	98.6
VDL45962.1\|5200026_5200572_-	hypothetical protein	A0A1B0YZV4	Pseudomonas_phage	7.0e-99	97.8
VDL45967.1\|5200571_5200982_-	hypothetical protein	A0A1W6JT78	Pseudomonas_phage	1.4e-54	92.6
VDL45973.1\|5200984_5202682_-	hypothetical protein	A0A1W6JTA3	Pseudomonas_phage	0.0e+00	97.9
VDL45978.1\|5202681_5203203_-	hypothetical protein	A0A1W6JT98	Pseudomonas_phage	3.7e-97	98.3
VDL45983.1\|5203242_5205726_-	hypothetical protein	A0A1B0YZV6	Pseudomonas_phage	0.0e+00	98.1
VDL45988.1\|5205828_5206131_-	hypothetical protein	A0A1W6JT80	Pseudomonas_phage	7.7e-47	98.0
VDL45995.1\|5206190_5206832_-	hypothetical protein	A0A1W6JT76	Pseudomonas_phage	1.8e-109	94.8
VDL46000.1\|5206913_5207666_-	hypothetical protein	A0A1B0YZT8	Pseudomonas_phage	9.9e-136	98.4
VDL46002.1\|5207667_5207862_-	hypothetical protein	A0A1W6JT79	Pseudomonas_phage	1.1e-25	93.8
VDL46008.1\|5207865_5208336_-	hypothetical protein	A0A1W6JT75	Pseudomonas_phage	4.5e-86	98.7
VDL46015.1\|5208332_5208662_-	hypothetical protein	A0A1W6JT71	Pseudomonas_phage	1.2e-56	98.2
VDL46020.1\|5208658_5208976_-	hypothetical protein	A0A1W6JT93	Pseudomonas_phage	1.7e-49	99.0
VDL46025.1\|5209042_5211124_-\|protease	ATP-dependent Clp protease proteolytic subunit	A0A1W6JT88	Pseudomonas_phage	0.0e+00	99.3
VDL46031.1\|5211095_5212742_-	hypothetical protein	A0A1W6JTB6	Pseudomonas_phage	0.0e+00	99.8
VDL46038.1\|5212741_5212957_-	hypothetical protein	A0A1W6JT66	Pseudomonas_phage	6.5e-32	100.0
VDL46042.1\|5212947_5214912_-	hypothetical protein	A0A1B0Z2K0	Pseudomonas_phage	0.0e+00	98.3
VDL46047.1\|5214883_5215429_-	hypothetical protein	A0A1B0Z033	Pseudomonas_phage	1.6e-95	99.4
VDL46052.1\|5215580_5216324_-	hypothetical protein	A0A1B0Z000	Pseudomonas_phage	1.4e-134	98.8
VDL46057.1\|5216376_5216574_-	hypothetical protein	A0A1W6JTG8	Pseudomonas_phage	1.0e-23	100.0
VDL46063.1\|5216787_5217027_-	hypothetical protein	A0A0H5AWC3	Pseudomonas_phage	6.3e-20	53.2
VDL46068.1\|5217026_5217644_-	hypothetical protein	A0A1W6JTC9	Pseudomonas_phage	2.5e-108	94.6
VDL46073.1\|5217640_5217973_-	hypothetical protein	A0A1W6JTC7	Pseudomonas_phage	1.9e-54	96.4
VDL46080.1\|5218058_5218589_-	hypothetical protein	A0A2D1GLJ3	Escherichia_phage	1.2e-26	37.3
VDL46085.1\|5219117_5219675_-	hypothetical protein	A0A0A0YRV6	Pseudomonas_phage	1.2e-74	97.1
VDL46091.1\|5219671_5219956_-	hypothetical protein	A0A1W6JTC1	Pseudomonas_phage	4.5e-41	96.6
VDL46096.1\|5219952_5221350_-	Replicative DNA helicase	A0A1W6JTB3	Pseudomonas_phage	1.7e-266	100.0
VDL46100.1\|5221346_5222162_-	DNA replication protein DnaC	A0A1W6JTD8	Pseudomonas_phage	1.5e-153	100.0
VDL46106.1\|5222142_5222982_-	hypothetical protein	A0A1W6JTD5	Pseudomonas_phage	5.3e-146	93.9
VDL46111.1\|5222978_5223209_-	hypothetical protein	A0A1W6JTF8	Pseudomonas_phage	2.3e-27	77.6
VDL46116.1\|5223205_5223970_-	hypothetical protein	A0A1W6JTB2	Pseudomonas_phage	1.7e-138	99.2
VDL46120.1\|5223966_5224458_-	hypothetical protein	A0A1W6JTB9	Pseudomonas_phage	9.2e-90	100.0
VDL46125.1\|5224454_5224730_-	hypothetical protein	A0A1W6JTB7	Pseudomonas_phage	1.7e-40	100.0
VDL46130.1\|5224726_5225035_-	hypothetical protein	A0A0A0YWH5	Pseudomonas_phage	5.1e-46	96.1
VDL46136.1\|5225031_5225319_-	hypothetical protein	A0A0A0YQ33	Pseudomonas_phage	7.6e-44	100.0
VDL46143.1\|5225315_5225627_-	hypothetical protein	A0A0A0YUF6	Pseudomonas_phage	1.7e-44	91.3
VDL46147.1\|5226039_5226345_-	hypothetical protein	A0A127KNT2	Pseudomonas_phage	4.0e-11	53.0
VDL46152.1\|5226862_5227114_+	hypothetical protein	A0A1W6JTC8	Pseudomonas_phage	1.9e-30	69.9
VDL46157.1\|5227262_5227649_+	hypothetical protein	A0A1W6JTA9	Pseudomonas_phage	8.3e-54	94.9
VDL46163.1\|5227651_5227885_+	hypothetical protein	A0A0A0YQ28	Pseudomonas_phage	6.6e-38	100.0
VDL46167.1\|5227984_5228239_+	hypothetical protein	A0A0A0YUF2	Pseudomonas_phage	3.8e-39	100.0
VDL46173.1\|5228235_5229072_+\|transposase	Putative transposase (identified by ISEscan HMM)	A0A0A0YRT7	Pseudomonas_phage	3.2e-127	99.3
VDL46178.1\|5229114_5229927_+	Ice nucleation protein	Q775A9	Bordetella_phage	2.5e-36	53.0
VDL46183.1\|5229929_5230160_+	hypothetical protein	A0A1W6JTB4	Pseudomonas_phage	4.5e-31	94.7
VDL46188.1\|5230162_5230963_+	hypothetical protein	A0A0A0YUE9	Pseudomonas_phage	6.9e-95	85.5
VDL46194.1\|5230959_5231487_+	hypothetical protein	A0A0A0YRT2	Pseudomonas_phage	1.2e-50	98.0
VDL46200.1\|5231483_5231600_+	hypothetical protein	A0A1W6JTC2	Pseudomonas_phage	6.8e-12	100.0
VDL46205.1\|5231599_5231791_+	hypothetical protein	A0A1W6JTB8	Pseudomonas_phage	5.4e-30	100.0
VDL46211.1\|5231787_5232507_+	hypothetical protein	A0A1W6JTE0	Pseudomonas_phage	4.3e-128	97.1
VDL46220.1\|5232971_5234159_+	Putative defective protein IntQ	A0A1W6JTA0	Pseudomonas_phage	6.4e-230	100.0
VDL46225.1\|5235745_5235976_+\|transposase	Putative transposase (identified by ISEscan HMM)	NA	NA	NA	NA
VDL46232.1\|5236062_5236440_+\|transposase	Putative transposase (identified by ISEscan HMM)	S5WIU1	Leptospira_phage	2.0e-23	45.0
VDL46237.1\|5236621_5239648_-	Type-1 restriction enzyme R protein	A0A220A398	Liberibacter_phage	4.6e-22	24.3
VDL46243.1\|5239644_5240352_-	hypothetical protein	NA	NA	NA	NA
VDL46248.1\|5240348_5241692_-	hypothetical protein	C7BGE8	Burkholderia_phage	2.5e-12	29.1
VDL46253.1\|5241760_5242951_-	Type-1 restriction enzyme EcoKI specificity protein	NA	NA	NA	NA
VDL46260.1\|5242947_5245176_-	putative type I restriction enzymeP M protein	A0A220A2U4	Liberibacter_phage	2.4e-28	29.4
VDL46266.1\|5245730_5245994_+\|transposase	Putative transposase (identified by ISEscan HMM)	NA	NA	NA	NA
VDL46271.1\|5246026_5246869_+\|transposase	Putative transposase (identified by ISEscan HMM)	S5WIU1	Leptospira_phage	1.3e-51	41.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. LR130534

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection