CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
LR134165	Bacillus licheniformis strain NCTC8721 genome assembly, chromosome: 1	2 crisprs	csa3,WYL,DinG,cas3,DEDDh	7	16	5	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: LR134165_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

LR134165_1

868022-869906

Orphan

Consensus_repeat	Method
CAACCGGNNCNACNGGAGCAAC	CRT

30 spacers

The CRISPR arrays of LR134165_1

>merge|LR134165|1|868022-869906|CRT
CAACCGGCCCGACAGGTCCAACCGGTCCAACAGGAGCGACAGGTCCAACAGGTCCGACGGGAGCAACCGGCCCGACAGGAGCGACAGGCCCAACAGGTCCGACGGGAGCAACCGGCCCAACAGGTCCGACAGGAGCAACAGGTCCGACGGGAGCAACCGGAGCGACAGGCCCAACAGGTCCGACGGGAGCAACCGGCCCGACAGGAGCAACGGGAGCAACCGGAGCAACGGGAGCAACCGGCCCGACAGGAGCAACCGGAGCGACAGGAGCCACGGGAGCGACAGGAGCAACCGGAGCGACAGGAGCAACCGGAGCGACAGGAGCAACCGGTCCGACGGGAGCCACGGGAGCGACAGGAGCAACCGGCCCGACAGGAGCAACGGGAGCAACAGGTCCGACGGGAGCAACCGGAGCAACCGGCCCGACAGGTCCAACGGGAGCGACAGGCGCAACGGGAGCAACCGGCCCGACAGGTCCAACGGGAGCGACAGGCCCAACAGGCCCAACAGGAGCCACGGGAGCAACCGGCCCGACGGGAGCCACGGGAGCGACAGGCCCAACAGGTCCGACGGGAGCCACGGGAGCGACAGGAGCAACCGGAGCGACAGGAGCAACAGGTCCGACGGGAGCCACGGGAGCAACCGGCCCGACGGGAGCCACGGGAGCGACAGGAGCAACCGGAGCGACAGGAGCAACAGGTCCAACCGGCGCAACGGGAGCAACCGGCCCGACAGGTCCAACGGGAGCAACAGGTCCAACCGGCGCAACGGGAGCAACCGGCCCGACAGGAGCAACCGGTCCGACGGGAGCAACCGGCCCGACAGGAGCAACCGGCGCAACGGGAGCAACCGGCCCGACAGGAGCAACGGGAGCGACAGGCCCAACAGGTCCGACGGGAGCAACCGGAGCGACAGGAGCAACCGGAGCAACCGGAGCAACCGGCGCAACGGGAGCGACAGGCCCAACAGGTCCGACGGGAGCAACCGGAGCGACAGGAGCAACCGGAGCGACAGGTCCAACAGGAGCCACGGGAGCAACCGGTCCGACGGGAGCAACAGGCGCAACCGGAGCAACCGGCCCGACAGGAGCAACCGGCCCGACAGGAGCAACCGGTCCGACGGGAGCAACCGGAGCGACAGGAGCAACCGGAGCAACGGGAGCAACCGGCCCGACGGGAGCAACCGGTCCAACCGGAGCAACCGGAGCGACAGGAGCAACCGGCCCGACAGGAGCAACCGGCCCGACAGGAGCAACCGGCCCGACAGGAGCAACCGGCCCGACAGGAGCAACCGGTCCGACGGGAGCAACCGGAGCGACAGGCCCAACCGGTCCGACGGGAGCAACCGGAGCGACAGGAGCAACAGGTCCAACCGGAGCAACGGGAGCAACCGGCCCGACAGGAGCAACCGGCCCGACAGGAGCAACCGGAGCGACAGGAGCAACAGGAGCAACCGGCGCAACGGGAGCAACCGGAGCGACAGGAGCAACCGGAGCGACAGGAGCAACCGGAGCGACAGGAGCAACCGGAGCGACAGGAGCAACCGGAGCGACAGGAGCAACAGGTCCGACGGGAGCAACCGGAGCAACGGGAGCAACCGGCCCGACAGGAGCAACCGGCCCGACAGGAGCCACGGGAGCAACCGGAGCGACAGGAGCAACCGGCGCAACGGGAGCAACCGGCGCAACGGGAGCAACCGGAGCAACGGGAGCAACCGGCGCAACGGGAGCAACCGGAGCAACGGGAGCAACCGGTCCGACGGGAGCAACCGGTCCAACCGGAGCGACAGGTCCAACAGGTCCAACCGGAGCGACAGGTCCAACCGGAGCGACAGGTCCAACCGGCCCGACAGGTCCAACTGGCCCAACAGGTCCAACCGGCGCTTA

>LR134165|1|1|868022-869906|CRT
CAACCGGCCCGACAGGTCCAAC	CGGTCCAACAGGAGCGACAGGTCCAACAGGTCCGACGGGAG
CAACCGGCCCGACAGGAGCGAC	AGGCCCAACAGGTCCGACGGGAGCAACCGGCC
CAACAGGTCCGACAGGAGCAAC	AGGTCCGACGGGAGCAACCGGAGCGACAGGCCCAACAGGTCCGACGGGAG
CAACCGGCCCGACAGGAGCAAC	GGGAGCAACCGGAGCAACGGGAG
CAACCGGCCCGACAGGAGCAAC	CGGAGCGACAGGAGCCACGGGAGCGACAGGAG
CAACCGGAGCGACAGGAGCAAC	CGGAGCGACAGGAGCAACCGGTCCGACGGGAG
CCACGGGAGCGACAGGAGCAAC	CGGCCCGACAGGAGCAACGGGAGCAACAGGTC
CGACGGGAGCAACCGGAGCAAC	CGGCCCGACAGGTCCAACGGGAG
CGACAGGCGCAACGGGAGCAAC	CGGCCCGACAGGTCCAACGGGAGCGACAGGCCCAACAGGCC
CAACAGGAGCCACGGGAGCAAC	CGGCCCGACGGGAGCCACGGGAGCGACAGGCCCAACAGGTC
CGACGGGAGCCACGGGAGCGAC	AGGAGCAACCGGAGCGACAGGAGCAACAGGTCCGACGGGAGCCACGGGAGCAACCGGCC
CGACGGGAGCCACGGGAGCGAC	AGGAGCAACCGGAGCGACAGGAGCAACAGGTC
CAACCGGCGCAACGGGAGCAAC	CGGCCCGACAGGTCCAACGGGAGCAACAGGTC
CAACCGGCGCAACGGGAGCAAC	CGGCCCGACAGGAGCAACCGGTCCGACGGGAGCAACCGGCCCGACAGGAG
CAACCGGCGCAACGGGAGCAAC	CGGCCCGACAGGAGCAACGGGAGCGACAGGCCCAACAGGTCCGACGGGAGCAACCGGAGCGACAGGAG
CAACCGGAGCAACCGGAGCAAC	CGGCGCAACGGGAGCGACAGGCCCAACAGGTCCGACGGGAG
CAACCGGAGCGACAGGAGCAAC	CGGAGCGACAGGTCCAACAGGAGCCACGGGAGCAACCGGTCCGACGGGAGCAACAGGCGCAACCGGAG
CAACCGGCCCGACAGGAGCAAC	CGGCCCGACAGGAGCAACCGGTCCGACGGGAGCAACCGGAGCGACAGGAGCAACCGGAGCAACGGGAG
CAACCGGCCCGACGGGAGCAAC	CGGTCCAACCGGAGCAACCGGAGCGACAGGAGCAACCGGCCCGACAGGAG
CAACCGGCCCGACAGGAGCAAC	CGGCCCGACAGGAGCAACCGGCCCGACAGGAG
CAACCGGTCCGACGGGAGCAAC	CGGAGCGACAGGCCCAACCGGTCCGACGGGAG
CAACCGGAGCGACAGGAGCAAC	AGGTCCAACCGGAGCAACGGGAGCAACCGGCCCGACAGGAGCAACCGGCCCGACAGGAG
CAACCGGAGCGACAGGAGCAAC	AGGAGCAACCGGCGCAACGGGAG
CAACCGGAGCGACAGGAGCAAC	CGGAGCGACAGGAGCAACCGGAGCGACAGGAG
CAACCGGAGCGACAGGAGCAAC	CGGAGCGACAGGAGCAACAGGTCCGACGGGAG
CAACCGGAGCAACGGGAGCAAC	CGGCCCGACAGGAGCAACCGGCCCGACAGGAGCCACGGGAGCAACCGGAGCGACAGGAG
CAACCGGCGCAACGGGAGCAAC	CGGCGCAACGGGAGCAACCGGAGCAACGGGAG
CAACCGGCGCAACGGGAGCAAC	CGGAGCAACGGGAGCAACCGGTCCGACGGGAG
CAACCGGTCCAACCGGAGCGAC	AGGTCCAACAGGTCCAACCGGAG
CGACAGGTCCAACCGGAGCGAC	AGGTCCAACCGGCCCGACAGGTCCAACTGGCC
CAACAGGTCCAACCGGCGCTTA

Protein	Signature genes	Signature genes Name	Protein_function
LR134165.1\|VEB17903.1\|879048_880113_+\|oxidoreductase	unknown	unknown	gnl\|CDD\|223745
LR134165.1\|VEB17889.1\|858578_859295_+\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|274116
LR134165.1\|VEB17901.1\|876738_877821_+\|glycosyl-transferase-family-2	unknown	unknown	gnl\|CDD\|133005
LR134165.1\|VEB17894.1\|866169_867261_+\|GXT-repeat-containing-collagen-like-protein	unknown	unknown	gnl\|CDD\|237537
LR134165.1\|VEB17898.1\|871732_872707_-\|NAD-dependent-epimerase/dehydratase	unknown	unknown	gnl\|CDD\|187566
LR134165.1\|VEB17887.1\|855377_856790_+\|PTS-system-trehalose-specific-transporter-subunit-IIBC	unknown	unknown	gnl\|CDD\|273916
LR134165.1\|VEB17891.1\|860220_862185_+\|GXT-repeat-containing-collagen-like-protein	unknown	unknown	gnl\|CDD\|236090
LR134165.1\|VEB17904.1\|880213_881494_+\|UDP-glucose-6-dehydrogenase	unknown	unknown	gnl\|CDD\|274399
LR134165.1\|VEB17896.1\|870084_871176_-\|spore-coat-biosynthesis-protein	unknown	unknown	gnl\|CDD\|99740
LR134165.1\|VEB17902.1\|877942_879052_+\|spore-coat-biosynthesis-protein	unknown	unknown	gnl\|CDD\|99740
LR134165.1\|VEB17899.1\|872774_874148_-\|transferase	unknown	unknown	gnl\|CDD\|223515
LR134165.1\|VEB17892.1\|862405_862843_+\|GXT-repeat-containing-collagen-like-protein	unknown	unknown	unknown
LR134165.1\|VEB17890.1\|859401_860094_+\|hexapaptide-repeat-containing-transferase	unknown	unknown	gnl\|CDD\|100048
LR134165.1\|VEB17905.1\|881595_882486_+\|serine-peptidase	unknown	unknown	gnl\|CDD\|223999
LR134165.1\|VEB17886.1\|853776_855189_+\|sodium:alanine-symporter-YflA	unknown	unknown	gnl\|CDD\|224040
LR134165.1\|VEB17888.1\|856862_858557_+\|glycoside-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|274115
LR134165.1\|VEB17893.1\|862977_865410_-\|putative-threonine-rich-GPI-anchored-glycoprotein	unknown	unknown	gnl\|CDD\|223021
LR134165.1\|VEB17885.1\|853328_853706_+\|YflB	unknown	unknown	gnl\|CDD\|378159
LR134165.1\|VEB17897.1\|871172_871715_-\|hexapaptide-repeat-containing-transferase	unknown	unknown	gnl\|CDD\|100047
LR134165.1\|VEB17900.1\|874301_876545_-\|glycosyl-transferase-family-protein	unknown	unknown	gnl\|CDD\|133055

Protein	Function_ID	Function_description	E-value
LR134165.1\|VEB17903.1\|879048_880113_+\|oxidoreductase	gnl\|CDD\|223745	COG0673, MviM, Predicted dehydrogenases and related proteins [General function prediction only].	2.66683e-71
LR134165.1\|VEB17889.1\|858578_859295_+\|GntR-family-transcriptional-regulator	gnl\|CDD\|274116	TIGR02404, Trehalose_operon_transcriptional_repressor, trehalose operon repressor, B. subtilis-type. This family consists of repressors of the GntR family typically associated with trehalose utilization operons. Trehalose is imported as trehalose-6-phosphate and then hydrolyzed by alpha,alpha-phosphotrehalase to glucose and glucose-6-P. This family includes repressors mostly from Gram-positive lineages and does not include the TreR from E. coli. [Regulatory functions, DNA interactions].	4.2589e-116
LR134165.1\|VEB17901.1\|876738_877821_+\|glycosyl-transferase-family-2	gnl\|CDD\|133005	cd02511, Beta4Glucosyltransferase, UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.	1.16222e-45
LR134165.1\|VEB17894.1\|866169_867261_+\|GXT-repeat-containing-collagen-like-protein	gnl\|CDD\|237537	PRK13875, PRK13875, conjugal transfer protein TrbL; Provisional.	1.18126e-08
LR134165.1\|VEB17898.1\|871732_872707_-\|NAD-dependent-epimerase/dehydratase	gnl\|CDD\|187566	cd05256, UDP_AE_SDR_e, UDP-N-acetylglucosamine 4-epimerase, extended (e) SDRs. This subgroup contains UDP-N-acetylglucosamine 4-epimerase of Pseudomonas aeruginosa, WbpP, an extended SDR, that catalyzes the NAD+ dependent conversion of UDP-GlcNAc and UDPGalNA to UDP-Glc and UDP-Gal. This subgroup has the characteristic active site tetrad and NAD-binding motif of the extended SDRs. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	1.001e-70
LR134165.1\|VEB17887.1\|855377_856790_+\|PTS-system-trehalose-specific-transporter-subunit-IIBC	gnl\|CDD\|273916	TIGR01992, phosphotransferase_system_trehalose_permease, PTS system, trehalose-specific IIBC component. This model represents the fused enzyme II B and C components of the trehalose-specific PTS sugar transporter system. Trehalose is converted to trehalose-6-phosphate in the process of translocation into the cell. These transporters lack their own IIA domains and instead use the glucose IIA protein (IIAglc or Crr). The exceptions to this rule are Staphylococci and Streptococci which contain their own A domain as a C-terminal fusion. This family is closely related to the sucrose transporting PTS IIBC enzymes and the B and C domains of each are described by subfamily-domain level TIGRFAMs models (TIGR00826 and TIGR00852, respectively). In E. coli, B. subtilis and P. fluorescens the presence of this gene is associated with the presence of trehalase which degrades T6P to glucose and glucose-6-P. Trehalose may also be transported (in Salmonella) via the mannose PTS or galactose permease systems, or (in Sinorhizobium, Thermococcus and Sulfolobus, for instance) by ABC transporters.	0
LR134165.1\|VEB17891.1\|860220_862185_+\|GXT-repeat-containing-collagen-like-protein	gnl\|CDD\|236090	PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated.	5.98043e-09
LR134165.1\|VEB17904.1\|880213_881494_+\|UDP-glucose-6-dehydrogenase	gnl\|CDD\|274399	TIGR03026, NDP-sugDHase, nucleotide sugar dehydrogenase. Enzymes in this family catalyze the NAD-dependent alcohol-to-acid oxidation of nucleotide-linked sugars. Examples include UDP-glucose 6-dehydrogenase (1.1.1.22), GDP-mannose 6-dehydrogenase (1.1.1.132), UDP-N-acetylglucosamine 6-dehydrogenase (1.1.1.136), UDP-N-acetyl-D-galactosaminuronic acid dehydrogenase, and UDP-N-acetyl-D-mannosaminuronic acid dehydrogenase. These enzymes are most often involved in the biosynthesis of polysaccharides and are often found in operons devoted to that purpose. All of these enzymes contain three Pfam domains, pfam03721, pfam00984, and pfam03720 for the N-terminal, central, and C-terminal regions respectively.	3.71529e-180
LR134165.1\|VEB17896.1\|870084_871176_-\|spore-coat-biosynthesis-protein	gnl\|CDD\|99740	cd00616, AHBA_syn, 3-amino-5-hydroxybenzoic acid synthase family (AHBA_syn). AHBA_syn family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The members of this CD are involved in various biosynthetic pathways for secondary metabolites. Some well studied proteins in this CD are AHBA_synthase, protein product of pleiotropic regulatory gene degT, Arnb aminotransferase and pilin glycosylation protein. The prototype of this family, the AHBA_synthase, is a dimeric PLP dependent enzyme. AHBA_syn is the terminal enzyme of 3-amino-5-hydroxybenzoic acid (AHBA) formation which is involved in the biosynthesis of ansamycin antibiotics, including rifamycin B. Some members of this CD are involved in 4-amino-6-deoxy-monosaccharide D-perosamine synthesis. Perosamine is an important element in the glycosylation of several cell products, such as antibiotics and lipopolysaccharides of gram-positive and gram-negative bacteria. The pilin glycosylation protein encoded by gene pglA, is a galactosyltransferase involved in pilin glycosylation. Additionally, this CD consists of ArnB (PmrH) aminotransferase, a 4-amino-4-deoxy-L-arabinose lipopolysaccharide-modifying enzyme. This CD also consists of several predicted pyridoxal phosphate-dependent enzymes apparently involved in regulation of cell wall biogenesis. The catalytic lysine which is present in all characterized PLP dependent enzymes is replaced by histidine in some members of this CD.	1.86717e-106
LR134165.1\|VEB17902.1\|877942_879052_+\|spore-coat-biosynthesis-protein	gnl\|CDD\|99740	cd00616, AHBA_syn, 3-amino-5-hydroxybenzoic acid synthase family (AHBA_syn). AHBA_syn family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The members of this CD are involved in various biosynthetic pathways for secondary metabolites. Some well studied proteins in this CD are AHBA_synthase, protein product of pleiotropic regulatory gene degT, Arnb aminotransferase and pilin glycosylation protein. The prototype of this family, the AHBA_synthase, is a dimeric PLP dependent enzyme. AHBA_syn is the terminal enzyme of 3-amino-5-hydroxybenzoic acid (AHBA) formation which is involved in the biosynthesis of ansamycin antibiotics, including rifamycin B. Some members of this CD are involved in 4-amino-6-deoxy-monosaccharide D-perosamine synthesis. Perosamine is an important element in the glycosylation of several cell products, such as antibiotics and lipopolysaccharides of gram-positive and gram-negative bacteria. The pilin glycosylation protein encoded by gene pglA, is a galactosyltransferase involved in pilin glycosylation. Additionally, this CD consists of ArnB (PmrH) aminotransferase, a 4-amino-4-deoxy-L-arabinose lipopolysaccharide-modifying enzyme. This CD also consists of several predicted pyridoxal phosphate-dependent enzymes apparently involved in regulation of cell wall biogenesis. The catalytic lysine which is present in all characterized PLP dependent enzymes is replaced by histidine in some members of this CD.	2.24791e-171
LR134165.1\|VEB17899.1\|872774_874148_-\|transferase	gnl\|CDD\|223515	COG0438, RfaG, Glycosyltransferase [Cell envelope biogenesis, outer membrane].	1.19612e-16
LR134165.1\|VEB17890.1\|859401_860094_+\|hexapaptide-repeat-containing-transferase	gnl\|CDD\|100048	cd03358, LbH_WxcM_N_like, WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain. WcxM is thought to be bifunctional, catalyzing both the isomerization and transacetylation reactions of keto-hexoses. It contains an N-terminal LbH domain responsible for the transacetylation function and a C-terminal isomerase domain. The LbH domain contains imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X), typical of enzymes with acyltransferase activity.	2.3885e-50
LR134165.1\|VEB17905.1\|881595_882486_+\|serine-peptidase	gnl\|CDD\|223999	COG1073, COG1073, Hydrolases of the alpha/beta superfamily [General function prediction only].	1.55936e-15
LR134165.1\|VEB17886.1\|853776_855189_+\|sodium:alanine-symporter-YflA	gnl\|CDD\|224040	COG1115, AlsT, Na+/alanine symporter [Amino acid transport and metabolism].	0
LR134165.1\|VEB17888.1\|856862_858557_+\|glycoside-hydrolase-family-protein	gnl\|CDD\|274115	TIGR02403, Trehalose-6-phosphate_hydrolase, alpha,alpha-phosphotrehalase. Trehalose is a glucose disaccharide that serves in many biological systems as a compatible solute for protection against hyperosmotic and thermal stress. This family describes trehalose-6-phosphate hydrolase, product of the treC (or treA) gene, which is often found together with a trehalose uptake transporter and a trehalose operon repressor.	0
LR134165.1\|VEB17893.1\|862977_865410_-\|putative-threonine-rich-GPI-anchored-glycoprotein	gnl\|CDD\|223021	PHA03247, PHA03247, large tegument protein UL36; Provisional.	5.57231e-20
LR134165.1\|VEB17885.1\|853328_853706_+\|YflB	gnl\|CDD\|378159	pfam09350, DUF1992, Domain of unknown function (DUF1992). This family of proteins are functionally uncharacterized.	9.13129e-19
LR134165.1\|VEB17897.1\|871172_871715_-\|hexapaptide-repeat-containing-transferase	gnl\|CDD\|100047	cd03357, LbH_MAT_GAT, Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates. MAT acetylates maltose and glucose exclusively at the C6 position of the nonreducing end glucosyl moiety. GAT specifically acetylates galactopyranosides. Furthermore, MAT shows higher affinity toward artificial substrates containing an alkyl or hydrophobic chain as well as a glucosyl unit. Active MAT and GAT are homotrimers, with each subunit consisting of an N-terminal alpha-helical region and a C-terminal left-handed parallel alpha-helix (LbH) subdomain with 6 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X).	1.27019e-36
LR134165.1\|VEB17900.1\|874301_876545_-\|glycosyl-transferase-family-protein	gnl\|CDD\|133055	cd06433, GT_2_WfgS_like, WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.	1.86656e-23

>LR134165.1|VEB17894.1|866169_867261_+|GXT-repeat-containing-collagen-like-protein
MTGATGPTGATGPTGATGATGATGPTGATGATGPTGATGATGPTGATGPTGATGATGATGATGATGATGATGATGATGATGATGPTGATGATGATGPTGATGPTGATGATGPTGATGATGPTGPTGATGATGATGPTGATGARGPTGATGPTGATGATGATGPTGATGATGATGPTGATGPTGPTGVTGATGPTGPTGPQGPTGPPGEAGTMGAAGPTGPTGPASPQTAIFFNNLFGSTTVYNPPTVPLNTEVTVVSVPNVSVTSGQNIKVDYALAIEAVNTANSNIIFEIRLYRGGTLVQTRIFNRSLAAAGTQRFPLASTIVDTVPATATVDYSVRVAVTTASNVTSAAAFNRDLNLIRFP
>LR134165.1|VEB17893.1|862977_865410_-|putative-threonine-rich-GPI-anchored-glycoprotein
MAPVGPVAPVAPVAPVGPVAPVGPVAPVTPVGPVAPVGPVGPVAPVAPVGPVAPVGPVGPVAPVGPVAPVAPVTPVGPVAPVGPVDPVAPVGPVAPVGPVGPVAPVGPVAPVAPVAPVAPVTPVGPVAPVGPVDPVAPVGPVAPVAPVGPVAPVGPVGPVAPVGPVAPVAPVAPVAPVTPVGPVAPVGPVDPVAPVGPVAPVAPVAPVAPVTPVGPVGPVAPVAPVGPVTPVGPVAPVAPVTPVEPVAPVGPVGPVAPVGPVAPVGPVTPVGPVAPVGPVAPVGPVAPVGPVAPVGPVGPVAPVGPVAPVGPVAPVGPVAPVAPVGPVAPVGPVGPVAPVGPVAPVGPVAPVGPVAPVGPVAPVAPVGPVAPVAPVGPVAPVAPVGPVAPVAPVAPVAPVAPVAPVAPVAPVAPVGPVAPGGPVAPVAPVGPVAPVGPVAPVGPVAPVGPVAPVGPVAPVGPVAPVAPVGPVAPVAPVAPVGPVAPVAPVAPVGPVGPVAPVAPVGPVAPVAPVGPVAPVAPVGPVAPVAPVGPVDPVEPVAPVGPVGPVGPVAPVGPVAPVGPVAPVGPVAPVAPVAPVGPVAPVGPVGPVAPVGPVAPVAPVTPVGPVAPVGPVAPVGPVAPVGPVAPVAPVGPVAPVAPVAPVGPVGPVAPVGPVAPVAPVGPVAPVEPVAPVGPVGPVAPVGPVTPVGPVAPVAPVAPVAPVGPVAPVEPVAPVGPVGPVAPVGPVTPVGPVAPVARLRLLLPSDQLLLLGRLLRLGRLLPSPRLLLLRLSLPLDLLGLSLLSGQLLRLNPLLPSGLLDLSLPSDL
>LR134165.1|VEB17892.1|862405_862843_+|GXT-repeat-containing-collagen-like-protein
MTIENRIINGGFETGSLPPWTGFNAVVTSNFSHSGIYSVNLVTSSIGILAQSFLVNPGENFEFVISISKASSAPNPAIVITVDYYNSSFDFLSQGLSLTIPVNRLSAVNVWNEIYATTNSAPPGTVIGVVTIQKLPLSGGGTDTN
>LR134165.1|VEB17891.1|860220_862185_+|GXT-repeat-containing-collagen-like-protein
MSIQNAVMNGGFETGAFSPWVGINASVTSQFSHSGFFSARFLGGTATSYIAQFVPARAGEGSEFLVSLAKAGFLPAPSITIQVTYFDSQFNFLEYGLFATVPSSRIPAAENGTWLEVYQTTSPAPPGTTQAFILINNIPQAGTASVLVDDVALLSVEGGGGPTGATGPTGATGPTGATGATGATGPTGATGPTGATGATGATGPTGATGPTGATGATGATGPTGATGPTGATGATGATGPTGATGPTGATGATGATGPTGATGPTGATGATGATGPTGATGPTGATGATGATGPTGATGPTGATGATGATGPTGATGPTGATGATGATGPTGATGPTGATGPIGVTGPTGATGTTGATGPTGTTGPTGATGPTGATGPTGVTGPTGATGPTGATGSTGATGPTGVTGPTGATGTTGATGPTGTTGPTGATGPTGVTGPTGATGTTGATGPTGTTGPTGATGPTGATGPTGATGSTGATGPTGVTGPTGATGTTGATGPTGTTGPTGATGATGPTGATGPGSLLGTPAQSTDPVSLTVGSETPILTTTVTSSAGQNIKVDSMAEVDIIIGPATTFEYSIIFTLYRNNGAIAQVSVDSQDEKSAGSVRVYGDIPNLTWVDTPGAGTQTYEVRINVTGTNLLAANVNTRALNAVIFD
>LR134165.1|VEB17890.1|859401_860094_+|hexapaptide-repeat-containing-transferase
MIHETVKIGKNVVLGEHAVIEENVVIGDNVTIGHHAIIKKDTQIGSGVKIGDLAVLGKAASSNKKMARQPKQAGAPLRIEDDAVVGASAVIYRDVLLEKGVFVGDMASIRENVAIGRESIIGRNAMVENNTKIGKRVTIQTGCYITADMTIEDEVFIGPCCSTSNDKYMGMGNYPYQGPTIKRGAKIGNNATLLPAVVIGEHAVIGAGAVITKDVPAGKTAVGNPGRLLK
>LR134165.1|VEB17889.1|858578_859295_+|GntR-family-transcriptional-regulator
MKINKYMMIYKQIAEQIDQSILNAGDILPSENDLAEQHDTSRETVRKALYVLAQNGYIQKIKGKGSVVLHREKMQFPVSGLVSFKELSETLGKETSTTVHEFGLTHPDAYIQKQLRTSGDEEVWRVVRSRNINGERIILDKDYFIRKHVPLLTKEICEDSIYQYLEGECGLVISYAHKEIVVEPCTAEDQEYLDLNGYEHIVVVKNFVFLDDTTLFQYTESRHRLDKFRFVDFARREK
>LR134165.1|VEB17888.1|856862_858557_+|glycoside-hydrolase-family-protein
METKENPWWKKAVVYQIYPKSFKDTTGNGVGDIRGIIEKLDYIKELACDVIWLTPIYQSPQNDNGYDISDYYNIHEEYGTMADFEELLEEAHKRGIKVIMDLVVNHTSTEHKWFKEAASGKENPYRDFYIWKDMKPDGAPPTNWESKFGGSAWEFHEETGQYYLHLYDVTQADLNWENDEVRKKVYEMMHFWFEKGIDGFRLDVINVISKDQRFPDDDEGDGRRFYTDGPRVHEFLNEMNREVFSKYDSMTVGEMSSTTIADCIRYTNPESRELDMVFNFHHLKADYPNGEKWALADFDFLKLKKILSEWQTEMHKGGGWNALFWCNHDQPRIVSRYGDDGKYRIKSAKMLATAIHMLQGTPYIYQGEELGMTNPKFDDISLYRDVESLNMYRLLKEAGKPEAEIIEILKAKSRDNSRTPVQWNGEKNAGFTTGTPWIPVPANYKEINAEKALSDPDSIFYHYKKLNKLRKEFDIITTGDYQLILEDDQALYAYLRNGADEKLLVINNFYGKETEFQLPDDIDIDIDGYDAKVLISNYTDLPESFTRFKVKPYQSIVYHLAKPC
>LR134165.1|VEB17887.1|855377_856790_+|PTS-system-trehalose-specific-transporter-subunit-IIBC
MTDLNQSARRIVDAVGGADNIAAVTHCVTRLRFALLDESKVNQEVLEQIDVVKGSFSTNGQFQVVIGQGTVNNVYAELVKATGIGESSKDDVKKASEKNMNPLQRAVKTLADIFIPILPAIVTAGLLMGINNILTAQDIFFSGKSIVEVYPEWADLANMINLIAGTAFAFLPALIGWSAVKRFGGNPLLGIVLGVMLVHPDLLNAWGYGAAEQSGEIPVWNLFGLEVQKVGYQGQVLPILLASYLLAKIERFLTKRTPESIQLLVVAPITLLVTGFASFIVIGPVTFAIGNVLTSGLIAVFEQFAVLGGLLYGGLYAALVITGMHHTFLAVDLQLIGSKLGGTFLWPMLALSNIAQGSAALAMMFIVKDEKQKGLSLTSGISAYLGITEPALFGVNLRYRFPFVIAMISSGIAGMFISSQGVLASSVGVGGVPGIFSIMSQYWGAFAIGMAIVLIAPFAGTYLYAKLKMK
>LR134165.1|VEB17886.1|853776_855189_+|sodium:alanine-symporter-YflA
MERLLNWVEYISDWLWGPPLIILLTGTGVYLTILLKFFQFRYPLYIFKQTIGSVGKKPKGEGTVTPLQALTSALSSTVGAANIVGVPAAIMFGGPGAVFWMWLVALFAMAIKFSESVLAVHYREKNEEGEYVGGPMYYITKGLSMKWLGVFFSVALMIELVPSIMVQGNSVSASLAESFSFNRLYTGIGIAFLIGLVVIGGIKRIGKVTELAVPLMAGAYIGAGFLIVVMNLSSVPAFFSLIFSNAFTSSSAFGGFAGAAVAETVRWGFARGLYSNEAGMGTAPIAHAAAMTDHPVRQGFWAVIGIVVDTLLICTTTAFVVLASGVWTAENAASNPGALAAAAFRSYFGPVGGYFVSVSLVFFVLSTITVVIFYGVKQAEFLFGRLAGHMIKFVYLGAVIIGAAGGAKAIWGFLDLALVFILIPNILAVLLLSKKVRSLYDEFFTSEKYYLKDIGQQDCADERDEKVNNL
>LR134165.1|VEB17885.1|853328_853706_+|YflB
MDFSSIVSEDKIKRAIKDGEFEGLPGMGKPLKKDDAAHVPEHLRMAYRVMKNAGMTGDEGALKKELMTIDDLIAKCADEDERDRLIERKTETRLRLDRLADKKGMFSKPASAFYKEKVYRRLSGK
>LR134165.1|VEB17896.1|870084_871176_-|spore-coat-biosynthesis-protein
MIRLIEPYITFEEVEAELKEIFSSGILTKGPYVRTFADHIKQYVSAKHAFLTTSATTALSMCLKSLNVQPGDEVIVSDFSFPATVNVIEDLGAKPIFADVDLETFNMLPEELESQITSRTKAVLFVDALGNPTGITNIKHICKEYSLPLVDDAACAIGSSEYGCKSGKIADLTCFSFHPRKLLTTGEGGAITTDREELKDWFSVKLNHGAAISDGQLDFMDFGYNYRLSDIQAALGIKQLQKLDDIIHRRNLQQKAYSEQLEPLGFQSQKIGPDVVHNTQSAVFKVPKNIVRDELIQYLSDCHIESTFGTYCLSGTTYYRRKYRQIKPNSIFLEQNTITLPCHDQVNVDQVVSAIQSFSQRKG
>LR134165.1|VEB17897.1|871172_871715_-|hexapaptide-repeat-containing-transferase
MKQWKSEGKGEFTLSQLGGCGENVVIEDGVRIFHPENIYIGDNVYIGHDTILKGYYKHDLIIGSNSWIGQQCFIHGAGGVTIGKFAGIGPNVRIHAAYHTDPDIPDSTILFSPLTFAPIHIEENCNIGIGASILAGVTIGAHSKIGANAVVNRHIPPYSIAVGVPAKVIKNRRMKDEEPS
>LR134165.1|VEB17898.1|871732_872707_-|NAD-dependent-epimerase/dehydratase
MSDMTELSGQHIFITGGAGFIGSSLIGKLIERNSVTVYDNFSRDSLRYKPYRDHPHLKVVQGDILDVNTLKKAIQGASHIVHAAGIAGIDTVIQNPVKTMQVNMIGSANLLEAAAGLTECKRVVCFSTSEVFGQIAFRARETSHTVLGAVGEARWTYAVSKLAEEHMAYAYFKEHGLPTVTVRPFNVYGPEQVGEGAIKTMVHRALLDEPIYIHGDGTQIRAWCYVDDMIDGILRCLTMKEAIGESFNIGNERTVITVYGLASTIIRVLGSKSQIIFGEKKEADIELRIPQVNKAKEMLGFSAKVDLEEGITRTAESIQKNLDQ
>LR134165.1|VEB17899.1|872774_874148_-|transferase
MKDFKSDIIHCLEQKDWNKAMKRLKEWEADGSHNKPDFYFFQASLSVYLGHDHNAWLWLWRGLDLFPDNRSLNLLMGKVCLRTGREQESAAYLQKGDGAETESGPKLDLPVHETTEPPAGQIRVLQGTMEIANQMNTLAKGLSQHGALAHTLNYYPYYLNYAADYTWSLLKERNTPAMNAKLRRLASDLLPSYDLFHFHFGTSFTLDMSDYPILKQAGKPMIMHHWGSDVRLYSTLAKTNPYAVVKTKNEARIRYHLKRISQYVQHCIVADMELYEYVKDYYEHVHMIPTMIQLDRYIPDYRSNEKPLIVHAPTSPGIKGTRHILKAVESLKEKYDFHFQLVRGVSHEQAKKIYQKADLIIDQLHIGSYGLFAVESMAMGKPVICWVSDFMKEHYPSELPLIRANPDNITEVIENVLKNRDMLPEIGQKGRKYAEVHHDMVKNSKKMLAVYQALLSG
>LR134165.1|VEB17900.1|874301_876545_-|glycosyl-transferase-family-protein
MDNELEYLLDSVGLSWRETEISQLIFQHKWHDAAQKLEERLEAAPFDPGLLISAAFVYEKKQQVQRASELYDDALLFVRREHQHRLMKEKADLFKKMVRRPKIIFFVKPDLDRFLNAVVEHLSETYRTRKIAVHDLNQIDTGMQWADICWFEWCDDLLIHGSKVPSAAAKTLICRLHSYEAFTFYIKKVYWQAVDQVIFDGEHMREYVLDQVKSLKKEKTAVVPNGIKLDEYTFQQRQKGFHIAYVGYINYKKGPMLLLQAFKALIDKDPRYKLFIAGTFQDARYQLYFKQMIDELRLTDNVQFDGWQDDMNQYLEDKHYLICTSLLESQHMSAMEAMAKGIKPLIHNFYGAKTIYDESVVWNTIDEFVAMITSGDYTSLHYRSFIEEHYSYDLSMRKIEEMISGFAKQSELTVMPNPPLITVGIINYNYSNFIDECLQSVLNQLYPNIDILIVDDHSTDDSMQKISSYQKTHPHIRTICHSENTKLPDLAFKEIFQEAKGEYVLLLSADDFLPHNLVLHDFMQCFFGEEGLDYVYGDLLLVDQHGKNAGLWTYQEYGDEELVRTIFQRGGSGIVPMVGMFKASYYQQKGFTWLVDPQKPLAGDVLNCLANTKRGWKRRYLRKPVLCYRRHQNNISYQLHKRIQSLVYVIDYIVKEFDESVYFPHIKWKELEENQRQSLKYFSIGKTFWRMARRYAQNGYTRHLDQDAKKECIQPLLDKMDEYFQLSLSSDNQYERYMKNIKKIQLI
>LR134165.1|VEB17901.1|876738_877821_+|glycosyl-transferase-family-2
MVTISLCMIVKNEEEVLARCLDTVKDIVDEINIVDTGSTDQTVEIAKRYTDRVFFFEWIGDFAAARNESFKHATKDYILYLDADDVLLEKDQKKLKELKETLDPSVDSVSMYYDAGTDEFGNVTLRYRRNRLVKREKNFKWKGDCHQYLEVFGNIINADISVTHKKIRHSVGRNLNIYQKKIDRGDTFTPRDYFYYGNELRENRHYEKAIESYNKNIEMKEGWIEDKVYACINKADCHRFLGDLDNELRSLFQSFEFSKTPRAETCSRIGYNFQRRREYNAAIYWYELATTLVPDSNKWSFTYPAYYTWYPHLQMCVCYYNLGDFEKSYQHNEEARKYRPDDKSVLHNKQLLEGKLGINK
>LR134165.1|VEB17902.1|877942_879052_+|spore-coat-biosynthesis-protein
MIPLINLKRQFQTVKQDILQEFEHVLDSGQYILGPKVEELEKRIAEKLGVKEAVAVANGTDALVLTLEAFGIGKGDEVITTPFTFFATAEAVSRVGAKPVFADVDRETCNLDPEKIEENITPATKAIIPVHIFGQPADMDEIMAIAKKHGLLVIEDACQAFGASYKGRPVGSIGDAACFSFFPTKNLGTLGDGGMVTISDPDAARQLRTLRTHGTSKKYFHDKIGFNSRLDELHAAALLILLEKIDGWNEQRRKVASRYREGLKTAEHLTLPAEKEDRTHIYHLYCIGAKDRDEFIQSLKEQNIHSGVYYPCCLHLQTVYSSLQYKKGDFPIAESLSETLFAIPMDPFLAAEEQEQIISALLKKGGGGK
>LR134165.1|VEB17903.1|879048_880113_+|oxidoreductase
MTVHFGLIGCGYMSRKHLQALAGCGDAKLSAVSDLQEERMKEAEQYYASLAGDESRMTRYQQYQALLSDSKIEAVIIAAVSGLHAEMAKAALQAGKHVIVEKPMTLSLQDADELIELAEQNGLKLMVCHQMRHRPIMKKLKETIERGKLGRIYLGTVSLRLNRSPAYYEAATWRGSWEKDGGMLVNQGIHLIDLLQWFLGDVKGVYGDILGGSGAKETEDVAVGVLTFASQAKGVVEANIVTQPNNIGSSLSIFGEHGTISLEGPALNRISRWYIHGEKDAAEEAAQLIDLSGEQTAMYQNFISAVKRQDTLLVDGYEGKKAIETIFGIYQSVLQKQPVQLPLSSFQTSDMKNK
>LR134165.1|VEB17904.1|880213_881494_+|UDP-glucose-6-dehydrogenase
MHNETIAVIGLGFVGLPLAMLLISKGIRVIGVDLDKKKVEALRKGNSYISDINDQAVQDGIGTGFFRPVSDYGLIGEADAVIICVPTPLNDDAGPDLTYVKRAAQSIGGHLKKGQLVVLESSTYPGTTRDIVKPILEESGLVCGKDFYLAYSPERVDPGNQFPIEVVPKVVGGATEACLEKVHQLYSGIYEEVVPVTSPETAELTKLLENTYRFINISFINEFAMICDKLGVNVWEVIEAASTKPYGFAAFYPGPGIGGHCIPVDPLYLQFVMKQSGLSSDFIELSEATNDRIVRYIAERSLQLAGKDKATDARILIYGVTYKRNIADVRESKSLDIIEKLIGMGADVSYHDPHVPELDLSGKKMASMPIDSEMLKAYDCVVVLTDHDALPKELLLNHATVIFDTRGVLREAAGKAKVIQLGNGCS
>LR134165.1|VEB17905.1|881595_882486_+|serine-peptidase
MVFGIGISIFAVSLIVSYLFVMPNRSTYEETFFSGLKHGEIIDDVFESHDKEELFLTAGDGCRLHALLFPVQKSRKVVIVSHGIKWSLFGGYKYVELFQSIGYNVLLCDSRCHGLSGGSHVSYGFYEKDDLARWADELENRFGKDLWIGVLGESLGAAAAIELMKQDRRIKFCIADSCFSDLTELCHFQLKAAVKLSVPFLIPLASGLIKRRHGWSLADISPVSNLEQSDTPLFIIHGTNDQLVPPEMAKSLYDRKKGIKKLYMIEGAGHVGGFRHDPEEYLSRIKDFLLKIEPAN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: LR134165_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

LR134165_3

3030667-3030755

Orphan

Consensus_repeat	Method
TTAGCCGAGTCTCCTTTCTCACCA	CRISPRCasFinder

1 spacers

The CRISPR arrays of LR134165_3

>merge|LR134165|3|3030667-3030755|CRISPRCasFinder
TTAGCCGAGTCTCCTTTCTCACCAGGACAAAGCTACTCGGCGTTCCTCGCAGGACGCGAAAGCCTTTAGCCGAGTCTCCTTTCTCACCA

>LR134165|3|2|3030667-3030755|CRISPRCasFinder
TTAGCCGAGTCTCCTTTCTCACCA	GGACAAAGCTACTCGGCGTTCCTCGCAGGACGCGAAAGCCT
TTAGCCGAGTCTCCTTTCTCACCA

Protein	Signature genes	Signature genes Name	Protein_function
LR134165.1\|VEB20104.1\|3042396_3044745_-\|RecJ-exonuclease	unknown	unknown	gnl\|CDD\|273193
LR134165.1\|VEB20091.1\|3027714_3027828_-\|Uncharacterised-protein	unknown	unknown	unknown
LR134165.1\|VEB20089.1\|3026538_3026991_-\|exodeoxyribonuclease-V-subunit-alpha	unknown	unknown	gnl\|CDD\|273632
LR134165.1\|VEB20090.1\|3027042_3027693_-\|putative-tetratricopeptide-repeat-family-protein	unknown	unknown	gnl\|CDD\|276809
LR134165.1\|VEB20098.1\|3035483_3036758_-\|histidyl-tRNA-synthetase	unknown	unknown	gnl\|CDD\|234586
LR134165.1\|VEB20092.1\|3027787_3028906_-\|tRNA-specific-2-thiouridylase-MnmA	unknown	unknown	gnl\|CDD\|234664
LR134165.1\|VEB20100.1\|3037439_3039011_+\|N-acetylmuramoyl-L-alanine-amidase	unknown	unknown	gnl\|CDD\|119407
LR134165.1\|VEB20093.1\|3029011_3030151_-\|aminotransferase-class-V	unknown	unknown	gnl\|CDD\|224029
LR134165.1\|VEB20088.1\|3024593_3026576_-\|exodeoxyribonuclease-V-subunit-alpha	unknown	unknown	gnl\|CDD\|273632
LR134165.1\|VEB20097.1\|3033690_3035469_-\|aspartyl-tRNA-synthetase	unknown	unknown	gnl\|CDD\|234775
LR134165.1\|VEB20096.1\|3032506_3033271_-\|sulfur-containing-coenzyme-synthesis-protein	unknown	unknown	gnl\|CDD\|224100
LR134165.1\|VEB20086.1\|3023833_3024025_-\|Zn-ribbon-containing-protein	unknown	unknown	unknown
LR134165.1\|VEB20102.1\|3039495_3041697_-\|GTP-diphosphokinase	unknown	unknown	gnl\|CDD\|223394
LR134165.1\|VEB20085.1\|3022540_3023599_-\|putative-permease	unknown	unknown	gnl\|CDD\|223701
LR134165.1\|VEB20101.1\|3039038_3039482_-\|D-tyrosyl-tRNA(Tyr)-deacylase	unknown	unknown	gnl\|CDD\|235383
LR134165.1\|VEB20103.1\|3041866_3042379_-\|adenine-phosphoribosyltransferase	unknown	unknown	gnl\|CDD\|235028
LR134165.1\|VEB20087.1\|3024040_3024505_-\|photosynthetic-reaction-centre,-H-chain,-cytoplasmic	unknown	unknown	gnl\|CDD\|226398
LR134165.1\|VEB20094.1\|3030171_3030588_-\|negative-regulator-of-riboflavin-kinase	unknown	unknown	gnl\|CDD\|224870
LR134165.1\|VEB20099.1\|3037132_3037279_-\|Uncharacterised-protein	unknown	unknown	gnl\|CDD\|340164
LR134165.1\|VEB20095.1\|3031094_3032360_+\|recombination-factor-protein-RarA	unknown	unknown	gnl\|CDD\|237355

Protein	Function_ID	Function_description	E-value
LR134165.1\|VEB20104.1\|3042396_3044745_-\|RecJ-exonuclease	gnl\|CDD\|273193	TIGR00644, recJ, single-stranded-DNA-specific exonuclease RecJ. All proteins in this family are 5'-3' single-strand DNA exonucleases. These proteins are used in some aspects of mismatch repair, recombination, and recombinational repair. [DNA metabolism, DNA replication, recombination, and repair].	0
LR134165.1\|VEB20089.1\|3026538_3026991_-\|exodeoxyribonuclease-V-subunit-alpha	gnl\|CDD\|273632	TIGR01448, recD_rel, helicase, putative, RecD/TraA family. This model describes a family similar to RecD, the exodeoxyribonuclease V alpha chain of TIGR01447. Members of this family, however, are not found in a context of RecB and RecC and are longer by about 200 amino acids at the amino end. Chlamydia muridarum has both a member of this family and a RecD. [Unknown function, Enzymes of unknown specificity].	1.99856e-34
LR134165.1\|VEB20090.1\|3027042_3027693_-\|putative-tetratricopeptide-repeat-family-protein	gnl\|CDD\|276809	sd00006, TPR, Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.	6.64548e-16
LR134165.1\|VEB20098.1\|3035483_3036758_-\|histidyl-tRNA-synthetase	gnl\|CDD\|234586	PRK00037, hisS, histidyl-tRNA synthetase; Reviewed.	0
LR134165.1\|VEB20092.1\|3027787_3028906_-\|tRNA-specific-2-thiouridylase-MnmA	gnl\|CDD\|234664	PRK00143, mnmA, tRNA-specific 2-thiouridylase MnmA; Reviewed.	0
LR134165.1\|VEB20100.1\|3037439_3039011_+\|N-acetylmuramoyl-L-alanine-amidase	gnl\|CDD\|119407	cd02696, MurNAc-LAA, N-acetylmuramoyl-L-alanine amidase or MurNAc-LAA (also known as peptidoglycan aminohydrolase, NAMLA amidase, NAMLAA, Amidase 3, and peptidoglycan amidase; EC 3.5.1.28) is an autolysin that hydrolyzes the amide bond between N-acetylmuramoyl and L-amino acids in certain cell wall glycopeptides. These proteins are Zn-dependent peptidases with highly conserved residues involved in cation co-ordination. MurNAc-LAA in this family is one of several peptidoglycan hydrolases (PGHs) found in bacterial and bacteriophage or prophage genomes that are involved in the degradation of the peptidoglycan. In Escherichia coli, there are five MurNAc-LAAs present: AmiA, AmiB, AmiC and AmiD that are periplasmic, and AmpD that is cytoplasmic. Three of these (AmiA, AmiB and AmiC) belong to this family, the other two (AmiD and AmpD) do not. E. coli AmiA, AmiB and AmiC play an important role in cleaving the septum to release daughter cells after cell division. In general, bacterial MurNAc-LAAs are members of the bacterial autolytic system and carry a signal peptide in their N-termini that allows their transport across the cytoplasmic membrane. However, the bacteriophage MurNAc-LAAs are endolysins since these phage-encoded enzymes break down bacterial peptidoglycan at the terminal stage of the phage reproduction cycle. As opposed to autolysins, almost all endolysins have no signal peptides and their translocation through the cytoplasmic membrane is thought to proceed with the help of phage-encoded holin proteins. The amidase catalytic module is fused to another functional module (cell wall binding module or CWBM) either at the N- or C-terminus, which is responsible for high affinity binding of the protein to the cell wall.	1.52205e-61
LR134165.1\|VEB20093.1\|3029011_3030151_-\|aminotransferase-class-V	gnl\|CDD\|224029	COG1104, NifS, Cysteine sulfinate desulfinase/cysteine desulfurase and related enzymes [Amino acid transport and metabolism].	0
LR134165.1\|VEB20088.1\|3024593_3026576_-\|exodeoxyribonuclease-V-subunit-alpha	gnl\|CDD\|273632	TIGR01448, recD_rel, helicase, putative, RecD/TraA family. This model describes a family similar to RecD, the exodeoxyribonuclease V alpha chain of TIGR01447. Members of this family, however, are not found in a context of RecB and RecC and are longer by about 200 amino acids at the amino end. Chlamydia muridarum has both a member of this family and a RecD. [Unknown function, Enzymes of unknown specificity].	0
LR134165.1\|VEB20097.1\|3033690_3035469_-\|aspartyl-tRNA-synthetase	gnl\|CDD\|234775	PRK00476, aspS, aspartyl-tRNA synthetase; Validated.	0
LR134165.1\|VEB20096.1\|3032506_3033271_-\|sulfur-containing-coenzyme-synthesis-protein	gnl\|CDD\|224100	COG1179, COG1179, Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism].	6.36091e-126
LR134165.1\|VEB20102.1\|3039495_3041697_-\|GTP-diphosphokinase	gnl\|CDD\|223394	COG0317, SpoT, Guanosine polyphosphate pyrophosphohydrolases/synthetases [Signal transduction mechanisms / Transcription].	0
LR134165.1\|VEB20085.1\|3022540_3023599_-\|putative-permease	gnl\|CDD\|223701	COG0628, yhhT, Predicted permease, member of the PurR regulon [General function prediction only].	1.13801e-58
LR134165.1\|VEB20101.1\|3039038_3039482_-\|D-tyrosyl-tRNA(Tyr)-deacylase	gnl\|CDD\|235383	PRK05273, PRK05273, D-tyrosyl-tRNA(Tyr) deacylase; Provisional.	5.12974e-94
LR134165.1\|VEB20103.1\|3041866_3042379_-\|adenine-phosphoribosyltransferase	gnl\|CDD\|235028	PRK02304, PRK02304, adenine phosphoribosyltransferase; Provisional.	3.09122e-94
LR134165.1\|VEB20087.1\|3024040_3024505_-\|photosynthetic-reaction-centre,-H-chain,-cytoplasmic	gnl\|CDD\|226398	COG3881, COG3881, PRC-barrel domain containing protein [General function prediction only].	1.2e-38
LR134165.1\|VEB20094.1\|3030171_3030588_-\|negative-regulator-of-riboflavin-kinase	gnl\|CDD\|224870	COG1959, COG1959, Predicted transcriptional regulator [Transcription].	5.8946e-50
LR134165.1\|VEB20099.1\|3037132_3037279_-\|Uncharacterised-protein	gnl\|CDD\|340164	pfam17449, yrzK, Uncharacterized protein YrzK. This is a family of unknown function found in Bacillus.	3.46316e-18
LR134165.1\|VEB20095.1\|3031094_3032360_+\|recombination-factor-protein-RarA	gnl\|CDD\|237355	PRK13342, PRK13342, recombination factor protein RarA; Reviewed.	0

>LR134165.1|VEB20094.1|3030171_3030588_-|negative-regulator-of-riboflavin-kinase
MKISTKGRYGLTIMIELAKKHGEGPTSLKSIAQTNDLSEHYLEQLVSPLRNAGLVKSIRGAYGGYILGDEPEAITAGDIIRVLEGPISPVEVLENEEPAKRELWIKIRDAVKEVLDSTTLEDLASYTEGEQEAYMFYI
>LR134165.1|VEB20093.1|3029011_3030151_-|aminotransferase-class-V
MERIYLDHAATSPTDPRVVEKMLPYLTENFGNPSSIHSFGRESRKWLDGTREMIAREIGAHPNEIVFTSGGTEADNMAILGTALAREQQGRHIITTKVEHHAVLHTCNRLEEMGFDVTYLDVDESGRISAEQVKDALRDDTILVTVMYGNNEVGTIQPIDEIGDLLKDHRALFHTDAVQAFGFLPIDVQKSRIDMMSVSGHKLNGPKGTGFLYVNENVKLSQLLFGGEQERKRRAGTENVPGIAGLGEAVLLSGQEREEKSALYRRFKDIVIRTLKADGVSFDVNGSREHSLPHILNLYFPGVSVESLLVNLDMAGIAVSSGSACTAGSVLPSHVLSAMFGEEDDRLTSSIRISFGFGNTEEQVERAAKELAAIVQRLS
>LR134165.1|VEB20092.1|3027787_3028906_-|tRNA-specific-2-thiouridylase-MnmA
MTKRPEDTRVVVGMSGGVDSSVAALLLKEQGYDVIGIFMKNWDDTDENGFCTATEDYEDVIKVCNQIGIPYYAVNFEKQYWEKVFQYFLDEYKAGRTPNPDVMCNKEIKFKAFLEHALSLGADYLATGHYARVNRTDGRVKMLRGLDENKDQTYFLNQLTEEQLSKVLFPIGELQKSRVREIAKEAGLATASKKDSTGICFIGERNFKTFLSQYLPAQPGDMRTMEGEFKGRHDGLMYYTIGQRHGLGIGGSGDPWFVVGKDLEKNILYVDQGFDNPLLFSDKITATNVSFVHDGVFGGEEELNCTAKFRYRQADHEVTVRMTGTDEAEVVFKEPVRAVTPGQAVVFYRGEECLGGGTIDDVFKDGQQLWYV
>LR134165.1|VEB20091.1|3027714_3027828_-|Uncharacterised-protein
MMCLKTDNNFGMYKTGALDNTPELLERLPAMSAAFLK
>LR134165.1|VEB20090.1|3027042_3027693_-|putative-tetratricopeptide-repeat-family-protein
MDYNQIGIDAMQKGDFEKAAEAFTKAIDENSGDPVPYINFANLLSAVGELDRALKFYDRAAALDEKAGAAYYGAGNVYVMKERYQEAKDMFEKAHRTGMENSDLYYMLGTTLVKLEQPKLAMPYLQRAAELNDTDVEARFQYAMCLANEGMLDEAITEFSNVTERDPSHADAFYNLGVAYAFKEDRETALAMLNKALDIQPDHMLSIRAKQLLEEA
>LR134165.1|VEB20089.1|3026538_3026991_-|exodeoxyribonuclease-V-subunit-alpha
MQRHNPDQIEMEEASFVKGMVAAVIYHNETNLYTVLKVKVEETSESFEDKTVSVTGYFPLIHEDDIYTFYGKTASHPKFGLQFQADHFKKEVPTTKEGVIQYLASDLFEGIGKKTAEEIVNKLGEGAINKILSDGAVLYDVPKLSKKKGG
>LR134165.1|VEB20088.1|3024593_3026576_-|exodeoxyribonuclease-V-subunit-alpha
MMFRSSPKKKADKLAAALQQHQGLEQIMISLSEFGFGPQLSMKIYQAYEAETLDKIRENPYQLVKDVEGIGFIKADELGGRMGISGKHEERIKAAILYTVEATCLQEGHTYIDTRQLIIETQKLLNQSAGDEKVTEMDVADAIISLGEQKELFIEDERCYYPSLYYAEQSFAKRVQKIAGQTEYDDQFPESEFLLALGELEERMKVQYAPSQKEAIQKALMSPMLLLTGGPGTGKTTVIRGIVELYSELHGLSLNPADYKKDETFPFVLAAPTGRAAKRMSESTGLPAVTIHRLLGWNGAEGFTHDEDNPIDGRLLIIDETSMLDIWLANQLFKAIPDRIQVIMVGDEDQLPSVGPGQVLRDLLASNVIPSVRLTDIYRQAEGSSIVELAHEMKQGKLPENLTAPTKDRSFIRCRQQQIKEVVEKVVKNALQKGYSARDIQILAPMYRGAAGINELNALLQGILNPPKPKGREMKYGDVVYRTGDKVLQLVNQPEHNVFNGDMGEIVSIFYAKENTEKEDMAVVSFDGNEITFTKKDFNQFTHAYCCSIHKSQGSEFPIVILPVVKSYYRMLRRNLLYTAITRSKKFLILCGEEEALEWGVKNKESSERQTSLKRRLQQAAHEEDEELMALQKELPFSVYDANIGMEGITPFDFMEKEAE
>LR134165.1|VEB20087.1|3024040_3024505_-|photosynthetic-reaction-centre,-H-chain,-cytoplasmic
MRTCNELEGLNVYDRQSSLPLGVVTDICFSNEGTCLGLIMEEKRRFYNPRSLLPLPAVTEIGRDSVYVDFTEFKPMQIPKQSLSYDQMKQKMVKNGAGDTLGMLEDVYFSSDTGIIVAYELSDGFFADLSGDKKQIHSSGEPLEVGRSTIVLNE
>LR134165.1|VEB20086.1|3023833_3024025_-|Zn-ribbon-containing-protein
MLVCPNCKSKNIGKIGVNQYYCWGCFIELTLSKGKISTHQVEEDGTLSSLDDLFSDDERTINL
>LR134165.1|VEB20085.1|3022540_3023599_-|putative-permease
MLKKPLQLLMWVSIFMLLLLTVYIFLQLRMIWEPVCVLLKSILIPLVIAVFITYLLLPVVEKIHRAGVPRTLSILLIYVLFFAGLGYAFYKGVPILIKQLTELSEGIPFLAASYESMLDQLHHHTDGWPDGMHDRIDRFVNQTEEFVASWVERTIRSIRFVFDYMLVAAIIPFLVFYMVKDIDTMKKAVWYLTPSSWRARGSEFIRDVDDSLGDYIRGQLFVCLVIGLGASLSFWFFDLPYPLILGLVIGATNVIPYFGPVIGAIPAVMVAAALSTRLVFVVIITILVLQFIEGNILGPLVVGKSLHMHPVVIMLGLLAGGELAGIIGMILAVPVMAVIKVMLVHFLAARKA
>LR134165.1|VEB20095.1|3031094_3032360_+|recombination-factor-protein-RarA
MKPLAFRMRPTKIEEVLGQDHLVGEGKIIHRMVQAKHLSSMILYGPPGIGKTSIATAIAGSTSIAFRKLNAVINNKKDMEAVAAEAKMSGQVILILDEVHRLDKGKQDFLLPYLENGMIIMIGATTANPYHAINPAIRSRTQIFELQPLDSEQIKAAIKRALEDEHRGLGSYDVALDDEALDHMARGCGGDVRSALNALELAVLSTKENSEGTIRITLEIAEECLQKKSFVHDKDGDAHYDVISAFQKSIRGSDVNAALHYLARLIEAGDLESLARRLLVIAYEDIGLASPQAGGRTLQAIQTAERIGFPEARIPLANAVIELCLSPKSNSAILAVDEALSDVRSGKIGDVPNHLKDAHYKGAAELGRGVEYKYPHNYENGWVKQQYLPDPLKNKVYYQPKQTGKFELALKQVYDKLMKQK
>LR134165.1|VEB20096.1|3032506_3033271_-|sulfur-containing-coenzyme-synthesis-protein
MLHQFSRNELAIGKEGLNILKNSTVAVLGVGGVGSFAAEALARSGVGRIVMVDKDDVDITNVNRQLPALLSTVGQPKVDLMKARIADINPECDVIALKMFYTEETYEQFFAYEPDYVIDASDTIHYKIHLMKECLKRDINIISSMGAANKTDPTRFQVADISKTHTDPIAKVIRTRLRKEGITKGIKVVFSDESPIVIREDVRQIVGNDEAKIRKAQMPPSSNAFVPSVAGLIMGGHVIMELLKDIPIKRVKDK
>LR134165.1|VEB20097.1|3033690_3035469_-|aspartyl-tRNA-synthetase
MFGRTYYCGEITEKAIGESVVLKGWVQKRRDLGGLIFIDLRDRTGIVQVVFNPDVSKDALETAESIRSEYVLDITGKVVAREEATVNPNLKTGRIEIQAESVNVLSAAKTPPFAISDQASEVSEDIRLKHRYLDLRRPEMFNTLKMRHNVTKAVRSFLDDNGFIDIETPVLTKKTPEGARDYLVPSRVHEGEFYALPQSPQLFKQLLMVSGFDRYYQIARCFRDEDLRADRQPEFTQIDIEMSFMNQEDIMKLAEEMMAKVMLETHGVDISLPLPRMSYQDAMNLYGSDKPDTRFDMLLTDVSENVKDSDFKVFASAVANGGAVKAINVKGAASKYSRKDIDALGEFAANYGAKGLAWLKAEADGLKGPIAKFFQDEKQQVLIEALDAKEGDLILFVADRLEVANDALGALRLKLGKELNLIDESLFNFLWVVDWPLLEYDSEEGRFYAAHHPFTMPVREDLDLVDTNPEDMKAQAYDLVLNGYELGGGSIRIFEKDVQEKMFALLGLSEEETKEQFGFLLEAFEYGAPPHGGIALGLDRLVMLLSGRTNLRDTIAFPKTASASCLLMEAPSEVDSAQLDELHLSINRKVRQ
>LR134165.1|VEB20098.1|3035483_3036758_-|histidyl-tRNA-synthetase
MGFNIPRGTQDILPGESERWQYVEKIARETCHAYQYKEIRTPIFEHTELFSRGVGESTDIVQKEMYTFADKKGRSLTLRPEGTASAVRSFVENKLFANPVQPTKLYYIGPMFRYERPQTGRYRQFYQFGIEAIGSNDPAIDAEVIALAMSVYRKAGLSNLKLVINSLGDKESRTAHREALIRHFEPRIDEFCSDCQKRLRQNPLRILDCKKDRDHELLKTAPSILDYLNEESKAYFAKVQQYLTDIGIAFEVDPNLVRGLDYYNHTAFEIMSNAEGFGAITTLAGGGRYDGLTEEFGGPKAPGIGFAMSIERLLAALDAENVKVGADEGIDCYIVTLGDKAKDYSVSLLYKLREAGISAEIDYEQKKMKGQFKSADRLNAKYIAVLGEDELSQNQMNVKDAKTGDQQAIGLDEFIHFLKTNTES
>LR134165.1|VEB20099.1|3037132_3037279_-|Uncharacterised-protein
MGRAIHEQDANLHLKDHADPEQAGFMEETATELGLASKESIQNKKNRK
>LR134165.1|VEB20100.1|3037439_3039011_+|N-acetylmuramoyl-L-alanine-amidase
MKKRTVLILSMMLAAQAAFYTSSNTASAAIGEAVIATDEINVRSGPGLSHEIVSVVSRNESYPILEERGDWVQIQLNGGQKGWVVSWLIKKKSQVSNGSDSAEGKVTSSEANLRIRKGPGTSYEVQGVFPEGEQADLLKTDGNWVKISYQNITGWVHSDYVNQGSGAKQSQSSSSRASSTKSGTVGVSTLNVRSTASHQGRIIASLQRNASVTILNEQHGWYEIEFNGQKGWVASHYILEGPKQKSGTSETSSGSGSKQQATIVYEGTNVRSGPSTSSAIVKRAGKGESYPIVSAKGDWYEIKLSNGDSAYVANWVVQTADQSGSAGDSKSAAPPLAKRSSASGTIKNKTVVIDAGHGGHDSGTIGTRGTLEKRLTIKTATLLAAKLRADGVNVYMTRNDDSFVSLQSRVATSHYRNADAFISIHYDSFPNASVRGNTAYYYSPSKDRKLAADVQSEIEKHSPLPSRGVLFGDYFVLRENKQAAALFELGYLSHPQEEAVVSTNAYRERVTDGIRSGLENYFN
>LR134165.1|VEB20101.1|3039038_3039482_-|D-tyrosyl-tRNA(Tyr)-deacylase
MRLVVQRVTDASVSVGGETVGQIGLGLMVLVGVTHEDTSEDAAYLAEKLVNLRIFEDEGEKMNLSLLDVGGSVLSVSQFTLYGDTKKGRRPNFTKAAKPDQALQLYEEWNSMLRAKGVAVETGRFGEMMDVKLTNSGPVTFIMDSKA
>LR134165.1|VEB20102.1|3039495_3041697_-|GTP-diphosphokinase
MANEQVLTAEQVIEKAKSYLSDEHVAFIKKAYQYAEDAHREQYRKSGEPYIIHPIQVAGILVDLEMDPATIAGGFLHDVVEDTSVTLEDLKEAFNEEVAMLVDGVTKLGKIKYKSQEEQQAENHRKMFVAMAQDIRVILIKLADRLHNMRTLKHLPQEKQRRISNETLEIFAPLAHRLGISKIKWELEDTALRYLNPQQYYRIVNLMKKKRAERELYVEEVVNEVKSRVEEVNIKADFSGRPKHIYSIYRKMAMQNKQFNEIYDLLAVRILVNSIKDCYAVLGIIHTCWKPMPGRFKDYIAMPKPNMYQSLHTTVIGPKGDPLEVQIRTFEMHEIAEYGIAAHWAYKEGKNVNEDSSFDKKLSWFREILEFQNESSDAEEFMESLKIDLFSDMVFVFTPKGDVIELPSGSVPIDFSYRIHSEIGNKTIGAKVNGKMVTLDYKLRTGDIVEILTSKHSYGPSQDWINLAQTSQAKHKIRQFFKKQRREENVEKGRELVEKEIKNLDFEVKDVLTVENLQKVADKFNFANEEDMYAAVGYNGITAAQVANRLTEKERKIRDQEEQVKSVQDVTPEPKPYQGKKREAGVRVKGVDNLLIRLSKCCNPVPGDPIVGFITKGRGVSVHREDCPNVLTNEALDRLIQVEWEHEPQTQRRKEYNVEIEILGYDRRGLLNEVLQAVNETKTNISSVSGKSDRNKVATIHMAIFIQNINHLHKVVERIKQIKDIYSVRRVMN
>LR134165.1|VEB20103.1|3041866_3042379_-|adenine-phosphoribosyltransferase
MDLKKYVTIVPDYPKEGVQFKDITTLMDKGDVYRYATDQIVTYAKEKEIDLVVGPEARGFIIGCPVAYSLGVGFAPVRKEGKLPREVIKVDYGLEYGKDVLTIHKDAIKPGQRVLITDDLLATGGTIEATIKLVEELGGVVAGIAFLIELTYLEGRNKLDGYDILTLMQY
>LR134165.1|VEB20104.1|3042396_3044745_-|RecJ-exonuclease
MLASKMRWDVQTPDKEKVEQLAGRLGITPLAASLLVMRGYDTADKASSFLNGKDAVFHDPYLLKDMEKAVQRIKQAISDQEKIMIYGDYDADGVTSTTVLLQMLKKCSAQADFYIPDRFKEGYGPNEAAFRGIKESGYSLIITVDTGIAAVHEAEVAKELGVDLIITDHHEPGPVLPDAYAIIHPKQPGCGYPFKELAGVGVAFKLAHALNGELPEDLLDLCAIGTIADLVPLHDENRQIAKRGMEQFRRTKRPGLKALTKIAGAEIHSADEETIGFQIAPRLNAVGRIEQADPAVYLLNTKDETEAEELAEDINALNKERQKIVNQMTEEAVQMIEEEGLDQPVIVAARPGWNPGVVGIVASKLVERYYRPAIVLGIDEEKGIAKGSARSIKGFDLFQNLSECRDILPHFGGHPMAAGMTLNLEDVSALRERINRQAEAVLTEEDFIPVQDVDLCCRLEDITVDSIAEMNMLAPFGTGNPKPFVLVSDVKIDDSRKIGANKNHLKLVLADGENKLDCIGFYKGAIEDGIVPGAKISIVGELSINEWNNRKKPQLMIKDAAVNEWQLFDLRGKRSWEEKILQLDPAKRACICFREETKAKLAGTGLEEELTVISGPEDAERLVLESRYAVFIDIPPSLDIFDQVIKGKKLERIYLIFYQSDEHFFSTFPTREYFKWYYAFLLKRGSFDLPKYGGELARHKGWTKDTIDFMTKVFFELGFVTIENGVLSVVYHAEKRDLTDSETYREKQRLIELEQKLIYSSADELKQWLDKRMAENAVAYKV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
LR134165_1	1.23\|869466\|23\|LR134165\|CRT	869466-869488	23	LR134165.1	860961-860983	1	0.957
LR134165_1	1.23\|869466\|23\|LR134165\|CRT	869466-869488	23	LR134165.1	861177-861199	1	0.957
LR134165_1	1.23\|869466\|23\|LR134165\|CRT	869466-869488	23	LR134165.1	866211-866233	1	0.957
LR134165_1	1.29\|869808\|23\|LR134165\|CRT	869808-869830	23	LR134165.1	865968-865990	1	0.957
LR134165_1	1.29\|869808\|23\|LR134165\|CRT	869808-869830	23	LR134165.1	866706-866728	1	0.957
LR134165_1	1.30\|869853\|32\|LR134165\|CRT	869853-869884	32	LR134165.1	867981-868012	1	0.969
LR134165_1	1.30\|869853\|32\|LR134165\|CRT	869853-869884	32	LR134165.1	867999-868030	1	0.969
LR134165_1	1.2\|868107\|32\|LR134165\|CRT	868107-868138	32	LR134165.1	864484-864515	2	0.938
LR134165_1	1.4\|868233\|23\|LR134165\|CRT	868233-868255	23	LR134165.1	864169-864191	2	0.913
LR134165_1	1.4\|868233\|23\|LR134165\|CRT	868233-868255	23	LR134165.1	864196-864218	2	0.913
LR134165_1	1.4\|868233\|23\|LR134165\|CRT	868233-868255	23	LR134165.1	864223-864245	2	0.913
LR134165_1	1.4\|868233\|23\|LR134165\|CRT	868233-868255	23	LR134165.1	865518-865540	2	0.913
LR134165_1	1.8\|868440\|23\|LR134165\|CRT	868440-868462	23	LR134165.1	865653-865675	2	0.913
LR134165_1	1.8\|868440\|23\|LR134165\|CRT	868440-868462	23	LR134165.1	866472-866494	2	0.913
LR134165_1	1.12\|868692\|32\|LR134165\|CRT	868692-868723	32	LR134165.1	865599-865630	2	0.938
LR134165_1	1.23\|869466\|23\|LR134165\|CRT	869466-869488	23	LR134165.1	860745-860767	2	0.913
LR134165_1	1.23\|869466\|23\|LR134165\|CRT	869466-869488	23	LR134165.1	860799-860821	2	0.913
LR134165_1	1.23\|869466\|23\|LR134165\|CRT	869466-869488	23	LR134165.1	860853-860875	2	0.913
LR134165_1	1.23\|869466\|23\|LR134165\|CRT	869466-869488	23	LR134165.1	860907-860929	2	0.913
LR134165_1	1.23\|869466\|23\|LR134165\|CRT	869466-869488	23	LR134165.1	861015-861037	2	0.913
LR134165_1	1.23\|869466\|23\|LR134165\|CRT	869466-869488	23	LR134165.1	861069-861091	2	0.913
LR134165_1	1.23\|869466\|23\|LR134165\|CRT	869466-869488	23	LR134165.1	861123-861145	2	0.913
LR134165_1	1.23\|869466\|23\|LR134165\|CRT	869466-869488	23	LR134165.1	863099-863121	2	0.913
LR134165_1	1.23\|869466\|23\|LR134165\|CRT	869466-869488	23	LR134165.1	863305-863327	2	0.913
LR134165_1	1.23\|869466\|23\|LR134165\|CRT	869466-869488	23	LR134165.1	864772-864794	2	0.913
LR134165_1	1.23\|869466\|23\|LR134165\|CRT	869466-869488	23	LR134165.1	864871-864893	2	0.913
LR134165_1	1.23\|869466\|23\|LR134165\|CRT	869466-869488	23	LR134165.1	864961-864983	2	0.913
LR134165_1	1.23\|869466\|23\|LR134165\|CRT	869466-869488	23	LR134165.1	865042-865064	2	0.913
LR134165_1	1.23\|869466\|23\|LR134165\|CRT	869466-869488	23	LR134165.1	865500-865522	2	0.913
LR134165_1	1.23\|869466\|23\|LR134165\|CRT	869466-869488	23	LR134165.1	865617-865639	2	0.913
LR134165_1	1.23\|869466\|23\|LR134165\|CRT	869466-869488	23	LR134165.1	865734-865756	2	0.913
LR134165_1	1.23\|869466\|23\|LR134165\|CRT	869466-869488	23	LR134165.1	865824-865846	2	0.913
LR134165_1	1.29\|869808\|23\|LR134165\|CRT	869808-869830	23	LR134165.1	863063-863085	2	0.913
LR134165_1	1.29\|869808\|23\|LR134165\|CRT	869808-869830	23	LR134165.1	863458-863480	2	0.913
LR134165_1	1.29\|869808\|23\|LR134165\|CRT	869808-869830	23	LR134165.1	863917-863939	2	0.913
LR134165_1	1.29\|869808\|23\|LR134165\|CRT	869808-869830	23	LR134165.1	864934-864956	2	0.913
LR134165_1	1.29\|869808\|23\|LR134165\|CRT	869808-869830	23	LR134165.1	865797-865819	2	0.913
LR134165_1	1.29\|869808\|23\|LR134165\|CRT	869808-869830	23	LR134165.1	866148-866170	2	0.913

1. spacer 1.23|869466|23|LR134165|CRT matches to position: 860961-860983, mismatch: 1, identity: 0.957

aggagcaaccggcgcaacgggag	CRISPR spacer
aggagcaacaggcgcaacgggag	Protospacer
********* *************

2. spacer 1.23|869466|23|LR134165|CRT matches to position: 861177-861199, mismatch: 1, identity: 0.957

aggagcaaccggcgcaacgggag	CRISPR spacer
aggagcaacaggcgcaacgggag	Protospacer
********* *************

3. spacer 1.23|869466|23|LR134165|CRT matches to position: 866211-866233, mismatch: 1, identity: 0.957

aggagcaaccggcgcaacgggag	CRISPR spacer
aggggcaaccggcgcaacgggag	Protospacer
***.*******************

4. spacer 1.29|869808|23|LR134165|CRT matches to position: 865968-865990, mismatch: 1, identity: 0.957

aggtccaacaggtccaaccggag	CRISPR spacer
agggccaacaggtccaaccggag	Protospacer
*** *******************

5. spacer 1.29|869808|23|LR134165|CRT matches to position: 866706-866728, mismatch: 1, identity: 0.957

aggtccaacaggtccaaccggag	CRISPR spacer
aggtccaacgggtccaaccggag	Protospacer
*********.*************

6. spacer 1.30|869853|32|LR134165|CRT matches to position: 867981-868012, mismatch: 1, identity: 0.969

aggtccaaccggcccgacaggtccaactggcc	CRISPR spacer
aggtccaaccggcccgacaggtccaaccggcc	Protospacer
***************************.****

7. spacer 1.30|869853|32|LR134165|CRT matches to position: 867999-868030, mismatch: 1, identity: 0.969

aggtccaaccggcccgacaggtccaactggcc	CRISPR spacer
aggtccaaccggcccgacaggtccaaccggcc	Protospacer
***************************.****

8. spacer 1.2|868107|32|LR134165|CRT matches to position: 864484-864515, mismatch: 2, identity: 0.938

aggcccaacaggtccgacgggagcaaccggcc	CRISPR spacer
aggcgcaaccggtccgacgggagcaaccggcc	Protospacer
**** **** **********************

9. spacer 1.4|868233|23|LR134165|CRT matches to position: 864169-864191, mismatch: 2, identity: 0.913

gggagcaaccggagcaacgggag	CRISPR spacer
gggagcaaccggggcaacaggag	Protospacer
************.*****.****

10. spacer 1.4|868233|23|LR134165|CRT matches to position: 864196-864218, mismatch: 2, identity: 0.913

gggagcaaccggagcaacgggag	CRISPR spacer
gggagcaaccggggcaacaggag	Protospacer
************.*****.****

11. spacer 1.4|868233|23|LR134165|CRT matches to position: 864223-864245, mismatch: 2, identity: 0.913

gggagcaaccggagcaacgggag	CRISPR spacer
gggagcaaccggggcaacaggag	Protospacer
************.*****.****

12. spacer 1.4|868233|23|LR134165|CRT matches to position: 865518-865540, mismatch: 2, identity: 0.913

gggagcaaccggagcaacgggag	CRISPR spacer
gggagcgacaggagcaacgggag	Protospacer
******.** *************

13. spacer 1.8|868440|23|LR134165|CRT matches to position: 865653-865675, mismatch: 2, identity: 0.913

cggcccgacaggtccaacgggag	CRISPR spacer
cggcccgacaggggcaacgggag	Protospacer
************  *********

14. spacer 1.8|868440|23|LR134165|CRT matches to position: 866472-866494, mismatch: 2, identity: 0.913

cggcccgacaggtccaacgggag	CRISPR spacer
cggcccgacaggcgcaacgggag	Protospacer
************. *********

15. spacer 1.12|868692|32|LR134165|CRT matches to position: 865599-865630, mismatch: 2, identity: 0.938

aggagcaaccggagcgacaggagcaacaggtc	CRISPR spacer
aggagcaacgggagcgacaggagcaaccggtc	Protospacer
********* ***************** ****

16. spacer 1.23|869466|23|LR134165|CRT matches to position: 860745-860767, mismatch: 2, identity: 0.913

aggagcaaccggcgcaacgggag	CRISPR spacer
aggagcaacaggagcaacgggag	Protospacer
********* ** **********

17. spacer 1.23|869466|23|LR134165|CRT matches to position: 860799-860821, mismatch: 2, identity: 0.913

aggagcaaccggcgcaacgggag	CRISPR spacer
aggagcaacgggagcaacgggag	Protospacer
********* ** **********

18. spacer 1.23|869466|23|LR134165|CRT matches to position: 860853-860875, mismatch: 2, identity: 0.913

aggagcaaccggcgcaacgggag	CRISPR spacer
aggagcaacaggagcaacgggag	Protospacer
********* ** **********

19. spacer 1.23|869466|23|LR134165|CRT matches to position: 860907-860929, mismatch: 2, identity: 0.913

aggagcaaccggcgcaacgggag	CRISPR spacer
aggagcaacaggagcaacgggag	Protospacer
********* ** **********

20. spacer 1.23|869466|23|LR134165|CRT matches to position: 861015-861037, mismatch: 2, identity: 0.913

aggagcaaccggcgcaacgggag	CRISPR spacer
aggagcaacaggagcaacgggag	Protospacer
********* ** **********

21. spacer 1.23|869466|23|LR134165|CRT matches to position: 861069-861091, mismatch: 2, identity: 0.913

aggagcaaccggcgcaacgggag	CRISPR spacer
aggagcaacaggagcaacgggag	Protospacer
********* ** **********

22. spacer 1.23|869466|23|LR134165|CRT matches to position: 861123-861145, mismatch: 2, identity: 0.913

aggagcaaccggcgcaacgggag	CRISPR spacer
aggagcaacaggagcaacgggag	Protospacer
********* ** **********

23. spacer 1.23|869466|23|LR134165|CRT matches to position: 863099-863121, mismatch: 2, identity: 0.913

aggagcaaccggcgcaacgggag	CRISPR spacer
aggagcaaccggggcgacgggag	Protospacer
************ **.*******

24. spacer 1.23|869466|23|LR134165|CRT matches to position: 863305-863327, mismatch: 2, identity: 0.913

aggagcaaccggcgcaacgggag	CRISPR spacer
aggcgcaaccggggcaacgggag	Protospacer
*** ******** **********

25. spacer 1.23|869466|23|LR134165|CRT matches to position: 864772-864794, mismatch: 2, identity: 0.913

aggagcaaccggcgcaacgggag	CRISPR spacer
aggagtaaccggggcaacgggag	Protospacer
*****.****** **********

26. spacer 1.23|869466|23|LR134165|CRT matches to position: 864871-864893, mismatch: 2, identity: 0.913

aggagcaaccggcgcaacgggag	CRISPR spacer
aggagtaaccggggcaacgggag	Protospacer
*****.****** **********

27. spacer 1.23|869466|23|LR134165|CRT matches to position: 864961-864983, mismatch: 2, identity: 0.913

aggagcaaccggcgcaacgggag	CRISPR spacer
aggtccaaccggcgcaacgggag	Protospacer
***  ******************

28. spacer 1.23|869466|23|LR134165|CRT matches to position: 865042-865064, mismatch: 2, identity: 0.913

aggagcaaccggcgcaacgggag	CRISPR spacer
aggagtaaccggggcaacgggag	Protospacer
*****.****** **********

29. spacer 1.23|869466|23|LR134165|CRT matches to position: 865500-865522, mismatch: 2, identity: 0.913

aggagcaaccggcgcaacgggag	CRISPR spacer
aggagcaaccggtccaacgggag	Protospacer
************. *********

30. spacer 1.23|869466|23|LR134165|CRT matches to position: 865617-865639, mismatch: 2, identity: 0.913

aggagcaaccggcgcaacgggag	CRISPR spacer
aggagcaaccggtccaacgggag	Protospacer
************. *********

31. spacer 1.23|869466|23|LR134165|CRT matches to position: 865734-865756, mismatch: 2, identity: 0.913

aggagcaaccggcgcaacgggag	CRISPR spacer
aggagtaaccggggcaacgggag	Protospacer
*****.****** **********

32. spacer 1.23|869466|23|LR134165|CRT matches to position: 865824-865846, mismatch: 2, identity: 0.913

aggagcaaccggcgcaacgggag	CRISPR spacer
aggtccaaccggcgcaacgggag	Protospacer
***  ******************

33. spacer 1.29|869808|23|LR134165|CRT matches to position: 863063-863085, mismatch: 2, identity: 0.913

aggtccaacaggtccaaccggag	CRISPR spacer
aggcccaacaggtccaacgggag	Protospacer
***.************** ****

34. spacer 1.29|869808|23|LR134165|CRT matches to position: 863458-863480, mismatch: 2, identity: 0.913

aggtccaacaggtccaaccggag	CRISPR spacer
aggcccaacaggtccaacgggag	Protospacer
***.************** ****

35. spacer 1.29|869808|23|LR134165|CRT matches to position: 863917-863939, mismatch: 2, identity: 0.913

aggtccaacaggtccaaccggag	CRISPR spacer
aggcccaacaggtccaacgggag	Protospacer
***.************** ****

36. spacer 1.29|869808|23|LR134165|CRT matches to position: 864934-864956, mismatch: 2, identity: 0.913

aggtccaacaggtccaaccggag	CRISPR spacer
aggaccaacgggtccaaccggag	Protospacer
*** *****.*************

37. spacer 1.29|869808|23|LR134165|CRT matches to position: 865797-865819, mismatch: 2, identity: 0.913

aggtccaacaggtccaaccggag	CRISPR spacer
aggaccaacgggtccaaccggag	Protospacer
*** *****.*************

38. spacer 1.29|869808|23|LR134165|CRT matches to position: 866148-866170, mismatch: 2, identity: 0.913

aggtccaacaggtccaaccggag	CRISPR spacer
aggagcaacaggtccaaccggag	Protospacer
***  ******************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
LR134165_1	1.4\|868233\|23\|LR134165\|CRT	868233-868255	23	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73744-73766	1	0.957
LR134165_1	1.4\|868233\|23\|LR134165\|CRT	868233-868255	23	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73969-73991	1	0.957
LR134165_1	1.4\|868233\|23\|LR134165\|CRT	868233-868255	23	MN694114	Marine virus AFVG_250M252, complete genome	19700-19722	1	0.957
LR134165_1	1.4\|868233\|23\|LR134165\|CRT	868233-868255	23	MG209611	Aphanizomenon phage vB_AphaS-CL131, complete genome	32390-32412	1	0.957
LR134165_1	1.23\|869466\|23\|LR134165\|CRT	869466-869488	23	MN694114	Marine virus AFVG_250M252, complete genome	19700-19722	1	0.957
LR134165_1	1.4\|868233\|23\|LR134165\|CRT	868233-868255	23	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68911-68933	2	0.913
LR134165_1	1.4\|868233\|23\|LR134165\|CRT	868233-868255	23	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73555-73577	2	0.913
LR134165_1	1.4\|868233\|23\|LR134165\|CRT	868233-868255	23	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73636-73658	2	0.913
LR134165_1	1.4\|868233\|23\|LR134165\|CRT	868233-868255	23	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73663-73685	2	0.913
LR134165_1	1.4\|868233\|23\|LR134165\|CRT	868233-868255	23	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73906-73928	2	0.913
LR134165_1	1.4\|868233\|23\|LR134165\|CRT	868233-868255	23	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130740-130762	2	0.913
LR134165_1	1.4\|868233\|23\|LR134165\|CRT	868233-868255	23	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130767-130789	2	0.913
LR134165_1	1.4\|868233\|23\|LR134165\|CRT	868233-868255	23	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68929-68951	2	0.913
LR134165_1	1.4\|868233\|23\|LR134165\|CRT	868233-868255	23	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71170-71192	2	0.913
LR134165_1	1.4\|868233\|23\|LR134165\|CRT	868233-868255	23	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71206-71228	2	0.913
LR134165_1	1.4\|868233\|23\|LR134165\|CRT	868233-868255	23	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	72579-72601	2	0.913
LR134165_1	1.4\|868233\|23\|LR134165\|CRT	868233-868255	23	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	72606-72628	2	0.913
LR134165_1	1.4\|868233\|23\|LR134165\|CRT	868233-868255	23	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73681-73703	2	0.913
LR134165_1	1.4\|868233\|23\|LR134165\|CRT	868233-868255	23	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73717-73739	2	0.913
LR134165_1	1.4\|868233\|23\|LR134165\|CRT	868233-868255	23	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130578-130600	2	0.913
LR134165_1	1.4\|868233\|23\|LR134165\|CRT	868233-868255	23	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130758-130780	2	0.913
LR134165_1	1.4\|868233\|23\|LR134165\|CRT	868233-868255	23	MN694114	Marine virus AFVG_250M252, complete genome	19718-19740	2	0.913
LR134165_1	1.4\|868233\|23\|LR134165\|CRT	868233-868255	23	MG209611	Aphanizomenon phage vB_AphaS-CL131, complete genome	32381-32403	2	0.913
LR134165_1	1.4\|868233\|23\|LR134165\|CRT	868233-868255	23	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321703-321725	2	0.913
LR134165_1	1.4\|868233\|23\|LR134165\|CRT	868233-868255	23	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321748-321770	2	0.913
LR134165_1	1.4\|868233\|23\|LR134165\|CRT	868233-868255	23	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321892-321914	2	0.913
LR134165_1	1.4\|868233\|23\|LR134165\|CRT	868233-868255	23	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321793-321815	2	0.913
LR134165_1	1.4\|868233\|23\|LR134165\|CRT	868233-868255	23	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321829-321851	2	0.913
LR134165_1	1.4\|868233\|23\|LR134165\|CRT	868233-868255	23	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321856-321878	2	0.913
LR134165_1	1.4\|868233\|23\|LR134165\|CRT	868233-868255	23	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321874-321896	2	0.913
LR134165_1	1.4\|868233\|23\|LR134165\|CRT	868233-868255	23	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321901-321923	2	0.913
LR134165_1	1.4\|868233\|23\|LR134165\|CRT	868233-868255	23	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321928-321950	2	0.913
LR134165_1	1.4\|868233\|23\|LR134165\|CRT	868233-868255	23	KY421186	Flavobacterium phage FL-1, complete genome	26703-26725	2	0.913
LR134165_1	1.4\|868233\|23\|LR134165\|CRT	868233-868255	23	KY421186	Flavobacterium phage FL-1, complete genome	26784-26806	2	0.913
LR134165_1	1.4\|868233\|23\|LR134165\|CRT	868233-868255	23	KY421186	Flavobacterium phage FL-1, complete genome	26883-26905	2	0.913
LR134165_1	1.4\|868233\|23\|LR134165\|CRT	868233-868255	23	KY421186	Flavobacterium phage FL-1, complete genome	26685-26707	2	0.913
LR134165_1	1.4\|868233\|23\|LR134165\|CRT	868233-868255	23	KY421186	Flavobacterium phage FL-1, complete genome	26874-26896	2	0.913
LR134165_1	1.4\|868233\|23\|LR134165\|CRT	868233-868255	23	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	251934-251956	2	0.913
LR134165_1	1.4\|868233\|23\|LR134165\|CRT	868233-868255	23	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	251898-251920	2	0.913
LR134165_1	1.4\|868233\|23\|LR134165\|CRT	868233-868255	23	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	133-155	2	0.913
LR134165_1	1.4\|868233\|23\|LR134165\|CRT	868233-868255	23	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	232-254	2	0.913
LR134165_1	1.4\|868233\|23\|LR134165\|CRT	868233-868255	23	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	403-425	2	0.913
LR134165_1	1.4\|868233\|23\|LR134165\|CRT	868233-868255	23	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	448-470	2	0.913
LR134165_1	1.4\|868233\|23\|LR134165\|CRT	868233-868255	23	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	97-119	2	0.913
LR134165_1	1.4\|868233\|23\|LR134165\|CRT	868233-868255	23	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	124-146	2	0.913
LR134165_1	1.4\|868233\|23\|LR134165\|CRT	868233-868255	23	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	151-173	2	0.913
LR134165_1	1.4\|868233\|23\|LR134165\|CRT	868233-868255	23	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	169-191	2	0.913
LR134165_1	1.4\|868233\|23\|LR134165\|CRT	868233-868255	23	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	196-218	2	0.913
LR134165_1	1.4\|868233\|23\|LR134165\|CRT	868233-868255	23	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	223-245	2	0.913
LR134165_1	1.4\|868233\|23\|LR134165\|CRT	868233-868255	23	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	250-272	2	0.913
LR134165_1	1.4\|868233\|23\|LR134165\|CRT	868233-868255	23	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	268-290	2	0.913
LR134165_1	1.4\|868233\|23\|LR134165\|CRT	868233-868255	23	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	295-317	2	0.913
LR134165_1	1.4\|868233\|23\|LR134165\|CRT	868233-868255	23	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	322-344	2	0.913
LR134165_1	1.4\|868233\|23\|LR134165\|CRT	868233-868255	23	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	358-380	2	0.913
LR134165_1	1.4\|868233\|23\|LR134165\|CRT	868233-868255	23	NZ_CP021356	Rhodococcus sp. S2-17 plasmid pRB29, complete sequence	58289-58311	2	0.913
LR134165_1	1.4\|868233\|23\|LR134165\|CRT	868233-868255	23	NZ_CP046575	Rhodococcus sp. WAY2 plasmid pRWAY03, complete sequence	30743-30765	2	0.913
LR134165_1	1.23\|869466\|23\|LR134165\|CRT	869466-869488	23	MN694114	Marine virus AFVG_250M252, complete genome	19718-19740	2	0.913
LR134165_1	1.23\|869466\|23\|LR134165\|CRT	869466-869488	23	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73717-73739	2	0.913
LR134165_1	1.23\|869466\|23\|LR134165\|CRT	869466-869488	23	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68911-68933	2	0.913
LR134165_1	1.23\|869466\|23\|LR134165\|CRT	869466-869488	23	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73555-73577	2	0.913
LR134165_1	1.23\|869466\|23\|LR134165\|CRT	869466-869488	23	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73663-73685	2	0.913
LR134165_1	1.23\|869466\|23\|LR134165\|CRT	869466-869488	23	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130740-130762	2	0.913
LR134165_1	1.23\|869466\|23\|LR134165\|CRT	869466-869488	23	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130767-130789	2	0.913
LR134165_1	1.23\|869466\|23\|LR134165\|CRT	869466-869488	23	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	251916-251938	2	0.913
LR134165_1	1.23\|869466\|23\|LR134165\|CRT	869466-869488	23	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	251988-252010	2	0.913
LR134165_1	1.23\|869466\|23\|LR134165\|CRT	869466-869488	23	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	133-155	2	0.913
LR134165_1	1.23\|869466\|23\|LR134165\|CRT	869466-869488	23	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	232-254	2	0.913
LR134165_1	1.23\|869466\|23\|LR134165\|CRT	869466-869488	23	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	403-425	2	0.913
LR134165_1	1.23\|869466\|23\|LR134165\|CRT	869466-869488	23	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	448-470	2	0.913
LR134165_1	1.23\|869466\|23\|LR134165\|CRT	869466-869488	23	MG209611	Aphanizomenon phage vB_AphaS-CL131, complete genome	32381-32403	2	0.913
LR134165_1	1.23\|869466\|23\|LR134165\|CRT	869466-869488	23	NZ_CP031193	Humibacter sp. BT305 plasmid unnamed1	35581-35603	2	0.913
LR134165_1	1.23\|869466\|23\|LR134165\|CRT	869466-869488	23	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321703-321725	2	0.913
LR134165_1	1.23\|869466\|23\|LR134165\|CRT	869466-869488	23	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321748-321770	2	0.913
LR134165_1	1.23\|869466\|23\|LR134165\|CRT	869466-869488	23	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321892-321914	2	0.913
LR134165_1	1.27\|869700\|32\|LR134165\|CRT	869700-869731	32	MN694114	Marine virus AFVG_250M252, complete genome	19691-19722	2	0.938
LR134165_1	1.27\|869700\|32\|LR134165\|CRT	869700-869731	32	MN694114	Marine virus AFVG_250M252, complete genome	19709-19740	2	0.938
LR134165_1	1.29\|869808\|23\|LR134165\|CRT	869808-869830	23	DQ222855	Bacillus anthracis phage Gamma isolate 53, complete genome	31271-31293	2	0.913
LR134165_1	1.29\|869808\|23\|LR134165\|CRT	869808-869830	23	DQ289555	Bacillus anthracis phage W Beta, complete genome	34071-34093	2	0.913
LR134165_1	1.29\|869808\|23\|LR134165\|CRT	869808-869830	23	NC_007734	Bacillus phage WBeta, complete genome	34071-34093	2	0.913
LR134165_1	1.29\|869808\|23\|LR134165\|CRT	869808-869830	23	DQ222854	Bacillus anthracis phage Gamma collagen region, complete sequence	4188-4210	2	0.913
LR134165_1	1.29\|869808\|23\|LR134165\|CRT	869808-869830	23	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	243080-243102	2	0.913
LR134165_1	1.12\|868692\|32\|LR134165\|CRT	868692-868723	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71206-71237	3	0.906
LR134165_1	1.12\|868692\|32\|LR134165\|CRT	868692-868723	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68866-68897	3	0.906
LR134165_1	1.12\|868692\|32\|LR134165\|CRT	868692-868723	32	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	131075-131106	3	0.906
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	125270-125301	3	0.906
LR134165_1	1.20\|869277\|32\|LR134165\|CRT	869277-869308	32	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	472756-472787	3	0.906
LR134165_1	1.27\|869700\|32\|LR134165\|CRT	869700-869731	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73735-73766	3	0.906
LR134165_1	1.27\|869700\|32\|LR134165\|CRT	869700-869731	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73672-73703	3	0.906
LR134165_1	1.27\|869700\|32\|LR134165\|CRT	869700-869731	32	MG209611	Aphanizomenon phage vB_AphaS-CL131, complete genome	32381-32412	3	0.906
LR134165_1	1.28\|869754\|32\|LR134165\|CRT	869754-869785	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73564-73595	3	0.906
LR134165_1	1.29\|869808\|23\|LR134165\|CRT	869808-869830	23	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	253689-253711	3	0.87
LR134165_1	1.29\|869808\|23\|LR134165\|CRT	869808-869830	23	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	253698-253720	3	0.87
LR134165_1	1.29\|869808\|23\|LR134165\|CRT	869808-869830	23	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	254091-254113	3	0.87
LR134165_1	1.29\|869808\|23\|LR134165\|CRT	869808-869830	23	NZ_CP028885	Borrelia turcica IST7 plasmid lp129, complete sequence	114718-114740	3	0.87
LR134165_1	1.29\|869808\|23\|LR134165\|CRT	869808-869830	23	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71446-71468	3	0.87
LR134165_1	1.12\|868692\|32\|LR134165\|CRT	868692-868723	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68776-68807	4	0.875
LR134165_1	1.12\|868692\|32\|LR134165\|CRT	868692-868723	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68785-68816	4	0.875
LR134165_1	1.12\|868692\|32\|LR134165\|CRT	868692-868723	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68794-68825	4	0.875
LR134165_1	1.12\|868692\|32\|LR134165\|CRT	868692-868723	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68803-68834	4	0.875
LR134165_1	1.12\|868692\|32\|LR134165\|CRT	868692-868723	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68812-68843	4	0.875
LR134165_1	1.12\|868692\|32\|LR134165\|CRT	868692-868723	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68821-68852	4	0.875
LR134165_1	1.12\|868692\|32\|LR134165\|CRT	868692-868723	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68830-68861	4	0.875
LR134165_1	1.12\|868692\|32\|LR134165\|CRT	868692-868723	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68839-68870	4	0.875
LR134165_1	1.12\|868692\|32\|LR134165\|CRT	868692-868723	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68848-68879	4	0.875
LR134165_1	1.12\|868692\|32\|LR134165\|CRT	868692-868723	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68857-68888	4	0.875
LR134165_1	1.12\|868692\|32\|LR134165\|CRT	868692-868723	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68920-68951	4	0.875
LR134165_1	1.12\|868692\|32\|LR134165\|CRT	868692-868723	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90216-90247	4	0.875
LR134165_1	1.12\|868692\|32\|LR134165\|CRT	868692-868723	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90225-90256	4	0.875
LR134165_1	1.12\|868692\|32\|LR134165\|CRT	868692-868723	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90234-90265	4	0.875
LR134165_1	1.12\|868692\|32\|LR134165\|CRT	868692-868723	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90243-90274	4	0.875
LR134165_1	1.12\|868692\|32\|LR134165\|CRT	868692-868723	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90252-90283	4	0.875
LR134165_1	1.12\|868692\|32\|LR134165\|CRT	868692-868723	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90261-90292	4	0.875
LR134165_1	1.12\|868692\|32\|LR134165\|CRT	868692-868723	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90270-90301	4	0.875
LR134165_1	1.12\|868692\|32\|LR134165\|CRT	868692-868723	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130569-130600	4	0.875
LR134165_1	1.12\|868692\|32\|LR134165\|CRT	868692-868723	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130587-130618	4	0.875
LR134165_1	1.12\|868692\|32\|LR134165\|CRT	868692-868723	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130596-130627	4	0.875
LR134165_1	1.12\|868692\|32\|LR134165\|CRT	868692-868723	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130659-130690	4	0.875
LR134165_1	1.12\|868692\|32\|LR134165\|CRT	868692-868723	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130668-130699	4	0.875
LR134165_1	1.12\|868692\|32\|LR134165\|CRT	868692-868723	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130677-130708	4	0.875
LR134165_1	1.12\|868692\|32\|LR134165\|CRT	868692-868723	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130686-130717	4	0.875
LR134165_1	1.12\|868692\|32\|LR134165\|CRT	868692-868723	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130695-130726	4	0.875
LR134165_1	1.12\|868692\|32\|LR134165\|CRT	868692-868723	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130704-130735	4	0.875
LR134165_1	1.12\|868692\|32\|LR134165\|CRT	868692-868723	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130713-130744	4	0.875
LR134165_1	1.12\|868692\|32\|LR134165\|CRT	868692-868723	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130722-130753	4	0.875
LR134165_1	1.12\|868692\|32\|LR134165\|CRT	868692-868723	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130749-130780	4	0.875
LR134165_1	1.12\|868692\|32\|LR134165\|CRT	868692-868723	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68929-68960	4	0.875
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	NC_010180	Bacillus mycoides KBAB4 plasmid pBWB401, complete sequence	116697-116728	4	0.875
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	472792-472823	5	0.844
LR134165_1	1.12\|868692\|32\|LR134165\|CRT	868692-868723	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71542-71573	5	0.844
LR134165_1	1.12\|868692\|32\|LR134165\|CRT	868692-868723	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130578-130609	5	0.844
LR134165_1	1.12\|868692\|32\|LR134165\|CRT	868692-868723	32	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	358-389	5	0.844
LR134165_1	1.12\|868692\|32\|LR134165\|CRT	868692-868723	32	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321784-321815	5	0.844
LR134165_1	1.20\|869277\|32\|LR134165\|CRT	869277-869308	32	NZ_CP053689	Arthrobacter citreus strain NEB 577 plasmid unnamed1, complete sequence	173231-173262	5	0.844
LR134165_1	1.27\|869700\|32\|LR134165\|CRT	869700-869731	32	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	394-425	5	0.844
LR134165_1	1.27\|869700\|32\|LR134165\|CRT	869700-869731	32	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	439-470	5	0.844
LR134165_1	1.27\|869700\|32\|LR134165\|CRT	869700-869731	32	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321703-321734	5	0.844
LR134165_1	1.27\|869700\|32\|LR134165\|CRT	869700-869731	32	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321748-321779	5	0.844
LR134165_1	1.2\|868107\|32\|LR134165\|CRT	868107-868138	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	161322-161353	6	0.812
LR134165_1	1.5\|868278\|32\|LR134165\|CRT	868278-868309	32	NZ_CP016082	Streptomyces sp. SAT1 plasmid unnamed2, complete sequence	220862-220893	6	0.812
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68911-68942	6	0.812
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73969-74000	6	0.812
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130740-130771	6	0.812
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71551-71582	6	0.812
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68866-68897	6	0.812
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68929-68960	6	0.812
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	133-164	6	0.812
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	232-263	6	0.812
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	403-434	6	0.812
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321739-321770	6	0.812
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321883-321914	6	0.812
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	131075-131106	6	0.812
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP053689	Arthrobacter citreus strain NEB 577 plasmid unnamed1, complete sequence	173150-173181	6	0.812
LR134165_1	1.12\|868692\|32\|LR134165\|CRT	868692-868723	32	MN693798	Marine virus AFVG_250M119, complete genome	11463-11494	6	0.812
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	328082-328113	6	0.812
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	328172-328203	6	0.812
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	328280-328311	6	0.812
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4642-4673	6	0.812
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4732-4763	6	0.812
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4840-4871	6	0.812
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	NZ_CP020744	Bacillus mycoides strain Gnyt1 plasmid unnamed1, complete sequence	49878-49909	6	0.812
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	NZ_CP020744	Bacillus mycoides strain Gnyt1 plasmid unnamed1, complete sequence	49914-49945	6	0.812
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	NZ_CP020744	Bacillus mycoides strain Gnyt1 plasmid unnamed1, complete sequence	49986-50017	6	0.812
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	NZ_CP020744	Bacillus mycoides strain Gnyt1 plasmid unnamed1, complete sequence	50022-50053	6	0.812
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	NZ_CP009638	Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence	42455-42486	6	0.812
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	NZ_CP009638	Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence	42527-42558	6	0.812
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	NZ_CP009638	Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence	42635-42666	6	0.812
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	NZ_CP009639	Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence	137856-137887	6	0.812
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	NZ_CP009639	Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence	137928-137959	6	0.812
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	NZ_CP009639	Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence	138036-138067	6	0.812
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	NZ_CP053963	Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence	179441-179472	6	0.812
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	NZ_CP053963	Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence	179513-179544	6	0.812
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	NZ_CP053963	Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence	179621-179652	6	0.812
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	NZ_CP053966	Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence	53526-53557	6	0.812
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	NZ_CP053966	Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence	53634-53665	6	0.812
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	NZ_CP053966	Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence	53706-53737	6	0.812
LR134165_1	1.20\|869277\|32\|LR134165\|CRT	869277-869308	32	NZ_CP053689	Arthrobacter citreus strain NEB 577 plasmid unnamed1, complete sequence	173339-173370	6	0.812
LR134165_1	1.21\|869331\|32\|LR134165\|CRT	869331-869362	32	NC_010180	Bacillus mycoides KBAB4 plasmid pBWB401, complete sequence	116688-116719	6	0.812
LR134165_1	1.21\|869331\|32\|LR134165\|CRT	869331-869362	32	NC_010180	Bacillus mycoides KBAB4 plasmid pBWB401, complete sequence	116724-116755	6	0.812
LR134165_1	1.25\|869565\|32\|LR134165\|CRT	869565-869596	32	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	472756-472787	6	0.812
LR134165_1	1.25\|869565\|32\|LR134165\|CRT	869565-869596	32	NC_014025	Bacillus megaterium QM B1551 plasmid pBM500, complete sequence	56215-56246	6	0.812
LR134165_1	1.27\|869700\|32\|LR134165\|CRT	869700-869731	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68902-68933	6	0.812
LR134165_1	1.27\|869700\|32\|LR134165\|CRT	869700-869731	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73627-73658	6	0.812
LR134165_1	1.27\|869700\|32\|LR134165\|CRT	869700-869731	32	KY421186	Flavobacterium phage FL-1, complete genome	26883-26914	6	0.812
LR134165_1	1.27\|869700\|32\|LR134165\|CRT	869700-869731	32	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	88-119	6	0.812
LR134165_1	1.27\|869700\|32\|LR134165\|CRT	869700-869731	32	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321928-321959	6	0.812
LR134165_1	1.27\|869700\|32\|LR134165\|CRT	869700-869731	32	NZ_CP021356	Rhodococcus sp. S2-17 plasmid pRB29, complete sequence	58280-58311	6	0.812
LR134165_1	1.27\|869700\|32\|LR134165\|CRT	869700-869731	32	NZ_CP046575	Rhodococcus sp. WAY2 plasmid pRWAY03, complete sequence	30734-30765	6	0.812
LR134165_1	1.27\|869700\|32\|LR134165\|CRT	869700-869731	32	NZ_CP011518	Pandoraea oxalativorans strain DSM 23570 plasmid pPO70-1, complete sequence	243043-243074	6	0.812
LR134165_1	1.2\|868107\|32\|LR134165\|CRT	868107-868138	32	NZ_CP021071	Mesorhizobium sp. WSM1497 plasmid pWSM1497, complete sequence	115-146	7	0.781
LR134165_1	1.5\|868278\|32\|LR134165\|CRT	868278-868309	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71377-71408	7	0.781
LR134165_1	1.5\|868278\|32\|LR134165\|CRT	868278-868309	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	72480-72511	7	0.781
LR134165_1	1.5\|868278\|32\|LR134165\|CRT	868278-868309	32	NC_019740	Microcoleus sp. PCC 7113 plasmid pMIC7113.03, complete sequence	67786-67817	7	0.781
LR134165_1	1.5\|868278\|32\|LR134165\|CRT	868278-868309	32	MN694155	Marine virus AFVG_250M1019, complete genome	34960-34991	7	0.781
LR134165_1	1.5\|868278\|32\|LR134165\|CRT	868278-868309	32	MN855854	Siphoviridae sp. isolate 269, complete genome	2175-2206	7	0.781
LR134165_1	1.6\|868332\|32\|LR134165\|CRT	868332-868363	32	NC_008464	Stx2-converting phage 86, complete genome	18072-18103	7	0.781
LR134165_1	1.6\|868332\|32\|LR134165\|CRT	868332-868363	32	KJ603229	Shigella phage POCJ13, complete genome	38802-38833	7	0.781
LR134165_1	1.6\|868332\|32\|LR134165\|CRT	868332-868363	32	AB255436	Stx2-converting phage 86 DNA, complete genome	18072-18103	7	0.781
LR134165_1	1.6\|868332\|32\|LR134165\|CRT	868332-868363	32	MH727593	Acidovorax phage ACPWH, complete genome	42297-42328	7	0.781
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68776-68807	7	0.781
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68785-68816	7	0.781
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68794-68825	7	0.781
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68803-68834	7	0.781
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68812-68843	7	0.781
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68821-68852	7	0.781
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68830-68861	7	0.781
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68839-68870	7	0.781
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68848-68879	7	0.781
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68857-68888	7	0.781
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73951-73982	7	0.781
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90216-90247	7	0.781
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90225-90256	7	0.781
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90234-90265	7	0.781
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90243-90274	7	0.781
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90252-90283	7	0.781
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90261-90292	7	0.781
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90270-90301	7	0.781
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130578-130609	7	0.781
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130587-130618	7	0.781
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130596-130627	7	0.781
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130659-130690	7	0.781
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130668-130699	7	0.781
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130677-130708	7	0.781
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130686-130717	7	0.781
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130695-130726	7	0.781
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130704-130735	7	0.781
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130713-130744	7	0.781
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130722-130753	7	0.781
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130767-130798	7	0.781
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	106-137	7	0.781
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	151-182	7	0.781
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	178-209	7	0.781
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	205-236	7	0.781
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	250-281	7	0.781
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	277-308	7	0.781
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	304-335	7	0.781
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	358-389	7	0.781
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	448-479	7	0.781
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321694-321725	7	0.781
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321784-321815	7	0.781
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321838-321869	7	0.781
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321865-321896	7	0.781
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321910-321941	7	0.781
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	131084-131115	7	0.781
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	133962-133993	7	0.781
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	MN693798	Marine virus AFVG_250M119, complete genome	11463-11494	7	0.781
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	CP002509	Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence	5894-5925	7	0.781
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	CP002509	Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence	5912-5943	7	0.781
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	CP002509	Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence	5930-5961	7	0.781
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	CP002509	Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence	5948-5979	7	0.781
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	CP002509	Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence	6002-6033	7	0.781
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	CP002509	Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence	6020-6051	7	0.781
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	CP002509	Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence	6038-6069	7	0.781
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	CP002509	Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence	6056-6087	7	0.781
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	CP002509	Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence	6074-6105	7	0.781
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	CP002509	Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence	6110-6141	7	0.781
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	CP002509	Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence	6200-6231	7	0.781
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	CP002509	Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence	6218-6249	7	0.781
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	CP002509	Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence	6236-6267	7	0.781
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	CP002509	Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence	6254-6285	7	0.781
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	CP002509	Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence	6290-6321	7	0.781
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	CP002509	Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence	6326-6357	7	0.781
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	CP002509	Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence	6416-6447	7	0.781
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	CP002509	Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence	6524-6555	7	0.781
LR134165_1	1.12\|868692\|32\|LR134165\|CRT	868692-868723	32	NC_028998	Phormidium phage MIS-PhV1B, complete genome	7523-7554	7	0.781
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	328352-328383	7	0.781
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	327938-327969	7	0.781
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	327974-328005	7	0.781
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	328100-328131	7	0.781
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	328136-328167	7	0.781
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	328316-328347	7	0.781
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4912-4943	7	0.781
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4498-4529	7	0.781
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4534-4565	7	0.781
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4660-4691	7	0.781
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4696-4727	7	0.781
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4876-4907	7	0.781
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	NZ_CP009638	Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence	42563-42594	7	0.781
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	NZ_CP009638	Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence	42599-42630	7	0.781
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	NZ_CP009639	Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence	137964-137995	7	0.781
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	NZ_CP009639	Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence	138000-138031	7	0.781
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	NZ_CP016452	Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence	1105134-1105165	7	0.781
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	NZ_CP053963	Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence	179549-179580	7	0.781
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	NZ_CP053963	Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence	179585-179616	7	0.781
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	NZ_CP053966	Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence	53562-53593	7	0.781
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	NZ_CP053966	Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence	53598-53629	7	0.781
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	133962-133993	7	0.781
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	1005-1036	7	0.781
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	NZ_CP011156	Bacillus cereus strain HN001 plasmid pRML01, complete sequence	127076-127107	7	0.781
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	CP002509	Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence	5894-5925	7	0.781
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	CP002509	Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence	5912-5943	7	0.781
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	CP002509	Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence	5930-5961	7	0.781
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	CP002509	Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence	5948-5979	7	0.781
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	CP002509	Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence	6002-6033	7	0.781
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	CP002509	Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence	6020-6051	7	0.781
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	CP002509	Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence	6038-6069	7	0.781
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	CP002509	Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence	6056-6087	7	0.781
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	CP002509	Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence	6200-6231	7	0.781
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	CP002509	Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence	6218-6249	7	0.781
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	CP002509	Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence	6236-6267	7	0.781
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	CP002509	Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence	6416-6447	7	0.781
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	CP002509	Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence	6524-6555	7	0.781
LR134165_1	1.20\|869277\|32\|LR134165\|CRT	869277-869308	32	NZ_CP053689	Arthrobacter citreus strain NEB 577 plasmid unnamed1, complete sequence	173141-173172	7	0.781
LR134165_1	1.20\|869277\|32\|LR134165\|CRT	869277-869308	32	NZ_CP041094	Klebsiella pneumoniae subsp. pneumoniae strain KPCTRSRTH01 plasmid unnamed2, complete sequence	84321-84352	7	0.781
LR134165_1	1.20\|869277\|32\|LR134165\|CRT	869277-869308	32	MK649828	Klebsiella pneumoniae strain 1675479 plasmid p1675479_1, complete sequence	57324-57355	7	0.781
LR134165_1	1.21\|869331\|32\|LR134165\|CRT	869331-869362	32	NZ_CP025614	Niveispirillum cyanobacteriorum strain TH16 plasmid unnamed2, complete sequence	50649-50680	7	0.781
LR134165_1	1.24\|869511\|32\|LR134165\|CRT	869511-869542	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71377-71408	7	0.781
LR134165_1	1.24\|869511\|32\|LR134165\|CRT	869511-869542	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	72480-72511	7	0.781
LR134165_1	1.24\|869511\|32\|LR134165\|CRT	869511-869542	32	NZ_CP016082	Streptomyces sp. SAT1 plasmid unnamed2, complete sequence	220862-220893	7	0.781
LR134165_1	1.24\|869511\|32\|LR134165\|CRT	869511-869542	32	MN694155	Marine virus AFVG_250M1019, complete genome	34960-34991	7	0.781
LR134165_1	1.24\|869511\|32\|LR134165\|CRT	869511-869542	32	MN855854	Siphoviridae sp. isolate 269, complete genome	2175-2206	7	0.781
LR134165_1	1.24\|869511\|32\|LR134165\|CRT	869511-869542	32	MN694697	Marine virus AFVG_250M792, complete genome	19461-19492	7	0.781
LR134165_1	1.25\|869565\|32\|LR134165\|CRT	869565-869596	32	NZ_CP015063	Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence	788-819	7	0.781
LR134165_1	1.25\|869565\|32\|LR134165\|CRT	869565-869596	32	NZ_CP015063	Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence	986-1017	7	0.781
LR134165_1	1.25\|869565\|32\|LR134165\|CRT	869565-869596	32	KU963260	Gordonia phage Emalyn, complete genome	29517-29548	7	0.781
LR134165_1	1.25\|869565\|32\|LR134165\|CRT	869565-869596	32	MK977707	Mycobacterium phage LilSpotty, complete genome	27112-27143	7	0.781
LR134165_1	1.25\|869565\|32\|LR134165\|CRT	869565-869596	32	MH727593	Acidovorax phage ACPWH, complete genome	42297-42328	7	0.781
LR134165_1	1.25\|869565\|32\|LR134165\|CRT	869565-869596	32	NZ_CP011156	Bacillus cereus strain HN001 plasmid pRML01, complete sequence	127067-127098	7	0.781
LR134165_1	1.25\|869565\|32\|LR134165\|CRT	869565-869596	32	MN693279	Marine virus AFVG_25M346, complete genome	16388-16419	7	0.781
LR134165_1	1.27\|869700\|32\|LR134165\|CRT	869700-869731	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	72615-72646	7	0.781
LR134165_1	1.27\|869700\|32\|LR134165\|CRT	869700-869731	32	NZ_CP029452	Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence	268834-268865	7	0.781
LR134165_1	1.28\|869754\|32\|LR134165\|CRT	869754-869785	32	NZ_AP014705	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence	515403-515434	7	0.781
LR134165_1	1.30\|869853\|32\|LR134165\|CRT	869853-869884	32	NC_019718	Enterobacteria phage vB_EcoS_Rogue1, complete genome	10361-10392	7	0.781
LR134165_1	1.30\|869853\|32\|LR134165\|CRT	869853-869884	32	MF158039	Shigella phage Sf12, complete genome	35328-35359	7	0.781
LR134165_1	1.2\|868107\|32\|LR134165\|CRT	868107-868138	32	NC_014172	Bacillus thuringiensis BMB171 plasmid pBMB171, complete sequence	29701-29732	8	0.75
LR134165_1	1.2\|868107\|32\|LR134165\|CRT	868107-868138	32	NZ_CP016317	Bacillus cereus strain M3 plasmid pBCM301, complete sequence	156647-156678	8	0.75
LR134165_1	1.2\|868107\|32\|LR134165\|CRT	868107-868138	32	NC_011777	Bacillus cereus AH820 plasmid pAH820_272, complete sequence	125155-125186	8	0.75
LR134165_1	1.5\|868278\|32\|LR134165\|CRT	868278-868309	32	JQ680367	Unidentified phage clone 2203_scaffold802 genomic sequence	1583-1614	8	0.75
LR134165_1	1.5\|868278\|32\|LR134165\|CRT	868278-868309	32	MN694155	Marine virus AFVG_250M1019, complete genome	34951-34982	8	0.75
LR134165_1	1.6\|868332\|32\|LR134165\|CRT	868332-868363	32	NZ_CP030127	Indioceanicola profundi strain SCSIO 08040 plasmid unnamed1, complete sequence	717996-718027	8	0.75
LR134165_1	1.6\|868332\|32\|LR134165\|CRT	868332-868363	32	NZ_CP030127	Indioceanicola profundi strain SCSIO 08040 plasmid unnamed1, complete sequence	897080-897111	8	0.75
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73744-73775	8	0.75
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	72408-72439	8	0.75
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73627-73658	8	0.75
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68920-68951	8	0.75
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	72363-72394	8	0.75
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130569-130600	8	0.75
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130731-130762	8	0.75
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130749-130780	8	0.75
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130758-130789	8	0.75
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	340-371	8	0.75
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	124-155	8	0.75
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	223-254	8	0.75
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	322-353	8	0.75
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321802-321833	8	0.75
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321820-321851	8	0.75
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321892-321923	8	0.75
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP040345	Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence	416109-416140	8	0.75
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP020744	Bacillus mycoides strain Gnyt1 plasmid unnamed1, complete sequence	49878-49909	8	0.75
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP020744	Bacillus mycoides strain Gnyt1 plasmid unnamed1, complete sequence	49914-49945	8	0.75
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP020744	Bacillus mycoides strain Gnyt1 plasmid unnamed1, complete sequence	49986-50017	8	0.75
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP020744	Bacillus mycoides strain Gnyt1 plasmid unnamed1, complete sequence	50022-50053	8	0.75
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	GU943063	Uncultured phage MedDCM-OCT-S05-C139 genomic sequence	12519-12550	8	0.75
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	MN694697	Marine virus AFVG_250M792, complete genome	19461-19492	8	0.75
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP024582	Roseomonas sp. FDAARGOS_362 plasmid unnamed1, complete sequence	27669-27700	8	0.75
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP021356	Rhodococcus sp. S2-17 plasmid pRB29, complete sequence	58280-58311	8	0.75
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP046575	Rhodococcus sp. WAY2 plasmid pRWAY03, complete sequence	30734-30765	8	0.75
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	CP002509	Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence	5804-5835	8	0.75
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	CP002509	Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence	5840-5871	8	0.75
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	CP002509	Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence	5876-5907	8	0.75
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	CP002509	Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence	5984-6015	8	0.75
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	CP002509	Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence	6092-6123	8	0.75
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	CP002509	Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence	6128-6159	8	0.75
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	CP002509	Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence	6164-6195	8	0.75
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	CP002509	Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence	6182-6213	8	0.75
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	CP002509	Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence	6272-6303	8	0.75
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	CP002509	Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence	6308-6339	8	0.75
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	CP002509	Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence	6344-6375	8	0.75
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	CP002509	Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence	6362-6393	8	0.75
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	CP002509	Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence	6380-6411	8	0.75
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	CP002509	Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence	6452-6483	8	0.75
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	CP002509	Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence	6470-6501	8	0.75
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	CP002509	Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence	6506-6537	8	0.75
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP025188	Roseomonas mucosa strain AD2 plasmid p1-AD2, complete sequence	400595-400626	8	0.75
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	MN693163	Marine virus AFVG_25M177, complete genome	10902-10933	8	0.75
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	MN694068	Marine virus AFVG_250M543, complete genome	15672-15703	8	0.75
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	MG209611	Aphanizomenon phage vB_AphaS-CL131, complete genome	32381-32412	8	0.75
LR134165_1	1.12\|868692\|32\|LR134165\|CRT	868692-868723	32	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	88-119	8	0.75
LR134165_1	1.12\|868692\|32\|LR134165\|CRT	868692-868723	32	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321928-321959	8	0.75
LR134165_1	1.12\|868692\|32\|LR134165\|CRT	868692-868723	32	NZ_LT599050	Lactococcus lactis subsp. lactis strain A12 plasmid pA12-1, complete sequence	2663-2694	8	0.75
LR134165_1	1.12\|868692\|32\|LR134165\|CRT	868692-868723	32	CP029293	Lactococcus lactis subsp. lactis KLDS 4.0325 plasmid unnamed6	93176-93207	8	0.75
LR134165_1	1.12\|868692\|32\|LR134165\|CRT	868692-868723	32	MN694155	Marine virus AFVG_250M1019, complete genome	34960-34991	8	0.75
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68911-68942	8	0.75
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73969-74000	8	0.75
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130740-130771	8	0.75
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	NZ_CP040345	Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence	416109-416140	8	0.75
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	MN693226	Marine virus AFVG_25M419, complete genome	11827-11858	8	0.75
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	133-164	8	0.75
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	232-263	8	0.75
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	403-434	8	0.75
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321739-321770	8	0.75
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321883-321914	8	0.75
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	CP002509	Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence	5804-5835	8	0.75
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	CP002509	Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence	5840-5871	8	0.75
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	CP002509	Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence	5876-5907	8	0.75
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	CP002509	Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence	5984-6015	8	0.75
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	CP002509	Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence	6092-6123	8	0.75
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	CP002509	Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence	6182-6213	8	0.75
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	CP002509	Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence	6272-6303	8	0.75
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	CP002509	Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence	6308-6339	8	0.75
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	CP002509	Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence	6470-6501	8	0.75
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	CP002509	Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence	6506-6537	8	0.75
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	MN693263	Marine virus AFVG_25M296, complete genome	14161-14192	8	0.75
LR134165_1	1.20\|869277\|32\|LR134165\|CRT	869277-869308	32	NZ_CP017756	Cupriavidus malaysiensis strain USMAA1020 isolate pure plasmid unnamed1, complete sequence	70107-70138	8	0.75
LR134165_1	1.20\|869277\|32\|LR134165\|CRT	869277-869308	32	MN096362	Arthrobacter phage Vibaki, complete genome	41434-41465	8	0.75
LR134165_1	1.20\|869277\|32\|LR134165\|CRT	869277-869308	32	NC_023607	Mycobacterium phage 40AC, complete genome	5075-5106	8	0.75
LR134165_1	1.21\|869331\|32\|LR134165\|CRT	869331-869362	32	NC_010180	Bacillus mycoides KBAB4 plasmid pBWB401, complete sequence	116643-116674	8	0.75
LR134165_1	1.24\|869511\|32\|LR134165\|CRT	869511-869542	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68767-68798	8	0.75
LR134165_1	1.24\|869511\|32\|LR134165\|CRT	869511-869542	32	MN694155	Marine virus AFVG_250M1019, complete genome	34951-34982	8	0.75
LR134165_1	1.24\|869511\|32\|LR134165\|CRT	869511-869542	32	NC_048182	Edwardsiella virus pEt-SU, complete genome	145375-145406	8	0.75
LR134165_1	1.25\|869565\|32\|LR134165\|CRT	869565-869596	32	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	131066-131097	8	0.75
LR134165_1	1.25\|869565\|32\|LR134165\|CRT	869565-869596	32	MN586049	Gordonia phage Yarn, complete genome	30061-30092	8	0.75
LR134165_1	1.25\|869565\|32\|LR134165\|CRT	869565-869596	32	MN234215	Gordonia phage SteamedHams, complete genome	29908-29939	8	0.75
LR134165_1	1.27\|869700\|32\|LR134165\|CRT	869700-869731	32	MG209611	Aphanizomenon phage vB_AphaS-CL131, complete genome	32390-32421	8	0.75
LR134165_1	1.27\|869700\|32\|LR134165\|CRT	869700-869731	32	NZ_CP034331	Tabrizicola piscis strain K13M18 plasmid unnamed3, complete sequence	1404-1435	8	0.75
LR134165_1	1.27\|869700\|32\|LR134165\|CRT	869700-869731	32	NZ_CP053689	Arthrobacter citreus strain NEB 577 plasmid unnamed1, complete sequence	173150-173181	8	0.75
LR134165_1	1.28\|869754\|32\|LR134165\|CRT	869754-869785	32	NC_011273	Mycobacterium phage Myrna, complete genome	132205-132236	8	0.75
LR134165_1	1.28\|869754\|32\|LR134165\|CRT	869754-869785	32	NZ_CP021356	Rhodococcus sp. S2-17 plasmid pRB29, complete sequence	58289-58320	8	0.75
LR134165_1	1.28\|869754\|32\|LR134165\|CRT	869754-869785	32	NZ_CP046575	Rhodococcus sp. WAY2 plasmid pRWAY03, complete sequence	30743-30774	8	0.75
LR134165_1	1.30\|869853\|32\|LR134165\|CRT	869853-869884	32	NZ_MF600313	Mycolicibacterium sp. CBMA 213 plasmid pCBMA213_1, complete sequence	135795-135826	8	0.75
LR134165_1	1.30\|869853\|32\|LR134165\|CRT	869853-869884	32	MF158042	Shigella phage Sd1, complete genome	31384-31415	8	0.75
LR134165_1	1.5\|868278\|32\|LR134165\|CRT	868278-868309	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130560-130591	9	0.719
LR134165_1	1.5\|868278\|32\|LR134165\|CRT	868278-868309	32	NZ_CP030933	Enterococcus gilvus strain CR1 plasmid pCR1A, complete sequence	597700-597731	9	0.719
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71278-71309	9	0.719
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71341-71372	9	0.719
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71377-71408	9	0.719
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	72480-72511	9	0.719
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	72747-72778	9	0.719
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73906-73937	9	0.719
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	115-146	9	0.719
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	160-191	9	0.719
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	187-218	9	0.719
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	214-245	9	0.719
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	259-290	9	0.719
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	286-317	9	0.719
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	313-344	9	0.719
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	349-380	9	0.719
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321793-321824	9	0.719
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321829-321860	9	0.719
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321856-321887	9	0.719
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321901-321932	9	0.719
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP032342	Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence	54657-54688	9	0.719
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP033321	Azospirillum brasilense strain Cd plasmid p3, complete sequence	4782-4813	9	0.719
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP033315	Azospirillum brasilense strain Sp 7 plasmid p3, complete sequence	67624-67655	9	0.719
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP021437	Bacillus thuringiensis strain C15 plasmid pBMB240, complete sequence	183754-183785	9	0.719
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP015254	Bacillus thuringiensis Bt18247 plasmid p81952, complete sequence	33504-33535	9	0.719
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	KY421186	Flavobacterium phage FL-1, complete genome	26883-26914	9	0.719
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	MG592551	Vibrio phage 1.185.O._10N.286.49.C2, partial genome	33139-33170	9	0.719
LR134165_1	1.12\|868692\|32\|LR134165\|CRT	868692-868723	32	MN693816	Marine virus AFVG_250M124, complete genome	30626-30657	9	0.719
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	NZ_CP021437	Bacillus thuringiensis strain C15 plasmid pBMB240, complete sequence	183754-183785	9	0.719
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	NZ_CP015254	Bacillus thuringiensis Bt18247 plasmid p81952, complete sequence	33504-33535	9	0.719
LR134165_1	1.24\|869511\|32\|LR134165\|CRT	869511-869542	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90207-90238	9	0.719
LR134165_1	1.24\|869511\|32\|LR134165\|CRT	869511-869542	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130560-130591	9	0.719
LR134165_1	1.24\|869511\|32\|LR134165\|CRT	869511-869542	32	NZ_CP030933	Enterococcus gilvus strain CR1 plasmid pCR1A, complete sequence	597700-597731	9	0.719
LR134165_1	1.27\|869700\|32\|LR134165\|CRT	869700-869731	32	NZ_CP023068	Ensifer sojae CCBAU 05684 plasmid pSJ05684b, complete sequence	1007309-1007340	9	0.719
LR134165_1	1.27\|869700\|32\|LR134165\|CRT	869700-869731	32	NZ_CP041223	Porphyrobacter sp. YT40 plasmid pYT40, complete sequence	27604-27635	9	0.719
LR134165_1	1.30\|869853\|32\|LR134165\|CRT	869853-869884	32	NZ_CP053933	Bacillus thuringiensis strain FDAARGOS_794 plasmid unnamed2, complete sequence	41537-41568	9	0.719
LR134165_1	1.30\|869853\|32\|LR134165\|CRT	869853-869884	32	NZ_CP053936	Bacillus thuringiensis strain FDAARGOS_794 plasmid unnamed4, complete sequence	11612-11643	9	0.719
LR134165_1	1.30\|869853\|32\|LR134165\|CRT	869853-869884	32	NZ_CP009718	Bacillus thuringiensis strain HD682 plasmid pBGN_2, complete sequence	15529-15560	9	0.719
LR134165_1	1.7\|868386\|32\|LR134165\|CRT	868386-868417	32	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	132554-132585	10	0.688
LR134165_1	1.13\|868746\|32\|LR134165\|CRT	868746-868777	32	NZ_CP027861	Ahniella affigens strain D13 plasmid unnamed, complete sequence	27899-27930	10	0.688
LR134165_1	1.20\|869277\|32\|LR134165\|CRT	869277-869308	32	NC_019848	Sinorhizobium meliloti GR4 plasmid pRmeGR4c, complete sequence	639853-639884	10	0.688
LR134165_1	1.20\|869277\|32\|LR134165\|CRT	869277-869308	32	NC_003037	Sinorhizobium meliloti 1021 plasmid pSymA, complete sequence	759998-760029	10	0.688
LR134165_1	1.20\|869277\|32\|LR134165\|CRT	869277-869308	32	NZ_CP019585	Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymA, complete sequence	796131-796162	10	0.688
LR134165_1	1.20\|869277\|32\|LR134165\|CRT	869277-869308	32	NC_017327	Sinorhizobium meliloti SM11 plasmid pSmeSM11c, complete sequence	820867-820898	10	0.688
LR134165_1	1.20\|869277\|32\|LR134165\|CRT	869277-869308	32	NZ_CP021798	Sinorhizobium meliloti strain USDA1106 plasmid psymA, complete sequence	1320797-1320828	10	0.688
LR134165_1	1.20\|869277\|32\|LR134165\|CRT	869277-869308	32	NC_017324	Sinorhizobium meliloti BL225C plasmid pSINMEB01, complete sequence	1174595-1174626	10	0.688
LR134165_1	1.20\|869277\|32\|LR134165\|CRT	869277-869308	32	NZ_CP009145	Sinorhizobium meliloti strain RMO17 plasmid pSymA, complete sequence	836504-836535	10	0.688
LR134165_1	1.20\|869277\|32\|LR134165\|CRT	869277-869308	32	NZ_CP021827	Sinorhizobium meliloti strain KH35c plasmid psymA, complete sequence	862904-862935	10	0.688
LR134165_1	1.20\|869277\|32\|LR134165\|CRT	869277-869308	32	NZ_CP021801	Sinorhizobium meliloti strain USDA1021 plasmid psymA, complete sequence	764453-764484	10	0.688
LR134165_1	1.20\|869277\|32\|LR134165\|CRT	869277-869308	32	NZ_CP021819	Sinorhizobium meliloti strain M162 plasmid psymA, complete sequence	670889-670920	10	0.688
LR134165_1	1.20\|869277\|32\|LR134165\|CRT	869277-869308	32	NZ_CP021830	Sinorhizobium meliloti strain HM006 plasmid psymA, complete sequence	233321-233352	10	0.688
LR134165_1	1.20\|869277\|32\|LR134165\|CRT	869277-869308	32	NZ_CP021824	Sinorhizobium meliloti strain KH46 plasmid psymA, complete sequence	717525-717556	10	0.688
LR134165_1	1.20\|869277\|32\|LR134165\|CRT	869277-869308	32	NZ_CP021813	Sinorhizobium meliloti strain M270 plasmid psymA, complete sequence	1147305-1147336	10	0.688
LR134165_1	1.20\|869277\|32\|LR134165\|CRT	869277-869308	32	NC_018683	Sinorhizobium meliloti Rm41 plasmid pSYMA, complete sequence	968844-968875	10	0.688
LR134165_1	1.20\|869277\|32\|LR134165\|CRT	869277-869308	32	NZ_CP021794	Sinorhizobium meliloti strain USDA1157 plasmid psymA, complete sequence	1331667-1331698	10	0.688
LR134165_1	1.20\|869277\|32\|LR134165\|CRT	869277-869308	32	NZ_CP021809	Sinorhizobium meliloti strain Rm41 plasmid psymA, complete sequence	1218334-1218365	10	0.688
LR134165_1	1.20\|869277\|32\|LR134165\|CRT	869277-869308	32	NZ_CP021805	Sinorhizobium meliloti strain T073 plasmid psymA, complete sequence	1084222-1084253	10	0.688
LR134165_1	1.20\|869277\|32\|LR134165\|CRT	869277-869308	32	NZ_CP021217	Sinorhizobium meliloti RU11/001 plasmid pSymA, complete sequence	410593-410624	10	0.688
LR134165_1	1.20\|869277\|32\|LR134165\|CRT	869277-869308	32	NZ_CP026526	Sinorhizobium meliloti strain AK21 plasmid pSymA, complete sequence	1049373-1049404	10	0.688
LR134165_1	1.20\|869277\|32\|LR134165\|CRT	869277-869308	32	NZ_CP019483	Sinorhizobium meliloti strain B401 plasmid pSymA, complete sequence	639007-639038	10	0.688
LR134165_1	1.20\|869277\|32\|LR134165\|CRT	869277-869308	32	NZ_CP019486	Sinorhizobium meliloti strain B399 plasmid pSymA, complete sequence	606684-606715	10	0.688
LR134165_1	1.20\|869277\|32\|LR134165\|CRT	869277-869308	32	NC_020527	Sinorhizobium meliloti 2011 plasmid pSymA, complete sequence	759665-759696	10	0.688
LR134165_1	1.30\|869853\|32\|LR134165\|CRT	869853-869884	32	NZ_CP034351	Streptomyces sp. W1SF4 plasmid p1, complete sequence	168145-168176	10	0.688
LR134165_1	1.25\|869565\|32\|LR134165\|CRT	869565-869596	32	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68974-69005	11	0.656

1. spacer 1.4|868233|23|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 1, identity: 0.957

gggagcaaccggagcaacgggag	CRISPR spacer
gggagtaaccggagcaacgggag	Protospacer
*****.*****************

2. spacer 1.4|868233|23|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 1, identity: 0.957

gggagcaaccggagcaacgggag	CRISPR spacer
gggagcaacaggagcaacgggag	Protospacer
********* *************

3. spacer 1.4|868233|23|LR134165|CRT matches to MN694114 (Marine virus AFVG_250M252, complete genome) position: , mismatch: 1, identity: 0.957

gggagcaaccggagcaacgggag	CRISPR spacer
gggagcaaccggcgcaacgggag	Protospacer
************ **********

4. spacer 1.4|868233|23|LR134165|CRT matches to MG209611 (Aphanizomenon phage vB_AphaS-CL131, complete genome) position: , mismatch: 1, identity: 0.957

gggagcaaccggagcaacgggag	CRISPR spacer
gggagcaacgggagcaacgggag	Protospacer
********* *************

5. spacer 1.23|869466|23|LR134165|CRT matches to MN694114 (Marine virus AFVG_250M252, complete genome) position: , mismatch: 1, identity: 0.957

aggagcaaccggcgcaacgggag	CRISPR spacer
gggagcaaccggcgcaacgggag	Protospacer
.**********************

6. spacer 1.4|868233|23|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.913

gggagcaaccggagcaacgggag	CRISPR spacer
aggagcaacaggagcaacgggag	Protospacer
.******** *************

7. spacer 1.4|868233|23|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.913

gggagcaaccggagcaacgggag	CRISPR spacer
aggagcaacgggagcaacgggag	Protospacer
.******** *************

8. spacer 1.4|868233|23|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.913

gggagcaaccggagcaacgggag	CRISPR spacer
cggagcaacgggagcaacgggag	Protospacer
 ******** *************

9. spacer 1.4|868233|23|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.913

gggagcaaccggagcaacgggag	CRISPR spacer
aggagtaaccggagcaacgggag	Protospacer
.****.*****************

10. spacer 1.4|868233|23|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.913

gggagcaaccggagcaacgggag	CRISPR spacer
tggagtaaccggagcaacgggag	Protospacer
 ****.*****************

11. spacer 1.4|868233|23|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.913

gggagcaaccggagcaacgggag	CRISPR spacer
aggagcaacaggagcaacgggag	Protospacer
.******** *************

12. spacer 1.4|868233|23|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.913

gggagcaaccggagcaacgggag	CRISPR spacer
aggagcaacaggagcaacgggag	Protospacer
.******** *************

13. spacer 1.4|868233|23|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.913

gggagcaaccggagcaacgggag	CRISPR spacer
gggagcaacaggagcaacaggag	Protospacer
********* ********.****

14. spacer 1.4|868233|23|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.913

gggagcaaccggagcaacgggag	CRISPR spacer
gggagcaaccggagcaacagggg	Protospacer
******************.**.*

15. spacer 1.4|868233|23|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.913

gggagcaaccggagcaacgggag	CRISPR spacer
gggagcaaccggagcgaccggag	Protospacer
***************.** ****

16. spacer 1.4|868233|23|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.913

gggagcaaccggagcaacgggag	CRISPR spacer
gggagcaatcggagcaacgggtg	Protospacer
********.************ *

17. spacer 1.4|868233|23|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.913

gggagcaaccggagcaacgggag	CRISPR spacer
gggagcagcaggagcaacgggag	Protospacer
*******.* *************

18. spacer 1.4|868233|23|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.913

gggagcaaccggagcaacgggag	CRISPR spacer
gggagcagccggagcaacggggg	Protospacer
*******.*************.*

19. spacer 1.4|868233|23|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.913

gggagcaaccggagcaacgggag	CRISPR spacer
gggagcaaccggcccaacgggag	Protospacer
************  *********

20. spacer 1.4|868233|23|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.913

gggagcaaccggagcaacgggag	CRISPR spacer
gggagcaacaggagcaacaggag	Protospacer
********* ********.****

21. spacer 1.4|868233|23|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.913

gggagcaaccggagcaacgggag	CRISPR spacer
gggagcaacaggagcaacaggag	Protospacer
********* ********.****

22. spacer 1.4|868233|23|LR134165|CRT matches to MN694114 (Marine virus AFVG_250M252, complete genome) position: , mismatch: 2, identity: 0.913

gggagcaaccggagcaacgggag	CRISPR spacer
gggagcaaccggcgcaacggggg	Protospacer
************ ********.*

23. spacer 1.4|868233|23|LR134165|CRT matches to MG209611 (Aphanizomenon phage vB_AphaS-CL131, complete genome) position: , mismatch: 2, identity: 0.913

gggagcaaccggagcaacgggag	CRISPR spacer
aggagcaacgggagcaacgggag	Protospacer
.******** *************

24. spacer 1.4|868233|23|LR134165|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 2, identity: 0.913

gggagcaaccggagcaacgggag	CRISPR spacer
aggagcaacgggagcaacgggag	Protospacer
.******** *************

25. spacer 1.4|868233|23|LR134165|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 2, identity: 0.913

gggagcaaccggagcaacgggag	CRISPR spacer
aggagcaacaggagcaacgggag	Protospacer
.******** *************

26. spacer 1.4|868233|23|LR134165|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 2, identity: 0.913

gggagcaaccggagcaacgggag	CRISPR spacer
aggagcaacaggagcaacgggag	Protospacer
.******** *************

27. spacer 1.4|868233|23|LR134165|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 2, identity: 0.913

gggagcaaccggagcaacgggag	CRISPR spacer
gggagcaacaggagcaacaggag	Protospacer
********* ********.****

28. spacer 1.4|868233|23|LR134165|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 2, identity: 0.913

gggagcaaccggagcaacgggag	CRISPR spacer
gggagcaacaggagcaacaggag	Protospacer
********* ********.****

29. spacer 1.4|868233|23|LR134165|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 2, identity: 0.913

gggagcaaccggagcaacgggag	CRISPR spacer
gggagcaacaggagcaacaggag	Protospacer
********* ********.****

30. spacer 1.4|868233|23|LR134165|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 2, identity: 0.913

gggagcaaccggagcaacgggag	CRISPR spacer
gggagcaacaggagtaacgggag	Protospacer
********* ****.********

31. spacer 1.4|868233|23|LR134165|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 2, identity: 0.913

gggagcaaccggagcaacgggag	CRISPR spacer
gggagcaacaggagcaacaggag	Protospacer
********* ********.****

32. spacer 1.4|868233|23|LR134165|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 2, identity: 0.913

gggagcaaccggagcaacgggag	CRISPR spacer
gggagcaacaggagcaacaggag	Protospacer
********* ********.****

33. spacer 1.4|868233|23|LR134165|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 2, identity: 0.913

gggagcaaccggagcaacgggag	CRISPR spacer
cggagcaatcggagcaacgggag	Protospacer
 *******.**************

34. spacer 1.4|868233|23|LR134165|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 2, identity: 0.913

gggagcaaccggagcaacgggag	CRISPR spacer
cggagcaaccggagcaacggaag	Protospacer
 *******************.**

35. spacer 1.4|868233|23|LR134165|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 2, identity: 0.913

gggagcaaccggagcaacgggag	CRISPR spacer
cggagcaacgggagcaacgggag	Protospacer
 ******** *************

36. spacer 1.4|868233|23|LR134165|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 2, identity: 0.913

gggagcaaccggagcaacgggag	CRISPR spacer
gggagcaaccggagcaatcggag	Protospacer
*****************. ****

37. spacer 1.4|868233|23|LR134165|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 2, identity: 0.913

gggagcaaccggagcaacgggag	CRISPR spacer
gggagcaacgggagcaacggaag	Protospacer
********* **********.**

38. spacer 1.4|868233|23|LR134165|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.913

gggagcaaccggagcaacgggag	CRISPR spacer
cggagcaaccggagcaactggag	Protospacer
 ***************** ****

39. spacer 1.4|868233|23|LR134165|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.913

gggagcaaccggagcaacgggag	CRISPR spacer
gggagcaaccggggcaacaggag	Protospacer
************.*****.****

40. spacer 1.4|868233|23|LR134165|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 2, identity: 0.913

gggagcaaccggagcaacgggag	CRISPR spacer
aggagcaacaggagcaacgggag	Protospacer
.******** *************

41. spacer 1.4|868233|23|LR134165|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 2, identity: 0.913

gggagcaaccggagcaacgggag	CRISPR spacer
aggagcaacaggagcaacgggag	Protospacer
.******** *************

42. spacer 1.4|868233|23|LR134165|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 2, identity: 0.913

gggagcaaccggagcaacgggag	CRISPR spacer
aggagcaacaggagcaacgggag	Protospacer
.******** *************

43. spacer 1.4|868233|23|LR134165|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 2, identity: 0.913

gggagcaaccggagcaacgggag	CRISPR spacer
aggagcaacgggagcaacgggag	Protospacer
.******** *************

44. spacer 1.4|868233|23|LR134165|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 2, identity: 0.913

gggagcaaccggagcaacgggag	CRISPR spacer
gggagcaacaggagcaacaggag	Protospacer
********* ********.****

45. spacer 1.4|868233|23|LR134165|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 2, identity: 0.913

gggagcaaccggagcaacgggag	CRISPR spacer
gggagcaacaggagcaacaggag	Protospacer
********* ********.****

46. spacer 1.4|868233|23|LR134165|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 2, identity: 0.913

gggagcaaccggagcaacgggag	CRISPR spacer
gggagcaacaggagtaacgggag	Protospacer
********* ****.********

47. spacer 1.4|868233|23|LR134165|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 2, identity: 0.913

gggagcaaccggagcaacgggag	CRISPR spacer
gggagcaacaggagcaacaggag	Protospacer
********* ********.****

48. spacer 1.4|868233|23|LR134165|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 2, identity: 0.913

gggagcaaccggagcaacgggag	CRISPR spacer
gggagcaacaggagcaacaggag	Protospacer
********* ********.****

49. spacer 1.4|868233|23|LR134165|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 2, identity: 0.913

gggagcaaccggagcaacgggag	CRISPR spacer
gggagcaacaggagcaacaggag	Protospacer
********* ********.****

50. spacer 1.4|868233|23|LR134165|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 2, identity: 0.913

gggagcaaccggagcaacgggag	CRISPR spacer
gggagcaacaggagtaacgggag	Protospacer
********* ****.********

51. spacer 1.4|868233|23|LR134165|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 2, identity: 0.913

gggagcaaccggagcaacgggag	CRISPR spacer
gggagcaacaggagcaacaggag	Protospacer
********* ********.****

52. spacer 1.4|868233|23|LR134165|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 2, identity: 0.913

gggagcaaccggagcaacgggag	CRISPR spacer
gggagcaacaggagcaacaggag	Protospacer
********* ********.****

53. spacer 1.4|868233|23|LR134165|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 2, identity: 0.913

gggagcaaccggagcaacgggag	CRISPR spacer
gggagcaacaggagcaacaggag	Protospacer
********* ********.****

54. spacer 1.4|868233|23|LR134165|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 2, identity: 0.913

gggagcaaccggagcaacgggag	CRISPR spacer
gggagcaacaggagcaacaggag	Protospacer
********* ********.****

55. spacer 1.4|868233|23|LR134165|CRT matches to NZ_CP021356 (Rhodococcus sp. S2-17 plasmid pRB29, complete sequence) position: , mismatch: 2, identity: 0.913

gggagcaaccggagcaacgggag	CRISPR spacer
gggagcaacgggagcaacgggac	Protospacer
********* ************

56. spacer 1.4|868233|23|LR134165|CRT matches to NZ_CP046575 (Rhodococcus sp. WAY2 plasmid pRWAY03, complete sequence) position: , mismatch: 2, identity: 0.913

gggagcaaccggagcaacgggag	CRISPR spacer
gggagcaacgggagcaacgggac	Protospacer
********* ************

57. spacer 1.23|869466|23|LR134165|CRT matches to MN694114 (Marine virus AFVG_250M252, complete genome) position: , mismatch: 2, identity: 0.913

aggagcaaccggcgcaacgggag	CRISPR spacer
gggagcaaccggcgcaacggggg	Protospacer
.********************.*

58. spacer 1.23|869466|23|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.913

aggagcaaccggcgcaacgggag	CRISPR spacer
gggagcaaccggcccaacgggag	Protospacer
.************ *********

59. spacer 1.23|869466|23|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.913

aggagcaaccggcgcaacgggag	CRISPR spacer
aggagcaacaggagcaacgggag	Protospacer
********* ** **********

60. spacer 1.23|869466|23|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.913

aggagcaaccggcgcaacgggag	CRISPR spacer
aggagcaacgggagcaacgggag	Protospacer
********* ** **********

61. spacer 1.23|869466|23|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.913

aggagcaaccggcgcaacgggag	CRISPR spacer
aggagtaaccggagcaacgggag	Protospacer
*****.****** **********

62. spacer 1.23|869466|23|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.913

aggagcaaccggcgcaacgggag	CRISPR spacer
aggagcaacaggagcaacgggag	Protospacer
********* ** **********

63. spacer 1.23|869466|23|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.913

aggagcaaccggcgcaacgggag	CRISPR spacer
aggagcaacaggagcaacgggag	Protospacer
********* ** **********

64. spacer 1.23|869466|23|LR134165|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.913

aggagcaaccggcgcaacgggag	CRISPR spacer
aggagcaaccggggcaaccggag	Protospacer
************ ***** ****

65. spacer 1.23|869466|23|LR134165|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.913

aggagcaaccggcgcaacgggag	CRISPR spacer
aggagcaaccggggcaacaggag	Protospacer
************ *****.****

66. spacer 1.23|869466|23|LR134165|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 2, identity: 0.913

aggagcaaccggcgcaacgggag	CRISPR spacer
aggagcaacaggagcaacgggag	Protospacer
********* ** **********

67. spacer 1.23|869466|23|LR134165|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 2, identity: 0.913

aggagcaaccggcgcaacgggag	CRISPR spacer
aggagcaacaggagcaacgggag	Protospacer
********* ** **********

68. spacer 1.23|869466|23|LR134165|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 2, identity: 0.913

aggagcaaccggcgcaacgggag	CRISPR spacer
aggagcaacaggagcaacgggag	Protospacer
********* ** **********

69. spacer 1.23|869466|23|LR134165|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 2, identity: 0.913

aggagcaaccggcgcaacgggag	CRISPR spacer
aggagcaacgggagcaacgggag	Protospacer
********* ** **********

70. spacer 1.23|869466|23|LR134165|CRT matches to MG209611 (Aphanizomenon phage vB_AphaS-CL131, complete genome) position: , mismatch: 2, identity: 0.913

aggagcaaccggcgcaacgggag	CRISPR spacer
aggagcaacgggagcaacgggag	Protospacer
********* ** **********

71. spacer 1.23|869466|23|LR134165|CRT matches to NZ_CP031193 (Humibacter sp. BT305 plasmid unnamed1) position: , mismatch: 2, identity: 0.913

aggagcaaccggcgcaacgggag	CRISPR spacer
aggaggaaccggcgccacgggag	Protospacer
***** ********* *******

72. spacer 1.23|869466|23|LR134165|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 2, identity: 0.913

aggagcaaccggcgcaacgggag	CRISPR spacer
aggagcaacgggagcaacgggag	Protospacer
********* ** **********

73. spacer 1.23|869466|23|LR134165|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 2, identity: 0.913

aggagcaaccggcgcaacgggag	CRISPR spacer
aggagcaacaggagcaacgggag	Protospacer
********* ** **********

74. spacer 1.23|869466|23|LR134165|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 2, identity: 0.913

aggagcaaccggcgcaacgggag	CRISPR spacer
aggagcaacaggagcaacgggag	Protospacer
********* ** **********

75. spacer 1.27|869700|32|LR134165|CRT matches to MN694114 (Marine virus AFVG_250M252, complete genome) position: , mismatch: 2, identity: 0.938

cggcgcaacgggagcaaccggagcaacgggag	CRISPR spacer
gggcgcaacgggagcaaccggcgcaacgggag	Protospacer
 ******************** **********

76. spacer 1.27|869700|32|LR134165|CRT matches to MN694114 (Marine virus AFVG_250M252, complete genome) position: , mismatch: 2, identity: 0.938

cggcgcaacgggagcaaccggagcaacgggag	CRISPR spacer
cggcgcaacgggagcaaccggcgcaacggggg	Protospacer
********************* ********.*

77. spacer 1.29|869808|23|LR134165|CRT matches to DQ222855 (Bacillus anthracis phage Gamma isolate 53, complete genome) position: , mismatch: 2, identity: 0.913

aggtccaacaggtccaaccggag	CRISPR spacer
aggtccaacaggtccaaccggtc	Protospacer
*********************

78. spacer 1.29|869808|23|LR134165|CRT matches to DQ289555 (Bacillus anthracis phage W Beta, complete genome) position: , mismatch: 2, identity: 0.913

aggtccaacaggtccaaccggag	CRISPR spacer
aggtccaacaggtccaaccggtc	Protospacer
*********************

79. spacer 1.29|869808|23|LR134165|CRT matches to NC_007734 (Bacillus phage WBeta, complete genome) position: , mismatch: 2, identity: 0.913

aggtccaacaggtccaaccggag	CRISPR spacer
aggtccaacaggtccaaccggtc	Protospacer
*********************

80. spacer 1.29|869808|23|LR134165|CRT matches to DQ222854 (Bacillus anthracis phage Gamma collagen region, complete sequence) position: , mismatch: 2, identity: 0.913

aggtccaacaggtccaaccggag	CRISPR spacer
aggtccaacaggtccaaccggtc	Protospacer
*********************

81. spacer 1.29|869808|23|LR134165|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 2, identity: 0.913

aggtccaacaggtccaaccggag	CRISPR spacer
aggtccaacaggtccaacaggac	Protospacer
****************** ***

82. spacer 1.12|868692|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.906

aggagcaaccggagcgacaggagcaacaggtc	CRISPR spacer
gggagcaaccggagcgaccggagcaacaggta	Protospacer
.***************** ************

83. spacer 1.12|868692|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.906

aggagcaaccggagcgacaggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacaggagcaacagggc	Protospacer
********* *****.************** *

84. spacer 1.12|868692|32|LR134165|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 3, identity: 0.906

aggagcaaccggagcgacaggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacaggagcaacaggac	Protospacer
********* *****.************** *

85. spacer 1.13|868746|32|LR134165|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.906

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
aggctcaacaggtccaacgggagcaacaggtc	Protospacer
 ***.*.*************************

86. spacer 1.20|869277|32|LR134165|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.906

cggcccgacaggagcaaccggcccgacaggag	CRISPR spacer
aggcctgacaggagcaacaggcccgacaggag	Protospacer
 ****.************ *************

87. spacer 1.27|869700|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.906

cggcgcaacgggagcaaccggagcaacgggag	CRISPR spacer
gggagcaacgggagtaaccggagcaacgggag	Protospacer
 ** **********.*****************

88. spacer 1.27|869700|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.906

cggcgcaacgggagcaaccggagcaacgggag	CRISPR spacer
cggagcaacgggagcagccggagcaacggggg	Protospacer
*** ************.*************.*

89. spacer 1.27|869700|32|LR134165|CRT matches to MG209611 (Aphanizomenon phage vB_AphaS-CL131, complete genome) position: , mismatch: 3, identity: 0.906

cggcgcaacgggagcaaccggagcaacgggag	CRISPR spacer
aggagcaacgggagcaacgggagcaacgggag	Protospacer
 ** ************** *************

90. spacer 1.28|869754|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.906

cggagcaacgggagcaaccggtccgacgggag	CRISPR spacer
gggagcaacgggagcgaccggtccaacgggag	Protospacer
 **************.********.*******

91. spacer 1.29|869808|23|LR134165|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 3, identity: 0.87

aggtccaacaggtccaaccggag	CRISPR spacer
aggtccaacaggtccaacaggtc	Protospacer
****************** **

92. spacer 1.29|869808|23|LR134165|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 3, identity: 0.87

aggtccaacaggtccaaccggag	CRISPR spacer
aggtccaacaggtccaacaggtc	Protospacer
****************** **

93. spacer 1.29|869808|23|LR134165|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 3, identity: 0.87

aggtccaacaggtccaaccggag	CRISPR spacer
aggtccaacaggtccaacaggtc	Protospacer
****************** **

94. spacer 1.29|869808|23|LR134165|CRT matches to NZ_CP028885 (Borrelia turcica IST7 plasmid lp129, complete sequence) position: , mismatch: 3, identity: 0.87

aggtccaacaggtccaaccggag	CRISPR spacer
aggtccaacaggtccaacaggtc	Protospacer
****************** **

95. spacer 1.29|869808|23|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.87

aggtccaacaggtccaaccggag	CRISPR spacer
aggtccaacaggtccaactggcc	Protospacer
******************.**

96. spacer 1.12|868692|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.875

aggagcaaccggagcgacaggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacaggagcaacaggag	Protospacer
********* *****.**************

97. spacer 1.12|868692|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.875

aggagcaaccggagcgacaggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacaggagcaacaggag	Protospacer
********* *****.**************

98. spacer 1.12|868692|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.875

aggagcaaccggagcgacaggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacaggagcaacaggag	Protospacer
********* *****.**************

99. spacer 1.12|868692|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.875

aggagcaaccggagcgacaggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacaggagcaacaggag	Protospacer
********* *****.**************

100. spacer 1.12|868692|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.875

aggagcaaccggagcgacaggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacaggagcaacaggag	Protospacer
********* *****.**************

101. spacer 1.12|868692|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.875

aggagcaaccggagcgacaggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacaggagcaacaggag	Protospacer
********* *****.**************

102. spacer 1.12|868692|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.875

aggagcaaccggagcgacaggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacaggagcaacaggag	Protospacer
********* *****.**************

103. spacer 1.12|868692|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.875

aggagcaaccggagcgacaggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacaggagcaacaggag	Protospacer
********* *****.**************

104. spacer 1.12|868692|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.875

aggagcaaccggagcgacaggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacaggagcaacaggag	Protospacer
********* *****.**************

105. spacer 1.12|868692|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.875

aggagcaaccggagcgacaggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacaggagcaacaggag	Protospacer
********* *****.**************

106. spacer 1.12|868692|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.875

aggagcaaccggagcgacaggagcaacaggtc	CRISPR spacer
aggagcaacgggagcaacaggagcaacaggag	Protospacer
********* *****.**************

107. spacer 1.12|868692|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.875

aggagcaaccggagcgacaggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacaggagcaacaggag	Protospacer
********* *****.**************

108. spacer 1.12|868692|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.875

aggagcaaccggagcgacaggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacaggagcaacaggag	Protospacer
********* *****.**************

109. spacer 1.12|868692|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.875

aggagcaaccggagcgacaggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacaggagcaacaggag	Protospacer
********* *****.**************

110. spacer 1.12|868692|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.875

aggagcaaccggagcgacaggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacaggagcaacaggag	Protospacer
********* *****.**************

111. spacer 1.12|868692|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.875

aggagcaaccggagcgacaggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacaggagcaacaggag	Protospacer
********* *****.**************

112. spacer 1.12|868692|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.875

aggagcaaccggagcgacaggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacaggagcaacaggag	Protospacer
********* *****.**************

113. spacer 1.12|868692|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.875

aggagcaaccggagcgacaggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacaggagcaacaggag	Protospacer
********* *****.**************

114. spacer 1.12|868692|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.875

aggagcaaccggagcgacaggagcaacaggtc	CRISPR spacer
aggagcaacgggagcaacaggagcaacaggag	Protospacer
********* *****.**************

115. spacer 1.12|868692|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.875

aggagcaaccggagcgacaggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacaggagcaacaggag	Protospacer
********* *****.**************

116. spacer 1.12|868692|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.875

aggagcaaccggagcgacaggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacaggagcaacaggag	Protospacer
********* *****.**************

117. spacer 1.12|868692|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.875

aggagcaaccggagcgacaggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacaggagcaacaggag	Protospacer
********* *****.**************

118. spacer 1.12|868692|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.875

aggagcaaccggagcgacaggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacaggagcaacaggag	Protospacer
********* *****.**************

119. spacer 1.12|868692|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.875

aggagcaaccggagcgacaggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacaggagcaacaggag	Protospacer
********* *****.**************

120. spacer 1.12|868692|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.875

aggagcaaccggagcgacaggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacaggagcaacaggag	Protospacer
********* *****.**************

121. spacer 1.12|868692|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.875

aggagcaaccggagcgacaggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacaggagcaacaggag	Protospacer
********* *****.**************

122. spacer 1.12|868692|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.875

aggagcaaccggagcgacaggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacaggagcaacaggag	Protospacer
********* *****.**************

123. spacer 1.12|868692|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.875

aggagcaaccggagcgacaggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacaggagcaacaggag	Protospacer
********* *****.**************

124. spacer 1.12|868692|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.875

aggagcaaccggagcgacaggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacaggagcaacaggag	Protospacer
********* *****.**************

125. spacer 1.12|868692|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.875

aggagcaaccggagcgacaggagcaacaggtc	CRISPR spacer
aggagcaacgggagcaacaggagcaacaggag	Protospacer
********* *****.**************

126. spacer 1.12|868692|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.875

aggagcaaccggagcgacaggagcaacaggtc	CRISPR spacer
gggagcaacaggagcaacaggagcaacagggc	Protospacer
.******** *****.************** *

127. spacer 1.13|868746|32|LR134165|CRT matches to NC_010180 (Bacillus mycoides KBAB4 plasmid pBWB401, complete sequence) position: , mismatch: 4, identity: 0.875

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
aggcccaaccggtccaacgggagcaacaggta	Protospacer
 *****.** *********************

128. spacer 1.7|868386|32|LR134165|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.844

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggtctaacaggagcaacgggagtaacaggtc	Protospacer
 **.*..****************.********

129. spacer 1.12|868692|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.844

aggagcaaccggagcgacaggagcaacaggtc	CRISPR spacer
cggagcaaccggagtgacaggagcaactggag	Protospacer
 *************.************ **

130. spacer 1.12|868692|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.844

aggagcaaccggagcgacaggagcaacaggtc	CRISPR spacer
gggagcaacaggagcaacaggagcaacaggag	Protospacer
.******** *****.**************

131. spacer 1.12|868692|32|LR134165|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 5, identity: 0.844

aggagcaaccggagcgacaggagcaacaggtc	CRISPR spacer
gggagcaacaggagcaacaggagcaacaggag	Protospacer
.******** *****.**************

132. spacer 1.12|868692|32|LR134165|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 5, identity: 0.844

aggagcaaccggagcgacaggagcaacaggtc	CRISPR spacer
gggagcaacaggagcaacaggagcaacaggag	Protospacer
.******** *****.**************

133. spacer 1.20|869277|32|LR134165|CRT matches to NZ_CP053689 (Arthrobacter citreus strain NEB 577 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.844

cggcccgacaggagcaaccggcccgacaggag	CRISPR spacer
gggatcgacaggagcaaccggcccaacaggaa	Protospacer
 ** .*******************.******.

134. spacer 1.27|869700|32|LR134165|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 5, identity: 0.844

cggcgcaacgggagcaaccggagcaacgggag	CRISPR spacer
ggggccaacaggagcaacaggagcaacgggag	Protospacer
 **  ****.******** *************

135. spacer 1.27|869700|32|LR134165|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 5, identity: 0.844

cggcgcaacgggagcaaccggagcaacgggag	CRISPR spacer
ggggccaacaggagcaacgggagcaacgggag	Protospacer
 **  ****.******** *************

136. spacer 1.27|869700|32|LR134165|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 5, identity: 0.844

cggcgcaacgggagcaaccggagcaacgggag	CRISPR spacer
ggggccaacaggagcaacgggagcaacgggag	Protospacer
 **  ****.******** *************

137. spacer 1.27|869700|32|LR134165|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 5, identity: 0.844

cggcgcaacgggagcaaccggagcaacgggag	CRISPR spacer
ggggccaacaggagcaacaggagcaacgggag	Protospacer
 **  ****.******** *************

138. spacer 1.2|868107|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.812

aggcccaacaggtccgacgggag---caaccggcc	CRISPR spacer
aggcccaacaggtcctgcgggaggcccaacag---	Protospacer
*************** .******   **** *

139. spacer 1.5|868278|32|LR134165|CRT matches to NZ_CP016082 (Streptomyces sp. SAT1 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.812

cggagcgacaggagccacgggagcgacaggag	CRISPR spacer
gagagcgacaggagcgacgggagcgacgcgat	Protospacer
 .************* ***********. **

140. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.812

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacgggagcaacaggag	Protospacer
 **  *.***********************

141. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.812

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
gggagcaacaggagcaacgggagcaacaggag	Protospacer
 **  *.***********************

142. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.812

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacgggagcaacaggag	Protospacer
 **  *.***********************

143. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.812

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
cggagtgacaggagcaactggagcaacaggag	Protospacer
***  .************ ***********

144. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.812

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacaggagcaacagggc	Protospacer
 **  *.***********.*********** *

145. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.812

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
gggagcaacaggagcaacaggagcaacagggc	Protospacer
 **  *.***********.*********** *

146. spacer 1.7|868386|32|LR134165|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 6, identity: 0.812

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacgggagcaacaggag	Protospacer
 **  *.***********************

147. spacer 1.7|868386|32|LR134165|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 6, identity: 0.812

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacgggagcaacaggag	Protospacer
 **  *.***********************

148. spacer 1.7|868386|32|LR134165|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 6, identity: 0.812

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacgggagcaacaggag	Protospacer
 **  *.***********************

149. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 6, identity: 0.812

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacgggagcaacaggag	Protospacer
 **  *.***********************

150. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 6, identity: 0.812

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacgggagcaacaggag	Protospacer
 **  *.***********************

151. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 6, identity: 0.812

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacaggagcaacaggac	Protospacer
 **  *.***********.*********** *

152. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP053689 (Arthrobacter citreus strain NEB 577 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.812

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
gggatcgacgggagcaacaggagcaacaggcc	Protospacer
 ** .****.********.***********.*

153. spacer 1.12|868692|32|LR134165|CRT matches to MN693798 (Marine virus AFVG_250M119, complete genome) position: , mismatch: 6, identity: 0.812

aggagcaaccggagcgacaggagcaacaggtc	CRISPR spacer
cgtagcaacaggagcaacaggagcaacaggag	Protospacer
 * ****** *****.**************

154. spacer 1.13|868746|32|LR134165|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
tggagcaacaggtcctactggagcaacaggtc	Protospacer
.**  *.******** ** *************

155. spacer 1.13|868746|32|LR134165|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
tggagcaacaggtcctaccggagcaacaggtc	Protospacer
.**  *.******** ** *************

156. spacer 1.13|868746|32|LR134165|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
tggagcaacaggtcctaccggagcaacaggtc	Protospacer
.**  *.******** ** *************

157. spacer 1.13|868746|32|LR134165|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 6, identity: 0.812

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
tggagcaacaggtcctactggagcaacaggtc	Protospacer
.**  *.******** ** *************

158. spacer 1.13|868746|32|LR134165|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 6, identity: 0.812

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
tggagcaacaggtcctaccggagcaacaggtc	Protospacer
.**  *.******** ** *************

159. spacer 1.13|868746|32|LR134165|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 6, identity: 0.812

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
tggagcaacaggtcctaccggagcaacaggtc	Protospacer
.**  *.******** ** *************

160. spacer 1.13|868746|32|LR134165|CRT matches to NZ_CP020744 (Bacillus mycoides strain Gnyt1 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.812

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
aggagaaataggtccaacgggagcaacaggtc	Protospacer
 **   .*.***********************

161. spacer 1.13|868746|32|LR134165|CRT matches to NZ_CP020744 (Bacillus mycoides strain Gnyt1 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.812

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
aggggacataggtccaacgggagcaacaggtc	Protospacer
 **    *.***********************

162. spacer 1.13|868746|32|LR134165|CRT matches to NZ_CP020744 (Bacillus mycoides strain Gnyt1 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.812

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
aggagaaataggtccaacgggagcaacaggtc	Protospacer
 **   .*.***********************

163. spacer 1.13|868746|32|LR134165|CRT matches to NZ_CP020744 (Bacillus mycoides strain Gnyt1 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.812

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
aggagaaataggtccaacgggagcaacaggtc	Protospacer
 **   .*.***********************

164. spacer 1.13|868746|32|LR134165|CRT matches to NZ_CP009638 (Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence) position: , mismatch: 6, identity: 0.812

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
tggagcaacaggtcctaccggagcaacaggtc	Protospacer
.**  *.******** ** *************

165. spacer 1.13|868746|32|LR134165|CRT matches to NZ_CP009638 (Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence) position: , mismatch: 6, identity: 0.812

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
tggagcaacaggtcctaccggagcaacaggtc	Protospacer
.**  *.******** ** *************

166. spacer 1.13|868746|32|LR134165|CRT matches to NZ_CP009638 (Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence) position: , mismatch: 6, identity: 0.812

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
tggagcaacaggtcctaccggagcaacaggtc	Protospacer
.**  *.******** ** *************

167. spacer 1.13|868746|32|LR134165|CRT matches to NZ_CP009639 (Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence) position: , mismatch: 6, identity: 0.812

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
tggagcaacaggtcctaccggagcaacaggtc	Protospacer
.**  *.******** ** *************

168. spacer 1.13|868746|32|LR134165|CRT matches to NZ_CP009639 (Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence) position: , mismatch: 6, identity: 0.812

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
tggagcaacaggtcctaccggagcaacaggtc	Protospacer
.**  *.******** ** *************

169. spacer 1.13|868746|32|LR134165|CRT matches to NZ_CP009639 (Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence) position: , mismatch: 6, identity: 0.812

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
tggagcaacaggtcctaccggagcaacaggtc	Protospacer
.**  *.******** ** *************

170. spacer 1.13|868746|32|LR134165|CRT matches to NZ_CP053963 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence) position: , mismatch: 6, identity: 0.812

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
tggagcaacaggtcctaccggagcaacaggtc	Protospacer
.**  *.******** ** *************

171. spacer 1.13|868746|32|LR134165|CRT matches to NZ_CP053963 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence) position: , mismatch: 6, identity: 0.812

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
tggagcaacaggtcctaccggagcaacaggtc	Protospacer
.**  *.******** ** *************

172. spacer 1.13|868746|32|LR134165|CRT matches to NZ_CP053963 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence) position: , mismatch: 6, identity: 0.812

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
tggagcaacaggtcctaccggagcaacaggtc	Protospacer
.**  *.******** ** *************

173. spacer 1.13|868746|32|LR134165|CRT matches to NZ_CP053966 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence) position: , mismatch: 6, identity: 0.812

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
tggagcaacaggtcctaccggagcaacaggtc	Protospacer
.**  *.******** ** *************

174. spacer 1.13|868746|32|LR134165|CRT matches to NZ_CP053966 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence) position: , mismatch: 6, identity: 0.812

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
tggagcaacaggtcctaccggagcaacaggtc	Protospacer
.**  *.******** ** *************

175. spacer 1.13|868746|32|LR134165|CRT matches to NZ_CP053966 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence) position: , mismatch: 6, identity: 0.812

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
tggagcaacaggtcctaccggagcaacaggtc	Protospacer
.**  *.******** ** *************

176. spacer 1.20|869277|32|LR134165|CRT matches to NZ_CP053689 (Arthrobacter citreus strain NEB 577 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.812

cggcccgacaggagcaaccggcccgacaggag	CRISPR spacer
gggatcgacaggagcaaccggcccaaccggaa	Protospacer
 ** .*******************.** ***.

177. spacer 1.21|869331|32|LR134165|CRT matches to NC_010180 (Bacillus mycoides KBAB4 plasmid pBWB401, complete sequence) position: , mismatch: 6, identity: 0.812

cggagcgacaggcccaaccggtccgacgggag	CRISPR spacer
gggtataacaggcccaaccggtccaacgggag	Protospacer
 ** ...*****************.*******

178. spacer 1.21|869331|32|LR134165|CRT matches to NC_010180 (Bacillus mycoides KBAB4 plasmid pBWB401, complete sequence) position: , mismatch: 6, identity: 0.812

cggagcgacaggcccaaccggtccgacgggag	CRISPR spacer
aggtataacaggcccaaccggtccaacgggag	Protospacer
 ** ...*****************.*******

179. spacer 1.25|869565|32|LR134165|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.812

cggagcgacaggagcaacaggtccgacgggag	CRISPR spacer
aggcctgacaggagcaacaggcccgacaggag	Protospacer
 **  .***************.*****.****

180. spacer 1.25|869565|32|LR134165|CRT matches to NC_014025 (Bacillus megaterium QM B1551 plasmid pBM500, complete sequence) position: , mismatch: 6, identity: 0.812

cggagcgacaggagcaacaggtccgacgggag	CRISPR spacer
tggaatcacaggagcaacaggtcctactggag	Protospacer
.***.. ***************** ** ****

181. spacer 1.27|869700|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.812

cggcgcaacgggagcaaccggagcaacgggag	CRISPR spacer
ggggccgacaggagcaacaggagcaacgggag	Protospacer
 **  *.**.******** *************

182. spacer 1.27|869700|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.812

cggcgcaacgggagcaaccggagcaacgggag	CRISPR spacer
aggggtgaccggagcaacgggagcaacgggag	Protospacer
 ** *..** ******** *************

183. spacer 1.27|869700|32|LR134165|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 6, identity: 0.812

cggcgcaacgggagcaaccggagcaacgggag	CRISPR spacer
tggttaaaccggagcaacgggagcaacgggag	Protospacer
.**.  *** ******** *************

184. spacer 1.27|869700|32|LR134165|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 6, identity: 0.812

cggcgcaacgggagcaaccggagcaacgggag	CRISPR spacer
ggggccgacgggagcaacaggagcaacaggag	Protospacer
 **  *.*********** ********.****

185. spacer 1.27|869700|32|LR134165|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 6, identity: 0.812

cggcgcaacgggagcaaccggagcaacgggag	CRISPR spacer
ggggccgacgggagcaacaggagcaacaggag	Protospacer
 **  *.*********** ********.****

186. spacer 1.27|869700|32|LR134165|CRT matches to NZ_CP021356 (Rhodococcus sp. S2-17 plasmid pRB29, complete sequence) position: , mismatch: 6, identity: 0.812

cggcgcaacgggagcaaccggagcaacgggag	CRISPR spacer
gcgaacaacgggagcaacgggagcaacgggac	Protospacer
  * .************* ************

187. spacer 1.27|869700|32|LR134165|CRT matches to NZ_CP046575 (Rhodococcus sp. WAY2 plasmid pRWAY03, complete sequence) position: , mismatch: 6, identity: 0.812

cggcgcaacgggagcaaccggagcaacgggag	CRISPR spacer
gcgaacaacgggagcaacgggagcaacgggac	Protospacer
  * .************* ************

188. spacer 1.27|869700|32|LR134165|CRT matches to NZ_CP011518 (Pandoraea oxalativorans strain DSM 23570 plasmid pPO70-1, complete sequence) position: , mismatch: 6, identity: 0.812

cggcgcaacgggagcaaccggagcaacgggag	CRISPR spacer
cggcgcaacgggggcgaccggagcgatcgggg	Protospacer
************.**.********.*. **.*

189. spacer 1.2|868107|32|LR134165|CRT matches to NZ_CP021071 (Mesorhizobium sp. WSM1497 plasmid pWSM1497, complete sequence) position: , mismatch: 7, identity: 0.781

aggcccaacaggtccgacgggagcaaccggcc	CRISPR spacer
cggttcgacaggttcgaccggagcaaccggct	Protospacer
 **..*.******.**** ************.

190. spacer 1.5|868278|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.781

cggagcgacaggagccacgggagcgacaggag	CRISPR spacer
tggtgaaacaggagcaacgggagcgacgggaa	Protospacer
.** * .******** ***********.***.

191. spacer 1.5|868278|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.781

cggagcgacaggagccacgggagcgacaggag	CRISPR spacer
gggtgaaacaggagcaacgggaacgacaggaa	Protospacer
 ** * .******** ******.********.

192. spacer 1.5|868278|32|LR134165|CRT matches to NC_019740 (Microcoleus sp. PCC 7113 plasmid pMIC7113.03, complete sequence) position: , mismatch: 7, identity: 0.781

cggagcgacaggagccacgggagcgacaggag	CRISPR spacer
aagcgtggcaggagcgacggcagcgacaggag	Protospacer
 .* *.*.******* **** ***********

193. spacer 1.5|868278|32|LR134165|CRT matches to MN694155 (Marine virus AFVG_250M1019, complete genome) position: , mismatch: 7, identity: 0.781

cggagcgacaggagccacgggagcgacaggag	CRISPR spacer
aggagcgacaggagcgacaggagcgcagggaa	Protospacer
 ************** **.******  .***.

194. spacer 1.5|868278|32|LR134165|CRT matches to MN855854 (Siphoviridae sp. isolate 269, complete genome) position: , mismatch: 7, identity: 0.781

cggagcgacaggagccacgggagcgacaggag	CRISPR spacer
cggcatcacaggagccaccggagcaacaggtg	Protospacer
*** .. *********** *****.***** *

195. spacer 1.6|868332|32|LR134165|CRT matches to NC_008464 (Stx2-converting phage 86, complete genome) position: , mismatch: 7, identity: 0.781

cggagcgacaggagcaaccggtccgacgggag	CRISPR spacer
aggcccgacaggagcaaccggaccggcgggtc	Protospacer
 **  **************** ***.****

196. spacer 1.6|868332|32|LR134165|CRT matches to KJ603229 (Shigella phage POCJ13, complete genome) position: , mismatch: 7, identity: 0.781

cggagcgacaggagcaaccggtccgacgggag	CRISPR spacer
aggcccgacaggagcaaccggaccggcgggtc	Protospacer
 **  **************** ***.****

197. spacer 1.6|868332|32|LR134165|CRT matches to AB255436 (Stx2-converting phage 86 DNA, complete genome) position: , mismatch: 7, identity: 0.781

cggagcgacaggagcaaccggtccgacgggag	CRISPR spacer
aggcccgacaggagcaaccggaccggcgggtc	Protospacer
 **  **************** ***.****

198. spacer 1.6|868332|32|LR134165|CRT matches to MH727593 (Acidovorax phage ACPWH, complete genome) position: , mismatch: 7, identity: 0.781

cggagcgacaggagcaaccggtccgacgggag	CRISPR spacer
gggggatacaggagcaactggtcccacgggac	Protospacer
 **.*  ***********.***** ******

199. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacaggagcaacaggag	Protospacer
 **  *.***********.***********

200. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacaggagcaacaggag	Protospacer
 **  *.***********.***********

201. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacaggagcaacaggag	Protospacer
 **  *.***********.***********

202. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacaggagcaacaggag	Protospacer
 **  *.***********.***********

203. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacaggagcaacaggag	Protospacer
 **  *.***********.***********

204. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacaggagcaacaggag	Protospacer
 **  *.***********.***********

205. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacaggagcaacaggag	Protospacer
 **  *.***********.***********

206. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacaggagcaacaggag	Protospacer
 **  *.***********.***********

207. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacaggagcaacaggag	Protospacer
 **  *.***********.***********

208. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacaggagcaacaggag	Protospacer
 **  *.***********.***********

209. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
tggagcgacaggagtaatgggagcaacaggag	Protospacer
.**  *********.**.************

210. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacaggagcaacaggag	Protospacer
 **  *.***********.***********

211. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacaggagcaacaggag	Protospacer
 **  *.***********.***********

212. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacaggagcaacaggag	Protospacer
 **  *.***********.***********

213. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacaggagcaacaggag	Protospacer
 **  *.***********.***********

214. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacaggagcaacaggag	Protospacer
 **  *.***********.***********

215. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacaggagcaacaggag	Protospacer
 **  *.***********.***********

216. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacaggagcaacaggag	Protospacer
 **  *.***********.***********

217. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
gggagcaacaggagcaacaggagcaacaggag	Protospacer
 **  *.***********.***********

218. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacaggagcaacaggag	Protospacer
 **  *.***********.***********

219. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacaggagcaacaggag	Protospacer
 **  *.***********.***********

220. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacaggagcaacaggag	Protospacer
 **  *.***********.***********

221. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacaggagcaacaggag	Protospacer
 **  *.***********.***********

222. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacaggagcaacaggag	Protospacer
 **  *.***********.***********

223. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacaggagcaacaggag	Protospacer
 **  *.***********.***********

224. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacaggagcaacaggag	Protospacer
 **  *.***********.***********

225. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacaggagcaacaggag	Protospacer
 **  *.***********.***********

226. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacaggagcaacaggag	Protospacer
 **  *.***********.***********

227. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacaggagcaacaggag	Protospacer
 **  *.***********.***********

228. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacgggagtaacaggag	Protospacer
 **  *.****************.******

229. spacer 1.7|868386|32|LR134165|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagcaacaggagtaacgggagcaacaggag	Protospacer
 **  *.*******.***************

230. spacer 1.7|868386|32|LR134165|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
gggagcaacaggagtaacgggagcaacaggag	Protospacer
 **  *.*******.***************

231. spacer 1.7|868386|32|LR134165|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagcaacaggagtaacgggagcaacaggag	Protospacer
 **  *.*******.***************

232. spacer 1.7|868386|32|LR134165|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagcaacaggagtaacgggagcaacaggag	Protospacer
 **  *.*******.***************

233. spacer 1.7|868386|32|LR134165|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
gggagcaacaggagtaacgggagcaacaggag	Protospacer
 **  *.*******.***************

234. spacer 1.7|868386|32|LR134165|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagcaacaggagtaacgggagcaacaggag	Protospacer
 **  *.*******.***************

235. spacer 1.7|868386|32|LR134165|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagcaacaggagtaacgggagcaacaggag	Protospacer
 **  *.*******.***************

236. spacer 1.7|868386|32|LR134165|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
gggagcaacaggagcaacaggagcaacaggag	Protospacer
 **  *.***********.***********

237. spacer 1.7|868386|32|LR134165|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagcaacgggagcaacgggagcaacagggg	Protospacer
 **  *.**.********************

238. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagcaacgggagcaacgggagcaacagggg	Protospacer
 **  *.**.********************

239. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
gggagcaacaggagcaacaggagcaacaggag	Protospacer
 **  *.***********.***********

240. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagcaacaggagtaacgggagcaacaggag	Protospacer
 **  *.*******.***************

241. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
gggagcaacaggagtaacgggagcaacaggag	Protospacer
 **  *.*******.***************

242. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagcaacaggagtaacgggagcaacaggag	Protospacer
 **  *.*******.***************

243. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
tggtgcaacaggagcaacaggagcaacaggag	Protospacer
.**. *.***********.***********

244. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
tggggcaacaggaccaacgggggcaacaggac	Protospacer
.**  *.****** *******.******** *

245. spacer 1.7|868386|32|LR134165|CRT matches to MN693798 (Marine virus AFVG_250M119, complete genome) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
cgtagcaacaggagcaacaggagcaacaggag	Protospacer
**   *.***********.***********

246. spacer 1.7|868386|32|LR134165|CRT matches to CP002509 (Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
gggagccacaggaccaacgggagccacaggac	Protospacer
 **  * ****** ********** ***** *

247. spacer 1.7|868386|32|LR134165|CRT matches to CP002509 (Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
gggagccacaggaccaacgggagccacaggac	Protospacer
 **  * ****** ********** ***** *

248. spacer 1.7|868386|32|LR134165|CRT matches to CP002509 (Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
gggagccacaggaccaacgggagccacaggac	Protospacer
 **  * ****** ********** ***** *

249. spacer 1.7|868386|32|LR134165|CRT matches to CP002509 (Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
gggaaccacaggaccaacgggagccacaggac	Protospacer
 **  * ****** ********** ***** *

250. spacer 1.7|868386|32|LR134165|CRT matches to CP002509 (Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
gggagccacaggaccaacgggagccacaggac	Protospacer
 **  * ****** ********** ***** *

251. spacer 1.7|868386|32|LR134165|CRT matches to CP002509 (Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
gggagccacaggaccaacgggagccacaggac	Protospacer
 **  * ****** ********** ***** *

252. spacer 1.7|868386|32|LR134165|CRT matches to CP002509 (Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
gggagccacaggaccaacgggagccacaggac	Protospacer
 **  * ****** ********** ***** *

253. spacer 1.7|868386|32|LR134165|CRT matches to CP002509 (Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
gggagccacaggaccaacgggagccacaggac	Protospacer
 **  * ****** ********** ***** *

254. spacer 1.7|868386|32|LR134165|CRT matches to CP002509 (Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
gggagccacaggatcaacgggagccacaggac	Protospacer
 **  * ****** ********** ***** *

255. spacer 1.7|868386|32|LR134165|CRT matches to CP002509 (Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
gggagccacaggatcaacgggagccacaggac	Protospacer
 **  * ****** ********** ***** *

256. spacer 1.7|868386|32|LR134165|CRT matches to CP002509 (Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
gggagccacaggaccaacgggagccacaggac	Protospacer
 **  * ****** ********** ***** *

257. spacer 1.7|868386|32|LR134165|CRT matches to CP002509 (Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
gggagccacaggaccaacgggagccacaggac	Protospacer
 **  * ****** ********** ***** *

258. spacer 1.7|868386|32|LR134165|CRT matches to CP002509 (Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
gggagccacaggaccaacgggagccacaggac	Protospacer
 **  * ****** ********** ***** *

259. spacer 1.7|868386|32|LR134165|CRT matches to CP002509 (Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
gggagccacaggatcaacgggagccacaggac	Protospacer
 **  * ****** ********** ***** *

260. spacer 1.7|868386|32|LR134165|CRT matches to CP002509 (Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
gggagccacaggatcaacgggagccacaggac	Protospacer
 **  * ****** ********** ***** *

261. spacer 1.7|868386|32|LR134165|CRT matches to CP002509 (Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
gggagccacaggatcaacgggagccacaggac	Protospacer
 **  * ****** ********** ***** *

262. spacer 1.7|868386|32|LR134165|CRT matches to CP002509 (Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
gggaaccacaggaccaacgggagccacaggac	Protospacer
 **  * ****** ********** ***** *

263. spacer 1.7|868386|32|LR134165|CRT matches to CP002509 (Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
gggagccacaggaccaacgggagccacaggac	Protospacer
 **  * ****** ********** ***** *

264. spacer 1.12|868692|32|LR134165|CRT matches to NC_028998 (Phormidium phage MIS-PhV1B, complete genome) position: , mismatch: 7, identity: 0.781

aggagcaaccggagcgacaggagcaacaggtc	CRISPR spacer
tggagcaactggagcaacaggagcgatcggac	Protospacer
 ********.*****.********.*. ** *

265. spacer 1.13|868746|32|LR134165|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
tggagcaacaggtcctaccggagcaacaggtt	Protospacer
.**  *.******** ** ************.

266. spacer 1.13|868746|32|LR134165|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
tggagcaacaggtcctaccggagcaacaggcc	Protospacer
.**  *.******** ** ***********.*

267. spacer 1.13|868746|32|LR134165|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
tggagcaacaggtcctaccggagcaacaggcc	Protospacer
.**  *.******** ** ***********.*

268. spacer 1.13|868746|32|LR134165|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
tggagcaacaggtcctaccggagcaacaggcc	Protospacer
.**  *.******** ** ***********.*

269. spacer 1.13|868746|32|LR134165|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
tggagcaacaggtcctaccggagcaacaggcc	Protospacer
.**  *.******** ** ***********.*

270. spacer 1.13|868746|32|LR134165|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
tggagcaacaggtcctaccggagcaacaggcc	Protospacer
.**  *.******** ** ***********.*

271. spacer 1.13|868746|32|LR134165|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
tggagcaacaggtcctaccggagcaacaggtt	Protospacer
.**  *.******** ** ************.

272. spacer 1.13|868746|32|LR134165|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
tggagcaacaggtcctaccggagcaacaggcc	Protospacer
.**  *.******** ** ***********.*

273. spacer 1.13|868746|32|LR134165|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
tggagcaacaggtcctaccggagcaacaggcc	Protospacer
.**  *.******** ** ***********.*

274. spacer 1.13|868746|32|LR134165|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
tggagcaacaggtcctaccggagcaacaggcc	Protospacer
.**  *.******** ** ***********.*

275. spacer 1.13|868746|32|LR134165|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
tggagcaacaggtcctaccggagcaacaggcc	Protospacer
.**  *.******** ** ***********.*

276. spacer 1.13|868746|32|LR134165|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
tggagcaacaggtcctaccggagcaacaggcc	Protospacer
.**  *.******** ** ***********.*

277. spacer 1.13|868746|32|LR134165|CRT matches to NZ_CP009638 (Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
tggagcaacaggtcctaccggagcaacaggcc	Protospacer
.**  *.******** ** ***********.*

278. spacer 1.13|868746|32|LR134165|CRT matches to NZ_CP009638 (Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
tggagcaacaggtcctaccggagcaacaggcc	Protospacer
.**  *.******** ** ***********.*

279. spacer 1.13|868746|32|LR134165|CRT matches to NZ_CP009639 (Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
tggagcaacaggtcctaccggagcaacaggcc	Protospacer
.**  *.******** ** ***********.*

280. spacer 1.13|868746|32|LR134165|CRT matches to NZ_CP009639 (Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
tggagcaacaggtcctaccggagcaacaggcc	Protospacer
.**  *.******** ** ***********.*

281. spacer 1.13|868746|32|LR134165|CRT matches to NZ_CP016452 (Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
gactgcgacaggtccaacgccagcaacaggtc	Protospacer
 . . **************  ***********

282. spacer 1.13|868746|32|LR134165|CRT matches to NZ_CP053963 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
tggagcaacaggtcctaccggagcaacaggcc	Protospacer
.**  *.******** ** ***********.*

283. spacer 1.13|868746|32|LR134165|CRT matches to NZ_CP053963 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
tggagcaacaggtcctaccggagcaacaggcc	Protospacer
.**  *.******** ** ***********.*

284. spacer 1.13|868746|32|LR134165|CRT matches to NZ_CP053966 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
tggagcaacaggtcctaccggagcaacaggcc	Protospacer
.**  *.******** ** ***********.*

285. spacer 1.13|868746|32|LR134165|CRT matches to NZ_CP053966 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
tggagcaacaggtcctaccggagcaacaggcc	Protospacer
.**  *.******** ** ***********.*

286. spacer 1.13|868746|32|LR134165|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
tggggcaacaggaccaacgggggcaacaggac	Protospacer
.**  *.***** ********.******** *

287. spacer 1.13|868746|32|LR134165|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
aggttcaacaggtccaacaggaccaacagggc	Protospacer
 **..*.***********.*** ******* *

288. spacer 1.13|868746|32|LR134165|CRT matches to NZ_CP011156 (Bacillus cereus strain HN001 plasmid pRML01, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
tggaaatactggtccaacaggagcaacaggtc	Protospacer
.**    ** ********.*************

289. spacer 1.13|868746|32|LR134165|CRT matches to CP002509 (Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
gggagccacaggaccaacgggagccacaggac	Protospacer
 **  * ***** *********** ***** *

290. spacer 1.13|868746|32|LR134165|CRT matches to CP002509 (Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
gggagccacaggaccaacgggagccacaggac	Protospacer
 **  * ***** *********** ***** *

291. spacer 1.13|868746|32|LR134165|CRT matches to CP002509 (Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
gggagccacaggaccaacgggagccacaggac	Protospacer
 **  * ***** *********** ***** *

292. spacer 1.13|868746|32|LR134165|CRT matches to CP002509 (Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
gggaaccacaggaccaacgggagccacaggac	Protospacer
 **  * ***** *********** ***** *

293. spacer 1.13|868746|32|LR134165|CRT matches to CP002509 (Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
gggagccacaggaccaacgggagccacaggac	Protospacer
 **  * ***** *********** ***** *

294. spacer 1.13|868746|32|LR134165|CRT matches to CP002509 (Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
gggagccacaggaccaacgggagccacaggac	Protospacer
 **  * ***** *********** ***** *

295. spacer 1.13|868746|32|LR134165|CRT matches to CP002509 (Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
gggagccacaggaccaacgggagccacaggac	Protospacer
 **  * ***** *********** ***** *

296. spacer 1.13|868746|32|LR134165|CRT matches to CP002509 (Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
gggagccacaggaccaacgggagccacaggac	Protospacer
 **  * ***** *********** ***** *

297. spacer 1.13|868746|32|LR134165|CRT matches to CP002509 (Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
gggagccacaggaccaacgggagccacaggac	Protospacer
 **  * ***** *********** ***** *

298. spacer 1.13|868746|32|LR134165|CRT matches to CP002509 (Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
gggagccacaggaccaacgggagccacaggac	Protospacer
 **  * ***** *********** ***** *

299. spacer 1.13|868746|32|LR134165|CRT matches to CP002509 (Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
gggagccacaggaccaacgggagccacaggac	Protospacer
 **  * ***** *********** ***** *

300. spacer 1.13|868746|32|LR134165|CRT matches to CP002509 (Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
gggaaccacaggaccaacgggagccacaggac	Protospacer
 **  * ***** *********** ***** *

301. spacer 1.13|868746|32|LR134165|CRT matches to CP002509 (Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
gggagccacaggaccaacgggagccacaggac	Protospacer
 **  * ***** *********** ***** *

302. spacer 1.20|869277|32|LR134165|CRT matches to NZ_CP053689 (Arthrobacter citreus strain NEB 577 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccgacaggagcaaccggcccgacaggag	CRISPR spacer
gggagcaacaggagcaacaggcccaacaggaa	Protospacer
 **  *.*********** *****.******.

303. spacer 1.20|869277|32|LR134165|CRT matches to NZ_CP041094 (Klebsiella pneumoniae subsp. pneumoniae strain KPCTRSRTH01 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccga---caggagcaaccggcccgacaggag	CRISPR spacer
---ctctagttcaggagcaaccgtcctgacaggag	Protospacer
   *.* *   ************ **.********

304. spacer 1.20|869277|32|LR134165|CRT matches to MK649828 (Klebsiella pneumoniae strain 1675479 plasmid p1675479_1, complete sequence) position: , mismatch: 7, identity: 0.781

cggcccga---caggagcaaccggcccgacaggag	CRISPR spacer
---ctctagttcaggagcaaccgtcctgacaggag	Protospacer
   *.* *   ************ **.********

305. spacer 1.21|869331|32|LR134165|CRT matches to NZ_CP025614 (Niveispirillum cyanobacteriorum strain TH16 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.781

cggagcgacaggcccaaccggtccgacgggag	CRISPR spacer
cggtgcgacaggcccaaccggtccagcgccgc	Protospacer
*** ********************..**  .

306. spacer 1.24|869511|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.781

cggagcgacaggagcaaccggagcgacaggag	CRISPR spacer
tggtgaaacaggagcaacgggagcgacgggaa	Protospacer
.** * .*********** ********.***.

307. spacer 1.24|869511|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.781

cggagcgacaggagcaaccggagcgacaggag	CRISPR spacer
gggtgaaacaggagcaacgggaacgacaggaa	Protospacer
 ** * .*********** ***.********.

308. spacer 1.24|869511|32|LR134165|CRT matches to NZ_CP016082 (Streptomyces sp. SAT1 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.781

cggagcgacaggagcaaccggagcgacaggag	CRISPR spacer
gagagcgacaggagcgacgggagcgacgcgat	Protospacer
 .*************.** ********. **

309. spacer 1.24|869511|32|LR134165|CRT matches to MN694155 (Marine virus AFVG_250M1019, complete genome) position: , mismatch: 7, identity: 0.781

cggagcgacaggagcaaccggagcgacaggag	CRISPR spacer
aggagcgacaggagcgacaggagcgcagggaa	Protospacer
 **************.** ******  .***.

310. spacer 1.24|869511|32|LR134165|CRT matches to MN855854 (Siphoviridae sp. isolate 269, complete genome) position: , mismatch: 7, identity: 0.781

cggagcgacaggagcaaccggagcgacaggag	CRISPR spacer
cggcatcacaggagccaccggagcaacaggtg	Protospacer
*** .. ******** ********.***** *

311. spacer 1.24|869511|32|LR134165|CRT matches to MN694697 (Marine virus AFVG_250M792, complete genome) position: , mismatch: 7, identity: 0.781

cggagcgacaggagcaaccggagcgacaggag	CRISPR spacer
aggaaacacaggagcaacaggagctacaggtg	Protospacer
 ***.  *********** ***** ***** *

312. spacer 1.25|869565|32|LR134165|CRT matches to NZ_CP015063 (Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence) position: , mismatch: 7, identity: 0.781

cggagcgacaggagcaacaggtccgacgggag	CRISPR spacer
aggttcgactggagcaacaggttcgacggggt	Protospacer
 **  **** ************.*******.

313. spacer 1.25|869565|32|LR134165|CRT matches to NZ_CP015063 (Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence) position: , mismatch: 7, identity: 0.781

cggagcgacaggagcaacaggtccgacgggag	CRISPR spacer
aggttcgactggagcaacaggttcgacggggt	Protospacer
 **  **** ************.*******.

314. spacer 1.25|869565|32|LR134165|CRT matches to KU963260 (Gordonia phage Emalyn, complete genome) position: , mismatch: 7, identity: 0.781

cggagcgacaggagcaacaggtccgacgggag	CRISPR spacer
acgagcgacaggagacacaggtccgacgcggt	Protospacer
  ************  ************ *.

315. spacer 1.25|869565|32|LR134165|CRT matches to MK977707 (Mycobacterium phage LilSpotty, complete genome) position: , mismatch: 7, identity: 0.781

cggagcgacaggagcaacaggtccgacgggag	CRISPR spacer
tgctgctgcagcagcaacaggaccgacgggag	Protospacer
.*  ** .*** ********* **********

316. spacer 1.25|869565|32|LR134165|CRT matches to MH727593 (Acidovorax phage ACPWH, complete genome) position: , mismatch: 7, identity: 0.781

cggagcgacaggagcaacaggtccgacgggag	CRISPR spacer
gggggatacaggagcaactggtcccacgggac	Protospacer
 **.*  *********** ***** ******

317. spacer 1.25|869565|32|LR134165|CRT matches to NZ_CP011156 (Bacillus cereus strain HN001 plasmid pRML01, complete sequence) position: , mismatch: 7, identity: 0.781

cggagcgacaggagcaacaggtccgacgggag	CRISPR spacer
tggtccaacaggagcaacaggtcctactgggg	Protospacer
.**  *.***************** ** **.*

318. spacer 1.25|869565|32|LR134165|CRT matches to MN693279 (Marine virus AFVG_25M346, complete genome) position: , mismatch: 7, identity: 0.781

cggagcgacaggagcaacaggtccgacgggag	CRISPR spacer
gggagctactggagcaacaggtcctcaggggg	Protospacer
 ***** ** **************   ***.*

319. spacer 1.27|869700|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.781

cggcgcaacgggagcaaccggagcaacgggag	CRISPR spacer
aggagcaacgggagcaatcggagcaattggcc	Protospacer
 ** *************.********. **

320. spacer 1.27|869700|32|LR134165|CRT matches to NZ_CP029452 (Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence) position: , mismatch: 7, identity: 0.781

cggcgcaacgggagcaaccggag-caacgggag	CRISPR spacer
cggcgcaacgggagacaccggagacaatcgcc-	Protospacer
**************  ******* ***. *

321. spacer 1.28|869754|32|LR134165|CRT matches to NZ_AP014705 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence) position: , mismatch: 7, identity: 0.781

cggagcaacgggagcaaccggtccgacgggag	CRISPR spacer
gggtaccacgggcgcgaccggtccgacgggtg	Protospacer
 ** .* ***** **.************** *

322. spacer 1.30|869853|32|LR134165|CRT matches to NC_019718 (Enterobacteria phage vB_EcoS_Rogue1, complete genome) position: , mismatch: 7, identity: 0.781

aggtccaaccggcccgacaggtccaactggcc	CRISPR spacer
aggtccaactggcccggcaggtccggcaggta	Protospacer
*********.******.*******..* **.

323. spacer 1.30|869853|32|LR134165|CRT matches to MF158039 (Shigella phage Sf12, complete genome) position: , mismatch: 7, identity: 0.781

aggtccaaccggcccgacaggtccaactggcc	CRISPR spacer
aggcccaactggcccgacaggtccggcaggta	Protospacer
***.*****.**************..* **.

324. spacer 1.2|868107|32|LR134165|CRT matches to NC_014172 (Bacillus thuringiensis BMB171 plasmid pBMB171, complete sequence) position: , mismatch: 8, identity: 0.75

aggcccaacaggtccgacgggagcaaccggcc	CRISPR spacer
cggagttacaggtcctacgggagccaccggtc	Protospacer
 **  . ******** ******** *****.*

325. spacer 1.2|868107|32|LR134165|CRT matches to NZ_CP016317 (Bacillus cereus strain M3 plasmid pBCM301, complete sequence) position: , mismatch: 8, identity: 0.75

aggcccaacaggtccgacgggagcaaccggcc	CRISPR spacer
cggagttacaggtcctacgggagccaccggtc	Protospacer
 **  . ******** ******** *****.*

326. spacer 1.2|868107|32|LR134165|CRT matches to NC_011777 (Bacillus cereus AH820 plasmid pAH820_272, complete sequence) position: , mismatch: 8, identity: 0.75

aggcccaacaggtccgacgggagcaaccggcc	CRISPR spacer
cggagttacaggtcctacgggagccaccggtc	Protospacer
 **  . ******** ******** *****.*

327. spacer 1.5|868278|32|LR134165|CRT matches to JQ680367 (Unidentified phage clone 2203_scaffold802 genomic sequence) position: , mismatch: 8, identity: 0.75

cggagcgacaggagccacgggagcgacaggag	CRISPR spacer
gggagccacaggagccacaggagcgggggcgg	Protospacer
 ***** ***********.******. .* .*

328. spacer 1.5|868278|32|LR134165|CRT matches to MN694155 (Marine virus AFVG_250M1019, complete genome) position: , mismatch: 8, identity: 0.75

cggagcgacaggagccacgggagcgacaggag	CRISPR spacer
tggaaacttaggagcgacaggagcgacaggag	Protospacer
.***.   .****** **.*************

329. spacer 1.6|868332|32|LR134165|CRT matches to NZ_CP030127 (Indioceanicola profundi strain SCSIO 08040 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

cggagcgacaggagcaaccggtccgacgggag	CRISPR spacer
aagagcgactggagcaacctgtccgaggtggt	Protospacer
 .******* ********* ****** * *.

330. spacer 1.6|868332|32|LR134165|CRT matches to NZ_CP030127 (Indioceanicola profundi strain SCSIO 08040 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

cggagcgacaggagcaaccggtccgacgggag	CRISPR spacer
aagagcgactggagcaacctgtccgaggtggt	Protospacer
 .******* ********* ****** * *.

331. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.75

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
gggagtaaccggagcaacgggagcaacaggaa	Protospacer
 **  ..** ********************

332. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.75

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
gggtgagacaggagcaacgggaacgacaggag	Protospacer
 **.  ****************.*.*****

333. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.75

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggggtgaccggagcaacgggagcaacgggag	Protospacer
 **  .*** *****************.**

334. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.75

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagcaacgggagcaacaggagcaacaggag	Protospacer
 **  *.**.********.***********

335. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.75

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
tggagcaacaggagcaatgggagcgacaggag	Protospacer
.**  *.**********.******.*****

336. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.75

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagcaacgggagcaacaggagcaacaggag	Protospacer
 **  *.**.********.***********

337. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.75

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacaggagcaacgggag	Protospacer
 **  *.***********.********.**

338. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.75

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagcaacgggagcaacaggagcaacaggag	Protospacer
 **  *.**.********.***********

339. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.75

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
gggagcaacaggagcaacaggagcaacgggag	Protospacer
 **  *.***********.********.**

340. spacer 1.7|868386|32|LR134165|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 8, identity: 0.75

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagtaacaggagtaacgggagcaacaggag	Protospacer
 **  ..*******.***************

341. spacer 1.7|868386|32|LR134165|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 8, identity: 0.75

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
gggagcaacaggagcaacaggagcaacgggag	Protospacer
 **  *.***********.********.**

342. spacer 1.7|868386|32|LR134165|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 8, identity: 0.75

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
gggagcaacaggagcaacaggagcaacgggag	Protospacer
 **  *.***********.********.**

343. spacer 1.7|868386|32|LR134165|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 8, identity: 0.75

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
gggagcaacaggagcaacaggagtaacaggag	Protospacer
 **  *.***********.****.******

344. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 8, identity: 0.75

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagtaacaggagtaacgggagcaacaggag	Protospacer
 **  ..*******.***************

345. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 8, identity: 0.75

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
gggagcaacaggagcaacaggagtaacaggag	Protospacer
 **  *.***********.****.******

346. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 8, identity: 0.75

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
gggagcaacaggagcaacaggagcaacgggag	Protospacer
 **  *.***********.********.**

347. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP040345 (Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggtgtaaccggaccaacgggagcaacaggtt	Protospacer
 **. ..** *** *****************.

348. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP020744 (Bacillus mycoides strain Gnyt1 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagaaataggtccaacgggagcaacaggtc	Protospacer
 **   .*.***  ******************

349. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP020744 (Bacillus mycoides strain Gnyt1 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggggacataggtccaacgggagcaacaggtc	Protospacer
 **    *.***  ******************

350. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP020744 (Bacillus mycoides strain Gnyt1 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagaaataggtccaacgggagcaacaggtc	Protospacer
 **   .*.***  ******************

351. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP020744 (Bacillus mycoides strain Gnyt1 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagaaataggtccaacgggagcaacaggtc	Protospacer
 **   .*.***  ******************

352. spacer 1.7|868386|32|LR134165|CRT matches to GU943063 (Uncultured phage MedDCM-OCT-S05-C139 genomic sequence) position: , mismatch: 8, identity: 0.75

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggtattactggagcaactggagcaacaggta	Protospacer
 **. . ** ******** ************

353. spacer 1.7|868386|32|LR134165|CRT matches to MN694697 (Marine virus AFVG_250M792, complete genome) position: , mismatch: 8, identity: 0.75

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggaaacacaggagcaacaggagctacaggtg	Protospacer
 **    ***********.***** ******

354. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP024582 (Roseomonas sp. FDAARGOS_362 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
ccgcacgacaggagcagcgggagcaggcggcg	Protospacer
* ** ***********.********.  **.

355. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP021356 (Rhodococcus sp. S2-17 plasmid pRB29, complete sequence) position: , mismatch: 8, identity: 0.75

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
gcgaacaacgggagcaacgggagcaacgggac	Protospacer
  *  *.**.*****************.** *

356. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP046575 (Rhodococcus sp. WAY2 plasmid pRWAY03, complete sequence) position: , mismatch: 8, identity: 0.75

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
gcgaacaacgggagcaacgggagcaacgggac	Protospacer
  *  *.**.*****************.** *

357. spacer 1.7|868386|32|LR134165|CRT matches to CP002509 (Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence) position: , mismatch: 8, identity: 0.75

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
gggagccacaggaccaacgggagccacaggat	Protospacer
 **  * ****** ********** ***** .

358. spacer 1.7|868386|32|LR134165|CRT matches to CP002509 (Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence) position: , mismatch: 8, identity: 0.75

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
gggaaccacaggaccaacgggagccacaggat	Protospacer
 **  * ****** ********** ***** .

359. spacer 1.7|868386|32|LR134165|CRT matches to CP002509 (Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence) position: , mismatch: 8, identity: 0.75

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
gggagccacaggaccaacgggagccacaggat	Protospacer
 **  * ****** ********** ***** .

360. spacer 1.7|868386|32|LR134165|CRT matches to CP002509 (Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence) position: , mismatch: 8, identity: 0.75

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
gggagccacaggaccaacgggagccacaggat	Protospacer
 **  * ****** ********** ***** .

361. spacer 1.7|868386|32|LR134165|CRT matches to CP002509 (Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence) position: , mismatch: 8, identity: 0.75

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
gggagccacaggaccaacgggagccacaggat	Protospacer
 **  * ****** ********** ***** .

362. spacer 1.7|868386|32|LR134165|CRT matches to CP002509 (Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence) position: , mismatch: 8, identity: 0.75

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
gggatccacaggatcaacgggagccacaggat	Protospacer
 ** .* ****** ********** ***** .

363. spacer 1.7|868386|32|LR134165|CRT matches to CP002509 (Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence) position: , mismatch: 8, identity: 0.75

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
gggagccacaggatcaacgggagccacaggat	Protospacer
 **  * ****** ********** ***** .

364. spacer 1.7|868386|32|LR134165|CRT matches to CP002509 (Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence) position: , mismatch: 8, identity: 0.75

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
gggagccacaggaccaacgggagccacaggat	Protospacer
 **  * ****** ********** ***** .

365. spacer 1.7|868386|32|LR134165|CRT matches to CP002509 (Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence) position: , mismatch: 8, identity: 0.75

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
gggagccacaggaccaacgggagccacaggat	Protospacer
 **  * ****** ********** ***** .

366. spacer 1.7|868386|32|LR134165|CRT matches to CP002509 (Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence) position: , mismatch: 8, identity: 0.75

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
gggagccacaggaccaacgggagccacaggat	Protospacer
 **  * ****** ********** ***** .

367. spacer 1.7|868386|32|LR134165|CRT matches to CP002509 (Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence) position: , mismatch: 8, identity: 0.75

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
gggagccacaggatcaacgggagccacaggat	Protospacer
 **  * ****** ********** ***** .

368. spacer 1.7|868386|32|LR134165|CRT matches to CP002509 (Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence) position: , mismatch: 8, identity: 0.75

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
gggagccacaggatcaacgggagccacaggat	Protospacer
 **  * ****** ********** ***** .

369. spacer 1.7|868386|32|LR134165|CRT matches to CP002509 (Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence) position: , mismatch: 8, identity: 0.75

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
gggaaccacaggatcaacgggagccacaggat	Protospacer
 **  * ****** ********** ***** .

370. spacer 1.7|868386|32|LR134165|CRT matches to CP002509 (Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence) position: , mismatch: 8, identity: 0.75

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
gggagccacaggatcaacgggagccacaggat	Protospacer
 **  * ****** ********** ***** .

371. spacer 1.7|868386|32|LR134165|CRT matches to CP002509 (Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence) position: , mismatch: 8, identity: 0.75

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
gggaaccacaggaccaacgggagccacaggat	Protospacer
 **  * ****** ********** ***** .

372. spacer 1.7|868386|32|LR134165|CRT matches to CP002509 (Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence) position: , mismatch: 8, identity: 0.75

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
gggagccacaggaccaacgggagccacaggat	Protospacer
 **  * ****** ********** ***** .

373. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP025188 (Roseomonas mucosa strain AD2 plasmid p1-AD2, complete sequence) position: , mismatch: 8, identity: 0.75

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
ccgcacgacaggagcagcgggagcaggcggcg	Protospacer
* ** ***********.********.  **.

374. spacer 1.7|868386|32|LR134165|CRT matches to MN693163 (Marine virus AFVG_25M177, complete genome) position: , mismatch: 8, identity: 0.75

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagctacaggagctacgggagctacaggcg	Protospacer
 **  * ******** ******** *****.

375. spacer 1.7|868386|32|LR134165|CRT matches to MN694068 (Marine virus AFVG_250M543, complete genome) position: , mismatch: 8, identity: 0.75

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
cgtatgcacaggagcagtgggagcaacaggac	Protospacer
**  .  *********..************ *

376. spacer 1.7|868386|32|LR134165|CRT matches to MG209611 (Aphanizomenon phage vB_AphaS-CL131, complete genome) position: , mismatch: 8, identity: 0.75

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagcaacgggagcaacgggagcaacgggag	Protospacer
 **  *.**.*****************.**

377. spacer 1.12|868692|32|LR134165|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 8, identity: 0.75

aggagcaaccggagcgacaggagcaacaggtc	CRISPR spacer
ggggccgacgggagcaacaggagcaacaggag	Protospacer
.**. *.** *****.**************

378. spacer 1.12|868692|32|LR134165|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 8, identity: 0.75

aggagcaaccggagcgacaggagcaacaggtc	CRISPR spacer
ggggccgacgggagcaacaggagcaacaggag	Protospacer
.**. *.** *****.**************

379. spacer 1.12|868692|32|LR134165|CRT matches to NZ_LT599050 (Lactococcus lactis subsp. lactis strain A12 plasmid pA12-1, complete sequence) position: , mismatch: 8, identity: 0.75

aggagcaaccggagcgacaggagcaacaggtc	CRISPR spacer
gtgtacaagcggagcgacaggagcaacaaggg	Protospacer
. * .*** *******************.*

380. spacer 1.12|868692|32|LR134165|CRT matches to CP029293 (Lactococcus lactis subsp. lactis KLDS 4.0325 plasmid unnamed6) position: , mismatch: 8, identity: 0.75

aggagcaaccggagcgacaggagcaacaggtc	CRISPR spacer
gtgtacaagcggagcgacaggagcaacaaggg	Protospacer
. * .*** *******************.*

381. spacer 1.12|868692|32|LR134165|CRT matches to MN694155 (Marine virus AFVG_250M1019, complete genome) position: , mismatch: 8, identity: 0.75

aggagcaaccggagcgacaggagcaacaggtc	CRISPR spacer
aggagcgacaggagcgacaggagcgcagggaa	Protospacer
******.** **************.  .**

382. spacer 1.13|868746|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.75

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacgggagcaacaggag	Protospacer
 **  *.*****  ****************

383. spacer 1.13|868746|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.75

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
gggagcaacaggagcaacgggagcaacaggag	Protospacer
 **  *.*****  ****************

384. spacer 1.13|868746|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.75

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacgggagcaacaggag	Protospacer
 **  *.*****  ****************

385. spacer 1.13|868746|32|LR134165|CRT matches to NZ_CP040345 (Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
aggtgtaaccggaccaacgggagcaacaggtt	Protospacer
 **. ..** ** ******************.

386. spacer 1.13|868746|32|LR134165|CRT matches to MN693226 (Marine virus AFVG_25M419, complete genome) position: , mismatch: 8, identity: 0.75

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
aggcaatgtaggtcctacaggagcaacaggtc	Protospacer
 ***   ..****** **.*************

387. spacer 1.13|868746|32|LR134165|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 8, identity: 0.75

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacgggagcaacaggag	Protospacer
 **  *.*****  ****************

388. spacer 1.13|868746|32|LR134165|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 8, identity: 0.75

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacgggagcaacaggag	Protospacer
 **  *.*****  ****************

389. spacer 1.13|868746|32|LR134165|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 8, identity: 0.75

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacgggagcaacaggag	Protospacer
 **  *.*****  ****************

390. spacer 1.13|868746|32|LR134165|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 8, identity: 0.75

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacgggagcaacaggag	Protospacer
 **  *.*****  ****************

391. spacer 1.13|868746|32|LR134165|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 8, identity: 0.75

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
aggagcaacaggagcaacgggagcaacaggag	Protospacer
 **  *.*****  ****************

392. spacer 1.13|868746|32|LR134165|CRT matches to CP002509 (Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence) position: , mismatch: 8, identity: 0.75

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
gggagccacaggaccaacgggagccacaggat	Protospacer
 **  * ***** *********** ***** .

393. spacer 1.13|868746|32|LR134165|CRT matches to CP002509 (Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence) position: , mismatch: 8, identity: 0.75

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
gggaaccacaggaccaacgggagccacaggat	Protospacer
 **  * ***** *********** ***** .

394. spacer 1.13|868746|32|LR134165|CRT matches to CP002509 (Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence) position: , mismatch: 8, identity: 0.75

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
gggagccacaggaccaacgggagccacaggat	Protospacer
 **  * ***** *********** ***** .

395. spacer 1.13|868746|32|LR134165|CRT matches to CP002509 (Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence) position: , mismatch: 8, identity: 0.75

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
gggagccacaggaccaacgggagccacaggat	Protospacer
 **  * ***** *********** ***** .

396. spacer 1.13|868746|32|LR134165|CRT matches to CP002509 (Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence) position: , mismatch: 8, identity: 0.75

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
gggagccacaggaccaacgggagccacaggat	Protospacer
 **  * ***** *********** ***** .

397. spacer 1.13|868746|32|LR134165|CRT matches to CP002509 (Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence) position: , mismatch: 8, identity: 0.75

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
gggagccacaggaccaacgggagccacaggat	Protospacer
 **  * ***** *********** ***** .

398. spacer 1.13|868746|32|LR134165|CRT matches to CP002509 (Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence) position: , mismatch: 8, identity: 0.75

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
gggagccacaggaccaacgggagccacaggat	Protospacer
 **  * ***** *********** ***** .

399. spacer 1.13|868746|32|LR134165|CRT matches to CP002509 (Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence) position: , mismatch: 8, identity: 0.75

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
gggagccacaggaccaacgggagccacaggat	Protospacer
 **  * ***** *********** ***** .

400. spacer 1.13|868746|32|LR134165|CRT matches to CP002509 (Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence) position: , mismatch: 8, identity: 0.75

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
gggaaccacaggaccaacgggagccacaggat	Protospacer
 **  * ***** *********** ***** .

401. spacer 1.13|868746|32|LR134165|CRT matches to CP002509 (Bacillus thuringiensis serovar finitimus YBT-020 plasmid pBMB26, complete sequence) position: , mismatch: 8, identity: 0.75

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
gggagccacaggaccaacgggagccacaggat	Protospacer
 **  * ***** *********** ***** .

402. spacer 1.13|868746|32|LR134165|CRT matches to MN693263 (Marine virus AFVG_25M296, complete genome) position: , mismatch: 8, identity: 0.75

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
aggtggtacaggtccaacaggaccaacaggac	Protospacer
 **.   ***********.*** ******* *

403. spacer 1.20|869277|32|LR134165|CRT matches to NZ_CP017756 (Cupriavidus malaysiensis strain USMAA1020 isolate pure plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

cggcccgacaggagcaaccggcccgacaggag	CRISPR spacer
cctcgcgagaggagcaaccgccccgacagatc	Protospacer
*  * *** *********** ********.

404. spacer 1.20|869277|32|LR134165|CRT matches to MN096362 (Arthrobacter phage Vibaki, complete genome) position: , mismatch: 8, identity: 0.75

cggcccgacaggagcaaccggcccgacaggag	CRISPR spacer
aagcccgacatgagcaaccagcccgccggcaa	Protospacer
 .******** ********.***** *.* *.

405. spacer 1.20|869277|32|LR134165|CRT matches to NC_023607 (Mycobacterium phage 40AC, complete genome) position: , mismatch: 8, identity: 0.75

cggcccgacaggagcaaccggcccgacaggag	CRISPR spacer
gggtgatacaggagccaccggcccgaaaggtg	Protospacer
 **.   ******** ********** *** *

406. spacer 1.21|869331|32|LR134165|CRT matches to NC_010180 (Bacillus mycoides KBAB4 plasmid pBWB401, complete sequence) position: , mismatch: 8, identity: 0.75

cggagcgacaggcccaaccggtccgacgggag	CRISPR spacer
aggcccaacaggcccaaccggtccaaccggtc	Protospacer
 **  *.*****************.** **

407. spacer 1.24|869511|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.75

cggagcgacaggagcaaccggagcgacaggag	CRISPR spacer
accagcaggaggagcaacaggagcaacaggag	Protospacer
   ***.. ********* *****.*******

408. spacer 1.24|869511|32|LR134165|CRT matches to MN694155 (Marine virus AFVG_250M1019, complete genome) position: , mismatch: 8, identity: 0.75

cggagcgacaggagcaaccggagcgacaggag	CRISPR spacer
tggaaacttaggagcgacaggagcgacaggag	Protospacer
.***.   .******.** *************

409. spacer 1.24|869511|32|LR134165|CRT matches to NC_048182 (Edwardsiella virus pEt-SU, complete genome) position: , mismatch: 8, identity: 0.75

cggagcgacaggagcaaccggagcgacaggag	CRISPR spacer
tacagaggtaggagcaaccggagtgacagtag	Protospacer
.. ** *..**************.***** **

410. spacer 1.25|869565|32|LR134165|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 8, identity: 0.75

cggagcgacaggagcaacaggtccgacgggag	CRISPR spacer
aggagcaacaggagcaacaggacctagtgctg	Protospacer
 *****.************** ** *  *  *

411. spacer 1.25|869565|32|LR134165|CRT matches to MN586049 (Gordonia phage Yarn, complete genome) position: , mismatch: 8, identity: 0.75

cggagcgacaggagcaacaggtccgacgggag	CRISPR spacer
acgagcgacaggagacacaggtccgaggcggt	Protospacer
  ************  ********** * *.

412. spacer 1.25|869565|32|LR134165|CRT matches to MN234215 (Gordonia phage SteamedHams, complete genome) position: , mismatch: 8, identity: 0.75

cggagcgacaggagcaacaggtccgacgggag	CRISPR spacer
acgagcgacaggagacacaggtccgaggcggt	Protospacer
  ************  ********** * *.

413. spacer 1.27|869700|32|LR134165|CRT matches to MG209611 (Aphanizomenon phage vB_AphaS-CL131, complete genome) position: , mismatch: 8, identity: 0.75

cggcgcaacgggagcaaccggagcaacgggag	CRISPR spacer
gggagcaacgggagcaacgggagcgatcgggc	Protospacer
 ** ************** *****.*. **.

414. spacer 1.27|869700|32|LR134165|CRT matches to NZ_CP034331 (Tabrizicola piscis strain K13M18 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.75

cggcgcaacgggagcaaccggagcaacgggag	CRISPR spacer
cggcgtcacgggagcaaccggagccgtagctg	Protospacer
*****. ***************** ...*  *

415. spacer 1.27|869700|32|LR134165|CRT matches to NZ_CP053689 (Arthrobacter citreus strain NEB 577 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

cggcgcaacgggagcaaccggagcaacgggag	CRISPR spacer
gggatcgacgggagcaacaggagcaacaggcc	Protospacer
 **  *.*********** ********.**

416. spacer 1.28|869754|32|LR134165|CRT matches to NC_011273 (Mycobacterium phage Myrna, complete genome) position: , mismatch: 8, identity: 0.75

cggagcaacgggagcaaccggtccgacgggag	CRISPR spacer
cctggcaacgggcgcaaccggtcggacgctcg	Protospacer
*  .******** ********** ****   *

417. spacer 1.28|869754|32|LR134165|CRT matches to NZ_CP021356 (Rhodococcus sp. S2-17 plasmid pRB29, complete sequence) position: , mismatch: 8, identity: 0.75

cggagcaacgggagcaaccggtccgacgggag	CRISPR spacer
gggagcaacgggagcaacgggacccgggcaag	Protospacer
 ***************** ** ** . * .**

418. spacer 1.28|869754|32|LR134165|CRT matches to NZ_CP046575 (Rhodococcus sp. WAY2 plasmid pRWAY03, complete sequence) position: , mismatch: 8, identity: 0.75

cggagcaacgggagcaaccggtccgacgggag	CRISPR spacer
gggagcaacgggagcaacgggacccgggcaag	Protospacer
 ***************** ** ** . * .**

419. spacer 1.30|869853|32|LR134165|CRT matches to NZ_MF600313 (Mycolicibacterium sp. CBMA 213 plasmid pCBMA213_1, complete sequence) position: , mismatch: 8, identity: 0.75

aggtccaaccggcccgacaggtccaactggcc	CRISPR spacer
aggtcaaaccggcccgacaggtccgaggaaaa	Protospacer
***** ******************.*  ..

420. spacer 1.30|869853|32|LR134165|CRT matches to MF158042 (Shigella phage Sd1, complete genome) position: , mismatch: 8, identity: 0.75

aggtccaaccggcccgacaggtccaactggcc	CRISPR spacer
aggcccaactggcccgacaggtccggaaggta	Protospacer
***.*****.**************..  **.

421. spacer 1.5|868278|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 9, identity: 0.719

cggagcgacaggagccacgggagcgacaggag	CRISPR spacer
tgaatttttaggagcaacgggagcaacaggag	Protospacer
.*.* .  .****** ********.*******

422. spacer 1.5|868278|32|LR134165|CRT matches to NZ_CP030933 (Enterococcus gilvus strain CR1 plasmid pCR1A, complete sequence) position: , mismatch: 9, identity: 0.719

cggagcgacaggagccacgggagcgacaggag	CRISPR spacer
tggagcgataggagccaccggagctggcgctg	Protospacer
.*******.********* ***** .  *  *

423. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 9, identity: 0.719

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
agggttaacaggagtaacgggagcaaccggag	Protospacer
 ** ...*******.************ **

424. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 9, identity: 0.719

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggaataacaggagtaacaggagcaacagggg	Protospacer
 **  ..*******.***.***********

425. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 9, identity: 0.719

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
tggtgaaacaggagcaacgggagcgacgggaa	Protospacer
.**.  .*****************.**.**

426. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 9, identity: 0.719

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
gggtgaaacaggagcaacgggaacgacaggaa	Protospacer
 **.  .***************.*.*****

427. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 9, identity: 0.719

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagtaaccggagcaacgggtgcaacaggag	Protospacer
 **  ..** *********** ********

428. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 9, identity: 0.719

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
tggagtaaccggagcaacgggagaaacaggag	Protospacer
.**  ..** ************* ******

429. spacer 1.7|868386|32|LR134165|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 9, identity: 0.719

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagtaacgggagcaacaggagcaacaggag	Protospacer
 **  ..**.********.***********

430. spacer 1.7|868386|32|LR134165|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 9, identity: 0.719

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagtaacgggagcaacaggagcaacaggag	Protospacer
 **  ..**.********.***********

431. spacer 1.7|868386|32|LR134165|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 9, identity: 0.719

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagtaacgggagcaacaggagcaacaggag	Protospacer
 **  ..**.********.***********

432. spacer 1.7|868386|32|LR134165|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 9, identity: 0.719

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagtaacgggagcaacaggagcaacaggag	Protospacer
 **  ..**.********.***********

433. spacer 1.7|868386|32|LR134165|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 9, identity: 0.719

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagtaacgggagcaacaggagcaacaggag	Protospacer
 **  ..**.********.***********

434. spacer 1.7|868386|32|LR134165|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 9, identity: 0.719

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagtaacgggagcaacaggagcaacaggag	Protospacer
 **  ..**.********.***********

435. spacer 1.7|868386|32|LR134165|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 9, identity: 0.719

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagtaacgggagcaacaggagcaacaggag	Protospacer
 **  ..**.********.***********

436. spacer 1.7|868386|32|LR134165|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 9, identity: 0.719

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagtaacgggagcaacaggagcaacaggag	Protospacer
 **  ..**.********.***********

437. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 9, identity: 0.719

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagtaacgggagcaacaggagcaacaggag	Protospacer
 **  ..**.********.***********

438. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 9, identity: 0.719

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagtaacgggagcaacaggagcaacaggag	Protospacer
 **  ..**.********.***********

439. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 9, identity: 0.719

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagtaacgggagcaacaggagcaacaggag	Protospacer
 **  ..**.********.***********

440. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 9, identity: 0.719

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
aggagtaacgggagcaacaggagcaacaggag	Protospacer
 **  ..**.********.***********

441. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP032342 (Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence) position: , mismatch: 9, identity: 0.719

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
gggatgaccagcagcaacggcagcaacaggta	Protospacer
 ** . . *** ******** **********

442. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP033321 (Azospirillum brasilense strain Cd plasmid p3, complete sequence) position: , mismatch: 9, identity: 0.719

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
gggatgaccagcagcaacggcagcaacaggta	Protospacer
 ** . . *** ******** **********

443. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP033315 (Azospirillum brasilense strain Sp 7 plasmid p3, complete sequence) position: , mismatch: 9, identity: 0.719

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
gggatgaccagcagcaacggcagcaacaggta	Protospacer
 ** . . *** ******** **********

444. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP021437 (Bacillus thuringiensis strain C15 plasmid pBMB240, complete sequence) position: , mismatch: 9, identity: 0.719

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
cacacacacaggtgcaacgggaggaacaggaa	Protospacer
*.  *  ***** ********** ******

445. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP015254 (Bacillus thuringiensis Bt18247 plasmid p81952, complete sequence) position: , mismatch: 9, identity: 0.719

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
cacacacacaggtgcaacgggaggaacaggaa	Protospacer
*.  *  ***** ********** ******

446. spacer 1.7|868386|32|LR134165|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 9, identity: 0.719

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
tggttaaaccggagcaacgggagcaacgggag	Protospacer
.**.. .** *****************.**

447. spacer 1.7|868386|32|LR134165|CRT matches to MG592551 (Vibrio phage 1.185.O._10N.286.49.C2, partial genome) position: , mismatch: 9, identity: 0.719

---cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
atttggt---acaggaggaacgggagcagcagggg	Protospacer
   .**.   ******* **********.****

448. spacer 1.12|868692|32|LR134165|CRT matches to MN693816 (Marine virus AFVG_250M124, complete genome) position: , mismatch: 9, identity: 0.719

aggagcaaccggagcgacaggagcaacaggtc	CRISPR spacer
acttcctactggagcgacaggagcgacaggag	Protospacer
*    * **.**************.*****

449. spacer 1.13|868746|32|LR134165|CRT matches to NZ_CP021437 (Bacillus thuringiensis strain C15 plasmid pBMB240, complete sequence) position: , mismatch: 9, identity: 0.719

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
cacacacacaggtgcaacgggaggaacaggaa	Protospacer
*.  *  ****** ********* ******

450. spacer 1.13|868746|32|LR134165|CRT matches to NZ_CP015254 (Bacillus thuringiensis Bt18247 plasmid p81952, complete sequence) position: , mismatch: 9, identity: 0.719

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
cacacacacaggtgcaacgggaggaacaggaa	Protospacer
*.  *  ****** ********* ******

451. spacer 1.24|869511|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 9, identity: 0.719

cggagcgacaggagcaaccggagcgacaggag	CRISPR spacer
acctgctggaggagcaacaggagcaacaggag	Protospacer
    ** . ********* *****.*******

452. spacer 1.24|869511|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 9, identity: 0.719

cggagcgacaggagcaaccggagcgacaggag	CRISPR spacer
tgaatttttaggagcaacgggagcaacaggag	Protospacer
.*.* .  .********* *****.*******

453. spacer 1.24|869511|32|LR134165|CRT matches to NZ_CP030933 (Enterococcus gilvus strain CR1 plasmid pCR1A, complete sequence) position: , mismatch: 9, identity: 0.719

cggagcgacaggagcaaccggagcgacaggag	CRISPR spacer
tggagcgataggagccaccggagctggcgctg	Protospacer
.*******.****** ******** .  *  *

454. spacer 1.27|869700|32|LR134165|CRT matches to NZ_CP023068 (Ensifer sojae CCBAU 05684 plasmid pSJ05684b, complete sequence) position: , mismatch: 9, identity: 0.719

cggcgcaacgggagcaaccggagcaacgggag	CRISPR spacer
atgcgcgacgggagcagccggagcagggactg	Protospacer
  ****.*********.********. *.  *

455. spacer 1.27|869700|32|LR134165|CRT matches to NZ_CP041223 (Porphyrobacter sp. YT40 plasmid pYT40, complete sequence) position: , mismatch: 9, identity: 0.719

cggcgcaacgggagcaaccggagcaacgggag	CRISPR spacer
tggcgtcacgggagcaaccggagccgtagctg	Protospacer
.****. ***************** ...*  *

456. spacer 1.30|869853|32|LR134165|CRT matches to NZ_CP053933 (Bacillus thuringiensis strain FDAARGOS_794 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

aggtccaaccggcccgacaggtccaactggcc	CRISPR spacer
cggaattactggccccacaggtccaactggaa	Protospacer
 **  . **.***** **************

457. spacer 1.30|869853|32|LR134165|CRT matches to NZ_CP053936 (Bacillus thuringiensis strain FDAARGOS_794 plasmid unnamed4, complete sequence) position: , mismatch: 9, identity: 0.719

aggtccaaccggcccgacaggtccaactggcc	CRISPR spacer
cggaattactggccccacaggtccaactggaa	Protospacer
 **  . **.***** **************

458. spacer 1.30|869853|32|LR134165|CRT matches to NZ_CP009718 (Bacillus thuringiensis strain HD682 plasmid pBGN_2, complete sequence) position: , mismatch: 9, identity: 0.719

aggtccaaccggcccgacaggtccaactggcc	CRISPR spacer
cggaattactggccccacaggtccaactggaa	Protospacer
 **  . **.***** **************

459. spacer 1.7|868386|32|LR134165|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 10, identity: 0.688

cggcccgacaggagcaacgggagcaacaggtc	CRISPR spacer
tcttggaacaggggcaacaggagcaacaggac	Protospacer
.  .  .*****.*****.*********** *

460. spacer 1.13|868746|32|LR134165|CRT matches to NZ_CP027861 (Ahniella affigens strain D13 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

cggcccgacaggtccaacgggagcaacaggtc	CRISPR spacer
gtgcccgacaggtccaacggtggcaccgacaa	Protospacer
  ****************** .*** *..

461. spacer 1.20|869277|32|LR134165|CRT matches to NC_019848 (Sinorhizobium meliloti GR4 plasmid pRmeGR4c, complete sequence) position: , mismatch: 10, identity: 0.688

cggcccgacaggagcaaccggcccgacaggag	CRISPR spacer
atcttcgacatgggcaaccggcccgacagcta	Protospacer
   ..***** *.****************  .

462. spacer 1.20|869277|32|LR134165|CRT matches to NC_003037 (Sinorhizobium meliloti 1021 plasmid pSymA, complete sequence) position: , mismatch: 10, identity: 0.688

cggcccgacaggagcaaccggcccgacaggag	CRISPR spacer
atcttcgacatgggcaaccggcccgacagcta	Protospacer
   ..***** *.****************  .

463. spacer 1.20|869277|32|LR134165|CRT matches to NZ_CP019585 (Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymA, complete sequence) position: , mismatch: 10, identity: 0.688

cggcccgacaggagcaaccggcccgacaggag	CRISPR spacer
atcttcgacatgggcaaccggcccgacagcta	Protospacer
   ..***** *.****************  .

464. spacer 1.20|869277|32|LR134165|CRT matches to NC_017327 (Sinorhizobium meliloti SM11 plasmid pSmeSM11c, complete sequence) position: , mismatch: 10, identity: 0.688

cggcccgacaggagcaaccggcccgacaggag	CRISPR spacer
atcttcgacatgggcaaccggcccgacagcta	Protospacer
   ..***** *.****************  .

465. spacer 1.20|869277|32|LR134165|CRT matches to NZ_CP021798 (Sinorhizobium meliloti strain USDA1106 plasmid psymA, complete sequence) position: , mismatch: 10, identity: 0.688

cggcccgacaggagcaaccggcccgacaggag	CRISPR spacer
atcttcgacatgggcaaccggcccgacagcta	Protospacer
   ..***** *.****************  .

466. spacer 1.20|869277|32|LR134165|CRT matches to NC_017324 (Sinorhizobium meliloti BL225C plasmid pSINMEB01, complete sequence) position: , mismatch: 10, identity: 0.688

cggcccgacaggagcaaccggcccgacaggag	CRISPR spacer
atcttcgacatgggcaaccggcccgacagcta	Protospacer
   ..***** *.****************  .

467. spacer 1.20|869277|32|LR134165|CRT matches to NZ_CP009145 (Sinorhizobium meliloti strain RMO17 plasmid pSymA, complete sequence) position: , mismatch: 10, identity: 0.688

cggcccgacaggagcaaccggcccgacaggag	CRISPR spacer
atcttcgacatgggcaaccggcccgacagcta	Protospacer
   ..***** *.****************  .

468. spacer 1.20|869277|32|LR134165|CRT matches to NZ_CP021827 (Sinorhizobium meliloti strain KH35c plasmid psymA, complete sequence) position: , mismatch: 10, identity: 0.688

cggcccgacaggagcaaccggcccgacaggag	CRISPR spacer
atcttcgacatgggcaaccggcccgacagcta	Protospacer
   ..***** *.****************  .

469. spacer 1.20|869277|32|LR134165|CRT matches to NZ_CP021801 (Sinorhizobium meliloti strain USDA1021 plasmid psymA, complete sequence) position: , mismatch: 10, identity: 0.688

cggcccgacaggagcaaccggcccgacaggag	CRISPR spacer
atcttcgacatgggcaaccggcccgacagcta	Protospacer
   ..***** *.****************  .

470. spacer 1.20|869277|32|LR134165|CRT matches to NZ_CP021819 (Sinorhizobium meliloti strain M162 plasmid psymA, complete sequence) position: , mismatch: 10, identity: 0.688

cggcccgacaggagcaaccggcccgacaggag	CRISPR spacer
atcttcgacatgggcaaccggcccgacagcta	Protospacer
   ..***** *.****************  .

471. spacer 1.20|869277|32|LR134165|CRT matches to NZ_CP021830 (Sinorhizobium meliloti strain HM006 plasmid psymA, complete sequence) position: , mismatch: 10, identity: 0.688

cggcccgacaggagcaaccggcccgacaggag	CRISPR spacer
atcttcgacatgggcaaccggcccgacagcta	Protospacer
   ..***** *.****************  .

472. spacer 1.20|869277|32|LR134165|CRT matches to NZ_CP021824 (Sinorhizobium meliloti strain KH46 plasmid psymA, complete sequence) position: , mismatch: 10, identity: 0.688

cggcccgacaggagcaaccggcccgacaggag	CRISPR spacer
atcttcgacatgggcaaccggcccgacagcta	Protospacer
   ..***** *.****************  .

473. spacer 1.20|869277|32|LR134165|CRT matches to NZ_CP021813 (Sinorhizobium meliloti strain M270 plasmid psymA, complete sequence) position: , mismatch: 10, identity: 0.688

cggcccgacaggagcaaccggcccgacaggag	CRISPR spacer
atcttcgacatgggcaaccggcccgacagcta	Protospacer
   ..***** *.****************  .

474. spacer 1.20|869277|32|LR134165|CRT matches to NC_018683 (Sinorhizobium meliloti Rm41 plasmid pSYMA, complete sequence) position: , mismatch: 10, identity: 0.688

cggcccgacaggagcaaccggcccgacaggag	CRISPR spacer
atcttcgacatgggcaaccggcccgacagcta	Protospacer
   ..***** *.****************  .

475. spacer 1.20|869277|32|LR134165|CRT matches to NZ_CP021794 (Sinorhizobium meliloti strain USDA1157 plasmid psymA, complete sequence) position: , mismatch: 10, identity: 0.688

cggcccgacaggagcaaccggcccgacaggag	CRISPR spacer
atcttcgacatgggcaaccggcccgacagcta	Protospacer
   ..***** *.****************  .

476. spacer 1.20|869277|32|LR134165|CRT matches to NZ_CP021809 (Sinorhizobium meliloti strain Rm41 plasmid psymA, complete sequence) position: , mismatch: 10, identity: 0.688

cggcccgacaggagcaaccggcccgacaggag	CRISPR spacer
atcttcgacatgggcaaccggcccgacagcta	Protospacer
   ..***** *.****************  .

477. spacer 1.20|869277|32|LR134165|CRT matches to NZ_CP021805 (Sinorhizobium meliloti strain T073 plasmid psymA, complete sequence) position: , mismatch: 10, identity: 0.688

cggcccgacaggagcaaccggcccgacaggag	CRISPR spacer
atcttcgacatgggcaaccggcccgacagcta	Protospacer
   ..***** *.****************  .

478. spacer 1.20|869277|32|LR134165|CRT matches to NZ_CP021217 (Sinorhizobium meliloti RU11/001 plasmid pSymA, complete sequence) position: , mismatch: 10, identity: 0.688

cggcccgacaggagcaaccggcccgacaggag	CRISPR spacer
atcttcgacatgggcaaccggcccgacagcta	Protospacer
   ..***** *.****************  .

479. spacer 1.20|869277|32|LR134165|CRT matches to NZ_CP026526 (Sinorhizobium meliloti strain AK21 plasmid pSymA, complete sequence) position: , mismatch: 10, identity: 0.688

cggcccgacaggagcaaccggcccgacaggag	CRISPR spacer
atcttcgacatgggcaaccggcccgacagcta	Protospacer
   ..***** *.****************  .

480. spacer 1.20|869277|32|LR134165|CRT matches to NZ_CP019483 (Sinorhizobium meliloti strain B401 plasmid pSymA, complete sequence) position: , mismatch: 10, identity: 0.688

cggcccgacaggagcaaccggcccgacaggag	CRISPR spacer
atcttcgacatgggcaaccggcccgacagcta	Protospacer
   ..***** *.****************  .

481. spacer 1.20|869277|32|LR134165|CRT matches to NZ_CP019486 (Sinorhizobium meliloti strain B399 plasmid pSymA, complete sequence) position: , mismatch: 10, identity: 0.688

cggcccgacaggagcaaccggcccgacaggag	CRISPR spacer
atcttcgacatgggcaaccggcccgacagcta	Protospacer
   ..***** *.****************  .

482. spacer 1.20|869277|32|LR134165|CRT matches to NC_020527 (Sinorhizobium meliloti 2011 plasmid pSymA, complete sequence) position: , mismatch: 10, identity: 0.688

cggcccgacaggagcaaccggcccgacaggag	CRISPR spacer
atcttcgacatgggcaaccggcccgacagcta	Protospacer
   ..***** *.****************  .

483. spacer 1.30|869853|32|LR134165|CRT matches to NZ_CP034351 (Streptomyces sp. W1SF4 plasmid p1, complete sequence) position: , mismatch: 10, identity: 0.688

aggtccaaccggcccgacaggtccaactggcc	CRISPR spacer
ccgtccagccggcccgccaggtccagggtgta	Protospacer
  *****.******** ********.   *.

484. spacer 1.25|869565|32|LR134165|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 11, identity: 0.656

cggagcgacaggagcaacaggtccgacgggag	CRISPR spacer
aggagcaacaggagcatcaggtccacttatta	Protospacer
 *****.********* *******. . .  .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

732304 : 742229

Synechococcus_phage(50.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
VEB17776.1\|732304_733600_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	5.9e-19	27.1
VEB17777.1\|733674_734391_+	phosphoribosylaminoimidazole-succinocarboxamide synthase	A0A0E3G7P8	Synechococcus_phage	7.4e-48	43.2
VEB17778.1\|734392_734647_+	phosphoribosylformylglycinamidine synthetase activity protein	M4QPE7	Synechococcus_phage	8.0e-05	33.3
VEB17779.1\|734643_735327_+	phosphoribosylformylglycinamidine synthase I	NA	NA	NA	NA
VEB17780.1\|735310_737539_+	phosphoribosylformylglycinamidine synthase II	A6N228	Microbacterium_phage	3.8e-159	41.9
VEB17781.1\|737514_738945_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	4.5e-52	32.9
VEB17782.1\|739066_740110_+	phosphoribosylaminoimidazole synthetase	A0A0E3F760	Synechococcus_phage	2.7e-62	46.7
VEB17783.1\|740106_740694_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	3.1e-28	39.5
VEB17784.1\|740690_742229_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	5.6e-77	52.0

DBSCAN-SWA_2

979703 : 1020137

Bacillus_phage(40.54%)

terminase,tail,coat,integrase,holin,transposase,protease

attL 979665:979687|attR 1022076:1022098

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
979665:979687	attL	NA	NA	NA	NA
VEB18001.1\|979703_980822_-\|integrase	integrase (phage-related protein)	Q5YAA6	Bacillus_phage	7.6e-124	60.8
VEB18002.1\|980836_981283_-	Domain of uncharacterised function (DUF955)	A0A2I7SC21	Paenibacillus_phage	3.2e-41	54.1
VEB18003.1\|981286_981628_-	PBSX genes transcriptional repressor	A0A2I7SC14	Paenibacillus_phage	2.1e-32	61.9
VEB18004.1\|981796_982048_+	Helix-turn-helix domain	A0A2I7SC17	Paenibacillus_phage	1.3e-26	72.2
VEB18005.1\|982064_982385_+	Uncharacterized protein conserved in bacteria	Q9MBW7	Lactococcus_phage	4.2e-11	34.0
VEB18006.1\|982403_983105_+	Rha family regulatory protein	A0A0S2MVD8	Bacillus_phage	2.1e-87	70.4
VEB18007.1\|983213_983432_+	Uncharacterised protein	NA	NA	NA	NA
VEB18008.1\|983424_984255_+	N-terminal phage replisome organizer	V9QKF6	Oenococcus_phage	4.6e-41	40.4
VEB18009.1\|984214_985063_+	dnaA-like Chromosomal replication initiator protein	Q9MBR8	Staphylococcus_prophage	1.3e-22	32.4
VEB18010.1\|985052_985211_+	Uncharacterised protein	NA	NA	NA	NA
VEB18011.1\|985207_985366_+	Uncharacterised protein	A8ATM6	Listeria_phage	3.8e-05	53.3
VEB18012.1\|985362_985911_+	Uncharacterised protein	A0A0K2CNP4	Brevibacillus_phage	1.4e-09	44.8
VEB18013.1\|986015_986165_+	Uncharacterised protein	NA	NA	NA	NA
VEB18014.1\|986236_986437_+	phage-like protein	A0A2H4J4M6	uncultured_Caudovirales_phage	3.6e-08	50.0
VEB18015.1\|986472_986706_+	Uncharacterised protein	NA	NA	NA	NA
VEB18016.1\|986702_986954_+	Uncharacterised protein	NA	NA	NA	NA
VEB18017.1\|986957_988328_+	C-5 cytosine-specific DNA methylase	A0A1I9KFD6	Aeromonas_phage	1.3e-141	48.9
VEB18018.1\|988348_989032_+	Uncharacterised protein	NA	NA	NA	NA
VEB18019.1\|989315_989450_+	Uncharacterised protein	NA	NA	NA	NA
VEB18020.1\|989534_989735_+	Uncharacterised protein	NA	NA	NA	NA
VEB18021.1\|990020_990461_+	phage transcriptional activator	S6AVV9	Thermus_phage	1.2e-35	50.4
VEB18022.1\|990460_991003_+	phage tyrosine recombinase xerD	D2XR58	Bacillus_phage	4.3e-56	60.6
VEB18023.1\|991222_991693_+	Uncharacterised protein	NA	NA	NA	NA
VEB18024.1\|992100_992325_+\|coat	spore coat protein	NA	NA	NA	NA
VEB18025.1\|992543_992852_+	Uncharacterised protein	NA	NA	NA	NA
VEB18026.1\|992878_993253_+	electron transporter	A0A1U7Q1S7	Geobacillus_virus	6.9e-29	50.8
VEB18027.1\|993483_993999_+\|terminase	phage terminase like, small subunit protein	A6M947	Geobacillus_virus	9.8e-34	45.2
VEB18028.1\|993995_995705_+\|terminase	putative terminase large subunit	W8CZ43	Bacillus_phage	4.8e-210	63.6
VEB18029.1\|995714_995909_+	phage-like protein	NA	NA	NA	NA
VEB18030.1\|995909_997220_+	phage-like protein	D6R3Y6	Bacillus_phage	2.4e-105	46.1
VEB18031.1\|997164_997896_+\|protease	ATP-dependent protease proteolytic subunit	A0A0B5A796	Paenibacillus_phage	2.4e-57	56.9
VEB18032.1\|997935_999216_+	phage-like protein	A0A288WGE9	Bacillus_phage	2.0e-75	43.8
VEB18033.1\|999238_999664_+	phage-like protein	D6R3Z0	Bacillus_phage	3.8e-15	54.4
VEB18034.1\|999684_999987_+	phage-like protein	A0A0S2GLH6	Bacillus_phage	1.2e-12	46.3
VEB18035.1\|999976_1000285_+	phage-like protein	A0A2H4JCB1	uncultured_Caudovirales_phage	2.0e-13	38.6
VEB18036.1\|1000284_1000683_+	phage-like protein	NA	NA	NA	NA
VEB18037.1\|1000679_1001063_+	Protein of uncharacterised function (DUF3168)	NA	NA	NA	NA
VEB18038.1\|1001077_1001695_+\|tail	phagelike major tail protein	NA	NA	NA	NA
VEB18039.1\|1001752_1002118_+	Uncharacterised protein	NA	NA	NA	NA
VEB18040.1\|1002165_1002264_+	Uncharacterised protein	NA	NA	NA	NA
VEB18041.1\|1002326_1006796_+\|tail	phage tail like protein	A6M961	Geobacillus_virus	1.1e-69	41.8
VEB18042.1\|1006795_1007632_+	phage-like protein	D6R3Z9	Bacillus_phage	1.3e-107	67.1
VEB18043.1\|1007644_1009357_+	glycoside hydrolase family protein	D6R400	Bacillus_phage	3.4e-216	65.6
VEB18044.1\|1009393_1012039_+	Pre-neck appendage protein	D6R401	Bacillus_phage	4.5e-292	56.7
VEB18045.1\|1012052_1013402_+	phage phi105 protein	D6R402	Bacillus_phage	1.8e-63	41.6
VEB18046.1\|1013414_1013738_+	phage-like protein	M4ZR44	Bacillus_phage	2.0e-13	47.4
VEB18047.1\|1013734_1013917_+	phage uncharacterized protein, XkdX family	A0EWM9	Staphylococcus_virus	1.8e-06	47.9
VEB18048.1\|1013979_1014249_+	phage-like protein	A0A2H4JD40	uncultured_Caudovirales_phage	3.3e-25	62.9
VEB18049.1\|1014264_1014528_+\|holin	holin	A0A2H4J6M0	uncultured_Caudovirales_phage	2.3e-31	75.9
VEB18050.1\|1014575_1015529_+	glycoside hydrolase family protein	A0A141HSE6	Bacillus_phage	1.3e-60	42.0
VEB18051.1\|1015628_1015964_-	Uncharacterised protein	NA	NA	NA	NA
VEB18052.1\|1015981_1017505_-\|transposase	transposase	A0A1L2JY53	Aeribacillus_phage	1.2e-07	36.6
VEB18053.1\|1017700_1017844_+	Uncharacterised protein	NA	NA	NA	NA
VEB18054.1\|1018098_1018329_+	Helix-turn-helix domain	NA	NA	NA	NA
VEB18055.1\|1018431_1019343_+	putative CheA signal transduction histidine kinase	J7KDG8	Streptococcus_phage	8.9e-38	33.4
VEB18056.1\|1019330_1019639_+	Uncharacterised protein	J7KJ12	Streptococcus_phage	2.8e-12	45.0
VEB18057.1\|1019768_1020137_-	YolD-like protein	O64030	Bacillus_phage	1.6e-17	39.5
1022076:1022098	attR	NA	NA	NA	NA

DBSCAN-SWA_3

1426951 : 1458024

uncultured_Caudovirales_phage(24.14%)

terminase,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
VEB18470.1\|1426951_1427599_+	putative PBSZ phage-related replication protein	A0A0Y0AJU6	Bacillus_phage	1.2e-44	46.5
VEB18471.1\|1427611_1428268_-	phage related gene	A0A2H4JA43	uncultured_Caudovirales_phage	6.8e-40	49.7
VEB18472.1\|1428456_1428810_-	transcriptional regulator	A0A2H4J6F9	uncultured_Caudovirales_phage	3.6e-19	49.6
VEB18473.1\|1428982_1429243_+	prophage LambdaBa04, DNA-binding protein	S5MA07	Brevibacillus_phage	3.0e-07	43.8
VEB18474.1\|1429232_1429529_+	Uncharacterized protein yjzJ	NA	NA	NA	NA
VEB18475.1\|1429529_1430354_+	phage-like protein	S6BFM4	Thermus_phage	2.1e-25	29.6
VEB18476.1\|1430403_1431054_+	DNA replicationl protein in PBSZ phage element	Q0H276	Geobacillus_phage	1.0e-56	54.4
VEB18477.1\|1431053_1431224_+	Uncharacterised protein	NA	NA	NA	NA
VEB18478.1\|1431224_1431665_+	phage-like protein	NA	NA	NA	NA
VEB18479.1\|1431661_1431865_+	phage-like protein	A0A2H4J4M6	uncultured_Caudovirales_phage	6.4e-13	56.2
VEB18480.1\|1431982_1432486_+	positive control sigma-like factor	A0A0K2CNQ1	Brevibacillus_phage	6.4e-22	39.3
VEB18481.1\|1432630_1433431_+\|terminase	phage terminase (small subunit)	A0A0S2MVB6	Bacillus_phage	2.6e-65	51.4
VEB18482.1\|1433427_1434726_+\|terminase	phage terminase (large subunit)	M4ZRM5	Bacillus_phage	2.5e-150	60.3
VEB18483.1\|1434729_1436244_+	phage-like protein	A0A1B1P7C8	Bacillus_phage	6.4e-142	55.3
VEB18484.1\|1436251_1437100_+	phage-like protein	A0A1B1P7E4	Bacillus_phage	8.8e-56	60.6
VEB18485.1\|1437117_1438053_+	phage-like protein	A0A1B1P7E3	Bacillus_phage	3.6e-103	64.1
VEB18486.1\|1438168_1438543_+	phage-like protein	NA	NA	NA	NA
VEB18487.1\|1438539_1438896_+	phage-like protein	NA	NA	NA	NA
VEB18488.1\|1438892_1439381_+	phage-like protein	A0A249XXA4	Clostridium_phage	4.9e-35	43.9
VEB18489.1\|1439393_1439834_+	phage-like protein	NA	NA	NA	NA
VEB18490.1\|1439834_1440059_+	Uncharacterised protein	NA	NA	NA	NA
VEB18491.1\|1440058_1441405_+	phage-like protein	S5MNC1	Brevibacillus_phage	8.1e-80	40.5
VEB18492.1\|1441406_1441850_+	Phage-like element PBSX protein xkdM	A0A0K2CNG3	Brevibacillus_phage	2.1e-24	44.7
VEB18493.1\|1442014_1442464_+	XkdN1	A0A0A7RTY8	Clostridium_phage	4.1e-12	38.7
VEB18494.1\|1442487_1442643_+	XkdN2	NA	NA	NA	NA
VEB18495.1\|1442646_1446426_+	phage-like protein	A0A1L2JY60	Aeribacillus_phage	3.4e-43	48.1
VEB18496.1\|1446418_1447075_+	phage-like protein	A0A090DBR9	Clostridium_phage	3.1e-24	32.6
VEB18497.1\|1447131_1448112_+	phage-like protein	H7BV96	unidentified_phage	3.0e-39	31.4
VEB18498.1\|1448108_1448417_+	phage-like protein	S6C459	Thermus_phage	1.4e-06	37.3
VEB18499.1\|1448435_1448861_+	phage-like protein	A0A2H4J6K5	uncultured_Caudovirales_phage	7.1e-14	37.3
VEB18500.1\|1448853_1449897_+	phage-like protein	S6AVU3	Thermus_phage	7.0e-71	43.5
VEB18501.1\|1449883_1450804_+	phage-like protein	A0A0A7RTT8	Clostridium_phage	1.4e-14	31.7
VEB18502.1\|1450817_1451204_+	phage-like protein	NA	NA	NA	NA
VEB18503.1\|1451351_1452527_+	phage-like protein	A0A2H4J4R1	uncultured_Caudovirales_phage	8.8e-22	39.7
VEB18504.1\|1452613_1452874_+	phage-like protein	A0A2H4JD40	uncultured_Caudovirales_phage	2.1e-24	69.5
VEB18505.1\|1452885_1453152_+\|holin	holin	A0A2H4J6M0	uncultured_Caudovirales_phage	9.2e-28	66.7
VEB18506.1\|1453204_1454269_+	N-acetylmuramoyl-L-alanine amidase	S6BFI4	Thermus_phage	5.1e-45	52.0
VEB18507.1\|1454366_1455053_+	DNA-binding transcriptional regulator	NA	NA	NA	NA
VEB18508.1\|1455065_1456082_+	Zinc-containing alcohol dehydrogenase	NA	NA	NA	NA
VEB18509.1\|1456102_1457200_+	mannonate dehydratase	NA	NA	NA	NA
VEB18510.1\|1457175_1458024_+	D-mannonate oxidoreductase	M1NMS3	Moumouvirus	5.6e-10	33.3

DBSCAN-SWA_4

2517716 : 2529347

Staphylococcus_phage(55.56%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
VEB19572.1\|2517716_2518310_-	SMC interacting protein	A0A1B1IVT7	uncultured_Mediterranean_phage	5.3e-15	38.2
VEB19573.1\|2518299_2519055_-	segregation and condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	1.0e-07	24.7
VEB19574.1\|2519237_2519333_+	Protein of uncharacterised function (Tiny_TM_bacill)	NA	NA	NA	NA
VEB19575.1\|2519452_2519974_+	SMC interacting protein	NA	NA	NA	NA
VEB19576.1\|2519984_2520359_-	reductase	NA	NA	NA	NA
VEB19577.1\|2520460_2520925_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.7e-45	70.7
VEB19578.1\|2520959_2522156_-	bifunctional 3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclohydrolase II protein	A0A2H4PQS2	Staphylococcus_phage	1.6e-116	54.2
VEB19579.1\|2522177_2522825_-	riboflavin synthase subunit alpha	A0A2H4PQS5	Staphylococcus_phage	5.2e-40	43.4
VEB19580.1\|2522836_2523925_-	riboflavin-specific deaminase	A0A2H4PQS8	Staphylococcus_phage	1.6e-62	37.5
VEB19581.1\|2524286_2524631_-	YpuD	NA	NA	NA	NA
VEB19582.1\|2524895_2527085_-	phosphatase	A0A220BYT7	Staphylococcus_phage	1.1e-153	41.7
VEB19583.1\|2527290_2527560_-	Uncharacterised protein	NA	NA	NA	NA
VEB19584.1\|2527549_2528680_-	response regulator aspartate phosphatase	A0A1P8CWN8	Bacillus_phage	1.2e-71	40.9
VEB19585.1\|2528909_2529347_-	peptidyl-prolyl isomerase	A0A2H4UTF4	Bodo_saltans_virus	9.2e-17	44.6

DBSCAN-SWA_5

2883903 : 2894134

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
VEB19942.1\|2883903_2884359_-	phage transcriptional regulator, ArpU family	A8ATM9	Listeria_phage	1.8e-07	32.0
VEB19943.1\|2884532_2884850_-	Uncharacterised protein	NA	NA	NA	NA
VEB19944.1\|2884876_2885167_-	Uncharacterised protein	A0A1P8CX38	Bacillus_phage	1.4e-13	42.0
VEB19945.1\|2885416_2886784_-	C-5 cytosine-specific DNA methylase	A0A1I9KFD6	Aeromonas_phage	6.2e-144	50.4
VEB19946.1\|2886819_2887170_-	Uncharacterised protein	NA	NA	NA	NA
VEB19947.1\|2887208_2887382_-	Uncharacterised protein	A0A1B1P7C0	Bacillus_phage	1.1e-16	75.4
VEB19948.1\|2887407_2887665_-	Uncharacterised protein	NA	NA	NA	NA
VEB19949.1\|2887655_2887991_-	Uncharacterised protein	NA	NA	NA	NA
VEB19950.1\|2887987_2888329_-	Domain of Uncharacterised Function with PDB structure	C9E2N9	Enterococcus_phage	8.5e-18	57.9
VEB19951.1\|2888422_2889163_-	Protein of uncharacterised function (DUF2786)	A0A1U9WR73	Streptococcus_virus	9.8e-27	36.7
VEB19952.1\|2889199_2889349_-	Uncharacterised protein	NA	NA	NA	NA
VEB19953.1\|2889362_2890367_-	Uncharacterised protein	Q0H278	Geobacillus_phage	1.0e-10	46.1
VEB19954.1\|2890449_2890656_-	XRE family transcriptional regulator	NA	NA	NA	NA
VEB19955.1\|2890838_2891243_+	transcriptional regulator	A0A0U4B088	Bacillus_phage	2.6e-05	29.5
VEB19956.1\|2891477_2891645_-	Uncharacterised protein	NA	NA	NA	NA
VEB19957.1\|2891641_2892760_-	spore transcriptional regulator YopK	NA	NA	NA	NA
VEB19958.1\|2892842_2893079_-	Uncharacterised protein	NA	NA	NA	NA
VEB19959.1\|2893285_2894134_+	recombinase	I3VYZ3	Thermoanaerobacterium_phage	2.7e-81	60.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. LR134165

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection