CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
LR134234	Escherichia coli strain NCTC8623 genome assembly, chromosome: 1	3 crisprs	cas3,c2c9_V-U4,DEDDh,DinG,csa3,cas2,cas1,cas6e,cas5,cas7,cse2gr11,cas8e,RT	0	19	12	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: LR134234_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

LR134234_2

2051992-2052325

TypeI-E

I-E

Consensus_repeat	Method
CGGTTTATCCCCGCTGGCGCGGGGAAC	CRT
CGGTTTATCCCCGCTGGCGCGGGGAAC	CRISPRCasFinder
CGGTTTATCCCCGCTGGCGCGGGGAACAC	PILER-CR

5 spacers

cas2,cas1,cas6e,cas5,cas7,cse2gr11,cas8e,cas3

The CRISPR arrays of LR134234_2

>merge|LR134234|2|2051992-2052325|CRT,CRISPRCasFinder,PILER-CR
GGGTGTTCTACCGCAGGGGCGGGGAATTCTAAGTGATATCCATCATCGCATCCAGTGCGCCCGGTTTATCCCCGCTGGCGCGGGGAACTCTTACTGCTTGGTATGCGGAATCACACCCTGAACGGTTTATCCCCGCTGGCGCGGGGAACACTGAAGCATCAAACATTTGGTGGACCAAACGGACGGTTTATCCCCGCTGGCGCGGGGAACACTGTACGCGGCGAGTTTTAGCGACAGGTCATCCCGGTTTATCCCCGCTGGCGCGGGGAACACGGATCTGCCAGCGCCTCTGCGGGGCGGTAAACCGGTTTATCCCCGCTGGCGCGGGGAACAC

>LR134234|2|1|2051992-2052323|CRT
GGGTGTTCTACCGCAGGGGCGGGGAAT	TCTAAGTGATATCCATCATCGCATCCAGTGCGCC
CGGTTTATCCCCGCTGGCGCGGGGAAC	TCTTACTGCTTGGTATGCGGAATCACACCCTGAA
CGGTTTATCCCCGCTGGCGCGGGGAAC	ACTGAAGCATCAAACATTTGGTGGACCAAACGGA
CGGTTTATCCCCGCTGGCGCGGGGAAC	ACTGTACGCGGCGAGTTTTAGCGACAGGTCATCC
CGGTTTATCCCCGCTGGCGCGGGGAAC	ACGGATCTGCCAGCGCCTCTGCGGGGCGGTAAAC
CGGTTTATCCCCGCTGGCGCGGGGAAC

>LR134234|2|2|2052053-2052323|CRISPRCasFinder
CGGTTTATCCCCGCTGGCGCGGGGAAC	TCTTACTGCTTGGTATGCGGAATCACACCCTGAA
CGGTTTATCCCCGCTGGCGCGGGGAAC	ACTGAAGCATCAAACATTTGGTGGACCAAACGGA
CGGTTTATCCCCGCTGGCGCGGGGAAC	ACTGTACGCGGCGAGTTTTAGCGACAGGTCATCC
CGGTTTATCCCCGCTGGCGCGGGGAAC	ACGGATCTGCCAGCGCCTCTGCGGGGCGGTAAAC
CGGTTTATCCCCGCTGGCGCGGGGAAC

>LR134234|2|1|2052114-2052325|PILER-CR
CGGTTTATCCCCGCTGGCGCGGGGAACAC	TGAAGCATCAAACATTTGGTGGACCAAACGGA
CGGTTTATCCCCGCTGGCGCGGGGAACAC	TGTACGCGGCGAGTTTTAGCGACAGGTCATCC
CGGTTTATCCCCGCTGGCGCGGGGAACAC	GGATCTGCCAGCGCCTCTGCGGGGCGGTAAAC
CGGTTTATCCCCGCTGGCGCGGGGAACAC

Protein	Signature genes	Signature genes Name	Protein_function
LR134234.1\|VED18078.1\|2052421_2052715_-\|CRISPR-associated-protein	cas2	cd09648_cas2_CAS-I-E	gnl\|CDD\|236930
LR134234.1\|VED18060.1\|2044607_2045657_-\|tRNA-pseudouridine-synthase-D	unknown	unknown	gnl\|CDD\|234884
LR134234.1\|VED18096.1\|2062399_2064112_-\|sulfite-reductase-(NADPH)-hemoprotein-beta-subunit	unknown	unknown	gnl\|CDD\|237402
LR134234.1\|VED18068.1\|2047366_2047690_-\|putative-cytochrome-oxidase-subunit	unknown	unknown	gnl\|CDD\|371891
LR134234.1\|VED18064.1\|2046132_2046843_-\|2-C-methyl-D-erythritol-4-phosphate-cytidylyltransferase	unknown	unknown	gnl\|CDD\|234670
LR134234.1\|VED18072.1\|2048344_2049772_-\|sulfate-adenylyltransferase	unknown	unknown	gnl\|CDD\|235349
LR134234.1\|VED18070.1\|2047739_2048345_-\|adenosine-5-phosphosulfate-kinase	unknown	unknown	gnl\|CDD\|179661
LR134234.1\|VED18090.1\|2056620_2058183_-\|CRISPR-associated-protein	cas8e	cd09669_cas8e_CAS-I-E	gnl\|CDD\|274192
LR134234.1\|VED18088.1\|2056087_2056624_-\|CRISPR-associated-Cse2-family-protein	cse2gr11	cd09670_cse2gr11_CAS-I-E	gnl\|CDD\|274193
LR134234.1\|VED18084.1\|2054263_2055010_-\|CRISPR-associated-protein	cas5	cd09645_cas5_CAS-I-E	gnl\|CDD\|187776
LR134234.1\|VED18094.1\|2061591_2062326_-\|phosphoadenosine-phosphosulfate-reductase	unknown	unknown	gnl\|CDD\|234997
LR134234.1\|VED18086.1\|2055020_2056076_-\|CRISPR-associated-protein	cas7	cd09646_cas7_CAS-I-E	gnl\|CDD\|273843
LR134234.1\|VED18080.1\|2052711_2053635_-\|CRISPR-associated-protein	cas1	cd09719_cas1_CAS-I-E	gnl\|CDD\|274693
LR134234.1\|VED18062.1\|2045653_2046133_-\|2-C-methyl-D-erythritol-2,4-cyclodiphosphate-synthase	unknown	unknown	gnl\|CDD\|178851
LR134234.1\|VED18058.1\|2043865_2044627_-\|stationary-phase-survival-protein-SurE	unknown	unknown	gnl\|CDD\|234732
LR134234.1\|VED18074.1\|2049773_2050682_-\|sulfate-adenylyltransferase	unknown	unknown	gnl\|CDD\|235375
LR134234.1\|VED18066.1\|2046861_2047173_-\|cell-division-protein	unknown	unknown	gnl\|CDD\|179156
LR134234.1\|VED18092.1\|2058280_2060980_-\|CRISPR-associated-helicase-Cas3	cas3	COG1203_cas3_CAS-I	gnl\|CDD\|224124
LR134234.1\|VED18076.1\|2050933_2051971_+\|alkaline-phosphatase-isozyme-conversion-protein	unknown	unknown	gnl\|CDD\|182299
LR134234.1\|VED18082.1\|2053631_2054282_-\|CRISPR-associated-protein	cas6e	cd09664_cas6e_CAS-I-E	gnl\|CDD\|273869

Protein	Function_ID	Function_description	E-value
LR134234.1\|VED18078.1\|2052421_2052715_-\|CRISPR-associated-protein	gnl\|CDD\|236930	PRK11558, PRK11558, putative ssRNA endonuclease; Provisional.	2.35543e-65
LR134234.1\|VED18060.1\|2044607_2045657_-\|tRNA-pseudouridine-synthase-D	gnl\|CDD\|234884	PRK00984, truD, tRNA pseudouridine synthase D; Reviewed.	0
LR134234.1\|VED18096.1\|2062399_2064112_-\|sulfite-reductase-(NADPH)-hemoprotein-beta-subunit	gnl\|CDD\|237402	PRK13504, PRK13504, NADPH-dependent assimilatory sulfite reductase hemoprotein subunit.	0
LR134234.1\|VED18068.1\|2047366_2047690_-\|putative-cytochrome-oxidase-subunit	gnl\|CDD\|371891	pfam12084, DUF3561, Protein of unknown function (DUF3561). This family of proteins is functionally uncharacterized. This protein is found in bacteria. Proteins in this family are about 110 amino acids in length.	1.22003e-52
LR134234.1\|VED18064.1\|2046132_2046843_-\|2-C-methyl-D-erythritol-4-phosphate-cytidylyltransferase	gnl\|CDD\|234670	PRK00155, ispD, D-ribitol-5-phosphate cytidylyltransferase.	3.26939e-121
LR134234.1\|VED18072.1\|2048344_2049772_-\|sulfate-adenylyltransferase	gnl\|CDD\|235349	PRK05124, cysN, sulfate adenylyltransferase subunit 1; Provisional.	0
LR134234.1\|VED18070.1\|2047739_2048345_-\|adenosine-5-phosphosulfate-kinase	gnl\|CDD\|179661	PRK03846, PRK03846, adenylylsulfate kinase; Provisional.	7.34447e-148
LR134234.1\|VED18090.1\|2056620_2058183_-\|CRISPR-associated-protein	gnl\|CDD\|274192	TIGR02547, CRISPR_system_Cascade_subunit_CasA, CRISPR type I-E/ECOLI-associated protein CasA/Cse1. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This model family, represented by CT1972 from Chlorobium tepidum, is found in Ecoli subtype CRISPR/Cas regions of many bacteria, most of which are mesophiles, and not in Archaea. It is designated Cse1.	0
LR134234.1\|VED18088.1\|2056087_2056624_-\|CRISPR-associated-Cse2-family-protein	gnl\|CDD\|274193	TIGR02548, CRISPR_system_Cascade_subunit_CasB, CRISPR type I-E/ECOLI-associated protein CasB/Cse2. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This model family is found in Ecoli subtype CRISPR/Cas regions of many bacteria, most of which are mesophiles, and not in Archaea. It was designated Cse2 originally, and renamed CasB based on its characterization in the CASCADE complex.	1.12087e-29
LR134234.1\|VED18084.1\|2054263_2055010_-\|CRISPR-associated-protein	gnl\|CDD\|187776	cd09645, Cas5_I-E, CRISPR/Cas system-associated RAMP superfamily protein Cas5. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas5 is a RAMP superfamily protein; Subunit of the Cascade complex.	5.83917e-49
LR134234.1\|VED18094.1\|2061591_2062326_-\|phosphoadenosine-phosphosulfate-reductase	gnl\|CDD\|234997	PRK02090, PRK02090, phosphoadenylyl-sulfate reductase.	7.99311e-138
LR134234.1\|VED18086.1\|2055020_2056076_-\|CRISPR-associated-protein	gnl\|CDD\|273843	TIGR01869, CRISPR_system_Cascade_subunit_CasC, CRISPR-associated protein Cas7/Cse4/CasC, subtype I-E/ECOLI. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family is represented by CT1975 of Chlorobium tepidum and is part of the Ecoli subtype of CRISPR/Cas locis. It is designated Cse4, for CRISPR/Cas Subtype Ecoli protein 4.	5.21697e-155
LR134234.1\|VED18080.1\|2052711_2053635_-\|CRISPR-associated-protein	gnl\|CDD\|274693	TIGR03638, cas1_ECOLI, CRISPR-associated endonuclease Cas1, subtype I-E/ECOLI. The CRISPR-associated protein Cas1 is virtually universal to CRISPR systems. CRISPR, an acronym for Clustered Regularly Interspaced Short Palindromic Repeats, is prokaryotic immunity system for foreign DNA, mostly from phage. CRISPR systems belong to different subtypes, distinguished by both nature of the repeats, the makeup of the cohort of associated Cas proteins, and by molecular phylogeny within the more universal Cas proteins such as this one. This model is of type EXCEPTION and provides more specific information than the EQUIVALOG model TIGR00287. It describes the Cas1 protein particular to the ECOLI subtype of CRISPR/Cas system.	6.67486e-158
LR134234.1\|VED18062.1\|2045653_2046133_-\|2-C-methyl-D-erythritol-2,4-cyclodiphosphate-synthase	gnl\|CDD\|178851	PRK00084, ispF, 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase; Reviewed.	5.43405e-104
LR134234.1\|VED18058.1\|2043865_2044627_-\|stationary-phase-survival-protein-SurE	gnl\|CDD\|234732	PRK00346, surE, 5'(3')-nucleotidase/polyphosphatase; Provisional.	1.92279e-150
LR134234.1\|VED18074.1\|2049773_2050682_-\|sulfate-adenylyltransferase	gnl\|CDD\|235375	PRK05253, PRK05253, sulfate adenylyltransferase subunit CysD.	0
LR134234.1\|VED18066.1\|2046861_2047173_-\|cell-division-protein	gnl\|CDD\|179156	PRK00888, ftsB, cell division protein FtsB; Reviewed.	5.55235e-62
LR134234.1\|VED18092.1\|2058280_2060980_-\|CRISPR-associated-helicase-Cas3	gnl\|CDD\|224124	COG1203, COG1203, CRISPR-associated helicase Cas3 [Defense mechanisms].	2.73118e-178
LR134234.1\|VED18076.1\|2050933_2051971_+\|alkaline-phosphatase-isozyme-conversion-protein	gnl\|CDD\|182299	PRK10199, PRK10199, alkaline phosphatase isozyme conversion aminopeptidase; Provisional.	0
LR134234.1\|VED18082.1\|2053631_2054282_-\|CRISPR-associated-protein	gnl\|CDD\|273869	TIGR01907, CRISPR_system_Cascade_subunit_CasE, CRISPR-associated protein Cas6/Cse3/CasE, subtype I-E/ECOLI. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This model family, represented by CT1974 from Chlorobium tepidum, is found in the Ecoli subtype of CRISPR/Cas regions and is designated Cse3 (CRISPR/Cas Subtype Ecoli protein 3). The representative of this family from Thermus thermophilus HB8 (TTHB192) has been crystallized and found to have a structure consisting of two domains with opposing parallel beta-sheets known as a beta-sheet platform. This structure is similar to those found in the Sex-lethal protein and poly(A)-binding protein. This structure is consistent with an RNA-binding function.	1.0289e-91

>LR134234.1|VED18076.1|2050933_2051971_+|alkaline-phosphatase-isozyme-conversion-protein
MFSALRHRTAALALGVCFILPVHASSPKPGDFANTQARHIATFFPGRMTGTPAEMLSADYIRQQFQQMGYRSDIRTFNSRYIYTARDNRKNWHNVTGSTVIAAHEGKAPQQIIIMAHLDTYAPLSDADADANLGGLTLQGMDDNAAGLGVMLELAERLKNTPTEYGIRFVATSGEEEGKLGAENLLKRMSDTEKKNTLLVINLDNLIVGDKLYFNSGVKTPEAVRKLTRDRALAIARSHGIAATTNPGLNKNYPKGTGCCNDAEIFDKAGIAVLSVEATNWNLGNKDGYQQRAKTAAFPAGNSWHDVRLDNQQHIDKALPGRIERRCRDVMRIMLPLVKELAKAS
>LR134234.1|VED18074.1|2049773_2050682_-|sulfate-adenylyltransferase
MDQIRLTHLRQLEAESIHIIREVAAEFSNPVMLYSIGKDSSVMLHLARKAFYPGTLPFPLLHVDTGWKFREMYEFRDRTAKAYGCELLVHKNLEGVAMGINPFVHGSAKHTDIMKTEGLKQALNKYGFDAAFGGARRDEEKSRAKERIYSFRDRFHRWDPKNQRPELWHNYNGQINKGESIRVFPLSNWTEQDIWQYIWLENIDIVPLYLAAERPVLERDGMLMMIDDNRIDLQPGEVIKKRMVRFRTLGCWPLTGAVESNAQTLPEIIEEMLVSTTSERQGRVIDRDQAGSMELKKRQGYF
>LR134234.1|VED18072.1|2048344_2049772_-|sulfate-adenylyltransferase
MNTALAQQIANEGGVEAWMIAQQHKSLLRFLTCGSVDDGKSTLIGRLLHDTRQIYEDQLSSLHNDSKRHGTQGEKLDLALLVDGLQAEREQGITIDVAYRYFSTEKRKFIIADTPGHEQYTRNMATGASTCELAILLIDARKGVLDQTRRHSFISTLLGIKHLVVAINKMDLVDYSEETFTRIREDYLTFAEQLPGNLDIRFVPLSALEGDNVASQSESMPWYSGPTLLEVLETVEIQRVVDAQPMRFPVQYVNRPNLDFRGYAGTLASGRVEVGQRVKVLPSGVESNVARIVTFDGDREEAFAGEAITLVLTDEIDISRGDLLLAADEALPAVQSASVDVVWMAEQPLSPGQSYDIKIAGKKTRARIDGIRYQVDINNLTQREVENLPLNGIGLVDLTFDEPLVLDRYQQNPVTGGLIFIDRLSNVTVGAGMVHEPKNEAAVASSEFSAFELELNALVRRHFPHWGARDLLGDK
>LR134234.1|VED18070.1|2047739_2048345_-|adenosine-5-phosphosulfate-kinase
MALHDENVVWHSHPVTVQQRELHHGHRGVVLWFTGLSGSGKSTVAGALEEALHKLGVSTYLLDGDNVRHGLCSDLGFSDADRKENIRRVGEVANLMVEAGLVVLTAFISPHRAERQMVRERVGEGRFIEVFVDTPLAICEARDPKGLYKKARAGELRNFTGIDSVYEAPESAEIHLNGEQLVTNLVQQLLDLLRQNDIIRS
>LR134234.1|VED18068.1|2047366_2047690_-|putative-cytochrome-oxidase-subunit
MRNSHNITLTNNDSLTEDEETTWSLPGAVVGFISWLFALAMPMLIYGSNTLFFFIYTWPFFLALMPVAVVVGIALHSLMDGKLRYSIVFTLVTVGIMFGALFMWLLG
>LR134234.1|VED18066.1|2046861_2047173_-|cell-division-protein
MGKLTLLLLAILVWLQYSLWFGKNGIHDYTRVNDDVAAQQATNAKLKARNDQLFAEIDDLNGGQEALEERARNELSMTRPGETFYRLVPDASKRAQSAGQNNR
>LR134234.1|VED18064.1|2046132_2046843_-|2-C-methyl-D-erythritol-4-phosphate-cytidylyltransferase
MATTHLDVCAVVPAAGFGRRMQTECPKQYLSIGNQTILEHSVHALLAHPRVKRVVIAISPGDSRFAQLPLANHPQITVVDGGDERADSVLAGLKAAGDAQWVLVHDAARPCLHQDDLARLLALSETSRTGGILAAPVRDTMKRAEPGKNAIAHTVDRNGLWHALTPQFFPRELLHDCLTRALNEGATITDEASALEYCGFHPQLVEGRADNIKVTRPEDLALAEFYLTRTIHQENT
>LR134234.1|VED18062.1|2045653_2046133_-|2-C-methyl-D-erythritol-2,4-cyclodiphosphate-synthase
MRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVTLHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIKATK
>LR134234.1|VED18060.1|2044607_2045657_-|tRNA-pseudouridine-synthase-D
MIEFDNLTYLHGKPQGTGLLKANPEDFVVVEDLGFEPDGEGEHILVRILKNGCNTRFVADALAKFLKIHAREVSFAGQKDKHAVTEQWLCARVPGKEMPDLSAFQLEGCQVLEYARHKRKLRLGALKGNAFTLVLREVSNRDDVEQRLIDICVKGVPNYFGAQRFGIGGSNLQGAQRWAQTNTPVRDRNKRSFWLSAARSALFNQIVAERLKKADVNQVVDGDALQLAGRGSWFVATTEELAELQRRVNDKELMITAALPGSGEWGTQREALAFEQAAVAAETELQALLVREKVEAARRAMLLYPQQLSWNWWDDVTVEIRFWLPAGSFATSVVRELINTTGDYAHIAE
>LR134234.1|VED18058.1|2043865_2044627_-|stationary-phase-survival-protein-SurE
MRILLSNDDGVHAPGIQTLAKALREFADVQVVAPDRNRSGASNSLTLESSLRTFTFENGDIAVQMGTPTDCVYLGVNALMRPRPDIVVSGINAGPNLGDDVIYSGTVAAAMEGRHLGFPALAVSLDGHKHYDTAAAVTCSILRALCKEPLRTGRILNINVPDLPLDQIKGIRVTRCGTRHPADQVIPQQDPRGNTLYWIGPPGGKCDAGPGTDFAAVDEGYVSITPLHVDLTAHSAQDVVSDWLNSVGVGTQW
>LR134234.1|VED18078.1|2052421_2052715_-|CRISPR-associated-protein
MSMVVVVTENVPPRLRGRLAIWLLEVRAGVYVGDTSKRIREMIWQQITQLAGCGNVVMAWATNTESGFEFQTWGENRRIPVDLDGLRLVSFLPVDNQ
>LR134234.1|VED18080.1|2052711_2053635_-|CRISPR-associated-protein
MTFVPLSPIPLKDRTSMIFLQYGQIDVLDGAFVLIDKTGIRTHIPVGSVACIMLEPGTRVSHAAVHLAATVGTLLVWVGEAGVRVYSSGQPGGARADKLLYQAKLALTEDLRLKVVRKMYELRFREPPPARRSVEQLRGIEGSRVRQTYALLAKQYGVKWNGRKYDPKDWEKGDVVNRCISAATSCLYGISEAAVLAAGYAPAIGFIHSGKPLSFVYDIADIIKFDSVVPKAFEIAARQPAEPDKEVRLACRDIFRSTKLTGKLIPLIEEVLAAGEIEPPQPAPDMLPPAIPEPETLGDSGHRGRGG
>LR134234.1|VED18082.1|2053631_2054282_-|CRISPR-associated-protein
MYLSRITLHTGQLSPAQLLHLVDRGEYVMHQWLWDLFPGGKERQFLYRREELQGAFRFFVLSQERPAESDTFTIECRSFAPELRTGQQLCFNLRANPTICKSGKRHDLLMEAKRQVRGQAEGSDVWLHQQQAALDWLAAQGERSGFTLLDTSVDAYRQQQLRRENSRQLIQFSSVDYTGMLTVTDPGLFLQRLSQGYGKSRAFGCGLMLIKPGAEA
>LR134234.1|VED18084.1|2054263_2055010_-|CRISPR-associated-protein
MSQYLIFQLHGPMASWGVDAPGEVRHTHELPSRSALLGLLAAGVGIRRDDTERLNAFNRHYSLVVCASRNPRWARDYHTIQMPKEVRKARYFSRREELSDPDLLSAIISRRDYYTDAWWMVAVATTADAPYSLEQLQDGLRHPVFPLYLGRKSHPLALPLAPLLLEGNACDALCNAYQQYQDHFHKLKVSLPKLQDECWWEGEHDGLVASKILRRRDVPLNRQQWLFGERTINQGPWLSKEEPCTSQE
>LR134234.1|VED18086.1|2055020_2056076_-|CRISPR-associated-protein
MTTFIQLHLLTAYPAANLNRDDTGAPKTVVLGGATRLRVSSQSLKRAWRTSALFEQALAGHIGIRSGRIAREAATILIEKGIEEKKAIEWAAKIADYLGKAKNDKKPKDPLTNAETEQLVHISPAEFDAVKALAHQLAEEKRAPKEEDLALLRKDRMAVDIAMFGRMLANKPEFNVEAACQVAHAFGVSETIVEDDFFTAVDDLRQASEDAGAGHLGETGFGSALFYTYICIDKDLLVENLGGDEALANQTIRAFTEAALKVSPTGKQNSFASRAYASWAMAEKGTEQPRSLAAAFYEPINGTRQLEVAVQRITTLRENMNTVYEQKTECASFDVMNKQGSMKDVLDFICA
>LR134234.1|VED18088.1|2056087_2056624_-|CRISPR-associated-Cse2-family-protein
MSIVKEEHKATLRKWHEELQEKRGERASLRRSTTVNDVCLTDGFRLFLKNRQIKWQDEPEWRITALALIAAVSANVKAIDERQPFAAQLAAVMSKGRFTRLSAVKTPDELLRQLRRAVRLLNGSVNLDSLAEGVFRWCQESDDLLNHHRRQQRPTEFIRIRWALEYYQAGDADNEQNQ
>LR134234.1|VED18090.1|2056620_2058183_-|CRISPR-associated-protein
MNSFSLLTTPWLPVRFKDGTTGKLAPVDLADENVVDIAAPRADLQGAAWQFLLGLLQTSFAPKDHRRWDDIWEDGLEVEKLREALLSLEHAFQFGPDSPSFMQDFEALTGDKVQVASLLPEIPGAQTTKFNKDHFIKRGVTEYLCPHCSALALFSLQLNAPSGGKGYRTGLRGGGPMTTLIELQEYQGNQQTPLWRKMWLNVMPQDEADLPLPKKFDDLVFPWLGPTRTSELAGAVVTDDQVNKLQAYWGMPRRIRIDFNTTTVGNCDICGEQNDALLSLMTTKNYGANYAMWQHPLTPYRVPLKEGGEFYSVKPQPGGLIWRDWLGLIETGKSENNTELPALVVKLFNASSLKQAKVGLWGFGYDFDNMKARCWYEHHFPLLLNKKEGQIPKLRLAAQTASRILSLLRSALKEAWFSDPKGARGDFSFVDIDFWNKTQHRFLRFVRQIEEGQDADELLSKWNKEIWLFARQDFDERVFTNPYEPVNLERIMTARKKYFTTSAEKQSAKAAREKKQEAAE
>LR134234.1|VED18092.1|2058280_2060980_-|CRISPR-associated-helicase-Cas3
MRKYPLSLLKDKNIVTFFDFWGKTRRGEKDGGDDYHLLCWHSLDVAAMGYLMVKRNCFGLADYFRQLGISDKEQAAQFFAWLLCWHDIGKFARSFQQLYLPPELKIQEGARKNYEKISHSTLGYWLWNHYLSECQELLPSSSLSPRKLRRVIEMWMPVTTGHHGRPPDRMDELDNFLPEDKAAARDFLLEIKPLFPLIEIPAFWDDDEGIELIKHLSWYISATVVLADWTGSSTRFFPRVAHPMDIKGYWQKTLIQAQNALTVFPLKAKVAPFNGINTLFPFIENPTPLQQKVLDLDISQQGPQLFILEDVTGAGKTEAALILAHRLIAAGKAQGLFFGLPTMATANAMYDRLVKTWLAFYSPESRPSLVLAHSARTLMDRFNESLWSGDLVGSEEPDEQTFSQGCAAWFADSNKKALLAEIGVGTLDQAMMAVMPFKHNNLRLLGLSNKILLADEIHACDAYMSCILEGLIERQARGGNSVILLSATLSQQQRDKLVAAFARGTEGLQEAPFLEKDDYPWLTHVTKSDVNSHRVATRKDVERSVSVGWLHSEQECIARIESAVSQGKCIAWIRNSVDDAIKVHRQLLARGVIPASSLSLFHSRFAFSDRQRIETETLARFGKYCSLQRASQVIVCTQVIEQSVDIDLDEMISDLAPVDLLIQRAGRLQRHIRDINGQLKRDGKDERSPPELLILAPVWDDSPGDEWFGSAMRNSAFVYPDHGRIWLTQRVLREQGAIQMPHSARLLIESVYGEDVVMPEGFARSEQEQVGKYYCDRARAKKFVLNFRPGYAANINDYLPEKLSTRLAEESVSLWLATCIDGVVKPYATGAHAWEMSVVRVRRSWWKKHRDEFSLLEGDAFRQWCIEQRQDPEMANVILVTDDESCGYSAMEGLTGKVG
>LR134234.1|VED18094.1|2061591_2062326_-|phosphoadenosine-phosphosulfate-reductase
MSKLDLNALNELPKVDRILALAETNAELEKLDAEGRVAWALDNLPGEYVLSSSFGIQAAVSLHLVNQIHPDIPVILTDTGYLFPETYRFIDELTDKLKLNLKVYRATESAAWQEARYGKLWEQGVEGIEKYNDINKVEPMNRALKELNAQTWFAGLRREQSGSRANLPVLAIQRGVFKVLPIIDWDNRTIYQYLQKHGLKYHPLWDEGYLSVGDTHTTRKWEPGMSEEETRFFGLKRECGLHEG
>LR134234.1|VED18096.1|2062399_2064112_-|sulfite-reductase-(NADPH)-hemoprotein-beta-subunit
MSEKHPGPLVVEGKLTDAERMKLESNYLRGTIAEDLNDGLTGGFKGDNFLLIRFHGMYQQDDRDIRAERAEQKLEPRHAMLLRCRLPGGVITTKQWQAIDKFAGENTIYGSIRLTNRQTFQFHGILKKNVKPVHQMLHSVGLDALATANDMNRNVLCTSNPYESQLHAEAYEWAKKISEHLLPRTRAYAEIWLDQEKVATTDEEPILGQTYLPRKFKTTVVIPPQNDIDLHANDMNFVAIAENGKLVGFNLLVGGGLSIEHGNKKTYARTASEFGYLPLEHTLAVAEAVVTTQRDWGNRTDRKNAKTKYTLERVGVETFKAEVERRAGIKFEPIRPYEFTGRGDRIGWVKGIDDNWHLTLFIENGRILDYPGRPLKTGLLEIAKIHKGDFRITANQNLIIAGVPESEKAKIEKIAKESGLMNAVTPQRENSMACVSFPTCPLAMAEAERFLPSFIDNIDNLMAKHGVSDEHIVMRVTGCPNGCGRAMLAEVGLVGKAPGRYNLHLGGNRIGTRIPRMYKENITEPEILASLDELIGRWAKEREAGEGFGDFTVRAGIIRPVLDPARDLWD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: LR134234_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

LR134234_3

2078026-2078969

Unclear

I-E

Consensus_repeat	Method
CGGTTTATCCCCGCTGGCGCGGGGAACTC	CRISPRCasFinder
CGGTTTATCCCCGCTGGCGCGGGGAACTC	CRT
CGGTTTATCCCCGCTGGCGCGGGGAACTC	PILER-CR

15 spacers

The CRISPR arrays of LR134234_3

>merge|LR134234|3|2078026-2078969|CRISPRCasFinder,CRT,PILER-CR
TGGTTTATCCCCGCTGGCGCGGGGAACTCGCCTGACATTGCAGACGTTACAAATTGAGAGGCGGTTTATCCCCGCTGGCGCGGGGAACTCTAATCACGTTTTAGCGCGCCCTCGTCCGGTTTCGGTTTATCCCCGCTGGCGCGGGGAACTCATCACGATAACGCTGCTGTGATTCGTCCCCGTCGGTTTATCCCCGCTGGCGCGGGGAACTCAAGACGACGTGATCCGCAAAGTCGAAGGCACGCGGTTTATCCCCGCTGGCGCGGGGAACTCTGTTTCTGTCCCAACTGAACAGCGCCGATAGTCGGTTTATCCCCGCTGGCGCGGGGAACTCGAATGATCCCAAATTTGGGTTACAGAACCAGTCGGTTTATCCCCGCTGGCGCGGGGAACTCTACCGGTGTGAATTACAGCACCACCGCCACCCCGGTTTATCCCCGCTGGCGCGGGGAACTCCAAACAGGTCGACATGTTTGGCTAACAGCTAACGGTTTATCCCCGCTGGCGCGGGGAACTCCGATAACACAGGGCCGTCAATGCGGCCCTTTTCGGTTTATCCCCGCTGGCGCGGGGAACTCTTTTACCGTAACGCAGCACAAGACACGCTCCGCGGTTTATCCCCGCTGGCGCGGGGAACTCCCCAGATGACAGCTTGCCTAAAACGAAAGCAGCGGTTTATCCCCGCTGGCGCGGGGAACTCTGCTTTCCTACGACAAATCTGGCGATGTTGCGCGGTTTATCCCCGCTGGCGCGGGGAACTCCTCAAGATAGAGCCTCCGGGTCGAGCCGCGATCGGTTTATCCCCGCTGGCGCGGGGAACTCTTGAACTGTTGATGTTATCAAAATATCAGCTCCGGTTTATCCCCGCTGGCGCGGGGAACTCGCGGAAAACAGCCAAAATAACGCAATTACCGCCGGTTTATCCCCGCTGGCGCGGGGAACTC

>LR134234|3|3|2078026-2078969|CRISPRCasFinder
TGGTTTATCCCCGCTGGCGCGGGGAACTC	GCCTGACATTGCAGACGTTACAAATTGAGAGG
CGGTTTATCCCCGCTGGCGCGGGGAACTC	TAATCACGTTTTAGCGCGCCCTCGTCCGGTTT
CGGTTTATCCCCGCTGGCGCGGGGAACTC	ATCACGATAACGCTGCTGTGATTCGTCCCCGT
CGGTTTATCCCCGCTGGCGCGGGGAACTC	AAGACGACGTGATCCGCAAAGTCGAAGGCACG
CGGTTTATCCCCGCTGGCGCGGGGAACTC	TGTTTCTGTCCCAACTGAACAGCGCCGATAGT
CGGTTTATCCCCGCTGGCGCGGGGAACTC	GAATGATCCCAAATTTGGGTTACAGAACCAGT
CGGTTTATCCCCGCTGGCGCGGGGAACTC	TACCGGTGTGAATTACAGCACCACCGCCACCC
CGGTTTATCCCCGCTGGCGCGGGGAACTC	CAAACAGGTCGACATGTTTGGCTAACAGCTAA
CGGTTTATCCCCGCTGGCGCGGGGAACTC	CGATAACACAGGGCCGTCAATGCGGCCCTTTT
CGGTTTATCCCCGCTGGCGCGGGGAACTC	TTTTACCGTAACGCAGCACAAGACACGCTCCG
CGGTTTATCCCCGCTGGCGCGGGGAACTC	CCCAGATGACAGCTTGCCTAAAACGAAAGCAG
CGGTTTATCCCCGCTGGCGCGGGGAACTC	TGCTTTCCTACGACAAATCTGGCGATGTTGCG
CGGTTTATCCCCGCTGGCGCGGGGAACTC	CTCAAGATAGAGCCTCCGGGTCGAGCCGCGAT
CGGTTTATCCCCGCTGGCGCGGGGAACTC	TTGAACTGTTGATGTTATCAAAATATCAGCTC
CGGTTTATCCCCGCTGGCGCGGGGAACTC	GCGGAAAACAGCCAAAATAACGCAATTACCGC
CGGTTTATCCCCGCTGGCGCGGGGAACTC

>LR134234|3|2|2078026-2078969|CRT
TGGTTTATCCCCGCTGGCGCGGGGAACTC	GCCTGACATTGCAGACGTTACAAATTGAGAGG
CGGTTTATCCCCGCTGGCGCGGGGAACTC	TAATCACGTTTTAGCGCGCCCTCGTCCGGTTT
CGGTTTATCCCCGCTGGCGCGGGGAACTC	ATCACGATAACGCTGCTGTGATTCGTCCCCGT
CGGTTTATCCCCGCTGGCGCGGGGAACTC	AAGACGACGTGATCCGCAAAGTCGAAGGCACG
CGGTTTATCCCCGCTGGCGCGGGGAACTC	TGTTTCTGTCCCAACTGAACAGCGCCGATAGT
CGGTTTATCCCCGCTGGCGCGGGGAACTC	GAATGATCCCAAATTTGGGTTACAGAACCAGT
CGGTTTATCCCCGCTGGCGCGGGGAACTC	TACCGGTGTGAATTACAGCACCACCGCCACCC
CGGTTTATCCCCGCTGGCGCGGGGAACTC	CAAACAGGTCGACATGTTTGGCTAACAGCTAA
CGGTTTATCCCCGCTGGCGCGGGGAACTC	CGATAACACAGGGCCGTCAATGCGGCCCTTTT
CGGTTTATCCCCGCTGGCGCGGGGAACTC	TTTTACCGTAACGCAGCACAAGACACGCTCCG
CGGTTTATCCCCGCTGGCGCGGGGAACTC	CCCAGATGACAGCTTGCCTAAAACGAAAGCAG
CGGTTTATCCCCGCTGGCGCGGGGAACTC	TGCTTTCCTACGACAAATCTGGCGATGTTGCG
CGGTTTATCCCCGCTGGCGCGGGGAACTC	CTCAAGATAGAGCCTCCGGGTCGAGCCGCGAT
CGGTTTATCCCCGCTGGCGCGGGGAACTC	TTGAACTGTTGATGTTATCAAAATATCAGCTC
CGGTTTATCCCCGCTGGCGCGGGGAACTC	GCGGAAAACAGCCAAAATAACGCAATTACCGC
CGGTTTATCCCCGCTGGCGCGGGGAACTC

>LR134234|3|2|2078027-2078969|PILER-CR
GGTTTATCCCCGCTGGCGCGGGGAACTCG	CCTGACATTGCAGACGTTACAAATTGAGAGGC
GGTTTATCCCCGCTGGCGCGGGGAACTCT	AATCACGTTTTAGCGCGCCCTCGTCCGGTTTC
GGTTTATCCCCGCTGGCGCGGGGAACTCA	TCACGATAACGCTGCTGTGATTCGTCCCCGTC
GGTTTATCCCCGCTGGCGCGGGGAACTCA	AGACGACGTGATCCGCAAAGTCGAAGGCACGC
GGTTTATCCCCGCTGGCGCGGGGAACTCT	GTTTCTGTCCCAACTGAACAGCGCCGATAGTC
GGTTTATCCCCGCTGGCGCGGGGAACTCG	AATGATCCCAAATTTGGGTTACAGAACCAGTC
GGTTTATCCCCGCTGGCGCGGGGAACTCT	ACCGGTGTGAATTACAGCACCACCGCCACCCC
GGTTTATCCCCGCTGGCGCGGGGAACTCC	AAACAGGTCGACATGTTTGGCTAACAGCTAAC
GGTTTATCCCCGCTGGCGCGGGGAACTCC	GATAACACAGGGCCGTCAATGCGGCCCTTTTC
GGTTTATCCCCGCTGGCGCGGGGAACTCT	TTTACCGTAACGCAGCACAAGACACGCTCCGC
GGTTTATCCCCGCTGGCGCGGGGAACTCC	CCAGATGACAGCTTGCCTAAAACGAAAGCAGC
GGTTTATCCCCGCTGGCGCGGGGAACTCT	GCTTTCCTACGACAAATCTGGCGATGTTGCGC
GGTTTATCCCCGCTGGCGCGGGGAACTCC	TCAAGATAGAGCCTCCGGGTCGAGCCGCGATC
GGTTTATCCCCGCTGGCGCGGGGAACTCT	TGAACTGTTGATGTTATCAAAATATCAGCTCC
GGTTTATCCCCGCTGGCGCGGGGAACTCG	CGGAAAACAGCCAAAATAACGCAATTACCGCC
GGTTTATCCCCGCTGGCGCGGGGAACTC

Protein	Signature genes	Signature genes Name	Protein_function
LR134234.1\|VED18106.1\|2068208_2068784_+\|glycerol-antiterminator-regulatory-protein	unknown	unknown	gnl\|CDD\|224865
LR134234.1\|VED18130.1\|2081204_2082503_-\|enolase	unknown	unknown	gnl\|CDD\|234617
LR134234.1\|VED18140.1\|2085978_2088213_-\|GTP-pyrophosphokinase	unknown	unknown	gnl\|CDD\|182797
LR134234.1\|VED18134.1\|2084455_2085247_-\|nucleoside-triphosphate-pyrophosphohydrolase	unknown	unknown	gnl\|CDD\|236569
LR134234.1\|VED18120.1\|2075908_2077387_+\|putative-sugar-kinase	unknown	unknown	gnl\|CDD\|212662
LR134234.1\|VED18126.1\|2080118_2080259_+\|small-protein-involved-in-the-cell-envelope-stress-response	unknown	unknown	unknown
LR134234.1\|VED18116.1\|2073500_2074286_-\|putative-short-chain-dehydrogenase	unknown	unknown	gnl\|CDD\|187605
LR134234.1\|VED18136.1\|2085317_2085653_-\|toxin-ChpA	unknown	unknown	gnl\|CDD\|182138
LR134234.1\|VED18110.1\|2069788_2070568_-\|electron-transfer-flavoprotein-subunit-YgcR	unknown	unknown	gnl\|CDD\|224997
LR134234.1\|VED18124.1\|2079308_2079980_-\|7-carboxy-7-deazaguanine-synthase;-queosine-biosynthesis	unknown	unknown	gnl\|CDD\|275126
LR134234.1\|VED18112.1\|2070545_2071955_-\|major-facilitator-superfamily-protein	unknown	unknown	gnl\|CDD\|340929
LR134234.1\|VED18104.1\|2067931_2068192_+\|ferredoxin-like-protein-YgcO	unknown	unknown	gnl\|CDD\|225289
LR134234.1\|VED18114.1\|2071976_2073431_-\|putative-FAD-binding-oxidoreductase	unknown	unknown	gnl\|CDD\|223354
LR134234.1\|VED18118.1\|2074604_2075882_+\|major-facilitator-superfamily-protein	unknown	unknown	gnl\|CDD\|349949
LR134234.1\|VED18138.1\|2085652_2085901_-\|antitoxin-MazE	unknown	unknown	gnl\|CDD\|182082
LR134234.1\|VED18102.1\|2066669_2067941_+\|putative-FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|182194
LR134234.1\|VED18128.1\|2080440_2081145_+\|protein	unknown	unknown	gnl\|CDD\|224429
LR134234.1\|VED18108.1\|2068931_2069792_-\|electron-transfer-flavoprotein-subunit-YgcQ	unknown	unknown	gnl\|CDD\|224936
LR134234.1\|VED18132.1\|2082590_2084228_-\|CTP-synthetase	unknown	unknown	gnl\|CDD\|235437
LR134234.1\|VED18142.1\|2088260_2089562_-\|23s-rRNA-(uracil-5-)-methyltransferase	unknown	unknown	gnl\|CDD\|237291

Protein	Function_ID	Function_description	E-value
LR134234.1\|VED18106.1\|2068208_2068784_+\|glycerol-antiterminator-regulatory-protein	gnl\|CDD\|224865	COG1954, GlpP, Glycerol-3-phosphate responsive antiterminator (mRNA-binding) [Transcription].	5.83077e-88
LR134234.1\|VED18130.1\|2081204_2082503_-\|enolase	gnl\|CDD\|234617	PRK00077, eno, enolase; Provisional.	0
LR134234.1\|VED18140.1\|2085978_2088213_-\|GTP-pyrophosphokinase	gnl\|CDD\|182797	PRK10872, relA, (p)ppGpp synthetase I/GTP pyrophosphokinase; Provisional.	0
LR134234.1\|VED18134.1\|2084455_2085247_-\|nucleoside-triphosphate-pyrophosphohydrolase	gnl\|CDD\|236569	PRK09562, mazG, nucleoside triphosphate pyrophosphohydrolase; Reviewed.	8.97718e-160
LR134234.1\|VED18120.1\|2075908_2077387_+\|putative-sugar-kinase	gnl\|CDD\|212662	cd07779, FGGY_ygcE_like, uncharacterized ygcE-like proteins. This subfamily consists of uncharacterized hypothetical bacterial proteins with similarity to Escherichia coli sugar kinase ygcE , whose functional roles are not yet clear. Escherichia coli ygcE is recognized by this model, but is not present in the alignment as it contains a deletion relative to other members of the group. These proteins belong to the FGGY family of carbohydrate kinases, the monomers of which contain two large domains, which are separated by a deep cleft that forms the active site. This model includes both the N-terminal domain, which adopts a ribonuclease H-like fold, and the structurally related C-terminal domain.	8.33202e-110
LR134234.1\|VED18116.1\|2073500_2074286_-\|putative-short-chain-dehydrogenase	gnl\|CDD\|187605	cd05347, Ga5DH-like_SDR_c, gluconate 5-dehydrogenase (Ga5DH)-like, classical (c) SDRs. Ga5DH catalyzes the NADP-dependent conversion of carbon source D-gluconate and 5-keto-D-gluconate. This SDR subgroup has a classical Gly-rich NAD(P)-binding motif and a conserved active site tetrad pattern. However, it has been proposed that Arg104 (Streptococcus suis Ga5DH numbering), as well as an active site Ca2+, play a critical role in catalysis. In addition to Ga5DHs this subgroup contains Erwinia chrysanthemi KduD which is involved in pectin degradation, and is a putative 2,5-diketo-3-deoxygluconate dehydrogenase. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107,15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	5.84461e-140
LR134234.1\|VED18136.1\|2085317_2085653_-\|toxin-ChpA	gnl\|CDD\|182138	PRK09907, PRK09907, endoribonuclease MazF.	2.42227e-74
LR134234.1\|VED18110.1\|2069788_2070568_-\|electron-transfer-flavoprotein-subunit-YgcR	gnl\|CDD\|224997	COG2086, FixA, Electron transfer flavoprotein, beta subunit [Energy production and conversion].	1.56693e-62
LR134234.1\|VED18124.1\|2079308_2079980_-\|7-carboxy-7-deazaguanine-synthase;-queosine-biosynthesis	gnl\|CDD\|275126	TIGR04322, organic_radical_activating_enzyme, putative 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE. Members of this radical SAM domain protein family appear to be the E. coli form of the queuosine biosynthesis protein QueE. QueE is involved in making preQ0 (7-cyano-7-deazaquanine), a precursor of both the bacterial/eukaryotic modified tRNA base queuosine and the archaeal modified base archaeosine. Members occur in species that lack known forms of QueE but usually are not found in queuosine biosynthesis operons. Members of this family tend to form bi-directional best hit matches to members of known (TIGR03365) and putative (TIGR03963) QueE families from other lineages.	3.98248e-155
LR134234.1\|VED18112.1\|2070545_2071955_-\|major-facilitator-superfamily-protein	gnl\|CDD\|340929	cd17371, MFS_MucK, Cis,cis-muconate transport protein and similar proteins of the Major Facilitator Superfamily. This subfamily is composed of Acinetobacter sp. Cis,cis-muconate transport protein (MucK), Escherichia coli putative sialic acid transporter 1, and similar proteins. MucK functions in the uptake of muconate and allows Acinetobacter calcoaceticus ADP1 (BD413) to grow on exogenous cis,cis-muconate as the sole carbon source. The MucK subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	8.50431e-51
LR134234.1\|VED18104.1\|2067931_2068192_+\|ferredoxin-like-protein-YgcO	gnl\|CDD\|225289	COG2440, FixX, Ferredoxin-like protein [Energy production and conversion].	8.55479e-42
LR134234.1\|VED18114.1\|2071976_2073431_-\|putative-FAD-binding-oxidoreductase	gnl\|CDD\|223354	COG0277, GlcD, FAD/FMN-containing dehydrogenases [Energy production and conversion].	1.25325e-82
LR134234.1\|VED18118.1\|2074604_2075882_+\|major-facilitator-superfamily-protein	gnl\|CDD\|349949	cd06174, MFS, Major Facilitator Superfamily. The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of substrates including ions, sugar phosphates, drugs, neurotransmitters, nucleosides, amino acids, and peptides. They do so using the electrochemical potential of the transported substrates. Uniporters transport a single substrate, while symporters and antiporters transport two substrates in the same or in opposite directions, respectively, across membranes. MFS proteins are typically 400 to 600 amino acids in length, and the majority contain 12 transmembrane alpha helices (TMs) connected by hydrophilic loops. The N- and C-terminal halves of these proteins display weak similarity and may be the result of a gene duplication/fusion event. Based on kinetic studies and the structures of a few bacterial superfamily members, GlpT (glycerol-3-phosphate transporter), LacY (lactose permease), and EmrD (multidrug transporter), MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement. Bacterial members function primarily for nutrient uptake, and as drug-efflux pumps to confer antibiotic resistance. Some MFS proteins have medical significance in humans such as the glucose transporter Glut4, which is impaired in type II diabetes, and glucose-6-phosphate transporter (G6PT), which causes glycogen storage disease when mutated.	4.01972e-29
LR134234.1\|VED18138.1\|2085652_2085901_-\|antitoxin-MazE	gnl\|CDD\|182082	PRK09798, PRK09798, MazF-MazE toxin-antitoxin system antitoxin MazE.	6.19513e-48
LR134234.1\|VED18102.1\|2066669_2067941_+\|putative-FAD-dependent-oxidoreductase	gnl\|CDD\|182194	PRK10015, PRK10015, oxidoreductase; Provisional.	3.54709e-126
LR134234.1\|VED18128.1\|2080440_2081145_+\|protein	gnl\|CDD\|224429	COG1512, COG1512, Beta-propeller domains of methanol dehydrogenase type [General function prediction only].	6.181e-77
LR134234.1\|VED18108.1\|2068931_2069792_-\|electron-transfer-flavoprotein-subunit-YgcQ	gnl\|CDD\|224936	COG2025, FixB, Electron transfer flavoprotein, alpha subunit [Energy production and conversion].	7.42017e-90
LR134234.1\|VED18132.1\|2082590_2084228_-\|CTP-synthetase	gnl\|CDD\|235437	PRK05380, pyrG, CTP synthetase; Validated.	0
LR134234.1\|VED18142.1\|2088260_2089562_-\|23s-rRNA-(uracil-5-)-methyltransferase	gnl\|CDD\|237291	PRK13168, rumA, 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD.	0

>LR134234.1|VED18120.1|2075908_2077387_+|putative-sugar-kinase
MSKKYIIGIDGGSQSTKVVMYDLEGNVVCEGKGLLQPMHTPDADTAEHPDDDLWASLCFAGHDLMSQFAGNKEDIVGIGLGSIRCCRALLKADGTPAAPLISWQDARVTRPYEHTNPDVAYVTSFSGYLTHRLTGEFKDNIANYFGQWPVDYKSWTWSEDAAVMDKFNIPRHMLFDVQMPGTVLGHITPQAALATHFPAGLPVVCTTSDKPVEALGAGLLDDETAVISLGTYIALMMNGKALPKDPVAYWPIMSSIPQTLLYEGYGIRKGMWTVSWLRDMLGESLIQDARAQDLSPEDLLNKKASSVPPGCNGLMTVLDWLTNPWEPYKRGIMIGFDSSMDYAWIYRSILESVALTLKNNYDNMCNEMNHFAKHVIITGGGSNSDLFMQIFADVFNLPARRNAINGCASLGAAINTAVGLGLYPDYATAVDKMVRVKDIFIPIESNAKRYDAMNKGIFKDLTKHTDVILKKSYEVMHGELGNVDSIQSWSNA
>LR134234.1|VED18118.1|2074604_2075882_+|major-facilitator-superfamily-protein
MQHNSYRRWITLAIISFSGGVSFDLAYLRYIYQIPMAKFMGFSNTEIGLIMSTFGIAAIILYAPSGVIADKFSHRKMITSAMIITGLLGLLMATYPPLWVMLCIQVAFAITTILMLWSVSIKAASLLGDHSEQGKIMGWMEGLRGVGVMSLAVFTMWVFSRFAPDDSASLKTVIIIYSVVYILLGILCWFFVSDNNNLRSANNEEKQSFQFSDILAVLRISTTWYCSMVIFGVFTIYAILSYSTNYLTEMYGMSLVAASYMGIVINKIFRALCGPLGGIITTYSKVKSPTRVIQILSVLGLLALTALLVTNSNPQSVAMGIGLILLLGFTCYASRGLYWACPGEARTPSYIMGTTVGICSVIGFLPDVFVYPIIGHWQDTLPAAEAYRNMWLMGMAALAMVIVFTFLLFQKIRTADSAPAMASSK
>LR134234.1|VED18116.1|2073500_2074286_-|putative-short-chain-dehydrogenase
MSIESLNAFSMDFFSLKGKTAIVTGGNSGLGQAFAMALAKAGANIFIPSFVKDNGETKEMIEKQGVEVDFMQVDITAEGAPQKIIAACCERFGTVDILVNNAGICKLNKVLDFGRADWDPMIDVNLTAAFELSYEAAKIMIPQKSGKIINICSLFSYLGGQWSPAYSATKHALAGFTKAYCDELGQYNIQVNGIAPGYYATDITLATRSNPETNQRVLDHIPANRWGDTQDLMGAAVFLASPASNYVNGHLLVVDGGYLVR
>LR134234.1|VED18114.1|2071976_2073431_-|putative-FAD-binding-oxidoreductase
MSLSRAAIVDQLKEIVGADRVITDETVLKKNSIDRFRKFPDIHGIYTLPIPAAVVKLGSTEQVSRVLNFMNAHKINGVPRTGASATEGGLETVVENSVVLDGSAMNQIINIDIENMQATAQCGVPLEVLENALREKGYTTGHSPQSKPLAQMGGLVATRSIGQFSTLYGAIEDMVVGLEAVLADGTVTRIKNVPRRAAGPDIRHIIIGNEGALCYITEVTVKIFKFTPENNLFYGYILEDMKTGFNILREVMVEGYRPSIARLYDAEDGTQHFTHFADGKCVLIFMAEGNPRIAKATGEGIAEIVARYPQCQRVDSKLIETWFNNLNWGPDKVAAERVQILKTGNMGFTTEVSGCWSCIHEIYESVINRIRTEFPHADDITMLGGHSSHSYQNGTNMYFVYDYNVVDCKPEEEIDKYHNPLNKIICEETIRLGGSMVHHHGIGKHRVHWSKLEHGSAWALLEGLKKQFDPNGIMNTGTIYPIEK
>LR134234.1|VED18112.1|2070545_2071955_-|major-facilitator-superfamily-protein
MTGRCLFGFSGEKPFLLPDNEGVKMNTSPVRMDDLPLNRFHCRIAALTFGAHLTDGYVLGVIGYAIIQLTPAMQLTPFMAGMIGGSALLGLFLGSLVLGWISDHIGRQKIFTFSFLLITLASFLQFFATTPEHLIGLRILIGIGLGGDYSVGHTLLAEFSPRRHRGILLGAFSVVWTVGYVLASIAGHHFISENPEAWRWLLASAALPALLITLLRWGTPESPRWLLRQGRFAEAHAIVHRYFGPHVLLGDEVVTATHKHIKTLFSSRYWRRTAFNSVFFVCLVIPWFVIYTWLPTIAQTIGLEDALTASLMLNALLIVGALLGLVLTHLLAHRKFLLGSFLLLAATLVVMACLPSGSSLTLLLFVLFSTTISAVSNLVGILPAESFPTDIRSLGVGFATAMSRLGAAVSTGLLPWVLAQWGMQVTLLLLATVLLVGFVVTWLWAPETKALPLVAAGNVGGANEHSVSV
>LR134234.1|VED18110.1|2069788_2070568_-|electron-transfer-flavoprotein-subunit-YgcR
MNILLAFKAEPDAGMLAEKEWQAAAQGKSGPDISLLRSLLGADEQAAAALLLAQRKNGTPMSLTALSMGDERALHWLRYLMALGFEEAVLLETAADLRFAPEFVARHIAEWQHQNPLDLIITGCQSSEGQNGQTPFLLAEMLGWPCFTQVERFTLDALFITLEQRTEHGLRCCRVRLPAVIAVRQCGEVALPVPGMRQRMAAGKAEIIRKTVAAEMPAMQCLQLARAEQRRGATLIDGQTVAEKAQKLWQDYLRQRMQP
>LR134234.1|VED18108.1|2068931_2069792_-|electron-transfer-flavoprotein-subunit-YgcQ
MNIAIVTINQENAAIASWLAAQDFSGCTLAHWQIEPQPVVAEQVLDALVEQWQRTPADVVLFPPGTFGDELSTRLAWRLHGASICQVTSLDIPTVSVRKSHWGNALTATLQTEKRPLCLSLARQAGAAKNATLPSGMQQLNIVPGALPDWLVSTEDLKNVTRDPLAEARRVLVVGQGGEADNQEIAMLAEKLGAEVGYSRARVMNGGVDAEKVIGISGHLLAPEVCIVVGASGAAALMAGVRNSKFVVAINHDASAAVFSQADVGVVDDWKVVLEALVTNIHADCQ
>LR134234.1|VED18106.1|2068208_2068784_+|glycerol-antiterminator-regulatory-protein
MPLLHLLRQNPVIAAVKDNASLQLAIDSECQFISVLYGNICTISNIVKKIKNAGKYAFIHVDLLEGASNKEVVIQFLKLVTEADGIISTKASMLKAARAEGFFCIHRLFIVDSISFHNIDKQVAQSNPDCIEILPGCMPKVLGWVTEKIRQPLIAGGLVCDEEDARNAINAGVVALSTTNTGVWTLAKKLL
>LR134234.1|VED18104.1|2067931_2068192_+|ferredoxin-like-protein-YgcO
MSVAHNLWRVADAPHIVPADSVERQMVQRLINACPAGLFSLTPEGDLRVDYHGCLECGTCRLLCDESTLQQWRYPPSGFGITYRFG
>LR134234.1|VED18102.1|2066669_2067941_+|putative-FAD-dependent-oxidoreductase
MEDDCDIIIIGAGIAGTACALRCARAGLSVLLLERAEIPGSKNLSGGRLYTHALAELLPQFHLTAPLERRITHESLSLLTPDGATTFSSLQPGGESWSVLRARFDPWLVAEAEKEGVECIPGATVDALYEENGRVCGVICGDDILRARYVVLAEGANSVLAERHGLVTRPAGEAMALGIKEVLSLETSAIEERFHLENNEGAALLFSGGICDDLPGGAFLYTNQQTLSLGIVCPLSSLTQSRVPASELLARFKTHPAVRPLIKNTESLEYGAHLVPEGGLHSMPVQYAGNGWLLVGDALRSCVNTGISVRGMDMALTGAQAAAQTLISACQHREPQNLFALYHHNVERSLLWDILQRYQHVPALLQRPGWYRAWPALMQDISRDLWDQGDKPVPPLRQLFWRHLRRHGLWHLAGDVIRSLRCL
>LR134234.1|VED18124.1|2079308_2079980_-|7-carboxy-7-deazaguanine-synthase;-queosine-biosynthesis
MQYPINEMFQTLQGEGYFTGVPAIFIRLQGCPVGCAWCDTKHTWEKLEDREVSLFSILAKTKESDKWGAASSEDLLAVIGRQGYTARHVVITGGEPCIHDLLPLTDLLEKNGFSCQIETSGTHEVRCTPNTWVTVSPKLNMRGGYEVLSQALERANEIKHPVGRVRDIEALDELLATLTDDKPRVIALQPISQKDDATRLCIETCIARNWRLSMQTHKYLNIA
>LR134234.1|VED18126.1|2080118_2080259_+|small-protein-involved-in-the-cell-envelope-stress-response
MSEENKENGFNHVKTFTKIIFIFSVLVFNDNESKITDAAVNLFIQI
>LR134234.1|VED18128.1|2080440_2081145_+|protein
MQIAVLIVPTTKDETIEQYATRVFDNWRLGDAKRNDGILIIVAWSDRTVRIQVGYGLEEKVTDALARDIIRSNMIPAFKQQKFAQGLELAINALNNQLTSQHQYPTNPSESESASSSDHYYFAIFWVFAVMFFPFWFFHQGSNFCRACKSGVYISAIYLLDLFLFSDKIFSIAVFSFFFTFTIFMVFTCLCVLQKRASGKSYHSDNSGSGGGSSGGGFSGGGGSSGGGGASGRW
>LR134234.1|VED18130.1|2081204_2082503_-|enolase
MSKIVKIIGREIIDSRGNPTVEAEVHLEGGFVGMAAAPSGASTGSREALELRDGDKSRFLGKGVTKAVAAVNGPIAQALIGKDAKDQAGIDKIMIDLDGTENKSKFGANAILAVSLANAKAAAAAKGMPLYEHIAELNGTPGKYSMPVPMMNIINGGEHADNNVDIQEFMIQPVGAKTVKEAIRMGSEVFHHLAKVLKAKGMNTAVGDEGGYAPNLGSNAEALAVIAEAVKAAGYELGKDITLAMDCAASEFYKDGKYVLAGEGNKAFTSEEFTHFLEELTKQYPIVSIEDGLDESDWDGFAYQTKVLGDKIQLVGDDLFVTNTKILKEGIEKGIANSILIKFNQIGSLTETLAAIKMAKDAGYTAVISHRSGETEDATIADLAVGTAAGQIKTGSMSRSDRVAKYNQLIRIEEALGEKAPYNGRKEIKGQA
>LR134234.1|VED18132.1|2082590_2084228_-|CTP-synthetase
MTTNYIFVTGGVVSSLGKGIAAASLAAILEARGLNVTIMKLDPYINVDPGTMSPIQHGEVFVTEDGAETDLDLGHYERFIRTKMSRRNNFTTGRIYSDVLRKERRGDYLGATVQVIPHITNAIKERVLEGGEGHDVVLVEIGGTVGDIESLPFLEAIRQMAVEIGREHTLFMHLTLVPYMAASGEVKTKPTQHSVKELLSIGIQPDILICRSDRAVPANERAKIALFCNVPEKAVISLKDVDSIYKIPGLLKSQGLDDYICKRFSLNCPEANLSEWEQVIFEEANPVSEVTIGMVGKYIELPDAYKSVIEALKHGGLKNRVSVNIKLIDSQDVETRGVEILKGLDAILVPGGFGYRGVEGMITTARFARENNIPYLGICLGMQVALIDYARHVANMENANSTEFVPDCKYPVVALITEWRDENGNVEVRSEKSDLGGTMRLGAQQCQLVDDSLVRQLYNAPTIVERHRHRYEVNNMLLKQIEDAGLRVAGRSGDDQLVEIIEVPNHPWFVACQFHPEFTSTPRDGHPLFAGFVKAASEFQKRQAK
>LR134234.1|VED18134.1|2084455_2085247_-|nucleoside-triphosphate-pyrophosphohydrolase
MNQIDRLLTIMQRLRDPENGCPWDKEQTFATIAPYTLEETYEVLDAIAREDFDDLRGELGDLLFQVVFYAQMAQEEGRFDFNDICAAISDKLERRHPHVFADSSAENSSEVLARWEQIKTEERAQKAQHSALDDIPRSLPALMRAQKIQKRCANVGFDWTTLGPVVDKVYEEIDEVMYEARQAVVDQAKLEEEMGDLLFATVNLARHLGTKAEIALQKANEKFERRFREVERIVAARGLEMTGVDLETMEEVWQQVKRQEIDL
>LR134234.1|VED18136.1|2085317_2085653_-|toxin-ChpA
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPYTTQSKGYPFEVVLSGQERDGVALADQVKSIAWRARGATKKGTVAPEELQLIKAKINVLIG
>LR134234.1|VED18138.1|2085652_2085901_-|antitoxin-MazE
MIHSSVKRWGNSPAVRIPATLMQALNLNIDDEVKIDLVDGKLIIEPVRKEPVFTLAELVNDITPENLHENIDWGEPKDKEVW
>LR134234.1|VED18140.1|2085978_2088213_-|GTP-pyrophosphokinase
MVAVRSAHINKAGEFDPEKWIASLGITSQKSCECLAETWAYCLQQTQGHPDASLLLWRGVEMVEILSTLSMDIDTLRAALLFPLADANVVSEDVLRESVGKSVVNLIHGVRDMAAIRQLKATHTDSVSSEQVDNVRRMLLAMVDDFRCVVIKLAERIAHLREVKDAPEDERVLAAKECTNIYAPLANRLGIGQLKWELEDYCFRYLHPTEYKRIAKLLHERRLDREHYIEEFVGHLRAEMKAEGVKAEVYGRPKHIYSIWRKMQKKNLAFDELFDVRAVRIVAERLQDCYAALGIVHTHYRHLPDEFDDYVANPKPNGYQSIHTVVLGPGGKTVEIQIRTKQMHEDAELGVAAHWKYKEGAAAGGARSGHEDRIAWLRKLIAWQEEMADSGEMLDEVRSQVFDDRVYVFTPKGDVVDLPAGSTPLDFAYHIHSDVGHRCIGAKIGGRIVPFTYQLQMGDQIEIITQKQPNPSRDWLNPNLGYVTTSRGRSKIHAWFRKQDRDKNILAGRQILDDELEHLGISLKEAEKHLLPRYNFNDVDELLAAIGGGDIRLNQMVNFLQSQFNKPSAEEQDAAALKQLQQKSYTPQNRSKDNGRVVVEGVGNLMHHIARCCQPIPGDEIVGFITQGRGISVHRADCEQLAELRSHAPERIVDAVWGESYSAGYSLVVRVVANDRSGLLRDITTILANEKVNVLGVASRSDTKQQLATIDMTIEIYNLQVLGRVLGKLNQVPDVIDARRLHGS
>LR134234.1|VED18142.1|2088260_2089562_-|23s-rRNA-(uracil-5-)-methyltransferase
MAQFYSAKRRTTTRQIITVSVNDLDSFGQGVARHNGKALFIPGLLPQENAEVTVTEDKKQYARAKVVRRLSDSPERETPRCPHFGVCGGCQQQHASVDLQQRSKSAALARLMKHEVSEVIADVPWGYRRRARLSLNYLPKTQQLQMGFRKAGSSDIVDVKQCPILVPKLEALLPKVRACLGSLQVMRHLGHVELVQATSGTLMILRHTAPLSSADREKLERFSHSEGLDLYLAPDSEILETVSGEMPWYDSNGLRLTFSPRDFIQVNAGVNQKMVARALEWLDVQPEDRVLDLFCGMGNFTLPLAKQAASVVGVEGVPALVEKGQQNARLNGLQNVTFYHENLEEDVTKQPWAKNGFDKVLLDPARAGAAGVMQQIIKLEPIRIVYVSCNPATLARDSEALLKAGYTIARLAMLDMFPHTGHLESMVLFSRVK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: LR134234_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

LR134234_4

4531065-4531161

Orphan

Consensus_repeat	Method
GCTTGACGCGTCTTATCAGGCCTACAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of LR134234_4

>merge|LR134234|4|4531065-4531161|CRISPRCasFinder
GCTTGACGCGTCTTATCAGGCCTACAACCGGTGCCGCATCCGGCAATTGGTGCACAATGCCTGATGCGATGCTTGACGCATCTTATCAGGCCTACAA

>LR134234|4|4|4531065-4531161|CRISPRCasFinder
GCTTGACGCGTCTTATCAGGCCTACAA	CCGGTGCCGCATCCGGCAATTGGTGCACAATGCCTGATGCGAT
GCTTGACGCATCTTATCAGGCCTACAA

Protein	Signature genes	Signature genes Name	Protein_function
LR134234.1\|VED23472.1\|4536573_4537440_-\|5,10-methylene-tetrahydrofolate-dehydrogenase	unknown	unknown	gnl\|CDD\|236760
LR134234.1\|VED23464.1\|4530137_4531031_+\|carbamate-kinase	unknown	unknown	gnl\|CDD\|181831
LR134234.1\|VED23473.1\|4537920_4538463_+\|fimbrial-like-protein	unknown	unknown	gnl\|CDD\|237920
LR134234.1\|VED23456.1\|4520362_4521664_+\|putative-permease	unknown	unknown	gnl\|CDD\|183124
LR134234.1\|VED23462.1\|4528055_4529315_+\|putative-cytoplasmic-protein	unknown	unknown	gnl\|CDD\|377673
LR134234.1\|VED23474.1\|4538682_4539375_+\|fimbrial-chaperone	unknown	unknown	gnl\|CDD\|185117
LR134234.1\|VED23463.1\|4529325_4530141_+\|putative-carboxylase	unknown	unknown	gnl\|CDD\|378658
LR134234.1\|VED23455.1\|4518944_4520306_+\|allantoinase	unknown	unknown	gnl\|CDD\|169193
LR134234.1\|VED23457.1\|4521685_4522831_+\|glycerate-kinase-II	unknown	unknown	gnl\|CDD\|182152
LR134234.1\|VED23468.1\|4533641_4534136_-\|peptidyl-prolyl-cis-trans-isomerase-B	unknown	unknown	gnl\|CDD\|182734
LR134234.1\|VED23469.1\|4534309_4535695_+\|cysteinyl-tRNA-synthetase	unknown	unknown	gnl\|CDD\|234705
LR134234.1\|VED23460.1\|4525012_4526062_-\|ureidoglycolate-dehydrogenase	unknown	unknown	gnl\|CDD\|184985
LR134234.1\|VED23470.1\|4535730_4536252_-\|putative-membrane-bound-metal-dependent-hydrolase	unknown	unknown	gnl\|CDD\|224899
LR134234.1\|VED23467.1\|4532916_4533639_-\|UDP-2,3-diacylglucosamine-hydrolase	unknown	unknown	gnl\|CDD\|235420
LR134234.1\|VED23466.1\|4532289_4532799_-\|phosphoribosylaminoimidazole-carboxylase-catalytic-subunit	unknown	unknown	gnl\|CDD\|223119
LR134234.1\|VED23459.1\|4523755_4524991_-\|allantoate-amidohydrolase	unknown	unknown	gnl\|CDD\|274471
LR134234.1\|VED23458.1\|4522959_4523745_-\|putative-glyoxylate-utilization	unknown	unknown	gnl\|CDD\|225796
LR134234.1\|VED23471.1\|4536359_4536572_-\|putative-RNA-binding-protein	unknown	unknown	gnl\|CDD\|183166
LR134234.1\|VED23465.1\|4531225_4532293_-\|phosphoribosylaminoimidazole-carboxylase-ATPase-subunit	unknown	unknown	gnl\|CDD\|235674
LR134234.1\|VED23461.1\|4526378_4528046_+\|FdrA-protein	unknown	unknown	gnl\|CDD\|180395

Protein	Function_ID	Function_description	E-value
LR134234.1\|VED23472.1\|4536573_4537440_-\|5,10-methylene-tetrahydrofolate-dehydrogenase	gnl\|CDD\|236760	PRK10792, PRK10792, bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD.	0
LR134234.1\|VED23464.1\|4530137_4531031_+\|carbamate-kinase	gnl\|CDD\|181831	PRK09411, PRK09411, carbamate kinase; Reviewed.	0
LR134234.1\|VED23473.1\|4537920_4538463_+\|fimbrial-like-protein	gnl\|CDD\|237920	PRK15194, PRK15194, type 1 fimbrial protein subunit FimA.	9.67411e-92
LR134234.1\|VED23456.1\|4520362_4521664_+\|putative-permease	gnl\|CDD\|183124	PRK11412, PRK11412, uracil/xanthine transporter.	0
LR134234.1\|VED23462.1\|4528055_4529315_+\|putative-cytoplasmic-protein	gnl\|CDD\|377673	pfam06545, DUF1116, Protein of unknown function (DUF1116). This family contains hypothetical bacterial proteins of unknown function.	1.8369e-131
LR134234.1\|VED23474.1\|4538682_4539375_+\|fimbrial-chaperone	gnl\|CDD\|185117	PRK15195, PRK15195, molecular chaperone FimC.	5.84958e-149
LR134234.1\|VED23463.1\|4529325_4530141_+\|putative-carboxylase	gnl\|CDD\|378658	pfam11392, DUF2877, Protein of unknown function (DUF2877). This bacterial family of proteins are putative carboxylase proteins however this cannot be confirmed.	3.34725e-37
LR134234.1\|VED23455.1\|4518944_4520306_+\|allantoinase	gnl\|CDD\|169193	PRK08044, PRK08044, allantoinase AllB.	0
LR134234.1\|VED23457.1\|4521685_4522831_+\|glycerate-kinase-II	gnl\|CDD\|182152	PRK09932, PRK09932, glycerate 3-kinase.	0
LR134234.1\|VED23468.1\|4533641_4534136_-\|peptidyl-prolyl-cis-trans-isomerase-B	gnl\|CDD\|182734	PRK10791, PRK10791, peptidylprolyl isomerase B.	2.40187e-121
LR134234.1\|VED23469.1\|4534309_4535695_+\|cysteinyl-tRNA-synthetase	gnl\|CDD\|234705	PRK00260, cysS, cysteinyl-tRNA synthetase; Validated.	0
LR134234.1\|VED23460.1\|4525012_4526062_-\|ureidoglycolate-dehydrogenase	gnl\|CDD\|184985	PRK15025, PRK15025, ureidoglycolate dehydrogenase; Provisional.	0
LR134234.1\|VED23470.1\|4535730_4536252_-\|putative-membrane-bound-metal-dependent-hydrolase	gnl\|CDD\|224899	COG1988, COG1988, Predicted membrane-bound metal-dependent hydrolases [General function prediction only].	1.06651e-30
LR134234.1\|VED23467.1\|4532916_4533639_-\|UDP-2,3-diacylglucosamine-hydrolase	gnl\|CDD\|235420	PRK05340, PRK05340, UDP-2,3-diacylglucosamine hydrolase; Provisional.	1.37025e-165
LR134234.1\|VED23466.1\|4532289_4532799_-\|phosphoribosylaminoimidazole-carboxylase-catalytic-subunit	gnl\|CDD\|223119	COG0041, PurE, Phosphoribosylcarboxyaminoimidazole (NCAIR) mutase [Nucleotide transport and metabolism].	1.14024e-91
LR134234.1\|VED23459.1\|4523755_4524991_-\|allantoate-amidohydrolase	gnl\|CDD\|274471	TIGR03176, AllC, allantoate amidohydrolase. This enzyme catalyzes the breakdown of allantoate, first to ureidoglycine by hydrolysis and then decarboxylation of one of the two equivalent ureido groups. Ureidoglycine then spontaneously exchanges ammonia for water resulting in ureidoglycolate. This enzyme is an alternative to allantoicase (3.5.3.4) which releases urea. [Central intermediary metabolism, Nitrogen metabolism].	0
LR134234.1\|VED23458.1\|4522959_4523745_-\|putative-glyoxylate-utilization	gnl\|CDD\|225796	COG3257, GlxB, Uncharacterized protein, possibly involved in glyoxylate utilization [General function prediction only].	1.89927e-151
LR134234.1\|VED23471.1\|4536359_4536572_-\|putative-RNA-binding-protein	gnl\|CDD\|183166	PRK11507, PRK11507, ribosome-associated protein YbcJ.	1.38756e-42
LR134234.1\|VED23465.1\|4531225_4532293_-\|phosphoribosylaminoimidazole-carboxylase-ATPase-subunit	gnl\|CDD\|235674	PRK06019, PRK06019, phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed.	9.74689e-179
LR134234.1\|VED23461.1\|4526378_4528046_+\|FdrA-protein	gnl\|CDD\|180395	PRK06091, PRK06091, membrane protein FdrA; Validated.	0

>LR134234.1|VED23464.1|4530137_4531031_+|carbamate-kinase
MKTLVVALGGNALLQRGEALTAENQYRNIASAVPALARLARSYRLAIVHGNGPQVGLLALQNLAWKEVEPYPLDVLVAESQGMIGYMLAQSLSAQPQMPPVTTVLTRIEVSPDDPAFLQPEKFIGPVYQPEEQEALEAAYGWQMKRDGKYLRRVVASPQPRKILDSEAIELLLKEGHVVICSGGGGVPVTEDGAGSEAVIDKDLAAALLAEQINADGLVILTDADAVYENWGTPQQRAIRHATPDELAPFAKADGSMGPKVTAVSGYVRSRGKPAWIGALSRIEETLAGEAGTCISL
>LR134234.1|VED23463.1|4529325_4530141_+|putative-carboxylase
MTIIHPLLASRSAPNYRQSWRLAGVWRRAINLMTESGELLTLHRQGSGFGPGGWVLRRAQFDALCGGLCGNERPQVVAQGIRLGRFTVKQPQRYCLLRITPPSHPQPLAAAWMQRAEETGLFGPLALAASDPLPAELRQFRHCFQAALNGVKTDWRHWLGKGPGLTPSHDDTLSGMLLAAWYYGALDARAGRPFFACSDNLQLVTTAVSVSYLRYAAQGYFASPLLHFVHALSCPKRTAVAIDSLLALGHTSGADTLLGFWLGQQLLQGKP
>LR134234.1|VED23462.1|4528055_4529315_+|putative-cytoplasmic-protein
MFTSVAQANAAVIEQIRRARPHWLDVQPASSLISELNEGKTLLHAGPPMRWQEMTGPMKGACVGACLFEGWAKDEAQALAILEQGEVNFIPCHHVNAVGPMGGITSASMPMLVVENVTDGNRAYCNLNEGIGKVMRFGAYGEDVLTRHRWMRDVLMPVLSAALGRMERGIDLTAMMAQGITMGDEFHQRNIASSALLMRALAPQIARLDHDKQHIAEVMDFLSVTDQFFLNLAMAYCKAAMDAGAMIRAGSIVTAMTRNGNMFGIRVSGLGERWFTAPVNTPQGLFFTGFSQEQANPDMGDSAITETFGIGGAAMIAAPGVTRFVGAGGMEAARAVSEEMAEIYLERNMQLQIPGWDFQGACLGLDIRRVVETGITPLINTGIAHKEAGIGQIGAGTVRAPLACFEQALEALAESMGIG
>LR134234.1|VED23461.1|4526378_4528046_+|FdrA-protein
MIHAFIKKGCFQDSVSLMIISRKLSESENVDDVSVMMGTPANKALLDTTGFWHDDFNNATPNDICVAIRSEAADAGIAQAIMQQLEEALKQLAQGSGSSQSLTQVRRWDSACQKLSDANLALISVAGEYAAELANQALDRNLNVMMFSDNVTLEDEIQLKTRAREKGLLVMGPDCGTSMIAATPLAFANVMPEGNIGVIGASGTGIQELCSQIALAGEGITHAIGLGGRDLSREVGGISALTALEMLSADEKSEVLAFVSKPPAEAVRLKIVNAMKATGKPTVALFLGYTPAVARDENVWFASSLDEAARLACLLSRVTARRNAIAPVSSGFICGLYTGGTLAAEAAGLLAGHLGVEADDTHHHGMMLDADGHQIIDLGDDFYTVGRPHPMIDPALRNQLIADLGAKPQVRVLLLDVVIGFGATADPAASLVSAWQKACAARSDSQPLYAIATVTGTERDPQCRSQQIATLEDAGIAVVSSLPEATLLAAALIRPLSPATQQHTPSLLENVAVINIGLRSFALELQSASKPVVHYQWSPVAGGNKKLARLLERLQ
>LR134234.1|VED23460.1|4525012_4526062_-|ureidoglycolate-dehydrogenase
MKISRETLHQLIENKLCQAGLKREHAATVAEVLVYADARGIHSHGAVRVEYYAERISKGGTNREPEFRLEETGPCSAILHADNAAGQVAAKMGMEHAIKTAEQNGVAVVGISRMGHSGAISYFVQQAARAGLIGISMCQSDPMVVPFGGAEIYYGTNPLAFAAPGEGDEILTFDMATTVQAWGKVLDARSRNMSIPDTWAVDKNGAPTTDPLAVHALLPAAGPKGYGLMMMIDVLSGVLLGLPFGRQVSSMYDDLHAGRNLGQLHIVINPNFFSSSELFRQHLSQTMRELNAITPAPGFNQVYYPGQDQDIKQRKAAVEGIEIVDDIYQYLISDALYNTSYETKNPFAQ
>LR134234.1|VED23459.1|4523755_4524991_-|allantoate-amidohydrolase
MITHFRQAIEETLPWLSSFGADPAGGMTRLLYSPEWLETQQQFKKRMAASGLETRFDEVGNLYGRLSGTEYPQEVVLSGSHIDTVVNGGNLDGQFGALAAWLAIDWLKTQYGAPLRTVEVVAMAEEEGSRFPYVFWGSKNIFGLANPDDVRNICDAKGNSFVDAMKACGFTLPNAPLTPRQDIKAFVELHIEQGCVLESNGQSIGVVNAIVGQRRYTVTLNGESNHAGTTPMGYRRDTVYAFSRICHQSIEKAKKMGDPLVLTFGKVEPRPNTVNVVPGKTTFTIDCRHTDAAVLRDFTQQLENDMRAICDEMDIGIDIDLWMDEEPVPMNKELVATLTELCESEKLNYRVMHSGAGHDAQIFAPRVPTCMIFIPSINGISHNPAERTNITDLAEGVKTLALMLYQLAWQK
>LR134234.1|VED23458.1|4522959_4523745_-|putative-glyoxylate-utilization
MGYLNNVTGYRDDLLANRAIVKHGNFALLTPDGLVKNIIPGFENCDATILSTPKLGASFVDYLVTLHQNGSNQQGFGGEGIETFLYVISGNITAKAEGKTFALSEGGYLYCPPGSLMTFVNAQAEDSQIFLYKRRYVPVEGHAPWLVSGNASELERIHYEGMDDVILLDFLPKELGFDMNMHILSFAPGASHGYIETHVQEHGAYILSGQGVYNLDNNWIPVKKGDYIFMGAYSLQAGYGVGRGEAFSYIYSKDCNRDVEI
>LR134234.1|VED23457.1|4521685_4522831_+|glycerate-kinase-II
MKIVIAPDSFKESLSAEKCCQAIKAGFSTLFPDANYICLPIADGGEGTVDAMVAATGGNIVTLEVCGPMGEKVNAFYGLTGDGKTAVIEMAAASGLMLVAPEKRNPLLASSFGTGELIRHALDNGIRHIILGIGGSATVDGGMGMAQALGVRFLDADGQVLVANGGNLARVASIEMDECDPRLANCHIEVACDVDNPLVGARGAAAVFGPQKGATPEMVEELEQGLQNYARVLQQQTEINVCQMAGGGAAGGMGIAAAVFLNADIKPGIEIVLNAVNLAQAVQGAALVITGEGRIDSQTAGGKAPLGVASVAKQFNVPVIGIAGVLGDGVEVVHQYGIDAVFSILPRLAPLAEVLASGETNLFNSARNIACAIKIGQGIKN
>LR134234.1|VED23456.1|4520362_4521664_+|putative-permease
MFNFAVSRESLLSGFQWFFFIFCNTVVVPPTLLSAFQLPQSSLLTLTQYAFLATALACFAQAFCGHRRAIMEGPGGLWWGTILTITLGEASRGTPINDIATSLAVGIALSGVLTMLIGFSGLGHRLARLFTPSVMVLFMLMLGAQLTTIFFKGMLGLPFGIADPNFKIQLPPFALSVAVMCLVLGMIIFLPQRFARYGLLVGTITGWLLWYFCFPSSHSLSGELHWQWFPLGSGGALSPGIILTAVITGLVNISNTYGAIRGTDVFYPQQGAGNTRYRRSFVATGFMTLITVPLAVIPFSPFVSSIGLLTQTGDYTRRSFIYGSVICLLVALVPALTRLFCSIPLPVSSAVMLVSYLPLLFSALVFSQQITFTARNIYRLALPLFVGIFLMALPPVYLQDLPLTLRPLLSNGLLVGILLAVLMDNLIPWERIE
>LR134234.1|VED23455.1|4518944_4520306_+|allantoinase
MSFDLIIKNGTVILENEARVVDIAVKGGKIAAIGQDLGDAKEVMDASGLVVSPGMVDAHTHISEPGRSHWEGYETGTRAAAKGGITTMIEMPLNQLPATVDRASIELKFDAAKGKLTIDAAQLGGLVSYNIDRLHELDEVGVVGFKCFVATCGDRGIDNDFRDVNDWQFFKGAQKLGELGQPVLVHCENALICDALGEEAKREGRVTAHDYVASRPVFTEVEAIRRVLYLAKVAGCRLHVCHISSPEGVEEVTRARQEGQDVTCESCPHYFVLDTDQFEEIGTLAKCSPPIRDLENQKGMWEKLFNGEIDCLVSDHSPCPPEMKAGNIMEAWGGIAGLQNCMDVMFDEAVQKRGMSLPMFGKLMATNAADIFGLQQKGRIAPGKDADFVFIQPNSSYVLTNDDLEYRHKVSPYVGRTIGARITKTILRGDVIYDIEQGFPVAPKGQFILKHQQ
>LR134234.1|VED23465.1|4531225_4532293_-|phosphoribosylaminoimidazole-carboxylase-ATPase-subunit
MKQVCVLGNGQLGRMLRQAGEPLGIAVWPVGLDAEPAAVPFQQSVITAEIERWPETALTRELARHPAFVNRDVFPIIADRLTQKQLFDKLHLPTAPWQLLADRSEWPAVFERLGELAIVKRRTGGYDGRGQWRLRANETEQLPAECYGECIVEQGINFSGEVSLVGARGFDGSTVFYPLTHNLHQDGILRTSVAFPQANAQQQAQAEEMLSAIMQELGYVGVMAMECFVTPQGLLINELAPRVHNSGHWTQNGASISQFELHLRAITDLPLPQPVVNNPSVMINLIGSDANYDWLKLPLVHLHWYDKEVRPGRKVGHLNLTDSDTSRLTATLEALIPLLPPEYASGVIWAQSKFG
>LR134234.1|VED23466.1|4532289_4532799_-|phosphoribosylaminoimidazole-carboxylase-catalytic-subunit
MSSRNNPARVAIVMGSKSDWATMQFAAEIFEILNVPHHVEVVSAHRTPDKLFSFAESAEENGYQVIIAGAGGAAHLPGMIAAKTLVPVLGVPVQSAALSGVDSLYSIVQMPRGIPVGTLAIGKAGAANAALLAAQILATHDKELHQRLNDWRKAQTDEVLENPDPRGAA
>LR134234.1|VED23467.1|4532916_4533639_-|UDP-2,3-diacylglucosamine-hydrolase
MATLFIADLHLCVEEPAITAGFLRFLAGEARKADALYILGDLFEAWIGDDDPNPLHRQMAAAIKAVSDSGVPCYFIHGNRDFLLGKRFARESGMTLLPEEKVLELYGRRVLIMHGDTLCTDDAGYQAFRAKVHKPWLQMLFLALPLFVRKRIAARMRANSKEANSSKSLAIMDVNQNAVVSAMEKHQVQWLIHGHTHRPAVHELIANQQPAFRVVLGAWHTEGSMVKVTADDVELIHFPF
>LR134234.1|VED23468.1|4533641_4534136_-|peptidyl-prolyl-cis-trans-isomerase-B
MVTFHTNHGDIVIKTFDDKAPETVKNFLDYCREGFYNNTIFHRVINGFMIQGGGFEPGMKQKATKEPIKNEANNGLKNTRGTLAMARTQAPHSATAQFFINVVDNDFLNFSGESLQGWGYCVFAEVVEGMDVVDKIKGVATGRSGMHQDVPKEDVIIESVTVSE
>LR134234.1|VED23469.1|4534309_4535695_+|cysteinyl-tRNA-synthetase
MLKIFNTLTRQKEEFKPIHAGEVGMYVCGITVYDLCHIGHGRTFVAFDVVARYLRFLGYKLKYVRNITDIDDKIIKRANENGESFVALVDRMIAEMHKDFDALNILRPDMEPRATHHIAEIIELTEQLIAKGHAYVADNGDVMFDVPTDPTYGVLSRQDLDQLQAGARVDVVDDKRNPMDFVLWKMSKEGEPSWPSPWGAGRPGWHIECSAMNCKQLGNHFDIHGGGSDLMFPHHENEIAQSTCAHDGQYVNYWMHSGMVMVDREKMSKSLGNFFTVRDVLKYYDAETVRYFLMSGHYRSQLNYSEENLKQARAALERLYTALRGTDKTVAPAGGEAFEARFIEAMDDDFNTPEAYSVLFDMAREVNRLKAEDMAAANAMASHLRKLSAVLGLLEQEPEAFLQSGAQADDSEVAEIEALIQQRLDARKAKDWAAADAARDRLNEMGIVLEDGPQGTTWRRK
>LR134234.1|VED23470.1|4535730_4536252_-|putative-membrane-bound-metal-dependent-hydrolase
MPTVITHAAVPLCIGLGLGSKVIPPRLLFAGIILAMLPDADVLSFKFGVAYGNVFGHRGFTHSLVFAFVVPLLCVLIGRRWFRAGLIRCWLFLTVSLLSHSLLDSVTTGGKGVGWLWPWSDERFFAPWQVIKVAPFALSRYTTPYGHQVIISELMWVWLPGMVLMGMLWWRRR
>LR134234.1|VED23471.1|4536359_4536572_-|putative-RNA-binding-protein
MATFSLGKHPHVELCDLLKLEGWSESGAQAKIAIAEGQVKVDGAVETRKRCKIVAGQTVSFAGHSVQVVA
>LR134234.1|VED23472.1|4536573_4537440_-|5,10-methylene-tetrahydrofolate-dehydrogenase
MAAKIIDGKTIAQQVRSEVAQKVQARIAAGLRAPGLAVVLVGSNPASQIYVASKRKACEEVGFVSRSYDLPETTSEAELLELIDTLNADNTIDGILVQLPLPAGIDNVKVLERIHPDKDVDGFHPYNVGRLCQRAPRLRPCTPRGIVTLLERYNIDTFGLNAVVIGASNIVGRPMSMELLLAGCTTTVTHRFTKNLRHHVENADLLIVAVGKPGFIPGDWIKEGAIVIDVGINRLENGKVVGDVVFEDAAKRASYITPVPGGVGPMTVATLIENTLQACVEYHDPQDE
>LR134234.1|VED23473.1|4537920_4538463_+|fimbrial-like-protein
MKLRFISSALAAALFAATGSYAAVVDGGTIHFEGELVNAACSVNTDSADQVVTLGQYRTDIFNAVGNTSALIPFTIQLNDCDPVVAANAAVAFSGQADAINDNLLAIASSTNTTTATGVGIEILDNTSAILKPDGNSFSTNQNLIPGTNVLHFSARYKGTGTSASAGQANADATFIMRYE
>LR134234.1|VED23474.1|4538682_4539375_+|fimbrial-chaperone
MMTKIKLLMLIIFYLIISASAHAAGGIALGATRIIYPADAKQTAVWIRNSHTNERFLVNSWIENSSGVKEKSFIITPPLFVSEPKSENTLRIIYTGPPLAADRESLFWMNVKTIPSVDKNALNGRNVLQLAILSRMKLFLRPIQLQELPAEAPDTLKFSRSGNYINVHNPSPFYVTLVNLQVGSQKLGNAMAAPRVSSQIPLPSGVQGKLKFQTVNDYGSVTPVREVNLN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
LR134234_1	1.1\|1642230\|43\|LR134234\|CRISPRCasFinder	1642230-1642272	43	NC_016160	Escherichia phage HK75, complete genome	28600-28642	0	1.0
LR134234_1	1.1\|1642230\|43\|LR134234\|CRISPRCasFinder	1642230-1642272	43	NC_019705	Enterobacteria phage mEpX2, complete genome	29054-29096	0	1.0
LR134234_1	1.1\|1642230\|43\|LR134234\|CRISPRCasFinder	1642230-1642272	43	KY979108	Escherichia phage ECP1, complete genome	435-477	0	1.0
LR134234_1	1.1\|1642230\|43\|LR134234\|CRISPRCasFinder	1642230-1642272	43	NC_019719	Enterobacteria phage HK633, complete genome	31748-31790	0	1.0
LR134234_1	1.1\|1642230\|43\|LR134234\|CRISPRCasFinder	1642230-1642272	43	JF974339	Enterobacteria phage IME10, complete genome	9731-9773	0	1.0
LR134234_1	1.1\|1642230\|43\|LR134234\|CRISPRCasFinder	1642230-1642272	43	NC_005344	Enterobacteria phage Sf6, complete genome	28418-28460	0	1.0
LR134234_1	1.1\|1642230\|43\|LR134234\|CRISPRCasFinder	1642230-1642272	43	NC_019715	Enterobacterial phage mEp234, complete genome	30416-30458	1	0.977
LR134234_1	1.1\|1642230\|43\|LR134234\|CRISPRCasFinder	1642230-1642272	43	NC_019711	Enterobacteria phage HK629, complete genome	37177-37219	1	0.977
LR134234_1	1.1\|1642230\|43\|LR134234\|CRISPRCasFinder	1642230-1642272	43	NC_019769	Enterobacteria phage HK542, complete genome	29183-29225	1	0.977
LR134234_1	1.1\|1642230\|43\|LR134234\|CRISPRCasFinder	1642230-1642272	43	NC_019768	Enterobacteria phage HK106, complete genome	32712-32754	1	0.977
LR134234_2	2.1\|2052019\|34\|LR134234\|CRT	2052019-2052052	34	LC542972	Escherichia coli IOMTU792 plasmid pIOMTU792 DNA, complete sequence	246937-246970	3	0.912
LR134234_3	3.4\|2078238\|32\|LR134234\|CRISPRCasFinder,CRT	2078238-2078269	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	4458190-4458221	7	0.781
LR134234_3	3.9\|2078543\|32\|LR134234\|CRISPRCasFinder,CRT	2078543-2078574	32	NZ_CP038598	Salmonella enterica subsp. enterica serovar Hadar strain 12-2388 plasmid p12-2388.3, complete sequence	2052-2083	7	0.781
LR134234_3	3.9\|2078543\|32\|LR134234\|CRISPRCasFinder,CRT	2078543-2078574	32	NZ_CP033827	Klebsiella sp. FDAARGOS_511 plasmid unnamed4, complete sequence	693-724	7	0.781
LR134234_3	3.9\|2078543\|32\|LR134234\|CRISPRCasFinder,CRT	2078543-2078574	32	NZ_CP029125	Enterobacter hormaechei strain AR432 plasmid unnamed2, complete sequence	518-549	7	0.781
LR134234_3	3.9\|2078543\|32\|LR134234\|CRISPRCasFinder,CRT	2078543-2078574	32	NZ_AP019693	Salmonella enterica subsp. enterica serovar Senftenberg strain SL180013 plasmid pSL180013-1, complete sequence	2812-2843	7	0.781
LR134234_3	3.9\|2078543\|32\|LR134234\|CRISPRCasFinder,CRT	2078543-2078574	32	NZ_CP030192	Salmonella enterica strain SA20104250 plasmid pSA20104250.2, complete sequence	1835-1866	7	0.781
LR134234_3	3.9\|2078543\|32\|LR134234\|CRISPRCasFinder,CRT	2078543-2078574	32	NZ_CP039274	Salmonella enterica subsp. enterica serovar Senftenberg str. CFSAN004025 plasmid pCFSAN004025.4, complete sequence	118-149	7	0.781
LR134234_3	3.9\|2078543\|32\|LR134234\|CRISPRCasFinder,CRT	2078543-2078574	32	NZ_CP016528	Salmonella enterica subsp. enterica serovar Heidelberg strain 09-036813-1A plasmid p09-036813-1A_4, complete sequence	53-84	7	0.781
LR134234_3	3.9\|2078543\|32\|LR134234\|CRISPRCasFinder,CRT	2078543-2078574	32	NZ_CP030227	Salmonella enterica strain SA20041605 plasmid pSA20041605.2, complete sequence	3124-3155	7	0.781
LR134234_3	3.9\|2078543\|32\|LR134234\|CRISPRCasFinder,CRT	2078543-2078574	32	NC_013090	Endophytic bacterium LOB-07 plasmid pLK39, complete sequence	53-84	7	0.781
LR134234_3	3.9\|2078543\|32\|LR134234\|CRISPRCasFinder,CRT	2078543-2078574	32	NZ_CP030009	Enterobacter hormaechei subsp. xiangfangensis strain Pb204 plasmid pPb204002, complete sequence	2572-2603	7	0.781
LR134234_3	3.9\|2078543\|32\|LR134234\|CRISPRCasFinder,CRT	2078543-2078574	32	NZ_CP011606	Citrobacter freundii strain CAV1321 plasmid pCAV1321-4310, complete sequence	3835-3866	7	0.781
LR134234_3	3.9\|2078543\|32\|LR134234\|CRISPRCasFinder,CRT	2078543-2078574	32	NZ_CP044113	Klebsiella michiganensis strain FDAARGOS_647 plasmid unnamed4, complete sequence	3639-3670	7	0.781
LR134234_3	3.19\|2078239\|32\|LR134234\|PILER-CR	2078239-2078270	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	4458190-4458221	7	0.781
LR134234_3	3.24\|2078544\|32\|LR134234\|PILER-CR	2078544-2078575	32	NZ_CP038598	Salmonella enterica subsp. enterica serovar Hadar strain 12-2388 plasmid p12-2388.3, complete sequence	2052-2083	7	0.781
LR134234_3	3.24\|2078544\|32\|LR134234\|PILER-CR	2078544-2078575	32	NZ_CP033827	Klebsiella sp. FDAARGOS_511 plasmid unnamed4, complete sequence	693-724	7	0.781
LR134234_3	3.24\|2078544\|32\|LR134234\|PILER-CR	2078544-2078575	32	NZ_CP029125	Enterobacter hormaechei strain AR432 plasmid unnamed2, complete sequence	518-549	7	0.781
LR134234_3	3.24\|2078544\|32\|LR134234\|PILER-CR	2078544-2078575	32	NZ_AP019693	Salmonella enterica subsp. enterica serovar Senftenberg strain SL180013 plasmid pSL180013-1, complete sequence	2812-2843	7	0.781
LR134234_3	3.24\|2078544\|32\|LR134234\|PILER-CR	2078544-2078575	32	NZ_CP030192	Salmonella enterica strain SA20104250 plasmid pSA20104250.2, complete sequence	1835-1866	7	0.781
LR134234_3	3.24\|2078544\|32\|LR134234\|PILER-CR	2078544-2078575	32	NZ_CP039274	Salmonella enterica subsp. enterica serovar Senftenberg str. CFSAN004025 plasmid pCFSAN004025.4, complete sequence	118-149	7	0.781
LR134234_3	3.24\|2078544\|32\|LR134234\|PILER-CR	2078544-2078575	32	NZ_CP016528	Salmonella enterica subsp. enterica serovar Heidelberg strain 09-036813-1A plasmid p09-036813-1A_4, complete sequence	53-84	7	0.781
LR134234_3	3.24\|2078544\|32\|LR134234\|PILER-CR	2078544-2078575	32	NZ_CP030227	Salmonella enterica strain SA20041605 plasmid pSA20041605.2, complete sequence	3124-3155	7	0.781
LR134234_3	3.24\|2078544\|32\|LR134234\|PILER-CR	2078544-2078575	32	NC_013090	Endophytic bacterium LOB-07 plasmid pLK39, complete sequence	53-84	7	0.781
LR134234_3	3.24\|2078544\|32\|LR134234\|PILER-CR	2078544-2078575	32	NZ_CP030009	Enterobacter hormaechei subsp. xiangfangensis strain Pb204 plasmid pPb204002, complete sequence	2572-2603	7	0.781
LR134234_3	3.24\|2078544\|32\|LR134234\|PILER-CR	2078544-2078575	32	NZ_CP011606	Citrobacter freundii strain CAV1321 plasmid pCAV1321-4310, complete sequence	3835-3866	7	0.781
LR134234_3	3.24\|2078544\|32\|LR134234\|PILER-CR	2078544-2078575	32	NZ_CP044113	Klebsiella michiganensis strain FDAARGOS_647 plasmid unnamed4, complete sequence	3639-3670	7	0.781
LR134234_2	2.6\|2052143\|32\|LR134234\|PILER-CR	2052143-2052174	32	MK448454	Streptococcus satellite phage Javan361, complete genome	9192-9223	8	0.75
LR134234_2	2.8\|2052265\|32\|LR134234\|PILER-CR	2052265-2052296	32	NZ_CP006991	Rhizobium sp. IE4771 plasmid pRetIE4771e, complete sequence	532343-532374	8	0.75
LR134234_3	3.4\|2078238\|32\|LR134234\|CRISPRCasFinder,CRT	2078238-2078269	32	NZ_LR594673	Variovorax sp. PBL-E5 plasmid 3	475357-475388	8	0.75
LR134234_3	3.7\|2078421\|32\|LR134234\|CRISPRCasFinder,CRT	2078421-2078452	32	AB452989	Serratia phage KSP20 orf7 to orf11 genes for scaffolding protein, major capsid protein, terminase, head completion protein, hypothetical protein, complete and partial cds	1966-1997	8	0.75
LR134234_3	3.9\|2078543\|32\|LR134234\|CRISPRCasFinder,CRT	2078543-2078574	32	NC_019341	Pseudomonas syringae plasmid pNCPPB880-40, complete sequence	6612-6643	8	0.75
LR134234_3	3.19\|2078239\|32\|LR134234\|PILER-CR	2078239-2078270	32	NZ_LR594673	Variovorax sp. PBL-E5 plasmid 3	475357-475388	8	0.75
LR134234_3	3.22\|2078422\|32\|LR134234\|PILER-CR	2078422-2078453	32	AB452989	Serratia phage KSP20 orf7 to orf11 genes for scaffolding protein, major capsid protein, terminase, head completion protein, hypothetical protein, complete and partial cds	1966-1997	8	0.75
LR134234_3	3.24\|2078544\|32\|LR134234\|PILER-CR	2078544-2078575	32	NC_019341	Pseudomonas syringae plasmid pNCPPB880-40, complete sequence	6612-6643	8	0.75
LR134234_2	2.5\|2052263\|34\|LR134234\|CRT,CRISPRCasFinder	2052263-2052296	34	NZ_CP040723	Rhodococcus pyridinivorans strain YF3 plasmid unnamed4, complete sequence	35740-35773	9	0.735
LR134234_2	2.8\|2052265\|32\|LR134234\|PILER-CR	2052265-2052296	32	NZ_CP040723	Rhodococcus pyridinivorans strain YF3 plasmid unnamed4, complete sequence	35740-35771	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP026049	Raoultella planticola strain FDAARGOS_64 plasmid unnamed2, complete sequence	60391-60422	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP026283	Klebsiella oxytoca strain KONIH2 plasmid pKOR-e6bf, complete sequence	67889-67920	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP018351	Klebsiella pneumoniae strain CAV1417 plasmid pCAV1417-185, complete sequence	126089-126120	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP018675	Klebsiella pneumoniae strain CAV1217 plasmid pKPC_CAV1217, complete sequence	64063-64094	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP032995	Escherichia coli strain W5-6 plasmid p3_W5-6, complete sequence	65532-65563	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP052329	Klebsiella pneumoniae strain D17KP0032 plasmid pD17KP0032-1, complete sequence	84972-85003	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP052168	Klebsiella pneumoniae strain F16KP0075 plasmid pF16KP0075-1, complete sequence	21055-21086	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_KX710093	Leclercia adecarboxylata strain pP10164 plasmid pP10164-2, complete sequence	172763-172794	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_KY271405	Klebsiella pneumoniae strain H151440672 plasmid pKPN3-307_typeB, complete sequence	87137-87168	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_KY271407	Klebsiella pneumoniae strain CIV-4 plasmid pKPN3-307_typeD, complete sequence	5987-6018	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP045446	Salmonella enterica subsp. enterica serovar Schwarzengrund strain 9355 plasmid p280_9355, complete sequence	123116-123147	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP014073	Klebsiella quasipneumoniae strain FDAARGOS_93 plasmid unnamed2, complete sequence	41291-41322	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	MN783747	Klebsiella oxytoca plasmid pIron_OXY, complete sequence	126581-126612	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP032195	Klebsiella pneumoniae strain AR_0097 plasmid unnamed1, complete sequence	140823-140854	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP050836	Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence	55131-55162	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP050847	Klebsiella pneumoniae strain Bckp206 plasmid pBckp206-2, complete sequence	27384-27415	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP041286	Escherichia coli strain 54 plasmid p54-tetX, complete sequence	76623-76654	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_KX636095	Klebsiella pneumoniae strain RJ119 plasmid pRJ119-NDM1, complete sequence	145724-145755	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_KX129784	Escherichia coli strain H226B plasmid pH226B, complete sequence	79543-79574	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP029739	Klebsiella pneumoniae strain AR_0087 plasmid unnamed1, complete sequence	56552-56583	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP028537	Enterobacter hormaechei strain SCEH020042 plasmid pQnrB4_020042, complete sequence	113798-113829	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP035548	Salmonella enterica subsp. enterica serovar Typhimurium strain YU07-18 plasmid pYU07-18_IncA/C2, complete sequence	95465-95496	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP052485	Klebsiella pneumoniae strain C16KP0036 plasmid pC16KP0036-1, complete sequence	21056-21087	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_KT203286	Klebsiella pneumoniae strain U25 plasmid PU25001, complete sequence	156534-156565	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_KR653209	Escherichia coli strain GDZ13 plasmid pGD0503Z13, complete sequence	189207-189238	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_KT347600	Escherichia coli strain EC5207 plasmid pEC5207, complete sequence	146671-146702	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP042628	Escherichia coli strain NCYU-25-82 plasmid pNCYU-25-82-1_MCR3, complete sequence	59166-59197	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP021752	Klebsiella pneumoniae strain AR_0113 plasmid unitig_1, complete sequence	109564-109595	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP025081	Klebsiella pneumoniae strain SGH10 plasmid pSGH10, complete sequence	27485-27516	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP025142	Klebsiella pneumoniae strain KP1768 plasmid KP1768_p2, complete sequence	150644-150675	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP031258	Klebsiella quasipneumoniae strain L22 plasmid pL22-1, complete sequence	158677-158708	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP026135	Klebsiella pneumoniae strain F5 plasmid pF5_3, complete sequence	42890-42921	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP018434	Klebsiella pneumoniae strain MNCRE53 plasmid pMNCRE53_4, complete sequence	75856-75887	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP044528	Klebsiella grimontii strain SS141 plasmid plamid_1, complete sequence	42343-42374	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP052163	Klebsiella pneumoniae strain F16KP0082 plasmid pF16KP0082-1, complete sequence	154295-154326	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP019195	Salmonella enterica subsp. enterica serovar Senftenberg str. ATCC 43845 plasmid pATCC43845, complete sequence	268794-268825	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	KY486279	Salmonella sp. strain SH-01 plasmid pSH-01, complete sequence	22960-22991	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP022125	Klebsiella pneumoniae strain DHQP1605752_NV plasmid p1605752FIB, complete sequence	42974-43005	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP018441	Klebsiella pneumoniae strain Kp_Goe_822917 plasmid pKp_Goe_917-1, complete sequence	2740-2771	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP043049	Klebsiella pneumoniae strain KLP268 plasmid pKLP268-3	164476-164507	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP019561	Escherichia coli strain KSC1031 plasmid pMRGN1031, complete sequence	36106-36137	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP019647	Salmonella enterica subsp. enterica serovar Typhimurium strain TW-Stm6 plasmid pSTM6-275, complete sequence	134010-134041	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP040123	Klebsiella pneumoniae strain LSH-KPN148 plasmid pLSH-KPN148-1, complete sequence	34520-34551	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP012256	Cronobacter sakazakii strain NCTC 8155 plasmid pCS3, complete sequence	24282-24313	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP013323	Klebsiella pneumoniae strain CAV1193 plasmid pCAV1193-258, complete sequence	255983-256014	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP029588	Klebsiella pneumoniae strain DA33141 plasmid pDA33141-217, complete sequence	17113-17144	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP030924	Klebsiella pneumoniae subsp. pneumoniae strain KC-Pl-HB1 plasmid pKC-Pl-HB1, complete sequence	150082-150113	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP034282	Klebsiella pneumoniae strain I72 plasmid p72_FIBkpn, complete sequence	108380-108411	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP026022	Klebsiella pneumoniae strain 11492 plasmid p11492-CTXM, complete sequence	31842-31873	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP014011	Klebsiella pneumoniae subsp. pneumoniae strain RJF999 plasmid pRJF999, complete sequence	153097-153128	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP037442	Klebsiella sp. PO552 plasmid p1, complete sequence	62272-62303	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP037743	Klebsiella pneumoniae strain ST23 plasmid pDHQP1701672_hv, complete sequence	26409-26440	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP052408	Klebsiella pneumoniae strain C17KP0008 plasmid pC17KP0008-1, complete sequence	21055-21086	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP052450	Klebsiella pneumoniae strain C16KP0077 plasmid pC16KP0077-1, complete sequence	21055-21086	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP023417	Klebsiella pneumoniae strain 1050 plasmid pKp1050-1, complete sequence	102049-102080	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP044256	Salmonella enterica strain CFSAN096147 plasmid pCFSAN096147, complete sequence	168104-168135	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NC_009649	Klebsiella pneumoniae subsp. pneumoniae MGH 78578 plasmid pKPN3, complete sequence	89263-89294	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP035215	Klebsiella michiganensis strain M82255 plasmid pKOCBH-A, complete sequence	179787-179818	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP035216	Klebsiella michiganensis strain M82255 plasmid pKOCBH-B, complete sequence	128793-128824	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP052491	Klebsiella pneumoniae strain B17KP0069 plasmid pB17KP0069-1, complete sequence	21056-21087	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP052159	Klebsiella pneumoniae strain F16KP0084 plasmid pF16KP0084-1, complete sequence	26413-26444	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP045449	Salmonella enterica subsp. enterica serovar Schwarzengrund strain 12888 plasmid p280_12888, complete sequence	123115-123146	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP040652	Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain SA20070548 plasmid pSA20070548.1, complete sequence	84052-84083	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP014649	Klebsiella pneumoniae strain KPNIH36 plasmid pKPN-fff, complete sequence	88889-88920	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP024193	Klebsiella pneumoniae isolate KSB1_5D plasmid unnamed2, complete sequence	21055-21086	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP011977	Klebsiella pneumoniae DMC1097 plasmid pDMC1097-218.836kb, complete sequence	127356-127387	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NC_014107	Enterobacter cloacae subsp. cloacae ATCC 13047 plasmid pECL_A, complete sequence	27583-27614	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	MT035874	Klebsiella pneumoniae strain KP18-3-8 plasmid pKP18-3-8_KPC_vir, complete sequence	26420-26451	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP052401	Klebsiella pneumoniae strain C17KP0039 plasmid pC17KP0039-2, complete sequence	21055-21086	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP052572	Klebsiella pneumoniae strain A16KP0016 plasmid pA16KP0016-1, complete sequence	21056-21087	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP053729	Escherichia coli strain CP61_Sichuan plasmid pCP61-IncFIB, complete sequence	29389-29420	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	MN200128	Klebsiella pneumoniae strain 17ZR-91 plasmid p17ZR-91-Vir-RC, complete sequence	169653-169684	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	MN200130	Escherichia coli strain EC600 plasmid p17ZR-91-TC1, complete sequence	169636-169667	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP041928	Klebsiella pneumoniae strain 18-2374 plasmid pSECR18-2374A, complete sequence	85156-85187	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP010393	Klebsiella pneumoniae strain 34618 plasmid p34618-207.543kb, complete sequence	75175-75206	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP029448	Serratia marcescens strain CAV1761 plasmid pCAV1761-205, complete sequence	123752-123783	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP026276	Klebsiella oxytoca strain KONIH5 plasmid pKOR-ab4d, complete sequence	202830-202861	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP020508	Serratia marcescens strain BWH-35 plasmid unnamed, complete sequence	112508-112539	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP035636	Enterobacter cloacae strain EN3600 plasmid unnamed4, complete sequence	11554-11585	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP052296	Klebsiella pneumoniae strain E16KP0210 plasmid pE16KP0210-1, complete sequence	21055-21086	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP053738	Escherichia coli strain CP8-3_Sichuan plasmid pCP8-3-IncFIB, complete sequence	51427-51458	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP042507	Leclercia adecarboxylata strain E1 plasmid pE1_002, complete sequence	184657-184688	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	MN543573	Klebsiella pneumoniae strain GH44 plasmid pGH44_216, complete sequence	21055-21086	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP033956	Klebsiella pneumoniae strain L39_2 plasmid p3_L39, complete sequence	79961-79992	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP019559	Escherichia coli strain KSC207 plasmid pMRGN207, complete sequence	195888-195919	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP047092	Salmonella sp. S13 plasmid pS13-3, complete sequence	52747-52778	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NC_022078	Klebsiella pneumoniae JM45 plasmid p1, complete sequence	211041-211072	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	KX023259	Escherichia coli plasmid pSCE516-4, complete sequence	17135-17166	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP026170	Leclercia sp. LSNIH1 plasmid pLEC-000f, complete sequence	1298-1329	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP051431	Escherichia sp. SCLE84 plasmid pSCLE1, complete sequence	175887-175918	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP052432	Klebsiella pneumoniae strain C16KP0122 plasmid pC16KP0122-1, complete sequence	26420-26451	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP052144	Klebsiella pneumoniae strain F17KP0012 plasmid pF17KP0012-1, complete sequence	26413-26444	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP052363	Klebsiella pneumoniae strain D16KP0122 plasmid pD16KP0122-1, complete sequence	27496-27527	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NC_009838	Escherichia coli APEC O1 plasmid pAPEC-O1-R, complete sequence	125062-125093	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NC_020261	Cronobacter sakazakii SP291 plasmid pSP291-2, complete sequence	15851-15882	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP046001	Escherichia coli strain 1916D6 plasmid p1916D6-1, complete sequence	37537-37568	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP024882	Citrobacter freundii strain AR_0022 plasmid unitig_1_pilon, complete sequence	79794-79825	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP028954	Klebsiella pneumoniae strain AR_0141 plasmid unnamed1, complete sequence	108856-108887	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP021103	Escherichia coli strain 13P477T plasmid p13P477T-7, complete sequence	28466-28497	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP006642	Escherichia coli PCN061 plasmid PCN061p6, complete sequence	18335-18366	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP008789	Klebsiella oxytoca KONIH1 plasmid pKOX-137, complete sequence	7282-7313	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP033627	Klebsiella pneumoniae strain 4743 plasmid unnamed2, complete sequence	19718-19749	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP027037	Klebsiella pneumoniae strain 16_GR_13 plasmid IncFIB IncFII, complete sequence	135488-135519	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP036302	Klebsiella pneumoniae subsp. pneumoniae strain WCHKP015093 plasmid p1_015093, complete sequence	21055-21086	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_LR130542	Klebsiella pneumoniae strain AJ218 isolate AJ218 plasmid 2	21055-21086	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NC_023332	Klebsiella pneumoniae strain ST48 plasmid pKP09085, complete sequence	54076-54107	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NC_023333	Klebsiella pneumoniae strain ST23 plasmid pKP007, complete sequence	51301-51332	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NC_023334	Klebsiella pneumoniae strain ST15 plasmid pKP02022, complete sequence	51301-51332	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP009871	Pantoea sp. PSNIH2 plasmid pPSP-cd6, complete sequence	12062-12093	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP012682	Salmonella enterica subsp. enterica serovar Typhimurium strain 33676 plasmid p33676_IncA/C, complete sequence	33654-33685	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP045188	Escherichia coli strain NT1F31 plasmid pNT1F31-tetX4, complete sequence	39224-39255	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP019049	Klebsiella pneumoniae subsp. pneumoniae strain RJA166 plasmid pRJA166b, complete sequence	87716-87747	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP020499	Klebsiella pneumoniae strain BWHC1 plasmid unnamed1, complete sequence	78665-78696	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP020506	Serratia marcescens strain 95 plasmid unnamed1, complete sequence	76683-76714	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP025038	Klebsiella pneumoniae strain NU-CRE047 plasmid pNU-CRE047_1, complete sequence	139081-139112	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP031547	Escherichia coli strain cq9 plasmid unnamed1, complete sequence	56633-56664	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	MK347226	Klebsiella pneumoniae strain K185 plasmid pK185_rmpA2, complete sequence	55694-55725	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	MK347227	Klebsiella pneumoniae strain K187 plasmid pK187_rmpA2, complete sequence	55586-55617	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	MK347228	Klebsiella pneumoniae strain K195 plasmid pK195_rmpA2, complete sequence	55588-55619	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	MK347229	Klebsiella pneumoniae strain K199 plasmid pK199_rmpA2, complete sequence	55591-55622	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	MK347230	Klebsiella pneumoniae strain K202 plasmid pK202_rmpA2, complete sequence	55686-55717	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	MK347231	Klebsiella pneumoniae strain K204 plasmid pK204_rmpA2, complete sequence	55589-55620	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	MK347232	Klebsiella pneumoniae strain K211 plasmid pK211_rmpA2, complete sequence	55665-55696	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	MK347233	Klebsiella pneumoniae strain K214 plasmid pK214_rmpA2, complete sequence	55670-55701	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	MK347234	Klebsiella pneumoniae strain K230 plasmid pK230_rmpA2, complete sequence	55677-55708	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	MK347235	Klebsiella pneumoniae strain K232 plasmid pK232_rmpA2, complete sequence	55685-55716	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	MK347236	Klebsiella pneumoniae strain K234 plasmid pK234_rmpA2, complete sequence	55672-55703	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	MK347237	Klebsiella pneumoniae strain K235 plasmid pK235_rmpA2, complete sequence	55677-55708	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	MK347238	Klebsiella pneumoniae strain K239 plasmid pK239_rmpA2, complete sequence	55588-55619	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP052405	Klebsiella pneumoniae strain C17KP0020 plasmid pC17KP0020-1, complete sequence	21055-21086	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP052137	Klebsiella pneumoniae strain F17KP0054 plasmid pF17KP0054-1, complete sequence	21055-21086	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP018693	Klebsiella pneumoniae strain Kp_Goe_821588 plasmid pKp_Goe_588-1, complete sequence	133570-133601	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP024708	Klebsiella pneumoniae strain cr-hvkp3 plasmid pPUTH1, complete sequence	147210-147241	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP034776	Klebsiella pneumoniae strain 18CPO060 plasmid phvKP060, complete sequence	77940-77971	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP042639	Escherichia coli strain NCYU-24-74 plasmid pNCYU-24-74-1, complete sequence	145904-145935	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP015135	Klebsiella pneumoniae strain ATCC 35657 plasmid p35657-1, complete sequence	156655-156686	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP045662	Klebsiella pneumoniae strain SMU18037509 plasmid unnamed1, complete sequence	51803-51834	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP020842	Klebsiella pneumoniae strain KPN1482 plasmid pKPN1482-1, complete sequence	33130-33161	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP020855	Klebsiella pneumoniae strain KPN528 plasmid pKPN528-2, complete sequence	178834-178865	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP044301	Escherichia coli strain P59A plasmid pP59A-3, complete sequence	44110-44141	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP031811	Klebsiella pneumoniae strain INF014-sc-2279884 plasmid unnamed1, complete sequence	10565-10596	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP025277	Salmonella enterica subsp. enterica strain USDA-ARS-USMARC-60984 plasmid pSJO-60984, complete sequence	131995-132026	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP017182	Enterobacter kobei strain DSM 13645 plasmid pDSMZ13645, complete sequence	21421-21452	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP013942	Cronobacter malonaticus LMG 23826 plasmid pCMA2, complete sequence	44399-44430	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	MN891675	Klebsiella pneumoniae strain 358573 plasmid p358573-KPC, complete sequence	139490-139521	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP052357	Klebsiella pneumoniae strain D16KP0144 plasmid pD16KP0144-1, complete sequence	26413-26444	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	LC549807	Klebsiella pneumoniae VNCKp115 plasmid pVNCKp115 DNA, complete sequence	81995-82026	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_LR134257	Klebsiella aerogenes strain NCTC9644 plasmid 4, complete sequence	33461-33492	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP041645	Klebsiella pneumoniae strain NKU_Kleb8A7 plasmid pKleb8A7, complete sequence	84060-84091	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP041949	Klebsiella pneumoniae strain KP2 plasmid pKP2_3, complete sequence	21055-21086	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP020838	Klebsiella pneumoniae strain BK13043 plasmid pBK13043-1, complete sequence	171910-171941	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP031569	Enterobacter hormaechei strain 2013_1a plasmid pIncFIB-1301491, complete sequence	128829-128860	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP031563	Klebsiella pneumoniae strain 2-1 plasmid pKP21HI1, complete sequence	43617-43648	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP030182	Salmonella enterica strain SA20030575 plasmid pSA20030575.1, complete sequence	119066-119097	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP028784	Klebsiella pneumoniae strain SCKP020049 plasmid p1_020049, complete sequence	18575-18606	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP027054	Klebsiella pneumoniae strain 2_GR_12 plasmid IncFIB IncFII	91698-91729	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP052445	Klebsiella pneumoniae strain C16KP0098 plasmid pC16KP0098-2, complete sequence	26414-26445	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP052570	Klebsiella pneumoniae strain A16KP0119 plasmid pA16KP0119-1, complete sequence	21055-21086	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP052218	Klebsiella pneumoniae strain E17KP0053 plasmid pE17KP0053-1, complete sequence	21055-21086	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP040894	Leclercia adecarboxylata strain Z96-1 plasmid pZ96-1_3, complete sequence	45062-45093	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP035380	Leclercia adecarboxylata strain R25 plasmid pLA-109, complete sequence	104667-104698	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP014009	Klebsiella pneumoniae subsp. pneumoniae strain RJF293 plasmid pRJF293, complete sequence	87695-87726	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP023479	Klebsiella quasipneumoniae strain KPC142 plasmid pKQPS142a, complete sequence	171975-172006	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	MN310373	Klebsiella pneumoniae strain BJ20 plasmid pBJ20-tetA, complete sequence	21981-22012	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	MN310374	Klebsiella pneumoniae strain 2016071221 plasmid p71221-tetA, complete sequence	108173-108204	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	MN310376	Klebsiella pneumoniae strain 08291 plasmid pW08291-tetA, complete sequence	22250-22281	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	MN310380	Raoultella ornithinolytica strain 170602815 plasmid p602815-NR, complete sequence	42027-42058	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP018424	Klebsiella pneumoniae strain MNCRE69 plasmid pMNCRE69_4, complete sequence	75856-75887	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP049605	Klebsiella pneumoniae strain Kp8701 plasmid unnamed, complete sequence	91344-91375	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	MH909331	Leclercia adecarboxylata plasmid p707804-NDM, complete sequence	220327-220358	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	AP020333	Salmonella enterica SESen3709 plasmid pSESen3709_1 DNA, complete genome	153774-153805	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP031736	Klebsiella pneumoniae subsp. pneumoniae strain Klebsiella pneumoniae plasmid pKPM502, complete sequence	139670-139701	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP034251	Salmonella enterica subsp. enterica serovar Derby strain Sa64 plasmid pSa64T-188, complete sequence	39196-39227	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP035916	Salmonella enterica strain S61394 plasmid pLS61394-MCR, complete sequence	118121-118152	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP039577	Salmonella enterica subsp. enterica serovar Typhimurium strain PNCS014856 plasmid p10-3857.1, complete sequence	89792-89823	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP029591	Klebsiella pneumoniae strain DA33144 plasmid pDA33144-220, complete sequence	138188-138219	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP012989	Klebsiella pneumoniae strain KpN01 plasmid pKpN01-SIL, complete sequence	99350-99381	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP018818	Klebsiella pneumoniae strain AR_0049 plasmid unitig_2, complete sequence	10679-10710	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP037966	Klebsiella pneumoniae strain SCKP020135 plasmid p1_020135, complete sequence	18575-18606	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP038140	Escherichia coli strain G3X16-2 plasmid pG3X16-2-3, complete sequence	114151-114182	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP052321	Klebsiella pneumoniae strain E16KP0035 plasmid pE16KP0035-1, complete sequence	10544-10575	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP052148	Klebsiella pneumoniae strain F16KP0108 plasmid pF16KP0108-1, complete sequence	21056-21087	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP019019	Escherichia coli strain Ecol_244 plasmid pEC244_1, complete sequence	69340-69371	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NC_021654	Klebsiella pneumoniae plasmid pKN-LS6, complete sequence	152482-152513	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	LR134211	Klebsiella aerogenes strain NCTC418 genome assembly, plasmid: 2	83102-83133	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP041084	Klebsiella pneumoniae strain Kp202 plasmid pKp202_2, complete sequence	21052-21083	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP042616	Escherichia coli strain NCYU-26-73 plasmid pNCYU-26-73-1, complete sequence	27538-27569	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP026274	Klebsiella oxytoca strain KONIH4 plasmid pKPC-4b66, complete sequence	59413-59444	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP031799	Klebsiella pneumoniae strain QMP B2-170 plasmid unnamed, complete sequence	65278-65309	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP036337	Klebsiella pneumoniae strain BP327 plasmid pIncFIBK, complete sequence	141984-142015	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP050011	Citrobacter sp. Y3 plasmid unnamed2, complete sequence	61173-61204	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP052415	Klebsiella pneumoniae strain C16KP0189 plasmid pC16KP0189-1, complete sequence	21055-21086	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP052559	Klebsiella pneumoniae strain A17KP0008 plasmid pA17KP0008-2, complete sequence	21056-21087	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP052270	Klebsiella pneumoniae strain E16KP0268 plasmid pE16K0268-2, complete sequence	21056-21087	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NC_005249	Klebsiella pneumoniae CG43 plasmid pLVPK, complete sequence	173018-173049	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NC_016966	Klebsiella pneumoniae plasmid pUUH239.2, complete sequence	51299-51330	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP031284	Escherichia fergusonii strain 40A plasmid p280_40A, complete sequence	265202-265233	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP041514	Klebsiella michiganensis strain KNU07 plasmid unnamed, complete sequence	26245-26276	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP041100	Klebsiella pneumoniae subsp. pneumoniae strain KPCTRSRTH07 plasmid unnamed1, complete sequence	22272-22303	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP041375	Klebsiella pneumoniae strain KP58 plasmid pKP58-2, complete sequence	81161-81192	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP042482	Klebsiella pneumoniae strain C51 plasmid pC51_001, complete sequence	21479-21510	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	MK461930	Escherichia coli strain 2009_36 plasmid p2009_36_HI2, complete sequence	157333-157364	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP021834	Klebsiella pneumoniae strain AR_0120 plasmid tig00000500_pilon, complete sequence	76432-76463	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP027613	Klebsiella pneumoniae subsp. ozaenae strain AR_0096 plasmid unnamed1, complete sequence	186405-186436	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP024875	Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence	202698-202729	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP022692	Klebsiella pneumoniae subsp. pneumoniae strain AUSMDU00008079 plasmid pAUSMDU00008079_01, complete sequence	21055-21086	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP022920	Klebsiella pneumoniae strain ST307PT03 plasmid pJYC03A, complete sequence	200876-200907	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP034326	Klebsiella pneumoniae isolate KSH203 plasmid pKSH203-qnrS, complete sequence	26887-26918	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP035180	Klebsiella pneumoniae strain BA33875 plasmid pBA33875_IncFIB, complete sequence	133223-133254	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NC_008573	Shewanella sp. ANA-3 plasmid unnamed1, complete sequence	181590-181621	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP025212	Klebsiella pneumoniae strain HZW25 plasmid unnamed1, complete sequence	86557-86588	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP052232	Klebsiella pneumoniae strain E17KP0033 plasmid pE17KP0033-1, complete sequence	26413-26444	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP052873	Enterobacter cloacae strain 3849 plasmid p3846III, complete sequence	17877-17908	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP021958	Klebsiella pneumoniae strain AR_0139 plasmid tig00000002_u	81477-81508	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP040546	Klebsiella pneumoniae strain CR-HvKP5 plasmid pCR-HvKP5-VIR, complete sequence	74607-74638	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP028792	Klebsiella pneumoniae strain WCHKP020030 plasmid pQnrS1_020030, complete sequence	21871-21902	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP033823	Klebsiella sp. FDAARGOS_511 plasmid unnamed1, complete sequence	167029-167060	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP015132	Klebsiella pneumoniae strain Kpn555 plasmid pKPN-d90, complete sequence	139746-139777	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP012572	Klebsiella pneumoniae strain UCLAOXA232KP plasmid pUCLAOXA232-6.X, complete sequence	143194-143225	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP042513	Serratia marcescens strain E28 plasmid pE28_001, complete sequence	22132-22163	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP032241	Klebsiella pneumoniae strain XJ-K2 plasmid unnamed1, complete sequence	157014-157045	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP046273	Enterobacter hormaechei strain E70 plasmid pE70-sul2, complete sequence	23136-23167	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP029136	Klebsiella pneumoniae strain AR376 plasmid unnamed2, complete sequence	105327-105358	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP047460	Escherichia coli strain ZF31 plasmid pZF31-tetX-119kb, complete sequence	61533-61564	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP047466	Escherichia coli strain ZF34 plasmid pZF34-tetX-114kb, complete sequence	8849-8880	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP052176	Klebsiella pneumoniae strain F16KP0050 plasmid pF16KP0050-1, complete sequence	21056-21087	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP052193	Klebsiella pneumoniae strain F16KP0014 plasmid pF16KP0014-1, complete sequence	21056-21087	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP014121	Klebsiella pneumoniae strain FDAARGOS_156 plasmid unnamed1, complete sequence	34821-34852	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_LT991959	Enterobacter cloacae complex sp. isolate C45 plasmid pC45-p2	22817-22848	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	LC511658	Escherichia coli 2017.03.03CC plasmid p2017_03_03CC DNA, complete genome	135929-135960	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP029037	Salmonella enterica subsp. enterica serovar Senftenberg str. 361154004 plasmid unnamed, complete sequence	73977-74008	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP041640	Klebsiella pneumoniae strain PIMB15ND2KP27 plasmid pKP27-MPH, complete sequence	43686-43717	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP043854	Enterobacter hormaechei strain EB_P6_L3_02.19 plasmid unnamed1, complete sequence	72852-72883	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP026752	Klebsiella pneumoniae strain AR_0066 plasmid tig00000080_pilon, complete sequence	84059-84090	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP018886	Klebsiella pneumoniae subsp. pneumoniae strain BR21 plasmid pIncF, complete sequence	30717-30748	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP039857	Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014876 plasmid p15-0756.1, complete sequence	83640-83671	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP039809	Klebsiella pneumoniae strain C2660 plasmid pC2660-2, complete sequence	21055-21086	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP029101	Klebsiella pneumoniae strain AR438 plasmid unnamed3, complete sequence	48003-48034	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP040862	Klebsiella pneumoniae strain Xen39 plasmid unnamed3, complete sequence	183500-183531	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP036191	Klebsiella pneumoniae strain BA34918 plasmid pvirulence_VBA34918, complete sequence	90627-90658	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP040025	Klebsiella pneumoniae strain KPC160132 plasmid pKpn3-L132, complete sequence	21056-21087	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP052266	Klebsiella pneumoniae strain E16KP0287 plasmid pE16K0287-1, complete sequence	21055-21086	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP052561	Klebsiella pneumoniae strain A17KP0004 plasmid pA17KP0004-1, complete sequence	21056-21087	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP052209	Klebsiella pneumoniae strain E17KP0085 plasmid pE17KP0085-2, complete sequence	21056-21087	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NC_006625	Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 plasmid pK2044, complete sequence	102690-102721	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP022734	Escherichia coli strain SA186 plasmid pSA186_5, complete sequence	52395-52426	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP038004	Klebsiella pneumoniae strain SCKP020009 plasmid pLAP2_020009, complete sequence	23518-23549	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP007734	Klebsiella pneumoniae subsp. pneumoniae KPNIH27 plasmid pKPN-262, complete sequence	70555-70586	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP026175	Klebsiella pneumoniae strain KPNIH50 plasmid pKPC-0cc9, complete sequence	142171-142202	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP026179	Klebsiella pneumoniae strain KPNIH49 plasmid pKPC-224e, complete sequence	215477-215508	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP026185	Klebsiella pneumoniae strain KPNIH49 plasmid pKPN-9a0d, complete sequence	14706-14737	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP026186	Klebsiella pneumoniae strain KPNIH49 plasmid pKPN-3967, complete sequence	141228-141259	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP028995	Klebsiella pneumoniae strain AR_0079 plasmid unnamed6, complete sequence	21694-21725	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP031815	Klebsiella pneumoniae strain KSB1_7F-sc-2280268 plasmid unnamed1, complete sequence	70329-70360	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP033402	Klebsiella pneumoniae strain WCHKP115069 plasmid p1_115069, complete sequence	21055-21086	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP039526	Klebsiella pneumoniae subsp. pneumoniae strain HB25-1 plasmid pHB25-1-vir, complete sequence	134438-134469	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP052302	Klebsiella pneumoniae strain E16KP0180 plasmid pE16KP0180-1, complete sequence	21055-21086	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP018355	Klebsiella pneumoniae strain CAV1453 plasmid pCAV1453-208, complete sequence	14591-14622	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP043751	Escherichia coli strain CVM N62675 plasmid pN62675, complete sequence	58583-58614	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP031583	Klebsiella pneumoniae strain N4b plasmid pIncFII-1502320, complete sequence	104373-104404	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP029598	Klebsiella quasipneumoniae subsp. similipneumoniae strain ATCC 700603 plasmid pDA33145-152, complete sequence	70441-70472	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP031614	Klebsiella pneumoniae strain ZYST1 plasmid pZYST1C1, complete sequence	168396-168427	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP047337	Klebsiella pneumoniae strain 2019036D plasmid p2019036D-mcr8-345kb, complete sequence	45989-46020	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP019214	Escherichia coli strain WCHEC050613 plasmid pMCR_WCHEC050613, complete sequence	126822-126853	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP021544	Klebsiella pneumoniae strain AR_0112 plasmid tig00000000, complete sequence	197032-197063	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP021540	Klebsiella pneumoniae strain AR_0047 plasmid tig00000001, complete sequence	201327-201358	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP021686	Klebsiella pneumoniae strain AR_0146 plasmid tig00001160, complete sequence	66354-66385	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP043545	Escherichia coli strain F2_81 plasmid pF2_18C_HI2, complete sequence	126513-126544	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP012169	Enterobacter hormaechei subsp. steigerwaltii strain 34998 plasmid p34998-210.894kb, complete sequence	23136-23167	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP022926	Klebsiella pneumoniae strain ST307PT01 plasmid pJYC01A, complete sequence	67389-67420	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP036307	Klebsiella pneumoniae strain WCHKP020098 plasmid p1_020098, complete sequence	23518-23549	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP022149	Enterobacter roggenkampii strain 704SK10 plasmid p704SK10_1, complete sequence	33744-33775	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	KT896504	Klebsiella pneumoniae strain I11 plasmid pKPSH11, complete sequence	21870-21901	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP036176	Klebsiella huaxiensis strain WCHKl090001 plasmid p1_090001, complete sequence	15823-15854	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP052380	Klebsiella pneumoniae strain D16KP0017 plasmid pD16KP0017-1, complete sequence	21055-21086	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP052563	Klebsiella pneumoniae strain A16KP0135 plasmid pA16KP0135-1, complete sequence	26408-26439	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP052525	Klebsiella pneumoniae strain B16KP0177 plasmid pB16KP0177-1, complete sequence	25094-25125	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	LT009688	Klebsiella pneumoniae plasmid pIT-06C07, strain O6CO7, complete sequence	53285-53316	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP030003	Salmonella enterica subsp. enterica serovar Brandenburg strain SA20064858 plasmid pSA20064858.1, complete sequence	27749-27780	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP030066	Klebsiella pneumoniae strain IA565 plasmid pDA11912.1, complete sequence	151884-151915	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP028549	Klebsiella variicola strain WCHKP19 plasmid p1_020019, complete sequence	16894-16925	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP009865	Klebsiella pneumoniae subsp. pneumoniae strain KPNIH29 plasmid pKPN-80a, complete sequence	107910-107941	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP009879	Klebsiella pneumoniae subsp. pneumoniae strain KPNIH31 plasmid pKPN-c22, complete sequence	171715-171746	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP009777	Klebsiella pneumoniae subsp. pneumoniae strain KPNIH32 plasmid pKPN-a68, complete sequence	70308-70339	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP008800	Klebsiella pneumoniae subsp. pneumoniae KPNIH24 plasmid pKPN-e44, complete sequence	104596-104627	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP044036	Klebsiella pneumoniae strain FDAARGOS_630 plasmid unnamed2, complete sequence	118108-118139	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP024153	Escherichia coli strain 14EC033 plasmid p14EC033f, complete sequence	75618-75649	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP046950	Klebsiella pneumoniae strain BD_DM_914 plasmid punnamed1, complete sequence	21056-21087	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP046940	Klebsiella pneumoniae strain BD_DM_697 plasmid punnamed1	98907-98938	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP006927	Klebsiella pneumoniae 30660/NJST258_1 plasmid pNJST258N1, complete sequence	69638-69669	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP008930	Klebsiella pneumoniae strain PMK1 plasmid pPMK1-A, complete sequence	115196-115227	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP007729	Klebsiella pneumoniae subsp. pneumoniae KPNIH10 plasmid pKPN-498, complete sequence	117056-117087	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP052282	Klebsiella pneumoniae strain E16KP0224 plasmid pE16KP0224-2, complete sequence	21057-21088	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP006663	Klebsiella pneumoniae strain ATCC BAA-2146 plasmid pCuAs, complete sequence	86728-86759	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP009855	UNVERIFIED_ORG: Enterobacter cloacae strain ECNIH5 plasmid pENT-22e, complete sequence	100676-100707	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP024144	Escherichia coli strain 14EC029 plasmid p14EC029c, complete sequence	1276-1307	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP026390	Leclercia sp. LSNIH3 plasmid pLEC-5e18, complete sequence	162961-162992	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP008907	Enterobacter hormaechei subsp. hoffmannii ECR091 plasmid pENT-4bd, complete sequence	58042-58073	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP029143	Klebsiella michiganensis strain AR375 plasmid unnamed3, complete sequence	95049-95080	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP048380	Klebsiella variicola strain 118 plasmid p118_A, complete sequence	122218-122249	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP030920	Escherichia coli strain KL53 plasmid pKL53-L, complete sequence	102780-102811	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP026397	Klebsiella pneumoniae strain KPNIH48 plasmid pKPN-10f7, complete sequence	138430-138461	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP052288	Klebsiella pneumoniae strain E16KP0218 plasmid pE16KP0218-2, complete sequence	21056-21087	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP008842	Klebsiella michiganensis strain M1 plasmid pKOXM1A, complete sequence	118065-118096	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP026058	Citrobacter freundii strain FDAARGOS_73 plasmid unnamed2, complete sequence	57437-57468	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP022824	Klebsiella quasivariicola strain KPN1705 plasmid pKPN1705-1, complete sequence	23481-23512	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_AP019666	Klebsiella pneumoniae strain TA6363 plasmid pTMTA63631, complete sequence	16416-16447	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP020062	Klebsiella pneumoniae strain AR_0117 plasmid unitig_1, complete sequence	19148-19179	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP020072	Klebsiella pneumoniae strain AR_0115 plasmid tig00000002, complete sequence	190390-190421	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP020109	Klebsiella pneumoniae strain AR_0098 plasmid tig00000001, complete sequence	28465-28496	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP047193	Klebsiella pneumoniae strain Kp36 plasmid unnamed1, complete sequence	102687-102718	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP029435	Klebsiella quasipneumoniae strain CAV2013 plasmid pCAV2013-156, complete sequence	1080-1111	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP029430	Klebsiella quasipneumoniae strain CAV2018 plasmid pCAV2018-177, complete sequence	127222-127253	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP029430	Klebsiella quasipneumoniae strain CAV2018 plasmid pCAV2018-177, complete sequence	159500-159531	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP015386	Klebsiella pneumoniae strain NY9 plasmid pNY9_1, complete sequence	22121-22152	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP020069	Klebsiella pneumoniae strain AR_0068 plasmid unitig_2, complete sequence	20855-20886	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP012567	Klebsiella pneumoniae strain UCLAOXA232KP plasmid pUCLAOXA232-6, complete sequence	176480-176511	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP010154	Escherichia coli strain D9 plasmid B, complete genome	23974-24005	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP024537	Klebsiella pneumoniae strain KSB1_9D plasmid unnamed2, complete sequence	21055-21086	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP024516	Klebsiella pneumoniae strain KSB1_10J plasmid unnamed1, complete sequence	21056-21087	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP032988	Escherichia coli strain BE2-5 plasmid p2_BE2-5, complete sequence	80086-80117	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP036443	Klebsiella pneumoniae strain ABFPV plasmid tig00001208_pilon, complete sequence	112528-112559	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP050379	Klebsiella pneumoniae strain 51015 plasmid p51015_CTX_M_15, complete sequence	92277-92308	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP035906	Klebsiella pneumoniae strain BA4656 plasmid unnamed1, complete sequence	25475-25506	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP025516	Klebsiella pneumoniae strain 002SK2 plasmid p002SK2_A, complete sequence	51727-51758	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP052276	Klebsiella pneumoniae strain E16KP0241 plasmid pE16KP0241-1, complete sequence	21056-21087	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	MF943217	Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_WCHKP13F2, complete sequence	183354-183385	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP032164	Klebsiella pneumoniae strain XJ-K1 plasmid unnamed1, complete sequence	119916-119947	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP025457	Klebsiella pneumoniae strain KP69 plasmid p69-1, complete sequence	135628-135659	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP024130	Escherichia coli strain 14EC001 plasmid p14EC001c, complete sequence	87142-87173	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP034416	Klebsiella pneumoniae strain C789 plasmid pVir-CR-hvKP-C789, complete sequence	26420-26451	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP011429	Salmonella enterica subsp. enterica serovar Typhimurium strain YU39 isolate YUHS 05-78 plasmid pYU39_IncA/C, complete sequence	94608-94639	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP034130	Klebsiella quasipneumoniae strain G4584 plasmid pG4584_218.9Kb, complete sequence	195601-195632	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP034681	Klebsiella quasipneumoniae strain D120-1 plasmid pD120-1_296kb, complete sequence	140936-140967	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	MF918373	Klebsiella pneumoniae plasmid p1512-dfrA, complete sequence	100460-100491	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP052423	Klebsiella pneumoniae strain C16KP0164 plasmid pC16KP0164-1, complete sequence	22212-22243	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP052545	Klebsiella pneumoniae strain B16KP0102 plasmid pB16KP0102-1, complete sequence	21055-21086	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP052298	Klebsiella pneumoniae strain E16KP0204 plasmid pE16KP0204-1, complete sequence	21056-21087	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_LR130549	Klebsiella pneumoniae strain KPC2 isolate KPC2 plasmid 2	21055-21086	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP032491	Salmonella enterica subsp. enterica serovar Typhimurium strain SL26 plasmid pSL26_IncA/C2, complete sequence	100943-100974	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP032495	Salmonella enterica subsp. enterica serovar Typhimurium strain SO21 plasmid pSO21_118, complete sequence	31736-31767	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP046382	Klebsiella pneumoniae strain BD_DM_782 plasmid punnamed1, complete sequence	21056-21087	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP022574	Klebsiella pneumoniae strain BIC-1 plasmid pBIC-1a, complete sequence	111321-111352	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP050373	Klebsiella pneumoniae strain 50595 plasmid p50595_IncFII, complete sequence	10677-10708	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP050174	Escherichia coli strain STB20-1 plasmid pSTB20-1T, complete sequence	71124-71155	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP048299	Salmonella enterica subsp. enterica serovar Schwarzengrund strain WAPHL_SAL-A00527 plasmid pN1566-2, complete sequence	289102-289133	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP052190	Klebsiella pneumoniae strain F16KP0019 plasmid pF16KP0019-1, complete sequence	26413-26444	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP052387	Klebsiella pneumoniae strain C17KP0055 plasmid pC17KP0055-1, complete sequence	22122-22153	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NC_005211	Serratia marcescens plasmid R478, complete sequence	129723-129754	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NC_021198	Klebsiella pneumoniae subsp. pneumoniae KPX plasmid pKPX-1 DNA, complete sequence	112875-112906	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP012884	Klebsiella pneumoniae KP-1 plasmid pKP1-19, complete sequence	39445-39476	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP026661	Salmonella enterica subsp. enterica strain 15-SA01028 plasmid pSE15-SA01028, complete sequence	140856-140887	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP018670	Klebsiella pneumoniae strain CAV1042 plasmid pCAV1042-183, complete sequence	52604-52635	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP028804	Klebsiella pneumoniae strain WCHKP7E2 plasmid pCMY2_085072, complete sequence	162624-162655	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP021713	Klebsiella pneumoniae strain AR_0129 plasmid tig00000000, complete sequence	115393-115424	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP030270	Klebsiella pneumoniae subsp. pneumoniae strain SC-7 plasmid pSC7-vir, complete sequence	26426-26457	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP030343	Klebsiella pneumoniae strain AR_362 plasmid unnamed1, complete sequence	80809-80840	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP035384	Klebsiella pneumoniae strain AP8555 plasmid pAP855, complete sequence	158839-158870	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP026151	Klebsiella pneumoniae strain F138 plasmid pF138_2, complete sequence	70847-70878	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP040030	Klebsiella pneumoniae strain KPC160121 plasmid pQnr-L121, complete sequence	21056-21087	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP052538	Klebsiella pneumoniae strain B16KP0141 plasmid pB16KP0141-1, complete sequence	21056-21087	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP023917	Klebsiella pneumoniae strain FDAARGOS_439 plasmid unnamed1, complete sequence	71309-71340	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP018460	Klebsiella pneumoniae strain Kp_Goe_39795 plasmid pKp_Goe_795-1, complete sequence	97649-97680	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP040540	Klebsiella pneumoniae strain CR-HvKP4 plasmid pCR-HvKP4-VIR, complete sequence	55592-55623	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	MF116002	Uncultured bacterium plasmid pLGP4 clone J53, complete sequence	45170-45201	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP029387	Klebsiella pneumoniae subsp. pneumoniae strain SCKP040074 plasmid pTetD_040074, complete sequence	21055-21086	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP011641	Serratia marcescens strain CAV1492 plasmid pCAV1492-199, complete sequence	191185-191216	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP020903	Klebsiella pneumoniae strain K66-45 plasmid pK66-45-2, complete sequence	77431-77462	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP045194	Klebsiella pneumoniae strain YML0508 plasmid pYML0508_1, complete sequence	19180-19211	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP045675	Klebsiella pneumoniae strain WSD411 plasmid pWSD411_2, complete sequence	27492-27523	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP047678	Klebsiella pneumoniae subsp. pneumoniae strain KUH-KPNHVF1 plasmid unnamed, complete sequence	107374-107405	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP028181	Klebsiella pneumoniae strain CFSAN054110 plasmid pGMI16-005_01, complete sequence	196311-196342	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP032173	Klebsiella pneumoniae strain AR_0160 plasmid unnamed1, complete sequence	113909-113940	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP026166	Klebsiella pneumoniae strain F81 plasmid pF81_2, complete sequence	31814-31845	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP031103	Leclercia sp. W17 plasmid pW17-2, complete sequence	77802-77833	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP052441	Klebsiella pneumoniae strain C16KP0102 plasmid pC16KP0102-1, complete sequence	21056-21087	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP052534	Klebsiella pneumoniae strain B16KP0157 plasmid pB16KP0157-1, complete sequence	21055-21086	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_LR025093	Klebsiella pneumoniae isolate KP9201 plasmid 2, complete sequence	124222-124253	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NC_006671	Escherichia coli A2363 plasmid pAPEC-O2-R, complete sequence	71466-71497	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP027603	UNVERIFIED_ORG: Klebsiella pneumoniae strain AR_0080 plasmid unnamed, complete sequence	220520-220551	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP017991	Enterobacter cloacae complex sp. ECNIH7 plasmid pENT-1ac, complete sequence	7287-7318	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP042521	Klebsiella pneumoniae strain C2 plasmid pC2_001, complete sequence	23292-23323	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP042546	Klebsiella michiganensis strain C52 plasmid pC52_001, complete sequence	16164-16195	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP046613	Klebsiella pneumoniae strain WCGKP294 plasmid pWCGKP294-1, complete sequence	170227-170258	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP021856	Klebsiella pneumoniae strain AR_0125 plasmid tig00000001_pilon, complete sequence	70954-70985	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP024500	Klebsiella pneumoniae strain KSB1_4E plasmid unnamed1, complete sequence	21056-21087	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP043734	Escherichia coli strain CVM N17EC1164 plasmid pN17EC1164-1, complete sequence	18568-18599	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP047676	Klebsiella pneumoniae subsp. pneumoniae strain KUH-KPNHVL1 plasmid unnamed, complete sequence	107374-107405	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP029724	Klebsiella pneumoniae strain AR_0140 plasmid unnamed2, complete sequence	46823-46854	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP034138	Klebsiella quasipneumoniae subsp. similipneumoniae strain G747 plasmid pG747_218.9Kb, complete sequence	195567-195598	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP027049	Klebsiella pneumoniae strain 20_GR_12 plasmid unnamed, complete sequence	70431-70462	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	MN823998	Klebsiella pneumoniae strain 161116753 plasmid p116753-FIIK, complete sequence	151909-151940	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	MN823999	Klebsiella pneumoniae strain 362713 plasmid p362713-FIIK, complete sequence	58768-58799	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP048303	Salmonella enterica subsp. enterica serovar Schwarzengrund strain WAPHL-SAL-A00375 plasmid p28945-2, complete sequence	134361-134392	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP052304	Klebsiella pneumoniae strain E16KP0172 plasmid pE16KP0172-1, complete sequence	26413-26444	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP052370	Klebsiella pneumoniae strain D16KP0087 plasmid pD16KP0087-1, complete sequence	21056-21087	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP051274	Salmonella enterica subsp. enterica serovar Worthington strain OLF-FSR1_WB_Partridge_SW-37 plasmid pSW37-267109, complete sequence	266479-266510	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP033347	Salmonella enterica subsp. enterica strain CFSA1096 plasmid pCFSA1096, complete sequence	156731-156762	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP011634	Klebsiella oxytoca strain CAV1374 plasmid pCAV1374-228, complete sequence	8924-8955	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP041453	Escherichia coli strain YPE3 plasmid pYPE3-92k-tetX4, complete sequence	66623-66654	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP042541	Enterobacter hormaechei strain C4 plasmid pC4_001, complete sequence	23136-23167	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP024508	Klebsiella pneumoniae strain KSB2_1B plasmid unnamed2, complete sequence	21056-21087	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP024551	Klebsiella pneumoniae strain INF163 plasmid unnamed2, complete sequence	21055-21086	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP032209	Klebsiella pneumoniae strain AR_0109 plasmid unnamed3, complete sequence	87428-87459	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP032186	Klebsiella pneumoniae strain AR_0075 plasmid unnamed1, complete sequence	133462-133493	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP027152	Klebsiella pneumoniae strain AR_0363 plasmid unnamed1, complete sequence	18252-18283	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP014697	Klebsiella quasipneumoniae strain ATCC 700603 isolate K6 plasmid pKQPS1, complete sequence	113621-113652	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	MN842293	Klebsiella pneumoniae strain 20130907-4 plasmid p309074-1FIIK, complete sequence	20785-20816	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	MG288679	Klebsiella pneumoniae plasmid p911021-tetA, complete sequence	156301-156332	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP052506	Klebsiella pneumoniae strain B16KP0226 plasmid pB16KP0226-1, complete sequence	21056-21087	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP052214	Klebsiella pneumoniae strain E17KP0079 plasmid pE17KP0079-1, complete sequence	21056-21087	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP051271	Salmonella enterica subsp. enterica serovar Worthington strain OLF-FSR1_WB_Quail_SW-70 plasmid pSW37-267106, complete sequence	249884-249915	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP052037	Klebsiella pneumoniae strain KPN41053 plasmid pKPN41953, complete sequence	67853-67884	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP015823	Klebsiella pneumoniae isolate blood sample 2 plasmid 1, complete sequence	11726-11757	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP021710	Klebsiella pneumoniae strain AR_0143 plasmid tig00000853, complete sequence	206031-206062	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP023488	Klebsiella pneumoniae subsp. pneumoniae strain ST101:960186733 plasmid p19-10_01, complete sequence	71952-71983	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP052204	Klebsiella pneumoniae strain F16KP0002 plasmid pF16KP0002-1, complete sequence	26413-26444	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP052504	Klebsiella pneumoniae strain B17KP0020 plasmid pB17KP0020-1, complete sequence	21055-21086	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP053365	Klebsiella pneumoniae strain BA2275 plasmid p1, complete sequence	242990-243021	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP018365	Klebsiella pneumoniae strain Kp_Goe_62629 plasmid pKp_Goe_629-1, complete sequence	116330-116361	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_AP018673	Klebsiella pneumoniae strain GSU10-3 plasmid pGSU10-3-2, complete sequence	3964-3995	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP033743	Citrobacter freundii strain FDAARGOS_549 plasmid unnamed, complete sequence	58619-58650	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NC_020132	Klebsiella pneumoniae strain BK32179 plasmid pBK32179, complete sequence	75032-75063	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NC_024992	Klebsiella pneumoniae plasmid pKp848CTX, complete sequence	74479-74510	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP023135	Klebsiella pneumoniae subsp. pneumoniae strain KpvK54 plasmid pKpvK54, complete sequence	161423-161454	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP011577	Klebsiella pneumoniae strain CAV1392 plasmid pCAV1392-131, complete sequence	119708-119739	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP011623	Klebsiella pneumoniae strain CAV1344 plasmid pCAV1344-250, complete sequence	248435-248466	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NC_023025	Cronobacter malonaticus plasmid p2, complete sequence	35571-35602	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP027161	Klebsiella pneumoniae strain AR_0361 plasmid unnamed1, complete sequence	58429-58460	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP022495	Salmonella enterica subsp. enterica serovar Derby strain SA20035215 plasmid unnamed1, complete sequence	48340-48371	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP040595	Klebsiella pneumoniae subsp. pneumoniae strain KpvST15_NDM plasmid pKpvST15, complete sequence	171335-171366	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP033798	Enterobacter roggenkampii strain FDAARGOS_523 plasmid unnamed2, complete sequence	8437-8468	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP018361	Klebsiella oxytoca strain CAV1752 plasmid pCAV1752-278, complete sequence	14571-14602	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP035197	Klebsiella pneumoniae strain LH375 plasmid pLH375_1, complete sequence	37604-37635	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP025009	Klebsiella pneumoniae strain AUSMDU00008119 plasmid pAUSMDU8119-1, complete sequence	21105-21136	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP022917	Klebsiella pneumoniae strain ST307PT04 plasmid pJYC04A, complete sequence	213706-213737	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP025577	Klebsiella pneumoniae strain 08EU827 plasmid p08EU827_1, complete sequence	132872-132903	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP050827	Klebsiella pneumoniae strain Bckp212 plasmid pBckp212-1, complete sequence	168159-168190	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP052237	Klebsiella pneumoniae strain E17KP0029 plasmid pE17KP0029-2, complete sequence	21056-21087	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP052521	Klebsiella pneumoniae strain B16KP0198 plasmid pB16KP0198-1, complete sequence	21055-21086	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP052178	Klebsiella pneumoniae strain F16KP0045 plasmid pF16KP0045-1, complete sequence	26414-26445	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP048776	Salmonella enterica subsp. enterica serovar Agona strain SG17-135 plasmid pSG17-135-HI2, complete sequence	151156-151187	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP042883	Klebsiella pneumoniae strain NMBU-W07E18 plasmid pNMBU-W07E18_01, complete sequence	21055-21086	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP047573	Escherichia coli strain 2EC1 plasmid p2EC1-2, complete sequence	15962-15993	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NC_019114	Salmonella enterica subsp. enterica serovar Heidelberg plasmid pSH111_227, complete sequence	118268-118299	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP031369	Klebsiella pneumoniae strain KpvST101_OXA-48 plasmid pKpvST101, complete sequence	35854-35885	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP041936	Klebsiella pneumoniae strain KP14003 plasmid unnamed2, complete sequence	25892-25923	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP035209	Klebsiella quasipneumoniae strain TH114 plasmid pTH114-1, complete sequence	22132-22163	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP024133	Escherichia coli strain 14EC007 plasmid p14EC007b, complete sequence	138922-138953	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP052435	Klebsiella pneumoniae strain C16KP0108 plasmid pC16KP0108-1, complete sequence	21055-21086	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP052140	Klebsiella pneumoniae strain F17KP0040 plasmid pF17KP0040-2, complete sequence	21056-21087	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP035211	Klebsiella pneumoniae strain TH164 plasmid pTH164-2, complete sequence	24398-24429	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP024543	Klebsiella pneumoniae strain INF042 plasmid unnamed1, complete sequence	27763-27794	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP041629	Escherichia coli strain PE15 plasmid pPE15-IncF, complete sequence	73986-74017	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	AP022358	Klebsiella pneumoniae E278 plasmid pE278_IMP6 DNA, complete sequence	141850-141881	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP052499	Klebsiella pneumoniae strain B17KP0021 plasmid pB17KP0021-1, complete sequence	21056-21087	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_AP014952	Klebsiella oxytoca strain JKo3 plasmid pKO_JKo3_1, complete sequence	174325-174356	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP054782	Klebsiella pneumoniae strain KP20194a plasmid pKP20194a-p2, complete sequence	79960-79991	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP028543	Klebsiella pneumoniae subsp. pneumoniae strain SCKP020143 plasmid p1_020143, complete sequence	21055-21086	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP028390	Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_095132, complete sequence	26420-26451	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP032842	Enterobacter hormaechei strain C15117 plasmid pSPRC-Echo1, complete sequence	272825-272856	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP018338	Klebsiella pneumoniae isolate Kp_Goe_154414 plasmid pKp_Goe_414-2, complete sequence	139672-139703	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP021697	Klebsiella pneumoniae strain AR_0158 plasmid tig00000161, complete sequence	185897-185928	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP024483	Klebsiella pneumoniae strain INF322 plasmid unnamed1, complete sequence	21056-21087	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP024484	Klebsiella pneumoniae strain INF322 plasmid unnamed2, complete sequence	11439-11470	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP034083	Klebsiella pneumoniae subsp. pneumoniae strain R210-2 plasmid pR210-2-vir, complete sequence	26420-26451	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP026851	UNVERIFIED_ORG: Enterobacter cloacae strain AR_0072 plasmid unnamed1	81659-81690	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_LR025089	Klebsiella pneumoniae isolate KP980 plasmid 2, complete sequence	173287-173318	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP050281	Klebsiella pneumoniae strain 9949 plasmid unnamed1, complete sequence	61897-61928	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP054265	Klebsiella pneumoniae strain 39427 plasmid pKPN39427.1, complete sequence	140062-140093	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP025340	Salmonella enterica subsp. enterica serovar Typhimurium strain BL10 plasmid p220k, complete sequence	126485-126516	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP054764	Klebsiella pneumoniae strain KP20194b2 plasmid pKP20194b2-p2, complete sequence	79961-79992	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP029383	Klebsiella pneumoniae subsp. pneumoniae strain SCKP020079 plasmid pVir_020079, complete sequence	138052-138083	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP028781	Klebsiella pneumoniae subsp. pneumoniae strain SCKP020046 plasmid pNDM5_020046, complete sequence	21055-21086	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP043934	Klebsiella pneumoniae strain 555 plasmid pSCKLB555-2, complete sequence	305-336	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP027425	Klebsiella oxytoca strain FDAARGOS_335 plasmid unnamed, complete sequence	94090-94121	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP026012	Klebsiella pneumoniae strain K2044 plasmid pK2044, complete sequence	121431-121462	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP026024	Klebsiella pneumoniae strain 11420 plasmid p11420-HVKP, complete sequence	157146-157177	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP021951	Klebsiella pneumoniae strain AR_0148 plasmid tig00000168_pilon, complete sequence	121512-121543	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP050823	Klebsiella pneumoniae strain Bckp091 plasmid pBckp091-1, complete sequence	14320-14351	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP050784	Salmonella enterica subsp. enterica serovar Indiana strain SI67 plasmid pSI67-1, complete sequence	137695-137726	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_AP019549	Klebsiella pneumoniae strain THC11 plasmid pTHC11-1, complete sequence	181676-181707	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP052477	Klebsiella pneumoniae strain C16KP0050 plasmid pC16KP0050-1, complete sequence	21055-21086	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_AP019401	Klebsiella pneumoniae strain E013 plasmid pE013, complete sequence	171594-171625	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_AP019405	Klebsiella pneumoniae strain E196 plasmid pE196_IMP6, complete sequence	239664-239695	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP054728	Klebsiella pneumoniae strain KP20194e plasmid pKP20194e-p2, complete sequence	79961-79992	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP025006	Klebsiella pneumoniae strain AUSMDU00003562 plasmid pAUSMDU3562-1, complete sequence	21103-21134	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP025145	Klebsiella pneumoniae strain NR5632 plasmid NR5632_p2, complete sequence	147572-147603	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP025148	Klebsiella pneumoniae strain KP1766 plasmid KP1766_p2, complete sequence	160400-160431	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP026716	Klebsiella oxytoca strain AR_0028 plasmid unitig_1_pilon, complete sequence	96498-96529	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP052243	Klebsiella pneumoniae strain E17KP0019 plasmid pE17KP0019-2, complete sequence	21056-21087	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP054734	Klebsiella pneumoniae strain KP20194d plasmid pKP20194d-p2, complete sequence	69366-69397	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP054722	Klebsiella pneumoniae strain KP20194f plasmid pKP20194f-p2, complete sequence	79961-79992	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	MH884652	Salmonella sp. strain Sa27 plasmid pSa27-CIP, complete sequence	91075-91106	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	MH884653	Salmonella sp. strain Sa27 plasmid pSa27-TC-CIP, complete sequence	91388-91419	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP041024	Klebsiella pneumoniae strain KP1692 plasmid pKP1692, complete sequence	152375-152406	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP027411	Salmonella enterica strain FDAARGOS_319 plasmid unnamed, complete sequence	229222-229253	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP036188	Klebsiella pneumoniae strain BA1559 plasmid pIncFIBK, complete sequence	62005-62036	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	CP050276	Klebsiella pneumoniae strain 10553 plasmid unnamed1, complete sequence	249423-249454	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	MK649822	Klebsiella pneumoniae strain 2579 plasmid p2579_1, complete sequence	27492-27523	9	0.719
LR134234_3	3.3\|2078177\|32\|LR134234\|CRISPRCasFinder,CRT	2078177-2078208	32	NZ_CP026937	Escherichia coli strain CFS3292 plasmid pCFS3292-2, complete sequence	96658-96689	9	0.719
LR134234_3	3.4\|2078238\|32\|LR134234\|CRISPRCasFinder,CRT	2078238-2078269	32	NZ_KX015668	Enterobacter cloacae strain CY01 plasmid pCY-CTX, complete sequence	115679-115710	9	0.719
LR134234_3	3.4\|2078238\|32\|LR134234\|CRISPRCasFinder,CRT	2078238-2078269	32	NZ_CP033346	Salmonella enterica subsp. enterica serovar Tennessee strain CFSAN076210 plasmid pCFSAN076210, complete sequence	16902-16933	9	0.719
LR134234_3	3.4\|2078238\|32\|LR134234\|CRISPRCasFinder,CRT	2078238-2078269	32	NZ_CP010386	Enterobacter hormaechei subsp. xiangfangensis strain 34399 plasmid p34399-121.660kb, complete sequence	40894-40925	9	0.719
LR134234_3	3.4\|2078238\|32\|LR134234\|CRISPRCasFinder,CRT	2078238-2078269	32	NZ_CP030078	Enterobacter hormaechei strain 20710 plasmid p4-20710, complete sequence	2056-2087	9	0.719
LR134234_3	3.4\|2078238\|32\|LR134234\|CRISPRCasFinder,CRT	2078238-2078269	32	NZ_CP029247	Enterobacter hormaechei subsp. xiangfangensis strain OSUVMCKPC4-2 plasmid pOSUEC_F, complete sequence	2047-2078	9	0.719
LR134234_3	3.4\|2078238\|32\|LR134234\|CRISPRCasFinder,CRT	2078238-2078269	32	NZ_CP048417	Citrobacter freundii strain CitB plasmid pA_CitB, complete sequence	2047-2078	9	0.719
LR134234_3	3.4\|2078238\|32\|LR134234\|CRISPRCasFinder,CRT	2078238-2078269	32	NZ_CP042573	Enterobacter hormaechei strain E5 plasmid pE5_002, complete sequence	2047-2078	9	0.719
LR134234_3	3.4\|2078238\|32\|LR134234\|CRISPRCasFinder,CRT	2078238-2078269	32	NZ_CP027605	UNVERIFIED_ORG: Enterobacter cloacae strain AR_0093 plasmid unnamed1, complete sequence	48296-48327	9	0.719
LR134234_3	3.4\|2078238\|32\|LR134234\|CRISPRCasFinder,CRT	2078238-2078269	32	NZ_CP051133	Enterobacter hormaechei strain AMS-38 plasmid pAMS-38a, complete sequence	19434-19465	9	0.719
LR134234_3	3.4\|2078238\|32\|LR134234\|CRISPRCasFinder,CRT	2078238-2078269	32	NZ_CP014995	Salmonella enterica subsp. enterica serovar Tennessee strain CFSAN001387 plasmid, complete sequence	66354-66385	9	0.719
LR134234_3	3.4\|2078238\|32\|LR134234\|CRISPRCasFinder,CRT	2078238-2078269	32	NZ_CP053193	Enterobacter hormaechei strain EGYMCRVIM plasmid pMS-37c, complete sequence	2056-2087	9	0.719
LR134234_3	3.4\|2078238\|32\|LR134234\|CRISPRCasFinder,CRT	2078238-2078269	32	NZ_CP023068	Ensifer sojae CCBAU 05684 plasmid pSJ05684b, complete sequence	72958-72989	9	0.719
LR134234_3	3.6\|2078360\|32\|LR134234\|CRISPRCasFinder,CRT	2078360-2078391	32	KT588075	Acinetobacter phage Ab105-2phi, complete genome	10451-10482	9	0.719
LR134234_3	3.12\|2078726\|32\|LR134234\|CRISPRCasFinder,CRT	2078726-2078757	32	NC_019911	Yersinia phage phi80-18 complete genome	19449-19480	9	0.719
LR134234_3	3.12\|2078726\|32\|LR134234\|CRISPRCasFinder,CRT	2078726-2078757	32	NC_047805	Yersinia phage fHe-Yen3-01, complete genome	20682-20713	9	0.719
LR134234_3	3.14\|2078848\|32\|LR134234\|CRISPRCasFinder,CRT	2078848-2078879	32	MN693437	Marine virus AFVG_25M476, complete genome	3051-3082	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP026049	Raoultella planticola strain FDAARGOS_64 plasmid unnamed2, complete sequence	60391-60422	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP026283	Klebsiella oxytoca strain KONIH2 plasmid pKOR-e6bf, complete sequence	67889-67920	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP018351	Klebsiella pneumoniae strain CAV1417 plasmid pCAV1417-185, complete sequence	126089-126120	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP018675	Klebsiella pneumoniae strain CAV1217 plasmid pKPC_CAV1217, complete sequence	64063-64094	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP032995	Escherichia coli strain W5-6 plasmid p3_W5-6, complete sequence	65532-65563	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP052329	Klebsiella pneumoniae strain D17KP0032 plasmid pD17KP0032-1, complete sequence	84972-85003	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP052168	Klebsiella pneumoniae strain F16KP0075 plasmid pF16KP0075-1, complete sequence	21055-21086	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_KX710093	Leclercia adecarboxylata strain pP10164 plasmid pP10164-2, complete sequence	172763-172794	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_KY271405	Klebsiella pneumoniae strain H151440672 plasmid pKPN3-307_typeB, complete sequence	87137-87168	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_KY271407	Klebsiella pneumoniae strain CIV-4 plasmid pKPN3-307_typeD, complete sequence	5987-6018	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP045446	Salmonella enterica subsp. enterica serovar Schwarzengrund strain 9355 plasmid p280_9355, complete sequence	123116-123147	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP014073	Klebsiella quasipneumoniae strain FDAARGOS_93 plasmid unnamed2, complete sequence	41291-41322	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	MN783747	Klebsiella oxytoca plasmid pIron_OXY, complete sequence	126581-126612	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP032195	Klebsiella pneumoniae strain AR_0097 plasmid unnamed1, complete sequence	140823-140854	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP050836	Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence	55131-55162	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP050847	Klebsiella pneumoniae strain Bckp206 plasmid pBckp206-2, complete sequence	27384-27415	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP041286	Escherichia coli strain 54 plasmid p54-tetX, complete sequence	76623-76654	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_KX636095	Klebsiella pneumoniae strain RJ119 plasmid pRJ119-NDM1, complete sequence	145724-145755	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_KX129784	Escherichia coli strain H226B plasmid pH226B, complete sequence	79543-79574	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP029739	Klebsiella pneumoniae strain AR_0087 plasmid unnamed1, complete sequence	56552-56583	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP028537	Enterobacter hormaechei strain SCEH020042 plasmid pQnrB4_020042, complete sequence	113798-113829	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP035548	Salmonella enterica subsp. enterica serovar Typhimurium strain YU07-18 plasmid pYU07-18_IncA/C2, complete sequence	95465-95496	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP052485	Klebsiella pneumoniae strain C16KP0036 plasmid pC16KP0036-1, complete sequence	21056-21087	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_KT203286	Klebsiella pneumoniae strain U25 plasmid PU25001, complete sequence	156534-156565	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_KR653209	Escherichia coli strain GDZ13 plasmid pGD0503Z13, complete sequence	189207-189238	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_KT347600	Escherichia coli strain EC5207 plasmid pEC5207, complete sequence	146671-146702	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP042628	Escherichia coli strain NCYU-25-82 plasmid pNCYU-25-82-1_MCR3, complete sequence	59166-59197	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP021752	Klebsiella pneumoniae strain AR_0113 plasmid unitig_1, complete sequence	109564-109595	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP025081	Klebsiella pneumoniae strain SGH10 plasmid pSGH10, complete sequence	27485-27516	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP025142	Klebsiella pneumoniae strain KP1768 plasmid KP1768_p2, complete sequence	150644-150675	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP031258	Klebsiella quasipneumoniae strain L22 plasmid pL22-1, complete sequence	158677-158708	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP026135	Klebsiella pneumoniae strain F5 plasmid pF5_3, complete sequence	42890-42921	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP018434	Klebsiella pneumoniae strain MNCRE53 plasmid pMNCRE53_4, complete sequence	75856-75887	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP044528	Klebsiella grimontii strain SS141 plasmid plamid_1, complete sequence	42343-42374	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP052163	Klebsiella pneumoniae strain F16KP0082 plasmid pF16KP0082-1, complete sequence	154295-154326	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP019195	Salmonella enterica subsp. enterica serovar Senftenberg str. ATCC 43845 plasmid pATCC43845, complete sequence	268794-268825	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	KY486279	Salmonella sp. strain SH-01 plasmid pSH-01, complete sequence	22960-22991	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP022125	Klebsiella pneumoniae strain DHQP1605752_NV plasmid p1605752FIB, complete sequence	42974-43005	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP018441	Klebsiella pneumoniae strain Kp_Goe_822917 plasmid pKp_Goe_917-1, complete sequence	2740-2771	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP043049	Klebsiella pneumoniae strain KLP268 plasmid pKLP268-3	164476-164507	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP019561	Escherichia coli strain KSC1031 plasmid pMRGN1031, complete sequence	36106-36137	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP019647	Salmonella enterica subsp. enterica serovar Typhimurium strain TW-Stm6 plasmid pSTM6-275, complete sequence	134010-134041	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP040123	Klebsiella pneumoniae strain LSH-KPN148 plasmid pLSH-KPN148-1, complete sequence	34520-34551	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP012256	Cronobacter sakazakii strain NCTC 8155 plasmid pCS3, complete sequence	24282-24313	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP013323	Klebsiella pneumoniae strain CAV1193 plasmid pCAV1193-258, complete sequence	255983-256014	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP029588	Klebsiella pneumoniae strain DA33141 plasmid pDA33141-217, complete sequence	17113-17144	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP030924	Klebsiella pneumoniae subsp. pneumoniae strain KC-Pl-HB1 plasmid pKC-Pl-HB1, complete sequence	150082-150113	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP034282	Klebsiella pneumoniae strain I72 plasmid p72_FIBkpn, complete sequence	108380-108411	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP026022	Klebsiella pneumoniae strain 11492 plasmid p11492-CTXM, complete sequence	31842-31873	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP014011	Klebsiella pneumoniae subsp. pneumoniae strain RJF999 plasmid pRJF999, complete sequence	153097-153128	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP037442	Klebsiella sp. PO552 plasmid p1, complete sequence	62272-62303	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP037743	Klebsiella pneumoniae strain ST23 plasmid pDHQP1701672_hv, complete sequence	26409-26440	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP052408	Klebsiella pneumoniae strain C17KP0008 plasmid pC17KP0008-1, complete sequence	21055-21086	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP052450	Klebsiella pneumoniae strain C16KP0077 plasmid pC16KP0077-1, complete sequence	21055-21086	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP023417	Klebsiella pneumoniae strain 1050 plasmid pKp1050-1, complete sequence	102049-102080	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP044256	Salmonella enterica strain CFSAN096147 plasmid pCFSAN096147, complete sequence	168104-168135	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NC_009649	Klebsiella pneumoniae subsp. pneumoniae MGH 78578 plasmid pKPN3, complete sequence	89263-89294	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP035215	Klebsiella michiganensis strain M82255 plasmid pKOCBH-A, complete sequence	179787-179818	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP035216	Klebsiella michiganensis strain M82255 plasmid pKOCBH-B, complete sequence	128793-128824	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP052491	Klebsiella pneumoniae strain B17KP0069 plasmid pB17KP0069-1, complete sequence	21056-21087	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP052159	Klebsiella pneumoniae strain F16KP0084 plasmid pF16KP0084-1, complete sequence	26413-26444	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP045449	Salmonella enterica subsp. enterica serovar Schwarzengrund strain 12888 plasmid p280_12888, complete sequence	123115-123146	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP040652	Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain SA20070548 plasmid pSA20070548.1, complete sequence	84052-84083	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP014649	Klebsiella pneumoniae strain KPNIH36 plasmid pKPN-fff, complete sequence	88889-88920	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP024193	Klebsiella pneumoniae isolate KSB1_5D plasmid unnamed2, complete sequence	21055-21086	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP011977	Klebsiella pneumoniae DMC1097 plasmid pDMC1097-218.836kb, complete sequence	127356-127387	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NC_014107	Enterobacter cloacae subsp. cloacae ATCC 13047 plasmid pECL_A, complete sequence	27583-27614	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	MT035874	Klebsiella pneumoniae strain KP18-3-8 plasmid pKP18-3-8_KPC_vir, complete sequence	26420-26451	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP052401	Klebsiella pneumoniae strain C17KP0039 plasmid pC17KP0039-2, complete sequence	21055-21086	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP052572	Klebsiella pneumoniae strain A16KP0016 plasmid pA16KP0016-1, complete sequence	21056-21087	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP053729	Escherichia coli strain CP61_Sichuan plasmid pCP61-IncFIB, complete sequence	29389-29420	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	MN200128	Klebsiella pneumoniae strain 17ZR-91 plasmid p17ZR-91-Vir-RC, complete sequence	169653-169684	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	MN200130	Escherichia coli strain EC600 plasmid p17ZR-91-TC1, complete sequence	169636-169667	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP041928	Klebsiella pneumoniae strain 18-2374 plasmid pSECR18-2374A, complete sequence	85156-85187	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP010393	Klebsiella pneumoniae strain 34618 plasmid p34618-207.543kb, complete sequence	75175-75206	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP029448	Serratia marcescens strain CAV1761 plasmid pCAV1761-205, complete sequence	123752-123783	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP026276	Klebsiella oxytoca strain KONIH5 plasmid pKOR-ab4d, complete sequence	202830-202861	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP020508	Serratia marcescens strain BWH-35 plasmid unnamed, complete sequence	112508-112539	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP035636	Enterobacter cloacae strain EN3600 plasmid unnamed4, complete sequence	11554-11585	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP052296	Klebsiella pneumoniae strain E16KP0210 plasmid pE16KP0210-1, complete sequence	21055-21086	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP053738	Escherichia coli strain CP8-3_Sichuan plasmid pCP8-3-IncFIB, complete sequence	51427-51458	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP042507	Leclercia adecarboxylata strain E1 plasmid pE1_002, complete sequence	184657-184688	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	MN543573	Klebsiella pneumoniae strain GH44 plasmid pGH44_216, complete sequence	21055-21086	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP033956	Klebsiella pneumoniae strain L39_2 plasmid p3_L39, complete sequence	79961-79992	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP019559	Escherichia coli strain KSC207 plasmid pMRGN207, complete sequence	195888-195919	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP047092	Salmonella sp. S13 plasmid pS13-3, complete sequence	52747-52778	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NC_022078	Klebsiella pneumoniae JM45 plasmid p1, complete sequence	211041-211072	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	KX023259	Escherichia coli plasmid pSCE516-4, complete sequence	17135-17166	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP026170	Leclercia sp. LSNIH1 plasmid pLEC-000f, complete sequence	1298-1329	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP051431	Escherichia sp. SCLE84 plasmid pSCLE1, complete sequence	175887-175918	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP052432	Klebsiella pneumoniae strain C16KP0122 plasmid pC16KP0122-1, complete sequence	26420-26451	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP052144	Klebsiella pneumoniae strain F17KP0012 plasmid pF17KP0012-1, complete sequence	26413-26444	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP052363	Klebsiella pneumoniae strain D16KP0122 plasmid pD16KP0122-1, complete sequence	27496-27527	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NC_009838	Escherichia coli APEC O1 plasmid pAPEC-O1-R, complete sequence	125062-125093	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NC_020261	Cronobacter sakazakii SP291 plasmid pSP291-2, complete sequence	15851-15882	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP046001	Escherichia coli strain 1916D6 plasmid p1916D6-1, complete sequence	37537-37568	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP024882	Citrobacter freundii strain AR_0022 plasmid unitig_1_pilon, complete sequence	79794-79825	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP028954	Klebsiella pneumoniae strain AR_0141 plasmid unnamed1, complete sequence	108856-108887	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP021103	Escherichia coli strain 13P477T plasmid p13P477T-7, complete sequence	28466-28497	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP006642	Escherichia coli PCN061 plasmid PCN061p6, complete sequence	18335-18366	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP008789	Klebsiella oxytoca KONIH1 plasmid pKOX-137, complete sequence	7282-7313	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP033627	Klebsiella pneumoniae strain 4743 plasmid unnamed2, complete sequence	19718-19749	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP027037	Klebsiella pneumoniae strain 16_GR_13 plasmid IncFIB IncFII, complete sequence	135488-135519	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP036302	Klebsiella pneumoniae subsp. pneumoniae strain WCHKP015093 plasmid p1_015093, complete sequence	21055-21086	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_LR130542	Klebsiella pneumoniae strain AJ218 isolate AJ218 plasmid 2	21055-21086	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NC_023332	Klebsiella pneumoniae strain ST48 plasmid pKP09085, complete sequence	54076-54107	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NC_023333	Klebsiella pneumoniae strain ST23 plasmid pKP007, complete sequence	51301-51332	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NC_023334	Klebsiella pneumoniae strain ST15 plasmid pKP02022, complete sequence	51301-51332	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP009871	Pantoea sp. PSNIH2 plasmid pPSP-cd6, complete sequence	12062-12093	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP012682	Salmonella enterica subsp. enterica serovar Typhimurium strain 33676 plasmid p33676_IncA/C, complete sequence	33654-33685	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP045188	Escherichia coli strain NT1F31 plasmid pNT1F31-tetX4, complete sequence	39224-39255	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP019049	Klebsiella pneumoniae subsp. pneumoniae strain RJA166 plasmid pRJA166b, complete sequence	87716-87747	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP020499	Klebsiella pneumoniae strain BWHC1 plasmid unnamed1, complete sequence	78665-78696	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP020506	Serratia marcescens strain 95 plasmid unnamed1, complete sequence	76683-76714	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP025038	Klebsiella pneumoniae strain NU-CRE047 plasmid pNU-CRE047_1, complete sequence	139081-139112	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP031547	Escherichia coli strain cq9 plasmid unnamed1, complete sequence	56633-56664	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	MK347226	Klebsiella pneumoniae strain K185 plasmid pK185_rmpA2, complete sequence	55694-55725	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	MK347227	Klebsiella pneumoniae strain K187 plasmid pK187_rmpA2, complete sequence	55586-55617	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	MK347228	Klebsiella pneumoniae strain K195 plasmid pK195_rmpA2, complete sequence	55588-55619	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	MK347229	Klebsiella pneumoniae strain K199 plasmid pK199_rmpA2, complete sequence	55591-55622	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	MK347230	Klebsiella pneumoniae strain K202 plasmid pK202_rmpA2, complete sequence	55686-55717	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	MK347231	Klebsiella pneumoniae strain K204 plasmid pK204_rmpA2, complete sequence	55589-55620	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	MK347232	Klebsiella pneumoniae strain K211 plasmid pK211_rmpA2, complete sequence	55665-55696	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	MK347233	Klebsiella pneumoniae strain K214 plasmid pK214_rmpA2, complete sequence	55670-55701	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	MK347234	Klebsiella pneumoniae strain K230 plasmid pK230_rmpA2, complete sequence	55677-55708	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	MK347235	Klebsiella pneumoniae strain K232 plasmid pK232_rmpA2, complete sequence	55685-55716	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	MK347236	Klebsiella pneumoniae strain K234 plasmid pK234_rmpA2, complete sequence	55672-55703	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	MK347237	Klebsiella pneumoniae strain K235 plasmid pK235_rmpA2, complete sequence	55677-55708	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	MK347238	Klebsiella pneumoniae strain K239 plasmid pK239_rmpA2, complete sequence	55588-55619	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP052405	Klebsiella pneumoniae strain C17KP0020 plasmid pC17KP0020-1, complete sequence	21055-21086	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP052137	Klebsiella pneumoniae strain F17KP0054 plasmid pF17KP0054-1, complete sequence	21055-21086	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP018693	Klebsiella pneumoniae strain Kp_Goe_821588 plasmid pKp_Goe_588-1, complete sequence	133570-133601	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP024708	Klebsiella pneumoniae strain cr-hvkp3 plasmid pPUTH1, complete sequence	147210-147241	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP034776	Klebsiella pneumoniae strain 18CPO060 plasmid phvKP060, complete sequence	77940-77971	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP042639	Escherichia coli strain NCYU-24-74 plasmid pNCYU-24-74-1, complete sequence	145904-145935	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP015135	Klebsiella pneumoniae strain ATCC 35657 plasmid p35657-1, complete sequence	156655-156686	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP045662	Klebsiella pneumoniae strain SMU18037509 plasmid unnamed1, complete sequence	51803-51834	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP020842	Klebsiella pneumoniae strain KPN1482 plasmid pKPN1482-1, complete sequence	33130-33161	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP020855	Klebsiella pneumoniae strain KPN528 plasmid pKPN528-2, complete sequence	178834-178865	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP044301	Escherichia coli strain P59A plasmid pP59A-3, complete sequence	44110-44141	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP031811	Klebsiella pneumoniae strain INF014-sc-2279884 plasmid unnamed1, complete sequence	10565-10596	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP025277	Salmonella enterica subsp. enterica strain USDA-ARS-USMARC-60984 plasmid pSJO-60984, complete sequence	131995-132026	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP017182	Enterobacter kobei strain DSM 13645 plasmid pDSMZ13645, complete sequence	21421-21452	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP013942	Cronobacter malonaticus LMG 23826 plasmid pCMA2, complete sequence	44399-44430	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	MN891675	Klebsiella pneumoniae strain 358573 plasmid p358573-KPC, complete sequence	139490-139521	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP052357	Klebsiella pneumoniae strain D16KP0144 plasmid pD16KP0144-1, complete sequence	26413-26444	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	LC549807	Klebsiella pneumoniae VNCKp115 plasmid pVNCKp115 DNA, complete sequence	81995-82026	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_LR134257	Klebsiella aerogenes strain NCTC9644 plasmid 4, complete sequence	33461-33492	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP041645	Klebsiella pneumoniae strain NKU_Kleb8A7 plasmid pKleb8A7, complete sequence	84060-84091	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP041949	Klebsiella pneumoniae strain KP2 plasmid pKP2_3, complete sequence	21055-21086	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP020838	Klebsiella pneumoniae strain BK13043 plasmid pBK13043-1, complete sequence	171910-171941	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP031569	Enterobacter hormaechei strain 2013_1a plasmid pIncFIB-1301491, complete sequence	128829-128860	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP031563	Klebsiella pneumoniae strain 2-1 plasmid pKP21HI1, complete sequence	43617-43648	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP030182	Salmonella enterica strain SA20030575 plasmid pSA20030575.1, complete sequence	119066-119097	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP028784	Klebsiella pneumoniae strain SCKP020049 plasmid p1_020049, complete sequence	18575-18606	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP027054	Klebsiella pneumoniae strain 2_GR_12 plasmid IncFIB IncFII	91698-91729	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP052445	Klebsiella pneumoniae strain C16KP0098 plasmid pC16KP0098-2, complete sequence	26414-26445	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP052570	Klebsiella pneumoniae strain A16KP0119 plasmid pA16KP0119-1, complete sequence	21055-21086	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP052218	Klebsiella pneumoniae strain E17KP0053 plasmid pE17KP0053-1, complete sequence	21055-21086	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP040894	Leclercia adecarboxylata strain Z96-1 plasmid pZ96-1_3, complete sequence	45062-45093	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP035380	Leclercia adecarboxylata strain R25 plasmid pLA-109, complete sequence	104667-104698	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP014009	Klebsiella pneumoniae subsp. pneumoniae strain RJF293 plasmid pRJF293, complete sequence	87695-87726	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP023479	Klebsiella quasipneumoniae strain KPC142 plasmid pKQPS142a, complete sequence	171975-172006	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	MN310373	Klebsiella pneumoniae strain BJ20 plasmid pBJ20-tetA, complete sequence	21981-22012	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	MN310374	Klebsiella pneumoniae strain 2016071221 plasmid p71221-tetA, complete sequence	108173-108204	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	MN310376	Klebsiella pneumoniae strain 08291 plasmid pW08291-tetA, complete sequence	22250-22281	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	MN310380	Raoultella ornithinolytica strain 170602815 plasmid p602815-NR, complete sequence	42027-42058	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP018424	Klebsiella pneumoniae strain MNCRE69 plasmid pMNCRE69_4, complete sequence	75856-75887	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP049605	Klebsiella pneumoniae strain Kp8701 plasmid unnamed, complete sequence	91344-91375	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	MH909331	Leclercia adecarboxylata plasmid p707804-NDM, complete sequence	220327-220358	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	AP020333	Salmonella enterica SESen3709 plasmid pSESen3709_1 DNA, complete genome	153774-153805	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP031736	Klebsiella pneumoniae subsp. pneumoniae strain Klebsiella pneumoniae plasmid pKPM502, complete sequence	139670-139701	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP034251	Salmonella enterica subsp. enterica serovar Derby strain Sa64 plasmid pSa64T-188, complete sequence	39196-39227	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP035916	Salmonella enterica strain S61394 plasmid pLS61394-MCR, complete sequence	118121-118152	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP039577	Salmonella enterica subsp. enterica serovar Typhimurium strain PNCS014856 plasmid p10-3857.1, complete sequence	89792-89823	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP029591	Klebsiella pneumoniae strain DA33144 plasmid pDA33144-220, complete sequence	138188-138219	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP012989	Klebsiella pneumoniae strain KpN01 plasmid pKpN01-SIL, complete sequence	99350-99381	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP018818	Klebsiella pneumoniae strain AR_0049 plasmid unitig_2, complete sequence	10679-10710	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP037966	Klebsiella pneumoniae strain SCKP020135 plasmid p1_020135, complete sequence	18575-18606	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP038140	Escherichia coli strain G3X16-2 plasmid pG3X16-2-3, complete sequence	114151-114182	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP052321	Klebsiella pneumoniae strain E16KP0035 plasmid pE16KP0035-1, complete sequence	10544-10575	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP052148	Klebsiella pneumoniae strain F16KP0108 plasmid pF16KP0108-1, complete sequence	21056-21087	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP019019	Escherichia coli strain Ecol_244 plasmid pEC244_1, complete sequence	69340-69371	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NC_021654	Klebsiella pneumoniae plasmid pKN-LS6, complete sequence	152482-152513	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	LR134211	Klebsiella aerogenes strain NCTC418 genome assembly, plasmid: 2	83102-83133	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP041084	Klebsiella pneumoniae strain Kp202 plasmid pKp202_2, complete sequence	21052-21083	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP042616	Escherichia coli strain NCYU-26-73 plasmid pNCYU-26-73-1, complete sequence	27538-27569	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP026274	Klebsiella oxytoca strain KONIH4 plasmid pKPC-4b66, complete sequence	59413-59444	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP031799	Klebsiella pneumoniae strain QMP B2-170 plasmid unnamed, complete sequence	65278-65309	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP036337	Klebsiella pneumoniae strain BP327 plasmid pIncFIBK, complete sequence	141984-142015	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP050011	Citrobacter sp. Y3 plasmid unnamed2, complete sequence	61173-61204	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP052415	Klebsiella pneumoniae strain C16KP0189 plasmid pC16KP0189-1, complete sequence	21055-21086	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP052559	Klebsiella pneumoniae strain A17KP0008 plasmid pA17KP0008-2, complete sequence	21056-21087	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP052270	Klebsiella pneumoniae strain E16KP0268 plasmid pE16K0268-2, complete sequence	21056-21087	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NC_005249	Klebsiella pneumoniae CG43 plasmid pLVPK, complete sequence	173018-173049	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NC_016966	Klebsiella pneumoniae plasmid pUUH239.2, complete sequence	51299-51330	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP031284	Escherichia fergusonii strain 40A plasmid p280_40A, complete sequence	265202-265233	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP041514	Klebsiella michiganensis strain KNU07 plasmid unnamed, complete sequence	26245-26276	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP041100	Klebsiella pneumoniae subsp. pneumoniae strain KPCTRSRTH07 plasmid unnamed1, complete sequence	22272-22303	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP041375	Klebsiella pneumoniae strain KP58 plasmid pKP58-2, complete sequence	81161-81192	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP042482	Klebsiella pneumoniae strain C51 plasmid pC51_001, complete sequence	21479-21510	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	MK461930	Escherichia coli strain 2009_36 plasmid p2009_36_HI2, complete sequence	157333-157364	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP021834	Klebsiella pneumoniae strain AR_0120 plasmid tig00000500_pilon, complete sequence	76432-76463	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP027613	Klebsiella pneumoniae subsp. ozaenae strain AR_0096 plasmid unnamed1, complete sequence	186405-186436	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP024875	Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence	202698-202729	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP022692	Klebsiella pneumoniae subsp. pneumoniae strain AUSMDU00008079 plasmid pAUSMDU00008079_01, complete sequence	21055-21086	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP022920	Klebsiella pneumoniae strain ST307PT03 plasmid pJYC03A, complete sequence	200876-200907	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP034326	Klebsiella pneumoniae isolate KSH203 plasmid pKSH203-qnrS, complete sequence	26887-26918	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP035180	Klebsiella pneumoniae strain BA33875 plasmid pBA33875_IncFIB, complete sequence	133223-133254	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NC_008573	Shewanella sp. ANA-3 plasmid unnamed1, complete sequence	181590-181621	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP025212	Klebsiella pneumoniae strain HZW25 plasmid unnamed1, complete sequence	86557-86588	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP052232	Klebsiella pneumoniae strain E17KP0033 plasmid pE17KP0033-1, complete sequence	26413-26444	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP052873	Enterobacter cloacae strain 3849 plasmid p3846III, complete sequence	17877-17908	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP021958	Klebsiella pneumoniae strain AR_0139 plasmid tig00000002_u	81477-81508	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP040546	Klebsiella pneumoniae strain CR-HvKP5 plasmid pCR-HvKP5-VIR, complete sequence	74607-74638	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP028792	Klebsiella pneumoniae strain WCHKP020030 plasmid pQnrS1_020030, complete sequence	21871-21902	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP033823	Klebsiella sp. FDAARGOS_511 plasmid unnamed1, complete sequence	167029-167060	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP015132	Klebsiella pneumoniae strain Kpn555 plasmid pKPN-d90, complete sequence	139746-139777	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP012572	Klebsiella pneumoniae strain UCLAOXA232KP plasmid pUCLAOXA232-6.X, complete sequence	143194-143225	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP042513	Serratia marcescens strain E28 plasmid pE28_001, complete sequence	22132-22163	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP032241	Klebsiella pneumoniae strain XJ-K2 plasmid unnamed1, complete sequence	157014-157045	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP046273	Enterobacter hormaechei strain E70 plasmid pE70-sul2, complete sequence	23136-23167	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP029136	Klebsiella pneumoniae strain AR376 plasmid unnamed2, complete sequence	105327-105358	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP047460	Escherichia coli strain ZF31 plasmid pZF31-tetX-119kb, complete sequence	61533-61564	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP047466	Escherichia coli strain ZF34 plasmid pZF34-tetX-114kb, complete sequence	8849-8880	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP052176	Klebsiella pneumoniae strain F16KP0050 plasmid pF16KP0050-1, complete sequence	21056-21087	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP052193	Klebsiella pneumoniae strain F16KP0014 plasmid pF16KP0014-1, complete sequence	21056-21087	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP014121	Klebsiella pneumoniae strain FDAARGOS_156 plasmid unnamed1, complete sequence	34821-34852	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_LT991959	Enterobacter cloacae complex sp. isolate C45 plasmid pC45-p2	22817-22848	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	LC511658	Escherichia coli 2017.03.03CC plasmid p2017_03_03CC DNA, complete genome	135929-135960	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP029037	Salmonella enterica subsp. enterica serovar Senftenberg str. 361154004 plasmid unnamed, complete sequence	73977-74008	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP041640	Klebsiella pneumoniae strain PIMB15ND2KP27 plasmid pKP27-MPH, complete sequence	43686-43717	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP043854	Enterobacter hormaechei strain EB_P6_L3_02.19 plasmid unnamed1, complete sequence	72852-72883	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP026752	Klebsiella pneumoniae strain AR_0066 plasmid tig00000080_pilon, complete sequence	84059-84090	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP018886	Klebsiella pneumoniae subsp. pneumoniae strain BR21 plasmid pIncF, complete sequence	30717-30748	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP039857	Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014876 plasmid p15-0756.1, complete sequence	83640-83671	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP039809	Klebsiella pneumoniae strain C2660 plasmid pC2660-2, complete sequence	21055-21086	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP029101	Klebsiella pneumoniae strain AR438 plasmid unnamed3, complete sequence	48003-48034	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP040862	Klebsiella pneumoniae strain Xen39 plasmid unnamed3, complete sequence	183500-183531	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP036191	Klebsiella pneumoniae strain BA34918 plasmid pvirulence_VBA34918, complete sequence	90627-90658	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP040025	Klebsiella pneumoniae strain KPC160132 plasmid pKpn3-L132, complete sequence	21056-21087	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP052266	Klebsiella pneumoniae strain E16KP0287 plasmid pE16K0287-1, complete sequence	21055-21086	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP052561	Klebsiella pneumoniae strain A17KP0004 plasmid pA17KP0004-1, complete sequence	21056-21087	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP052209	Klebsiella pneumoniae strain E17KP0085 plasmid pE17KP0085-2, complete sequence	21056-21087	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NC_006625	Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 plasmid pK2044, complete sequence	102690-102721	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP022734	Escherichia coli strain SA186 plasmid pSA186_5, complete sequence	52395-52426	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP038004	Klebsiella pneumoniae strain SCKP020009 plasmid pLAP2_020009, complete sequence	23518-23549	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP007734	Klebsiella pneumoniae subsp. pneumoniae KPNIH27 plasmid pKPN-262, complete sequence	70555-70586	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP026175	Klebsiella pneumoniae strain KPNIH50 plasmid pKPC-0cc9, complete sequence	142171-142202	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP026179	Klebsiella pneumoniae strain KPNIH49 plasmid pKPC-224e, complete sequence	215477-215508	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP026185	Klebsiella pneumoniae strain KPNIH49 plasmid pKPN-9a0d, complete sequence	14706-14737	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP026186	Klebsiella pneumoniae strain KPNIH49 plasmid pKPN-3967, complete sequence	141228-141259	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP028995	Klebsiella pneumoniae strain AR_0079 plasmid unnamed6, complete sequence	21694-21725	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP031815	Klebsiella pneumoniae strain KSB1_7F-sc-2280268 plasmid unnamed1, complete sequence	70329-70360	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP033402	Klebsiella pneumoniae strain WCHKP115069 plasmid p1_115069, complete sequence	21055-21086	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP039526	Klebsiella pneumoniae subsp. pneumoniae strain HB25-1 plasmid pHB25-1-vir, complete sequence	134438-134469	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP052302	Klebsiella pneumoniae strain E16KP0180 plasmid pE16KP0180-1, complete sequence	21055-21086	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP018355	Klebsiella pneumoniae strain CAV1453 plasmid pCAV1453-208, complete sequence	14591-14622	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP043751	Escherichia coli strain CVM N62675 plasmid pN62675, complete sequence	58583-58614	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP031583	Klebsiella pneumoniae strain N4b plasmid pIncFII-1502320, complete sequence	104373-104404	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP029598	Klebsiella quasipneumoniae subsp. similipneumoniae strain ATCC 700603 plasmid pDA33145-152, complete sequence	70441-70472	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP031614	Klebsiella pneumoniae strain ZYST1 plasmid pZYST1C1, complete sequence	168396-168427	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP047337	Klebsiella pneumoniae strain 2019036D plasmid p2019036D-mcr8-345kb, complete sequence	45989-46020	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP019214	Escherichia coli strain WCHEC050613 plasmid pMCR_WCHEC050613, complete sequence	126822-126853	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP021544	Klebsiella pneumoniae strain AR_0112 plasmid tig00000000, complete sequence	197032-197063	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP021540	Klebsiella pneumoniae strain AR_0047 plasmid tig00000001, complete sequence	201327-201358	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP021686	Klebsiella pneumoniae strain AR_0146 plasmid tig00001160, complete sequence	66354-66385	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP043545	Escherichia coli strain F2_81 plasmid pF2_18C_HI2, complete sequence	126513-126544	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP012169	Enterobacter hormaechei subsp. steigerwaltii strain 34998 plasmid p34998-210.894kb, complete sequence	23136-23167	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP022926	Klebsiella pneumoniae strain ST307PT01 plasmid pJYC01A, complete sequence	67389-67420	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP036307	Klebsiella pneumoniae strain WCHKP020098 plasmid p1_020098, complete sequence	23518-23549	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP022149	Enterobacter roggenkampii strain 704SK10 plasmid p704SK10_1, complete sequence	33744-33775	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	KT896504	Klebsiella pneumoniae strain I11 plasmid pKPSH11, complete sequence	21870-21901	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP036176	Klebsiella huaxiensis strain WCHKl090001 plasmid p1_090001, complete sequence	15823-15854	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP052380	Klebsiella pneumoniae strain D16KP0017 plasmid pD16KP0017-1, complete sequence	21055-21086	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP052563	Klebsiella pneumoniae strain A16KP0135 plasmid pA16KP0135-1, complete sequence	26408-26439	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP052525	Klebsiella pneumoniae strain B16KP0177 plasmid pB16KP0177-1, complete sequence	25094-25125	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	LT009688	Klebsiella pneumoniae plasmid pIT-06C07, strain O6CO7, complete sequence	53285-53316	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP030003	Salmonella enterica subsp. enterica serovar Brandenburg strain SA20064858 plasmid pSA20064858.1, complete sequence	27749-27780	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP030066	Klebsiella pneumoniae strain IA565 plasmid pDA11912.1, complete sequence	151884-151915	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP028549	Klebsiella variicola strain WCHKP19 plasmid p1_020019, complete sequence	16894-16925	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP009865	Klebsiella pneumoniae subsp. pneumoniae strain KPNIH29 plasmid pKPN-80a, complete sequence	107910-107941	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP009879	Klebsiella pneumoniae subsp. pneumoniae strain KPNIH31 plasmid pKPN-c22, complete sequence	171715-171746	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP009777	Klebsiella pneumoniae subsp. pneumoniae strain KPNIH32 plasmid pKPN-a68, complete sequence	70308-70339	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP008800	Klebsiella pneumoniae subsp. pneumoniae KPNIH24 plasmid pKPN-e44, complete sequence	104596-104627	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP044036	Klebsiella pneumoniae strain FDAARGOS_630 plasmid unnamed2, complete sequence	118108-118139	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP024153	Escherichia coli strain 14EC033 plasmid p14EC033f, complete sequence	75618-75649	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP046950	Klebsiella pneumoniae strain BD_DM_914 plasmid punnamed1, complete sequence	21056-21087	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP046940	Klebsiella pneumoniae strain BD_DM_697 plasmid punnamed1	98907-98938	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP006927	Klebsiella pneumoniae 30660/NJST258_1 plasmid pNJST258N1, complete sequence	69638-69669	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP008930	Klebsiella pneumoniae strain PMK1 plasmid pPMK1-A, complete sequence	115196-115227	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP007729	Klebsiella pneumoniae subsp. pneumoniae KPNIH10 plasmid pKPN-498, complete sequence	117056-117087	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP052282	Klebsiella pneumoniae strain E16KP0224 plasmid pE16KP0224-2, complete sequence	21057-21088	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP006663	Klebsiella pneumoniae strain ATCC BAA-2146 plasmid pCuAs, complete sequence	86728-86759	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP009855	UNVERIFIED_ORG: Enterobacter cloacae strain ECNIH5 plasmid pENT-22e, complete sequence	100676-100707	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP024144	Escherichia coli strain 14EC029 plasmid p14EC029c, complete sequence	1276-1307	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP026390	Leclercia sp. LSNIH3 plasmid pLEC-5e18, complete sequence	162961-162992	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP008907	Enterobacter hormaechei subsp. hoffmannii ECR091 plasmid pENT-4bd, complete sequence	58042-58073	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP029143	Klebsiella michiganensis strain AR375 plasmid unnamed3, complete sequence	95049-95080	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP048380	Klebsiella variicola strain 118 plasmid p118_A, complete sequence	122218-122249	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP030920	Escherichia coli strain KL53 plasmid pKL53-L, complete sequence	102780-102811	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP026397	Klebsiella pneumoniae strain KPNIH48 plasmid pKPN-10f7, complete sequence	138430-138461	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP052288	Klebsiella pneumoniae strain E16KP0218 plasmid pE16KP0218-2, complete sequence	21056-21087	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP008842	Klebsiella michiganensis strain M1 plasmid pKOXM1A, complete sequence	118065-118096	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP026058	Citrobacter freundii strain FDAARGOS_73 plasmid unnamed2, complete sequence	57437-57468	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP022824	Klebsiella quasivariicola strain KPN1705 plasmid pKPN1705-1, complete sequence	23481-23512	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_AP019666	Klebsiella pneumoniae strain TA6363 plasmid pTMTA63631, complete sequence	16416-16447	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP020062	Klebsiella pneumoniae strain AR_0117 plasmid unitig_1, complete sequence	19148-19179	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP020072	Klebsiella pneumoniae strain AR_0115 plasmid tig00000002, complete sequence	190390-190421	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP020109	Klebsiella pneumoniae strain AR_0098 plasmid tig00000001, complete sequence	28465-28496	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP047193	Klebsiella pneumoniae strain Kp36 plasmid unnamed1, complete sequence	102687-102718	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP029435	Klebsiella quasipneumoniae strain CAV2013 plasmid pCAV2013-156, complete sequence	1080-1111	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP029430	Klebsiella quasipneumoniae strain CAV2018 plasmid pCAV2018-177, complete sequence	127222-127253	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP029430	Klebsiella quasipneumoniae strain CAV2018 plasmid pCAV2018-177, complete sequence	159500-159531	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP015386	Klebsiella pneumoniae strain NY9 plasmid pNY9_1, complete sequence	22121-22152	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP020069	Klebsiella pneumoniae strain AR_0068 plasmid unitig_2, complete sequence	20855-20886	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP012567	Klebsiella pneumoniae strain UCLAOXA232KP plasmid pUCLAOXA232-6, complete sequence	176480-176511	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP010154	Escherichia coli strain D9 plasmid B, complete genome	23974-24005	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP024537	Klebsiella pneumoniae strain KSB1_9D plasmid unnamed2, complete sequence	21055-21086	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP024516	Klebsiella pneumoniae strain KSB1_10J plasmid unnamed1, complete sequence	21056-21087	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP032988	Escherichia coli strain BE2-5 plasmid p2_BE2-5, complete sequence	80086-80117	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP036443	Klebsiella pneumoniae strain ABFPV plasmid tig00001208_pilon, complete sequence	112528-112559	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP050379	Klebsiella pneumoniae strain 51015 plasmid p51015_CTX_M_15, complete sequence	92277-92308	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP035906	Klebsiella pneumoniae strain BA4656 plasmid unnamed1, complete sequence	25475-25506	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP025516	Klebsiella pneumoniae strain 002SK2 plasmid p002SK2_A, complete sequence	51727-51758	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP052276	Klebsiella pneumoniae strain E16KP0241 plasmid pE16KP0241-1, complete sequence	21056-21087	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	MF943217	Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_WCHKP13F2, complete sequence	183354-183385	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP032164	Klebsiella pneumoniae strain XJ-K1 plasmid unnamed1, complete sequence	119916-119947	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP025457	Klebsiella pneumoniae strain KP69 plasmid p69-1, complete sequence	135628-135659	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP024130	Escherichia coli strain 14EC001 plasmid p14EC001c, complete sequence	87142-87173	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP034416	Klebsiella pneumoniae strain C789 plasmid pVir-CR-hvKP-C789, complete sequence	26420-26451	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP011429	Salmonella enterica subsp. enterica serovar Typhimurium strain YU39 isolate YUHS 05-78 plasmid pYU39_IncA/C, complete sequence	94608-94639	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP034130	Klebsiella quasipneumoniae strain G4584 plasmid pG4584_218.9Kb, complete sequence	195601-195632	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP034681	Klebsiella quasipneumoniae strain D120-1 plasmid pD120-1_296kb, complete sequence	140936-140967	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	MF918373	Klebsiella pneumoniae plasmid p1512-dfrA, complete sequence	100460-100491	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP052423	Klebsiella pneumoniae strain C16KP0164 plasmid pC16KP0164-1, complete sequence	22212-22243	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP052545	Klebsiella pneumoniae strain B16KP0102 plasmid pB16KP0102-1, complete sequence	21055-21086	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP052298	Klebsiella pneumoniae strain E16KP0204 plasmid pE16KP0204-1, complete sequence	21056-21087	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_LR130549	Klebsiella pneumoniae strain KPC2 isolate KPC2 plasmid 2	21055-21086	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP032491	Salmonella enterica subsp. enterica serovar Typhimurium strain SL26 plasmid pSL26_IncA/C2, complete sequence	100943-100974	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP032495	Salmonella enterica subsp. enterica serovar Typhimurium strain SO21 plasmid pSO21_118, complete sequence	31736-31767	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP046382	Klebsiella pneumoniae strain BD_DM_782 plasmid punnamed1, complete sequence	21056-21087	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP022574	Klebsiella pneumoniae strain BIC-1 plasmid pBIC-1a, complete sequence	111321-111352	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP050373	Klebsiella pneumoniae strain 50595 plasmid p50595_IncFII, complete sequence	10677-10708	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP050174	Escherichia coli strain STB20-1 plasmid pSTB20-1T, complete sequence	71124-71155	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP048299	Salmonella enterica subsp. enterica serovar Schwarzengrund strain WAPHL_SAL-A00527 plasmid pN1566-2, complete sequence	289102-289133	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP052190	Klebsiella pneumoniae strain F16KP0019 plasmid pF16KP0019-1, complete sequence	26413-26444	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP052387	Klebsiella pneumoniae strain C17KP0055 plasmid pC17KP0055-1, complete sequence	22122-22153	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NC_005211	Serratia marcescens plasmid R478, complete sequence	129723-129754	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NC_021198	Klebsiella pneumoniae subsp. pneumoniae KPX plasmid pKPX-1 DNA, complete sequence	112875-112906	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP012884	Klebsiella pneumoniae KP-1 plasmid pKP1-19, complete sequence	39445-39476	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP026661	Salmonella enterica subsp. enterica strain 15-SA01028 plasmid pSE15-SA01028, complete sequence	140856-140887	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP018670	Klebsiella pneumoniae strain CAV1042 plasmid pCAV1042-183, complete sequence	52604-52635	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP028804	Klebsiella pneumoniae strain WCHKP7E2 plasmid pCMY2_085072, complete sequence	162624-162655	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP021713	Klebsiella pneumoniae strain AR_0129 plasmid tig00000000, complete sequence	115393-115424	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP030270	Klebsiella pneumoniae subsp. pneumoniae strain SC-7 plasmid pSC7-vir, complete sequence	26426-26457	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP030343	Klebsiella pneumoniae strain AR_362 plasmid unnamed1, complete sequence	80809-80840	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP035384	Klebsiella pneumoniae strain AP8555 plasmid pAP855, complete sequence	158839-158870	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP026151	Klebsiella pneumoniae strain F138 plasmid pF138_2, complete sequence	70847-70878	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP040030	Klebsiella pneumoniae strain KPC160121 plasmid pQnr-L121, complete sequence	21056-21087	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP052538	Klebsiella pneumoniae strain B16KP0141 plasmid pB16KP0141-1, complete sequence	21056-21087	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP023917	Klebsiella pneumoniae strain FDAARGOS_439 plasmid unnamed1, complete sequence	71309-71340	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP018460	Klebsiella pneumoniae strain Kp_Goe_39795 plasmid pKp_Goe_795-1, complete sequence	97649-97680	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP040540	Klebsiella pneumoniae strain CR-HvKP4 plasmid pCR-HvKP4-VIR, complete sequence	55592-55623	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	MF116002	Uncultured bacterium plasmid pLGP4 clone J53, complete sequence	45170-45201	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP029387	Klebsiella pneumoniae subsp. pneumoniae strain SCKP040074 plasmid pTetD_040074, complete sequence	21055-21086	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP011641	Serratia marcescens strain CAV1492 plasmid pCAV1492-199, complete sequence	191185-191216	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP020903	Klebsiella pneumoniae strain K66-45 plasmid pK66-45-2, complete sequence	77431-77462	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP045194	Klebsiella pneumoniae strain YML0508 plasmid pYML0508_1, complete sequence	19180-19211	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP045675	Klebsiella pneumoniae strain WSD411 plasmid pWSD411_2, complete sequence	27492-27523	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP047678	Klebsiella pneumoniae subsp. pneumoniae strain KUH-KPNHVF1 plasmid unnamed, complete sequence	107374-107405	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP028181	Klebsiella pneumoniae strain CFSAN054110 plasmid pGMI16-005_01, complete sequence	196311-196342	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP032173	Klebsiella pneumoniae strain AR_0160 plasmid unnamed1, complete sequence	113909-113940	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP026166	Klebsiella pneumoniae strain F81 plasmid pF81_2, complete sequence	31814-31845	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP031103	Leclercia sp. W17 plasmid pW17-2, complete sequence	77802-77833	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP052441	Klebsiella pneumoniae strain C16KP0102 plasmid pC16KP0102-1, complete sequence	21056-21087	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP052534	Klebsiella pneumoniae strain B16KP0157 plasmid pB16KP0157-1, complete sequence	21055-21086	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_LR025093	Klebsiella pneumoniae isolate KP9201 plasmid 2, complete sequence	124222-124253	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NC_006671	Escherichia coli A2363 plasmid pAPEC-O2-R, complete sequence	71466-71497	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP027603	UNVERIFIED_ORG: Klebsiella pneumoniae strain AR_0080 plasmid unnamed, complete sequence	220520-220551	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP017991	Enterobacter cloacae complex sp. ECNIH7 plasmid pENT-1ac, complete sequence	7287-7318	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP042521	Klebsiella pneumoniae strain C2 plasmid pC2_001, complete sequence	23292-23323	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP042546	Klebsiella michiganensis strain C52 plasmid pC52_001, complete sequence	16164-16195	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP046613	Klebsiella pneumoniae strain WCGKP294 plasmid pWCGKP294-1, complete sequence	170227-170258	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP021856	Klebsiella pneumoniae strain AR_0125 plasmid tig00000001_pilon, complete sequence	70954-70985	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP024500	Klebsiella pneumoniae strain KSB1_4E plasmid unnamed1, complete sequence	21056-21087	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP043734	Escherichia coli strain CVM N17EC1164 plasmid pN17EC1164-1, complete sequence	18568-18599	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP047676	Klebsiella pneumoniae subsp. pneumoniae strain KUH-KPNHVL1 plasmid unnamed, complete sequence	107374-107405	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP029724	Klebsiella pneumoniae strain AR_0140 plasmid unnamed2, complete sequence	46823-46854	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP034138	Klebsiella quasipneumoniae subsp. similipneumoniae strain G747 plasmid pG747_218.9Kb, complete sequence	195567-195598	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP027049	Klebsiella pneumoniae strain 20_GR_12 plasmid unnamed, complete sequence	70431-70462	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	MN823998	Klebsiella pneumoniae strain 161116753 plasmid p116753-FIIK, complete sequence	151909-151940	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	MN823999	Klebsiella pneumoniae strain 362713 plasmid p362713-FIIK, complete sequence	58768-58799	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP048303	Salmonella enterica subsp. enterica serovar Schwarzengrund strain WAPHL-SAL-A00375 plasmid p28945-2, complete sequence	134361-134392	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP052304	Klebsiella pneumoniae strain E16KP0172 plasmid pE16KP0172-1, complete sequence	26413-26444	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP052370	Klebsiella pneumoniae strain D16KP0087 plasmid pD16KP0087-1, complete sequence	21056-21087	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP051274	Salmonella enterica subsp. enterica serovar Worthington strain OLF-FSR1_WB_Partridge_SW-37 plasmid pSW37-267109, complete sequence	266479-266510	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP033347	Salmonella enterica subsp. enterica strain CFSA1096 plasmid pCFSA1096, complete sequence	156731-156762	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP011634	Klebsiella oxytoca strain CAV1374 plasmid pCAV1374-228, complete sequence	8924-8955	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP041453	Escherichia coli strain YPE3 plasmid pYPE3-92k-tetX4, complete sequence	66623-66654	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP042541	Enterobacter hormaechei strain C4 plasmid pC4_001, complete sequence	23136-23167	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP024508	Klebsiella pneumoniae strain KSB2_1B plasmid unnamed2, complete sequence	21056-21087	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP024551	Klebsiella pneumoniae strain INF163 plasmid unnamed2, complete sequence	21055-21086	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP032209	Klebsiella pneumoniae strain AR_0109 plasmid unnamed3, complete sequence	87428-87459	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP032186	Klebsiella pneumoniae strain AR_0075 plasmid unnamed1, complete sequence	133462-133493	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP027152	Klebsiella pneumoniae strain AR_0363 plasmid unnamed1, complete sequence	18252-18283	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP014697	Klebsiella quasipneumoniae strain ATCC 700603 isolate K6 plasmid pKQPS1, complete sequence	113621-113652	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	MN842293	Klebsiella pneumoniae strain 20130907-4 plasmid p309074-1FIIK, complete sequence	20785-20816	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	MG288679	Klebsiella pneumoniae plasmid p911021-tetA, complete sequence	156301-156332	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP052506	Klebsiella pneumoniae strain B16KP0226 plasmid pB16KP0226-1, complete sequence	21056-21087	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP052214	Klebsiella pneumoniae strain E17KP0079 plasmid pE17KP0079-1, complete sequence	21056-21087	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP051271	Salmonella enterica subsp. enterica serovar Worthington strain OLF-FSR1_WB_Quail_SW-70 plasmid pSW37-267106, complete sequence	249884-249915	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP052037	Klebsiella pneumoniae strain KPN41053 plasmid pKPN41953, complete sequence	67853-67884	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP015823	Klebsiella pneumoniae isolate blood sample 2 plasmid 1, complete sequence	11726-11757	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP021710	Klebsiella pneumoniae strain AR_0143 plasmid tig00000853, complete sequence	206031-206062	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP023488	Klebsiella pneumoniae subsp. pneumoniae strain ST101:960186733 plasmid p19-10_01, complete sequence	71952-71983	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP052204	Klebsiella pneumoniae strain F16KP0002 plasmid pF16KP0002-1, complete sequence	26413-26444	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP052504	Klebsiella pneumoniae strain B17KP0020 plasmid pB17KP0020-1, complete sequence	21055-21086	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP053365	Klebsiella pneumoniae strain BA2275 plasmid p1, complete sequence	242990-243021	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP018365	Klebsiella pneumoniae strain Kp_Goe_62629 plasmid pKp_Goe_629-1, complete sequence	116330-116361	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_AP018673	Klebsiella pneumoniae strain GSU10-3 plasmid pGSU10-3-2, complete sequence	3964-3995	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP033743	Citrobacter freundii strain FDAARGOS_549 plasmid unnamed, complete sequence	58619-58650	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NC_020132	Klebsiella pneumoniae strain BK32179 plasmid pBK32179, complete sequence	75032-75063	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NC_024992	Klebsiella pneumoniae plasmid pKp848CTX, complete sequence	74479-74510	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP023135	Klebsiella pneumoniae subsp. pneumoniae strain KpvK54 plasmid pKpvK54, complete sequence	161423-161454	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP011577	Klebsiella pneumoniae strain CAV1392 plasmid pCAV1392-131, complete sequence	119708-119739	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP011623	Klebsiella pneumoniae strain CAV1344 plasmid pCAV1344-250, complete sequence	248435-248466	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NC_023025	Cronobacter malonaticus plasmid p2, complete sequence	35571-35602	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP027161	Klebsiella pneumoniae strain AR_0361 plasmid unnamed1, complete sequence	58429-58460	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP022495	Salmonella enterica subsp. enterica serovar Derby strain SA20035215 plasmid unnamed1, complete sequence	48340-48371	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP040595	Klebsiella pneumoniae subsp. pneumoniae strain KpvST15_NDM plasmid pKpvST15, complete sequence	171335-171366	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP033798	Enterobacter roggenkampii strain FDAARGOS_523 plasmid unnamed2, complete sequence	8437-8468	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP018361	Klebsiella oxytoca strain CAV1752 plasmid pCAV1752-278, complete sequence	14571-14602	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP035197	Klebsiella pneumoniae strain LH375 plasmid pLH375_1, complete sequence	37604-37635	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP025009	Klebsiella pneumoniae strain AUSMDU00008119 plasmid pAUSMDU8119-1, complete sequence	21105-21136	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP022917	Klebsiella pneumoniae strain ST307PT04 plasmid pJYC04A, complete sequence	213706-213737	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP025577	Klebsiella pneumoniae strain 08EU827 plasmid p08EU827_1, complete sequence	132872-132903	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP050827	Klebsiella pneumoniae strain Bckp212 plasmid pBckp212-1, complete sequence	168159-168190	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP052237	Klebsiella pneumoniae strain E17KP0029 plasmid pE17KP0029-2, complete sequence	21056-21087	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP052521	Klebsiella pneumoniae strain B16KP0198 plasmid pB16KP0198-1, complete sequence	21055-21086	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP052178	Klebsiella pneumoniae strain F16KP0045 plasmid pF16KP0045-1, complete sequence	26414-26445	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP048776	Salmonella enterica subsp. enterica serovar Agona strain SG17-135 plasmid pSG17-135-HI2, complete sequence	151156-151187	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP042883	Klebsiella pneumoniae strain NMBU-W07E18 plasmid pNMBU-W07E18_01, complete sequence	21055-21086	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP047573	Escherichia coli strain 2EC1 plasmid p2EC1-2, complete sequence	15962-15993	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NC_019114	Salmonella enterica subsp. enterica serovar Heidelberg plasmid pSH111_227, complete sequence	118268-118299	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP031369	Klebsiella pneumoniae strain KpvST101_OXA-48 plasmid pKpvST101, complete sequence	35854-35885	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP041936	Klebsiella pneumoniae strain KP14003 plasmid unnamed2, complete sequence	25892-25923	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP035209	Klebsiella quasipneumoniae strain TH114 plasmid pTH114-1, complete sequence	22132-22163	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP024133	Escherichia coli strain 14EC007 plasmid p14EC007b, complete sequence	138922-138953	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP052435	Klebsiella pneumoniae strain C16KP0108 plasmid pC16KP0108-1, complete sequence	21055-21086	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP052140	Klebsiella pneumoniae strain F17KP0040 plasmid pF17KP0040-2, complete sequence	21056-21087	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP035211	Klebsiella pneumoniae strain TH164 plasmid pTH164-2, complete sequence	24398-24429	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP024543	Klebsiella pneumoniae strain INF042 plasmid unnamed1, complete sequence	27763-27794	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP041629	Escherichia coli strain PE15 plasmid pPE15-IncF, complete sequence	73986-74017	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	AP022358	Klebsiella pneumoniae E278 plasmid pE278_IMP6 DNA, complete sequence	141850-141881	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP052499	Klebsiella pneumoniae strain B17KP0021 plasmid pB17KP0021-1, complete sequence	21056-21087	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_AP014952	Klebsiella oxytoca strain JKo3 plasmid pKO_JKo3_1, complete sequence	174325-174356	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP054782	Klebsiella pneumoniae strain KP20194a plasmid pKP20194a-p2, complete sequence	79960-79991	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP028543	Klebsiella pneumoniae subsp. pneumoniae strain SCKP020143 plasmid p1_020143, complete sequence	21055-21086	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP028390	Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_095132, complete sequence	26420-26451	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP032842	Enterobacter hormaechei strain C15117 plasmid pSPRC-Echo1, complete sequence	272825-272856	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP018338	Klebsiella pneumoniae isolate Kp_Goe_154414 plasmid pKp_Goe_414-2, complete sequence	139672-139703	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP021697	Klebsiella pneumoniae strain AR_0158 plasmid tig00000161, complete sequence	185897-185928	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP024483	Klebsiella pneumoniae strain INF322 plasmid unnamed1, complete sequence	21056-21087	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP024484	Klebsiella pneumoniae strain INF322 plasmid unnamed2, complete sequence	11439-11470	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP034083	Klebsiella pneumoniae subsp. pneumoniae strain R210-2 plasmid pR210-2-vir, complete sequence	26420-26451	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP026851	UNVERIFIED_ORG: Enterobacter cloacae strain AR_0072 plasmid unnamed1	81659-81690	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_LR025089	Klebsiella pneumoniae isolate KP980 plasmid 2, complete sequence	173287-173318	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP050281	Klebsiella pneumoniae strain 9949 plasmid unnamed1, complete sequence	61897-61928	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP054265	Klebsiella pneumoniae strain 39427 plasmid pKPN39427.1, complete sequence	140062-140093	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP025340	Salmonella enterica subsp. enterica serovar Typhimurium strain BL10 plasmid p220k, complete sequence	126485-126516	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP054764	Klebsiella pneumoniae strain KP20194b2 plasmid pKP20194b2-p2, complete sequence	79961-79992	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP029383	Klebsiella pneumoniae subsp. pneumoniae strain SCKP020079 plasmid pVir_020079, complete sequence	138052-138083	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP028781	Klebsiella pneumoniae subsp. pneumoniae strain SCKP020046 plasmid pNDM5_020046, complete sequence	21055-21086	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP043934	Klebsiella pneumoniae strain 555 plasmid pSCKLB555-2, complete sequence	305-336	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP027425	Klebsiella oxytoca strain FDAARGOS_335 plasmid unnamed, complete sequence	94090-94121	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP026012	Klebsiella pneumoniae strain K2044 plasmid pK2044, complete sequence	121431-121462	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP026024	Klebsiella pneumoniae strain 11420 plasmid p11420-HVKP, complete sequence	157146-157177	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP021951	Klebsiella pneumoniae strain AR_0148 plasmid tig00000168_pilon, complete sequence	121512-121543	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP050823	Klebsiella pneumoniae strain Bckp091 plasmid pBckp091-1, complete sequence	14320-14351	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP050784	Salmonella enterica subsp. enterica serovar Indiana strain SI67 plasmid pSI67-1, complete sequence	137695-137726	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_AP019549	Klebsiella pneumoniae strain THC11 plasmid pTHC11-1, complete sequence	181676-181707	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP052477	Klebsiella pneumoniae strain C16KP0050 plasmid pC16KP0050-1, complete sequence	21055-21086	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_AP019401	Klebsiella pneumoniae strain E013 plasmid pE013, complete sequence	171594-171625	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_AP019405	Klebsiella pneumoniae strain E196 plasmid pE196_IMP6, complete sequence	239664-239695	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP054728	Klebsiella pneumoniae strain KP20194e plasmid pKP20194e-p2, complete sequence	79961-79992	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP025006	Klebsiella pneumoniae strain AUSMDU00003562 plasmid pAUSMDU3562-1, complete sequence	21103-21134	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP025145	Klebsiella pneumoniae strain NR5632 plasmid NR5632_p2, complete sequence	147572-147603	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP025148	Klebsiella pneumoniae strain KP1766 plasmid KP1766_p2, complete sequence	160400-160431	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP026716	Klebsiella oxytoca strain AR_0028 plasmid unitig_1_pilon, complete sequence	96498-96529	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP052243	Klebsiella pneumoniae strain E17KP0019 plasmid pE17KP0019-2, complete sequence	21056-21087	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP054734	Klebsiella pneumoniae strain KP20194d plasmid pKP20194d-p2, complete sequence	69366-69397	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP054722	Klebsiella pneumoniae strain KP20194f plasmid pKP20194f-p2, complete sequence	79961-79992	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	MH884652	Salmonella sp. strain Sa27 plasmid pSa27-CIP, complete sequence	91075-91106	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	MH884653	Salmonella sp. strain Sa27 plasmid pSa27-TC-CIP, complete sequence	91388-91419	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP041024	Klebsiella pneumoniae strain KP1692 plasmid pKP1692, complete sequence	152375-152406	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP027411	Salmonella enterica strain FDAARGOS_319 plasmid unnamed, complete sequence	229222-229253	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP036188	Klebsiella pneumoniae strain BA1559 plasmid pIncFIBK, complete sequence	62005-62036	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	CP050276	Klebsiella pneumoniae strain 10553 plasmid unnamed1, complete sequence	249423-249454	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	MK649822	Klebsiella pneumoniae strain 2579 plasmid p2579_1, complete sequence	27492-27523	9	0.719
LR134234_3	3.18\|2078178\|32\|LR134234\|PILER-CR	2078178-2078209	32	NZ_CP026937	Escherichia coli strain CFS3292 plasmid pCFS3292-2, complete sequence	96658-96689	9	0.719
LR134234_3	3.19\|2078239\|32\|LR134234\|PILER-CR	2078239-2078270	32	NZ_KX015668	Enterobacter cloacae strain CY01 plasmid pCY-CTX, complete sequence	115679-115710	9	0.719
LR134234_3	3.19\|2078239\|32\|LR134234\|PILER-CR	2078239-2078270	32	NZ_CP033346	Salmonella enterica subsp. enterica serovar Tennessee strain CFSAN076210 plasmid pCFSAN076210, complete sequence	16902-16933	9	0.719
LR134234_3	3.19\|2078239\|32\|LR134234\|PILER-CR	2078239-2078270	32	NZ_CP010386	Enterobacter hormaechei subsp. xiangfangensis strain 34399 plasmid p34399-121.660kb, complete sequence	40894-40925	9	0.719
LR134234_3	3.19\|2078239\|32\|LR134234\|PILER-CR	2078239-2078270	32	NZ_CP030078	Enterobacter hormaechei strain 20710 plasmid p4-20710, complete sequence	2056-2087	9	0.719
LR134234_3	3.19\|2078239\|32\|LR134234\|PILER-CR	2078239-2078270	32	NZ_CP029247	Enterobacter hormaechei subsp. xiangfangensis strain OSUVMCKPC4-2 plasmid pOSUEC_F, complete sequence	2047-2078	9	0.719
LR134234_3	3.19\|2078239\|32\|LR134234\|PILER-CR	2078239-2078270	32	NZ_CP048417	Citrobacter freundii strain CitB plasmid pA_CitB, complete sequence	2047-2078	9	0.719
LR134234_3	3.19\|2078239\|32\|LR134234\|PILER-CR	2078239-2078270	32	NZ_CP042573	Enterobacter hormaechei strain E5 plasmid pE5_002, complete sequence	2047-2078	9	0.719
LR134234_3	3.19\|2078239\|32\|LR134234\|PILER-CR	2078239-2078270	32	NZ_CP027605	UNVERIFIED_ORG: Enterobacter cloacae strain AR_0093 plasmid unnamed1, complete sequence	48296-48327	9	0.719
LR134234_3	3.19\|2078239\|32\|LR134234\|PILER-CR	2078239-2078270	32	NZ_CP051133	Enterobacter hormaechei strain AMS-38 plasmid pAMS-38a, complete sequence	19434-19465	9	0.719
LR134234_3	3.19\|2078239\|32\|LR134234\|PILER-CR	2078239-2078270	32	NZ_CP014995	Salmonella enterica subsp. enterica serovar Tennessee strain CFSAN001387 plasmid, complete sequence	66354-66385	9	0.719
LR134234_3	3.19\|2078239\|32\|LR134234\|PILER-CR	2078239-2078270	32	NZ_CP053193	Enterobacter hormaechei strain EGYMCRVIM plasmid pMS-37c, complete sequence	2056-2087	9	0.719
LR134234_3	3.19\|2078239\|32\|LR134234\|PILER-CR	2078239-2078270	32	NZ_CP023068	Ensifer sojae CCBAU 05684 plasmid pSJ05684b, complete sequence	72958-72989	9	0.719
LR134234_3	3.21\|2078361\|32\|LR134234\|PILER-CR	2078361-2078392	32	KT588075	Acinetobacter phage Ab105-2phi, complete genome	10451-10482	9	0.719
LR134234_3	3.27\|2078727\|32\|LR134234\|PILER-CR	2078727-2078758	32	NC_019911	Yersinia phage phi80-18 complete genome	19449-19480	9	0.719
LR134234_3	3.27\|2078727\|32\|LR134234\|PILER-CR	2078727-2078758	32	NC_047805	Yersinia phage fHe-Yen3-01, complete genome	20682-20713	9	0.719
LR134234_3	3.29\|2078849\|32\|LR134234\|PILER-CR	2078849-2078880	32	MN693437	Marine virus AFVG_25M476, complete genome	3051-3082	9	0.719
LR134234_3	3.4\|2078238\|32\|LR134234\|CRISPRCasFinder,CRT	2078238-2078269	32	NZ_CP016452	Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence	1979379-1979410	10	0.688
LR134234_3	3.19\|2078239\|32\|LR134234\|PILER-CR	2078239-2078270	32	NZ_CP016452	Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence	1979379-1979410	10	0.688
LR134234_2	2.1\|2052019\|34\|LR134234\|CRT	2052019-2052052	34	NZ_CP017563	Paraburkholderia sprentiae WSM5005 plasmid pl1WSM5005, complete sequence	141276-141309	11	0.676

1. spacer 1.1|1642230|43|LR134234|CRISPRCasFinder matches to NC_016160 (Escherichia phage HK75, complete genome) position: , mismatch: 0, identity: 1.0

gttggacaatctccgctgagagccgcgccattactggtgtttg	CRISPR spacer
gttggacaatctccgctgagagccgcgccattactggtgtttg	Protospacer
*******************************************

2. spacer 1.1|1642230|43|LR134234|CRISPRCasFinder matches to NC_019705 (Enterobacteria phage mEpX2, complete genome) position: , mismatch: 0, identity: 1.0

gttggacaatctccgctgagagccgcgccattactggtgtttg	CRISPR spacer
gttggacaatctccgctgagagccgcgccattactggtgtttg	Protospacer
*******************************************

3. spacer 1.1|1642230|43|LR134234|CRISPRCasFinder matches to KY979108 (Escherichia phage ECP1, complete genome) position: , mismatch: 0, identity: 1.0

gttggacaatctccgctgagagccgcgccattactggtgtttg	CRISPR spacer
gttggacaatctccgctgagagccgcgccattactggtgtttg	Protospacer
*******************************************

4. spacer 1.1|1642230|43|LR134234|CRISPRCasFinder matches to NC_019719 (Enterobacteria phage HK633, complete genome) position: , mismatch: 0, identity: 1.0

gttggacaatctccgctgagagccgcgccattactggtgtttg	CRISPR spacer
gttggacaatctccgctgagagccgcgccattactggtgtttg	Protospacer
*******************************************

5. spacer 1.1|1642230|43|LR134234|CRISPRCasFinder matches to JF974339 (Enterobacteria phage IME10, complete genome) position: , mismatch: 0, identity: 1.0

gttggacaatctccgctgagagccgcgccattactggtgtttg	CRISPR spacer
gttggacaatctccgctgagagccgcgccattactggtgtttg	Protospacer
*******************************************

6. spacer 1.1|1642230|43|LR134234|CRISPRCasFinder matches to NC_005344 (Enterobacteria phage Sf6, complete genome) position: , mismatch: 0, identity: 1.0

gttggacaatctccgctgagagccgcgccattactggtgtttg	CRISPR spacer
gttggacaatctccgctgagagccgcgccattactggtgtttg	Protospacer
*******************************************

7. spacer 1.1|1642230|43|LR134234|CRISPRCasFinder matches to NC_019715 (Enterobacterial phage mEp234, complete genome) position: , mismatch: 1, identity: 0.977

gttggacaatctccgctgagagccgcgccattactggtgtttg	CRISPR spacer
gttggacaatctccgctgagatccgcgccattactggtgtttg	Protospacer
********************* *********************

8. spacer 1.1|1642230|43|LR134234|CRISPRCasFinder matches to NC_019711 (Enterobacteria phage HK629, complete genome) position: , mismatch: 1, identity: 0.977

gttggacaatctccgctgagagccgcgccattactggtgtttg	CRISPR spacer
gttggacaatctccgctgagagacgcgccattactggtgtttg	Protospacer
********************** ********************

9. spacer 1.1|1642230|43|LR134234|CRISPRCasFinder matches to NC_019769 (Enterobacteria phage HK542, complete genome) position: , mismatch: 1, identity: 0.977

gttggacaatctccgctgagagccgcgccattactggtgtttg	CRISPR spacer
gttggacaatctccgctgagagccgcaccattactggtgtttg	Protospacer
**************************.****************

10. spacer 1.1|1642230|43|LR134234|CRISPRCasFinder matches to NC_019768 (Enterobacteria phage HK106, complete genome) position: , mismatch: 1, identity: 0.977

gttggacaatctccgctgagagccgcgccattactggtgtttg	CRISPR spacer
gttggacaatctccgctgagatccgcgccattactggtgtttg	Protospacer
********************* *********************

11. spacer 2.1|2052019|34|LR134234|CRT matches to LC542972 (Escherichia coli IOMTU792 plasmid pIOMTU792 DNA, complete sequence) position: , mismatch: 3, identity: 0.912

tctaagtgatatccatcatcgcatccagtgcgcc	CRISPR spacer
tccaagtgatgtccatcatcgcatccagtgcgtc	Protospacer
**.*******.*********************.*

12. spacer 3.4|2078238|32|LR134234|CRISPRCasFinder,CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 7, identity: 0.781

aagacgacgtgatccgcaaagtcgaaggcacg	CRISPR spacer
aggagaacgtgatccgcaacgtcgaaggcgtt	Protospacer
*.** .************* *********..

13. spacer 3.9|2078543|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP038598 (Salmonella enterica subsp. enterica serovar Hadar strain 12-2388 plasmid p12-2388.3, complete sequence) position: , mismatch: 7, identity: 0.781

----cgataacacagggccgtcaatgcggccctttt	CRISPR spacer
tctccga----aaagggccgctaatgcggccctttt	Protospacer
    ***    * *******..**************

14. spacer 3.9|2078543|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP033827 (Klebsiella sp. FDAARGOS_511 plasmid unnamed4, complete sequence) position: , mismatch: 7, identity: 0.781

----cgataacacagggccgtcaatgcggccctttt	CRISPR spacer
tctccga----aaagggccgctaatgcggccctttt	Protospacer
    ***    * *******..**************

15. spacer 3.9|2078543|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP029125 (Enterobacter hormaechei strain AR432 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.781

----cgataacacagggccgtcaatgcggccctttt	CRISPR spacer
tctccga----aaagggccgctaatgcggccctttt	Protospacer
    ***    * *******..**************

16. spacer 3.9|2078543|32|LR134234|CRISPRCasFinder,CRT matches to NZ_AP019693 (Salmonella enterica subsp. enterica serovar Senftenberg strain SL180013 plasmid pSL180013-1, complete sequence) position: , mismatch: 7, identity: 0.781

----cgataacacagggccgtcaatgcggccctttt	CRISPR spacer
tctccga----aaagggccgctaatgcggccctttt	Protospacer
    ***    * *******..**************

17. spacer 3.9|2078543|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP030192 (Salmonella enterica strain SA20104250 plasmid pSA20104250.2, complete sequence) position: , mismatch: 7, identity: 0.781

----cgataacacagggccgtcaatgcggccctttt	CRISPR spacer
tctccga----aaagggccgctaatgcggccctttt	Protospacer
    ***    * *******..**************

18. spacer 3.9|2078543|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP039274 (Salmonella enterica subsp. enterica serovar Senftenberg str. CFSAN004025 plasmid pCFSAN004025.4, complete sequence) position: , mismatch: 7, identity: 0.781

----cgataacacagggccgtcaatgcggccctttt	CRISPR spacer
tctccga----aaagggccgctaatgcggccctttt	Protospacer
    ***    * *******..**************

19. spacer 3.9|2078543|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP016528 (Salmonella enterica subsp. enterica serovar Heidelberg strain 09-036813-1A plasmid p09-036813-1A_4, complete sequence) position: , mismatch: 7, identity: 0.781

----cgataacacagggccgtcaatgcggccctttt	CRISPR spacer
tctccga----aaagggccgctaatgcggccctttt	Protospacer
    ***    * *******..**************

20. spacer 3.9|2078543|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP030227 (Salmonella enterica strain SA20041605 plasmid pSA20041605.2, complete sequence) position: , mismatch: 7, identity: 0.781

----cgataacacagggccgtcaatgcggccctttt	CRISPR spacer
tctccga----aaagggccgctaatgcggccctttt	Protospacer
    ***    * *******..**************

21. spacer 3.9|2078543|32|LR134234|CRISPRCasFinder,CRT matches to NC_013090 (Endophytic bacterium LOB-07 plasmid pLK39, complete sequence) position: , mismatch: 7, identity: 0.781

----cgataacacagggccgtcaatgcggccctttt	CRISPR spacer
tctccga----aaagggccgctaatgcggccctttt	Protospacer
    ***    * *******..**************

22. spacer 3.9|2078543|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP030009 (Enterobacter hormaechei subsp. xiangfangensis strain Pb204 plasmid pPb204002, complete sequence) position: , mismatch: 7, identity: 0.781

----cgataacacagggccgtcaatgcggccctttt	CRISPR spacer
tctccga----aaagggccgctaatgcggccctttt	Protospacer
    ***    * *******..**************

23. spacer 3.9|2078543|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP011606 (Citrobacter freundii strain CAV1321 plasmid pCAV1321-4310, complete sequence) position: , mismatch: 7, identity: 0.781

----cgataacacagggccgtcaatgcggccctttt	CRISPR spacer
tctccga----aaagggccgctaatgcggccctttt	Protospacer
    ***    * *******..**************

24. spacer 3.9|2078543|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP044113 (Klebsiella michiganensis strain FDAARGOS_647 plasmid unnamed4, complete sequence) position: , mismatch: 7, identity: 0.781

----cgataacacagggccgtcaatgcggccctttt	CRISPR spacer
tctccga----aaagggccgctaatgcggccctttt	Protospacer
    ***    * *******..**************

25. spacer 3.19|2078239|32|LR134234|PILER-CR matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 7, identity: 0.781

aagacgacgtgatccgcaaagtcgaaggcacg	CRISPR spacer
aggagaacgtgatccgcaacgtcgaaggcgtt	Protospacer
*.** .************* *********..

26. spacer 3.24|2078544|32|LR134234|PILER-CR matches to NZ_CP038598 (Salmonella enterica subsp. enterica serovar Hadar strain 12-2388 plasmid p12-2388.3, complete sequence) position: , mismatch: 7, identity: 0.781

----cgataacacagggccgtcaatgcggccctttt	CRISPR spacer
tctccga----aaagggccgctaatgcggccctttt	Protospacer
    ***    * *******..**************

27. spacer 3.24|2078544|32|LR134234|PILER-CR matches to NZ_CP033827 (Klebsiella sp. FDAARGOS_511 plasmid unnamed4, complete sequence) position: , mismatch: 7, identity: 0.781

----cgataacacagggccgtcaatgcggccctttt	CRISPR spacer
tctccga----aaagggccgctaatgcggccctttt	Protospacer
    ***    * *******..**************

28. spacer 3.24|2078544|32|LR134234|PILER-CR matches to NZ_CP029125 (Enterobacter hormaechei strain AR432 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.781

----cgataacacagggccgtcaatgcggccctttt	CRISPR spacer
tctccga----aaagggccgctaatgcggccctttt	Protospacer
    ***    * *******..**************

29. spacer 3.24|2078544|32|LR134234|PILER-CR matches to NZ_AP019693 (Salmonella enterica subsp. enterica serovar Senftenberg strain SL180013 plasmid pSL180013-1, complete sequence) position: , mismatch: 7, identity: 0.781

----cgataacacagggccgtcaatgcggccctttt	CRISPR spacer
tctccga----aaagggccgctaatgcggccctttt	Protospacer
    ***    * *******..**************

30. spacer 3.24|2078544|32|LR134234|PILER-CR matches to NZ_CP030192 (Salmonella enterica strain SA20104250 plasmid pSA20104250.2, complete sequence) position: , mismatch: 7, identity: 0.781

----cgataacacagggccgtcaatgcggccctttt	CRISPR spacer
tctccga----aaagggccgctaatgcggccctttt	Protospacer
    ***    * *******..**************

31. spacer 3.24|2078544|32|LR134234|PILER-CR matches to NZ_CP039274 (Salmonella enterica subsp. enterica serovar Senftenberg str. CFSAN004025 plasmid pCFSAN004025.4, complete sequence) position: , mismatch: 7, identity: 0.781

----cgataacacagggccgtcaatgcggccctttt	CRISPR spacer
tctccga----aaagggccgctaatgcggccctttt	Protospacer
    ***    * *******..**************

32. spacer 3.24|2078544|32|LR134234|PILER-CR matches to NZ_CP016528 (Salmonella enterica subsp. enterica serovar Heidelberg strain 09-036813-1A plasmid p09-036813-1A_4, complete sequence) position: , mismatch: 7, identity: 0.781

----cgataacacagggccgtcaatgcggccctttt	CRISPR spacer
tctccga----aaagggccgctaatgcggccctttt	Protospacer
    ***    * *******..**************

33. spacer 3.24|2078544|32|LR134234|PILER-CR matches to NZ_CP030227 (Salmonella enterica strain SA20041605 plasmid pSA20041605.2, complete sequence) position: , mismatch: 7, identity: 0.781

----cgataacacagggccgtcaatgcggccctttt	CRISPR spacer
tctccga----aaagggccgctaatgcggccctttt	Protospacer
    ***    * *******..**************

34. spacer 3.24|2078544|32|LR134234|PILER-CR matches to NC_013090 (Endophytic bacterium LOB-07 plasmid pLK39, complete sequence) position: , mismatch: 7, identity: 0.781

----cgataacacagggccgtcaatgcggccctttt	CRISPR spacer
tctccga----aaagggccgctaatgcggccctttt	Protospacer
    ***    * *******..**************

35. spacer 3.24|2078544|32|LR134234|PILER-CR matches to NZ_CP030009 (Enterobacter hormaechei subsp. xiangfangensis strain Pb204 plasmid pPb204002, complete sequence) position: , mismatch: 7, identity: 0.781

----cgataacacagggccgtcaatgcggccctttt	CRISPR spacer
tctccga----aaagggccgctaatgcggccctttt	Protospacer
    ***    * *******..**************

36. spacer 3.24|2078544|32|LR134234|PILER-CR matches to NZ_CP011606 (Citrobacter freundii strain CAV1321 plasmid pCAV1321-4310, complete sequence) position: , mismatch: 7, identity: 0.781

----cgataacacagggccgtcaatgcggccctttt	CRISPR spacer
tctccga----aaagggccgctaatgcggccctttt	Protospacer
    ***    * *******..**************

37. spacer 3.24|2078544|32|LR134234|PILER-CR matches to NZ_CP044113 (Klebsiella michiganensis strain FDAARGOS_647 plasmid unnamed4, complete sequence) position: , mismatch: 7, identity: 0.781

----cgataacacagggccgtcaatgcggccctttt	CRISPR spacer
tctccga----aaagggccgctaatgcggccctttt	Protospacer
    ***    * *******..**************

38. spacer 2.6|2052143|32|LR134234|PILER-CR matches to MK448454 (Streptococcus satellite phage Javan361, complete genome) position: , mismatch: 8, identity: 0.75

tgaagcatcaaacatttggtggaccaaacgga	CRISPR spacer
tgaagaatcaaaaatttggtggattgataaga	Protospacer
***** ****** **********...*  .**

39. spacer 2.8|2052265|32|LR134234|PILER-CR matches to NZ_CP006991 (Rhizobium sp. IE4771 plasmid pRetIE4771e, complete sequence) position: , mismatch: 8, identity: 0.75

ggatctgccagcgcctctgcggggcggtaaac	CRISPR spacer
ggatcggccagcgcatctgcgggaggatgatg	Protospacer
***** ******** ********. *.*.*

40. spacer 3.4|2078238|32|LR134234|CRISPRCasFinder,CRT matches to NZ_LR594673 (Variovorax sp. PBL-E5 plasmid 3) position: , mismatch: 8, identity: 0.75

aagacgacgtgatccgcaaagtcgaaggcacg	CRISPR spacer
cggacgacgtgatcggcaaagtcgaccaggcg	Protospacer
 .************ **********  . .**

41. spacer 3.7|2078421|32|LR134234|CRISPRCasFinder,CRT matches to AB452989 (Serratia phage KSP20 orf7 to orf11 genes for scaffolding protein, major capsid protein, terminase, head completion protein, hypothetical protein, complete and partial cds) position: , mismatch: 8, identity: 0.75

taccggtgtgaattacagcaccaccgccaccc	CRISPR spacer
ggccggtgtgaacaacagcaccaccacgcgcc	Protospacer
 .**********. ***********.*   **

42. spacer 3.9|2078543|32|LR134234|CRISPRCasFinder,CRT matches to NC_019341 (Pseudomonas syringae plasmid pNCPPB880-40, complete sequence) position: , mismatch: 8, identity: 0.75

cgataacacagggccgtcaatgcggccctttt	CRISPR spacer
caaattaaaagggccgctaatgcggccctttt	Protospacer
*.*    * *******..**************

43. spacer 3.19|2078239|32|LR134234|PILER-CR matches to NZ_LR594673 (Variovorax sp. PBL-E5 plasmid 3) position: , mismatch: 8, identity: 0.75

aagacgacgtgatccgcaaagtcgaaggcacg	CRISPR spacer
cggacgacgtgatcggcaaagtcgaccaggcg	Protospacer
 .************ **********  . .**

44. spacer 3.22|2078422|32|LR134234|PILER-CR matches to AB452989 (Serratia phage KSP20 orf7 to orf11 genes for scaffolding protein, major capsid protein, terminase, head completion protein, hypothetical protein, complete and partial cds) position: , mismatch: 8, identity: 0.75

taccggtgtgaattacagcaccaccgccaccc	CRISPR spacer
ggccggtgtgaacaacagcaccaccacgcgcc	Protospacer
 .**********. ***********.*   **

45. spacer 3.24|2078544|32|LR134234|PILER-CR matches to NC_019341 (Pseudomonas syringae plasmid pNCPPB880-40, complete sequence) position: , mismatch: 8, identity: 0.75

cgataacacagggccgtcaatgcggccctttt	CRISPR spacer
caaattaaaagggccgctaatgcggccctttt	Protospacer
*.*    * *******..**************

46. spacer 2.5|2052263|34|LR134234|CRT,CRISPRCasFinder matches to NZ_CP040723 (Rhodococcus pyridinivorans strain YF3 plasmid unnamed4, complete sequence) position: , mismatch: 9, identity: 0.735

acggat-ctgccagcgcctctgcggggcggtaaac	CRISPR spacer
-cggtcgctgccagcgcctcggcgaggcggtctcg	Protospacer
 *** . ************* ***.******

47. spacer 2.8|2052265|32|LR134234|PILER-CR matches to NZ_CP040723 (Rhodococcus pyridinivorans strain YF3 plasmid unnamed4, complete sequence) position: , mismatch: 9, identity: 0.719

ggatctgccagcgcctctgcggggcggtaaac	CRISPR spacer
gtcgctgccagcgcctcggcgaggcggtctcg	Protospacer
*   ************* ***.******

48. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP026049 (Raoultella planticola strain FDAARGOS_64 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

49. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP026283 (Klebsiella oxytoca strain KONIH2 plasmid pKOR-e6bf, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

50. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP018351 (Klebsiella pneumoniae strain CAV1417 plasmid pCAV1417-185, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

51. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP018675 (Klebsiella pneumoniae strain CAV1217 plasmid pKPC_CAV1217, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

52. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP032995 (Escherichia coli strain W5-6 plasmid p3_W5-6, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

53. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP052329 (Klebsiella pneumoniae strain D17KP0032 plasmid pD17KP0032-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

54. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP052168 (Klebsiella pneumoniae strain F16KP0075 plasmid pF16KP0075-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

55. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_KX710093 (Leclercia adecarboxylata strain pP10164 plasmid pP10164-2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

56. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_KY271405 (Klebsiella pneumoniae strain H151440672 plasmid pKPN3-307_typeB, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

57. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_KY271407 (Klebsiella pneumoniae strain CIV-4 plasmid pKPN3-307_typeD, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

58. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP045446 (Salmonella enterica subsp. enterica serovar Schwarzengrund strain 9355 plasmid p280_9355, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

59. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP014073 (Klebsiella quasipneumoniae strain FDAARGOS_93 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

60. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to MN783747 (Klebsiella oxytoca plasmid pIron_OXY, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

61. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP032195 (Klebsiella pneumoniae strain AR_0097 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

62. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP050836 (Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

63. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP050847 (Klebsiella pneumoniae strain Bckp206 plasmid pBckp206-2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

64. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP041286 (Escherichia coli strain 54 plasmid p54-tetX, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

65. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_KX636095 (Klebsiella pneumoniae strain RJ119 plasmid pRJ119-NDM1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

66. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_KX129784 (Escherichia coli strain H226B plasmid pH226B, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

67. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP029739 (Klebsiella pneumoniae strain AR_0087 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

68. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP028537 (Enterobacter hormaechei strain SCEH020042 plasmid pQnrB4_020042, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

69. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP035548 (Salmonella enterica subsp. enterica serovar Typhimurium strain YU07-18 plasmid pYU07-18_IncA/C2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

70. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP052485 (Klebsiella pneumoniae strain C16KP0036 plasmid pC16KP0036-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

71. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_KT203286 (Klebsiella pneumoniae strain U25 plasmid PU25001, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

72. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_KR653209 (Escherichia coli strain GDZ13 plasmid pGD0503Z13, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

73. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_KT347600 (Escherichia coli strain EC5207 plasmid pEC5207, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

74. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP042628 (Escherichia coli strain NCYU-25-82 plasmid pNCYU-25-82-1_MCR3, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

75. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP021752 (Klebsiella pneumoniae strain AR_0113 plasmid unitig_1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

76. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP025081 (Klebsiella pneumoniae strain SGH10 plasmid pSGH10, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

77. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP025142 (Klebsiella pneumoniae strain KP1768 plasmid KP1768_p2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

78. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP031258 (Klebsiella quasipneumoniae strain L22 plasmid pL22-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

79. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP026135 (Klebsiella pneumoniae strain F5 plasmid pF5_3, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

80. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP018434 (Klebsiella pneumoniae strain MNCRE53 plasmid pMNCRE53_4, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

81. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP044528 (Klebsiella grimontii strain SS141 plasmid plamid_1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

82. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP052163 (Klebsiella pneumoniae strain F16KP0082 plasmid pF16KP0082-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

83. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP019195 (Salmonella enterica subsp. enterica serovar Senftenberg str. ATCC 43845 plasmid pATCC43845, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

84. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to KY486279 (Salmonella sp. strain SH-01 plasmid pSH-01, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

85. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP022125 (Klebsiella pneumoniae strain DHQP1605752_NV plasmid p1605752FIB, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

86. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP018441 (Klebsiella pneumoniae strain Kp_Goe_822917 plasmid pKp_Goe_917-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

87. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP043049 (Klebsiella pneumoniae strain KLP268 plasmid pKLP268-3) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

88. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP019561 (Escherichia coli strain KSC1031 plasmid pMRGN1031, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

89. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP019647 (Salmonella enterica subsp. enterica serovar Typhimurium strain TW-Stm6 plasmid pSTM6-275, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

90. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP040123 (Klebsiella pneumoniae strain LSH-KPN148 plasmid pLSH-KPN148-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

91. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP012256 (Cronobacter sakazakii strain NCTC 8155 plasmid pCS3, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

92. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP013323 (Klebsiella pneumoniae strain CAV1193 plasmid pCAV1193-258, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

93. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP029588 (Klebsiella pneumoniae strain DA33141 plasmid pDA33141-217, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

94. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP030924 (Klebsiella pneumoniae subsp. pneumoniae strain KC-Pl-HB1 plasmid pKC-Pl-HB1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

95. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP034282 (Klebsiella pneumoniae strain I72 plasmid p72_FIBkpn, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

96. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP026022 (Klebsiella pneumoniae strain 11492 plasmid p11492-CTXM, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

97. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP014011 (Klebsiella pneumoniae subsp. pneumoniae strain RJF999 plasmid pRJF999, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

98. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP037442 (Klebsiella sp. PO552 plasmid p1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

99. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP037743 (Klebsiella pneumoniae strain ST23 plasmid pDHQP1701672_hv, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

100. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP052408 (Klebsiella pneumoniae strain C17KP0008 plasmid pC17KP0008-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

101. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP052450 (Klebsiella pneumoniae strain C16KP0077 plasmid pC16KP0077-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

102. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP023417 (Klebsiella pneumoniae strain 1050 plasmid pKp1050-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

103. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP044256 (Salmonella enterica strain CFSAN096147 plasmid pCFSAN096147, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

104. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NC_009649 (Klebsiella pneumoniae subsp. pneumoniae MGH 78578 plasmid pKPN3, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

105. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP035215 (Klebsiella michiganensis strain M82255 plasmid pKOCBH-A, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

106. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP035216 (Klebsiella michiganensis strain M82255 plasmid pKOCBH-B, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

107. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP052491 (Klebsiella pneumoniae strain B17KP0069 plasmid pB17KP0069-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

108. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP052159 (Klebsiella pneumoniae strain F16KP0084 plasmid pF16KP0084-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

109. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP045449 (Salmonella enterica subsp. enterica serovar Schwarzengrund strain 12888 plasmid p280_12888, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

110. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP040652 (Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain SA20070548 plasmid pSA20070548.1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

111. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP014649 (Klebsiella pneumoniae strain KPNIH36 plasmid pKPN-fff, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

112. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP024193 (Klebsiella pneumoniae isolate KSB1_5D plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

113. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP011977 (Klebsiella pneumoniae DMC1097 plasmid pDMC1097-218.836kb, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

114. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NC_014107 (Enterobacter cloacae subsp. cloacae ATCC 13047 plasmid pECL_A, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

115. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to MT035874 (Klebsiella pneumoniae strain KP18-3-8 plasmid pKP18-3-8_KPC_vir, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

116. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP052401 (Klebsiella pneumoniae strain C17KP0039 plasmid pC17KP0039-2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

117. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP052572 (Klebsiella pneumoniae strain A16KP0016 plasmid pA16KP0016-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

118. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP053729 (Escherichia coli strain CP61_Sichuan plasmid pCP61-IncFIB, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

119. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to MN200128 (Klebsiella pneumoniae strain 17ZR-91 plasmid p17ZR-91-Vir-RC, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

120. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to MN200130 (Escherichia coli strain EC600 plasmid p17ZR-91-TC1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

121. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP041928 (Klebsiella pneumoniae strain 18-2374 plasmid pSECR18-2374A, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

122. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP010393 (Klebsiella pneumoniae strain 34618 plasmid p34618-207.543kb, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

123. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP029448 (Serratia marcescens strain CAV1761 plasmid pCAV1761-205, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

124. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP026276 (Klebsiella oxytoca strain KONIH5 plasmid pKOR-ab4d, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

125. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP020508 (Serratia marcescens strain BWH-35 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

126. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP035636 (Enterobacter cloacae strain EN3600 plasmid unnamed4, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

127. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP052296 (Klebsiella pneumoniae strain E16KP0210 plasmid pE16KP0210-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

128. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP053738 (Escherichia coli strain CP8-3_Sichuan plasmid pCP8-3-IncFIB, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

129. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP042507 (Leclercia adecarboxylata strain E1 plasmid pE1_002, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

130. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to MN543573 (Klebsiella pneumoniae strain GH44 plasmid pGH44_216, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

131. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP033956 (Klebsiella pneumoniae strain L39_2 plasmid p3_L39, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

132. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP019559 (Escherichia coli strain KSC207 plasmid pMRGN207, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

133. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP047092 (Salmonella sp. S13 plasmid pS13-3, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

134. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NC_022078 (Klebsiella pneumoniae JM45 plasmid p1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

135. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to KX023259 (Escherichia coli plasmid pSCE516-4, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

136. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP026170 (Leclercia sp. LSNIH1 plasmid pLEC-000f, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

137. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP051431 (Escherichia sp. SCLE84 plasmid pSCLE1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

138. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP052432 (Klebsiella pneumoniae strain C16KP0122 plasmid pC16KP0122-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

139. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP052144 (Klebsiella pneumoniae strain F17KP0012 plasmid pF17KP0012-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

140. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP052363 (Klebsiella pneumoniae strain D16KP0122 plasmid pD16KP0122-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

141. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NC_009838 (Escherichia coli APEC O1 plasmid pAPEC-O1-R, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

142. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NC_020261 (Cronobacter sakazakii SP291 plasmid pSP291-2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

143. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP046001 (Escherichia coli strain 1916D6 plasmid p1916D6-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

144. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP024882 (Citrobacter freundii strain AR_0022 plasmid unitig_1_pilon, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

145. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP028954 (Klebsiella pneumoniae strain AR_0141 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

146. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP021103 (Escherichia coli strain 13P477T plasmid p13P477T-7, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

147. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP006642 (Escherichia coli PCN061 plasmid PCN061p6, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

148. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP008789 (Klebsiella oxytoca KONIH1 plasmid pKOX-137, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

149. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP033627 (Klebsiella pneumoniae strain 4743 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

150. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP027037 (Klebsiella pneumoniae strain 16_GR_13 plasmid IncFIB IncFII, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

151. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP036302 (Klebsiella pneumoniae subsp. pneumoniae strain WCHKP015093 plasmid p1_015093, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

152. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_LR130542 (Klebsiella pneumoniae strain AJ218 isolate AJ218 plasmid 2) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

153. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NC_023332 (Klebsiella pneumoniae strain ST48 plasmid pKP09085, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

154. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NC_023333 (Klebsiella pneumoniae strain ST23 plasmid pKP007, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

155. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NC_023334 (Klebsiella pneumoniae strain ST15 plasmid pKP02022, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

156. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP009871 (Pantoea sp. PSNIH2 plasmid pPSP-cd6, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

157. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP012682 (Salmonella enterica subsp. enterica serovar Typhimurium strain 33676 plasmid p33676_IncA/C, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

158. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP045188 (Escherichia coli strain NT1F31 plasmid pNT1F31-tetX4, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

159. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP019049 (Klebsiella pneumoniae subsp. pneumoniae strain RJA166 plasmid pRJA166b, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

160. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP020499 (Klebsiella pneumoniae strain BWHC1 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

161. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP020506 (Serratia marcescens strain 95 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

162. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP025038 (Klebsiella pneumoniae strain NU-CRE047 plasmid pNU-CRE047_1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

163. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP031547 (Escherichia coli strain cq9 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

164. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to MK347226 (Klebsiella pneumoniae strain K185 plasmid pK185_rmpA2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

165. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to MK347227 (Klebsiella pneumoniae strain K187 plasmid pK187_rmpA2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

166. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to MK347228 (Klebsiella pneumoniae strain K195 plasmid pK195_rmpA2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

167. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to MK347229 (Klebsiella pneumoniae strain K199 plasmid pK199_rmpA2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

168. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to MK347230 (Klebsiella pneumoniae strain K202 plasmid pK202_rmpA2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

169. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to MK347231 (Klebsiella pneumoniae strain K204 plasmid pK204_rmpA2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

170. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to MK347232 (Klebsiella pneumoniae strain K211 plasmid pK211_rmpA2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

171. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to MK347233 (Klebsiella pneumoniae strain K214 plasmid pK214_rmpA2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

172. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to MK347234 (Klebsiella pneumoniae strain K230 plasmid pK230_rmpA2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

173. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to MK347235 (Klebsiella pneumoniae strain K232 plasmid pK232_rmpA2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

174. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to MK347236 (Klebsiella pneumoniae strain K234 plasmid pK234_rmpA2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

175. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to MK347237 (Klebsiella pneumoniae strain K235 plasmid pK235_rmpA2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

176. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to MK347238 (Klebsiella pneumoniae strain K239 plasmid pK239_rmpA2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

177. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP052405 (Klebsiella pneumoniae strain C17KP0020 plasmid pC17KP0020-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

178. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP052137 (Klebsiella pneumoniae strain F17KP0054 plasmid pF17KP0054-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

179. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP018693 (Klebsiella pneumoniae strain Kp_Goe_821588 plasmid pKp_Goe_588-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

180. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP024708 (Klebsiella pneumoniae strain cr-hvkp3 plasmid pPUTH1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

181. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP034776 (Klebsiella pneumoniae strain 18CPO060 plasmid phvKP060, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

182. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP042639 (Escherichia coli strain NCYU-24-74 plasmid pNCYU-24-74-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

183. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP015135 (Klebsiella pneumoniae strain ATCC 35657 plasmid p35657-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

184. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP045662 (Klebsiella pneumoniae strain SMU18037509 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

185. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP020842 (Klebsiella pneumoniae strain KPN1482 plasmid pKPN1482-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

186. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP020855 (Klebsiella pneumoniae strain KPN528 plasmid pKPN528-2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

187. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP044301 (Escherichia coli strain P59A plasmid pP59A-3, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

188. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP031811 (Klebsiella pneumoniae strain INF014-sc-2279884 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

189. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP025277 (Salmonella enterica subsp. enterica strain USDA-ARS-USMARC-60984 plasmid pSJO-60984, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

190. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP017182 (Enterobacter kobei strain DSM 13645 plasmid pDSMZ13645, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

191. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP013942 (Cronobacter malonaticus LMG 23826 plasmid pCMA2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

192. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to MN891675 (Klebsiella pneumoniae strain 358573 plasmid p358573-KPC, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

193. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP052357 (Klebsiella pneumoniae strain D16KP0144 plasmid pD16KP0144-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

194. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to LC549807 (Klebsiella pneumoniae VNCKp115 plasmid pVNCKp115 DNA, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

195. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_LR134257 (Klebsiella aerogenes strain NCTC9644 plasmid 4, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

196. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP041645 (Klebsiella pneumoniae strain NKU_Kleb8A7 plasmid pKleb8A7, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

197. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP041949 (Klebsiella pneumoniae strain KP2 plasmid pKP2_3, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

198. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP020838 (Klebsiella pneumoniae strain BK13043 plasmid pBK13043-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

199. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP031569 (Enterobacter hormaechei strain 2013_1a plasmid pIncFIB-1301491, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

200. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP031563 (Klebsiella pneumoniae strain 2-1 plasmid pKP21HI1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

201. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP030182 (Salmonella enterica strain SA20030575 plasmid pSA20030575.1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

202. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP028784 (Klebsiella pneumoniae strain SCKP020049 plasmid p1_020049, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

203. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP027054 (Klebsiella pneumoniae strain 2_GR_12 plasmid IncFIB IncFII) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

204. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP052445 (Klebsiella pneumoniae strain C16KP0098 plasmid pC16KP0098-2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

205. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP052570 (Klebsiella pneumoniae strain A16KP0119 plasmid pA16KP0119-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

206. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP052218 (Klebsiella pneumoniae strain E17KP0053 plasmid pE17KP0053-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

207. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP040894 (Leclercia adecarboxylata strain Z96-1 plasmid pZ96-1_3, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

208. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP035380 (Leclercia adecarboxylata strain R25 plasmid pLA-109, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

209. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP014009 (Klebsiella pneumoniae subsp. pneumoniae strain RJF293 plasmid pRJF293, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

210. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP023479 (Klebsiella quasipneumoniae strain KPC142 plasmid pKQPS142a, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

211. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to MN310373 (Klebsiella pneumoniae strain BJ20 plasmid pBJ20-tetA, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

212. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to MN310374 (Klebsiella pneumoniae strain 2016071221 plasmid p71221-tetA, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

213. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to MN310376 (Klebsiella pneumoniae strain 08291 plasmid pW08291-tetA, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

214. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to MN310380 (Raoultella ornithinolytica strain 170602815 plasmid p602815-NR, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

215. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP018424 (Klebsiella pneumoniae strain MNCRE69 plasmid pMNCRE69_4, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

216. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP049605 (Klebsiella pneumoniae strain Kp8701 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

217. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to MH909331 (Leclercia adecarboxylata plasmid p707804-NDM, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

218. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to AP020333 (Salmonella enterica SESen3709 plasmid pSESen3709_1 DNA, complete genome) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

219. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP031736 (Klebsiella pneumoniae subsp. pneumoniae strain Klebsiella pneumoniae plasmid pKPM502, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

220. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP034251 (Salmonella enterica subsp. enterica serovar Derby strain Sa64 plasmid pSa64T-188, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

221. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP035916 (Salmonella enterica strain S61394 plasmid pLS61394-MCR, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

222. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP039577 (Salmonella enterica subsp. enterica serovar Typhimurium strain PNCS014856 plasmid p10-3857.1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

223. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP029591 (Klebsiella pneumoniae strain DA33144 plasmid pDA33144-220, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

224. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP012989 (Klebsiella pneumoniae strain KpN01 plasmid pKpN01-SIL, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

225. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP018818 (Klebsiella pneumoniae strain AR_0049 plasmid unitig_2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

226. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP037966 (Klebsiella pneumoniae strain SCKP020135 plasmid p1_020135, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

227. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP038140 (Escherichia coli strain G3X16-2 plasmid pG3X16-2-3, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

228. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP052321 (Klebsiella pneumoniae strain E16KP0035 plasmid pE16KP0035-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

229. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP052148 (Klebsiella pneumoniae strain F16KP0108 plasmid pF16KP0108-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

230. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP019019 (Escherichia coli strain Ecol_244 plasmid pEC244_1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

231. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NC_021654 (Klebsiella pneumoniae plasmid pKN-LS6, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

232. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to LR134211 (Klebsiella aerogenes strain NCTC418 genome assembly, plasmid: 2) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

233. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP041084 (Klebsiella pneumoniae strain Kp202 plasmid pKp202_2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

234. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP042616 (Escherichia coli strain NCYU-26-73 plasmid pNCYU-26-73-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

235. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP026274 (Klebsiella oxytoca strain KONIH4 plasmid pKPC-4b66, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

236. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP031799 (Klebsiella pneumoniae strain QMP B2-170 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

237. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP036337 (Klebsiella pneumoniae strain BP327 plasmid pIncFIBK, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

238. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP050011 (Citrobacter sp. Y3 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

239. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP052415 (Klebsiella pneumoniae strain C16KP0189 plasmid pC16KP0189-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

240. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP052559 (Klebsiella pneumoniae strain A17KP0008 plasmid pA17KP0008-2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

241. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP052270 (Klebsiella pneumoniae strain E16KP0268 plasmid pE16K0268-2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

242. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NC_005249 (Klebsiella pneumoniae CG43 plasmid pLVPK, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

243. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NC_016966 (Klebsiella pneumoniae plasmid pUUH239.2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

244. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP031284 (Escherichia fergusonii strain 40A plasmid p280_40A, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

245. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP041514 (Klebsiella michiganensis strain KNU07 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

246. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP041100 (Klebsiella pneumoniae subsp. pneumoniae strain KPCTRSRTH07 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

247. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP041375 (Klebsiella pneumoniae strain KP58 plasmid pKP58-2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

248. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP042482 (Klebsiella pneumoniae strain C51 plasmid pC51_001, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

249. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to MK461930 (Escherichia coli strain 2009_36 plasmid p2009_36_HI2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

250. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP021834 (Klebsiella pneumoniae strain AR_0120 plasmid tig00000500_pilon, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

251. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP027613 (Klebsiella pneumoniae subsp. ozaenae strain AR_0096 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

252. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP024875 (Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

253. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP022692 (Klebsiella pneumoniae subsp. pneumoniae strain AUSMDU00008079 plasmid pAUSMDU00008079_01, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

254. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP022920 (Klebsiella pneumoniae strain ST307PT03 plasmid pJYC03A, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

255. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP034326 (Klebsiella pneumoniae isolate KSH203 plasmid pKSH203-qnrS, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

256. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP035180 (Klebsiella pneumoniae strain BA33875 plasmid pBA33875_IncFIB, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

257. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NC_008573 (Shewanella sp. ANA-3 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

258. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP025212 (Klebsiella pneumoniae strain HZW25 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

259. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP052232 (Klebsiella pneumoniae strain E17KP0033 plasmid pE17KP0033-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

260. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP052873 (Enterobacter cloacae strain 3849 plasmid p3846III, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

261. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP021958 (Klebsiella pneumoniae strain AR_0139 plasmid tig00000002_u) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

262. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP040546 (Klebsiella pneumoniae strain CR-HvKP5 plasmid pCR-HvKP5-VIR, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

263. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP028792 (Klebsiella pneumoniae strain WCHKP020030 plasmid pQnrS1_020030, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

264. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP033823 (Klebsiella sp. FDAARGOS_511 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

265. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP015132 (Klebsiella pneumoniae strain Kpn555 plasmid pKPN-d90, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

266. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP012572 (Klebsiella pneumoniae strain UCLAOXA232KP plasmid pUCLAOXA232-6.X, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

267. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP042513 (Serratia marcescens strain E28 plasmid pE28_001, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

268. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP032241 (Klebsiella pneumoniae strain XJ-K2 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

269. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP046273 (Enterobacter hormaechei strain E70 plasmid pE70-sul2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

270. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP029136 (Klebsiella pneumoniae strain AR376 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

271. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP047460 (Escherichia coli strain ZF31 plasmid pZF31-tetX-119kb, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

272. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP047466 (Escherichia coli strain ZF34 plasmid pZF34-tetX-114kb, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

273. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP052176 (Klebsiella pneumoniae strain F16KP0050 plasmid pF16KP0050-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

274. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP052193 (Klebsiella pneumoniae strain F16KP0014 plasmid pF16KP0014-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

275. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP014121 (Klebsiella pneumoniae strain FDAARGOS_156 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

276. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_LT991959 (Enterobacter cloacae complex sp. isolate C45 plasmid pC45-p2) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

277. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to LC511658 (Escherichia coli 2017.03.03CC plasmid p2017_03_03CC DNA, complete genome) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

278. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP029037 (Salmonella enterica subsp. enterica serovar Senftenberg str. 361154004 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

279. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP041640 (Klebsiella pneumoniae strain PIMB15ND2KP27 plasmid pKP27-MPH, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

280. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP043854 (Enterobacter hormaechei strain EB_P6_L3_02.19 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

281. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP026752 (Klebsiella pneumoniae strain AR_0066 plasmid tig00000080_pilon, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

282. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP018886 (Klebsiella pneumoniae subsp. pneumoniae strain BR21 plasmid pIncF, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

283. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP039857 (Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014876 plasmid p15-0756.1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

284. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP039809 (Klebsiella pneumoniae strain C2660 plasmid pC2660-2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

285. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP029101 (Klebsiella pneumoniae strain AR438 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

286. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP040862 (Klebsiella pneumoniae strain Xen39 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

287. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP036191 (Klebsiella pneumoniae strain BA34918 plasmid pvirulence_VBA34918, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

288. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP040025 (Klebsiella pneumoniae strain KPC160132 plasmid pKpn3-L132, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

289. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP052266 (Klebsiella pneumoniae strain E16KP0287 plasmid pE16K0287-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

290. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP052561 (Klebsiella pneumoniae strain A17KP0004 plasmid pA17KP0004-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

291. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP052209 (Klebsiella pneumoniae strain E17KP0085 plasmid pE17KP0085-2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

292. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NC_006625 (Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 plasmid pK2044, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

293. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP022734 (Escherichia coli strain SA186 plasmid pSA186_5, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

294. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP038004 (Klebsiella pneumoniae strain SCKP020009 plasmid pLAP2_020009, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

295. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP007734 (Klebsiella pneumoniae subsp. pneumoniae KPNIH27 plasmid pKPN-262, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

296. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP026175 (Klebsiella pneumoniae strain KPNIH50 plasmid pKPC-0cc9, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

297. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP026179 (Klebsiella pneumoniae strain KPNIH49 plasmid pKPC-224e, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

298. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP026185 (Klebsiella pneumoniae strain KPNIH49 plasmid pKPN-9a0d, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

299. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP026186 (Klebsiella pneumoniae strain KPNIH49 plasmid pKPN-3967, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

300. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP028995 (Klebsiella pneumoniae strain AR_0079 plasmid unnamed6, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

301. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP031815 (Klebsiella pneumoniae strain KSB1_7F-sc-2280268 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

302. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP033402 (Klebsiella pneumoniae strain WCHKP115069 plasmid p1_115069, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

303. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP039526 (Klebsiella pneumoniae subsp. pneumoniae strain HB25-1 plasmid pHB25-1-vir, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

304. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP052302 (Klebsiella pneumoniae strain E16KP0180 plasmid pE16KP0180-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

305. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP018355 (Klebsiella pneumoniae strain CAV1453 plasmid pCAV1453-208, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

306. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP043751 (Escherichia coli strain CVM N62675 plasmid pN62675, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

307. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP031583 (Klebsiella pneumoniae strain N4b plasmid pIncFII-1502320, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

308. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP029598 (Klebsiella quasipneumoniae subsp. similipneumoniae strain ATCC 700603 plasmid pDA33145-152, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

309. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP031614 (Klebsiella pneumoniae strain ZYST1 plasmid pZYST1C1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

310. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP047337 (Klebsiella pneumoniae strain 2019036D plasmid p2019036D-mcr8-345kb, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

311. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP019214 (Escherichia coli strain WCHEC050613 plasmid pMCR_WCHEC050613, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

312. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP021544 (Klebsiella pneumoniae strain AR_0112 plasmid tig00000000, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

313. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP021540 (Klebsiella pneumoniae strain AR_0047 plasmid tig00000001, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

314. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP021686 (Klebsiella pneumoniae strain AR_0146 plasmid tig00001160, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

315. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP043545 (Escherichia coli strain F2_81 plasmid pF2_18C_HI2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

316. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP012169 (Enterobacter hormaechei subsp. steigerwaltii strain 34998 plasmid p34998-210.894kb, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

317. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP022926 (Klebsiella pneumoniae strain ST307PT01 plasmid pJYC01A, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

318. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP036307 (Klebsiella pneumoniae strain WCHKP020098 plasmid p1_020098, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

319. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP022149 (Enterobacter roggenkampii strain 704SK10 plasmid p704SK10_1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

320. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to KT896504 (Klebsiella pneumoniae strain I11 plasmid pKPSH11, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

321. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP036176 (Klebsiella huaxiensis strain WCHKl090001 plasmid p1_090001, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

322. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP052380 (Klebsiella pneumoniae strain D16KP0017 plasmid pD16KP0017-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

323. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP052563 (Klebsiella pneumoniae strain A16KP0135 plasmid pA16KP0135-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

324. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP052525 (Klebsiella pneumoniae strain B16KP0177 plasmid pB16KP0177-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

325. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to LT009688 (Klebsiella pneumoniae plasmid pIT-06C07, strain O6CO7, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

326. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP030003 (Salmonella enterica subsp. enterica serovar Brandenburg strain SA20064858 plasmid pSA20064858.1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

327. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP030066 (Klebsiella pneumoniae strain IA565 plasmid pDA11912.1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

328. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP028549 (Klebsiella variicola strain WCHKP19 plasmid p1_020019, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

329. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP009865 (Klebsiella pneumoniae subsp. pneumoniae strain KPNIH29 plasmid pKPN-80a, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

330. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP009879 (Klebsiella pneumoniae subsp. pneumoniae strain KPNIH31 plasmid pKPN-c22, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

331. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP009777 (Klebsiella pneumoniae subsp. pneumoniae strain KPNIH32 plasmid pKPN-a68, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

332. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP008800 (Klebsiella pneumoniae subsp. pneumoniae KPNIH24 plasmid pKPN-e44, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

333. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP044036 (Klebsiella pneumoniae strain FDAARGOS_630 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

334. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP024153 (Escherichia coli strain 14EC033 plasmid p14EC033f, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

335. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP046950 (Klebsiella pneumoniae strain BD_DM_914 plasmid punnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

336. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP046940 (Klebsiella pneumoniae strain BD_DM_697 plasmid punnamed1) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

337. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP006927 (Klebsiella pneumoniae 30660/NJST258_1 plasmid pNJST258N1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

338. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP008930 (Klebsiella pneumoniae strain PMK1 plasmid pPMK1-A, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

339. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP007729 (Klebsiella pneumoniae subsp. pneumoniae KPNIH10 plasmid pKPN-498, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

340. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP052282 (Klebsiella pneumoniae strain E16KP0224 plasmid pE16KP0224-2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

341. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP006663 (Klebsiella pneumoniae strain ATCC BAA-2146 plasmid pCuAs, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

342. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP009855 (UNVERIFIED_ORG: Enterobacter cloacae strain ECNIH5 plasmid pENT-22e, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

343. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP024144 (Escherichia coli strain 14EC029 plasmid p14EC029c, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

344. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP026390 (Leclercia sp. LSNIH3 plasmid pLEC-5e18, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

345. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP008907 (Enterobacter hormaechei subsp. hoffmannii ECR091 plasmid pENT-4bd, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

346. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP029143 (Klebsiella michiganensis strain AR375 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

347. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP048380 (Klebsiella variicola strain 118 plasmid p118_A, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

348. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP030920 (Escherichia coli strain KL53 plasmid pKL53-L, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

349. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP026397 (Klebsiella pneumoniae strain KPNIH48 plasmid pKPN-10f7, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

350. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP052288 (Klebsiella pneumoniae strain E16KP0218 plasmid pE16KP0218-2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

351. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP008842 (Klebsiella michiganensis strain M1 plasmid pKOXM1A, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

352. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP026058 (Citrobacter freundii strain FDAARGOS_73 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

353. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP022824 (Klebsiella quasivariicola strain KPN1705 plasmid pKPN1705-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

354. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_AP019666 (Klebsiella pneumoniae strain TA6363 plasmid pTMTA63631, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

355. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP020062 (Klebsiella pneumoniae strain AR_0117 plasmid unitig_1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

356. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP020072 (Klebsiella pneumoniae strain AR_0115 plasmid tig00000002, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

357. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP020109 (Klebsiella pneumoniae strain AR_0098 plasmid tig00000001, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

358. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP047193 (Klebsiella pneumoniae strain Kp36 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

359. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP029435 (Klebsiella quasipneumoniae strain CAV2013 plasmid pCAV2013-156, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

360. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP029430 (Klebsiella quasipneumoniae strain CAV2018 plasmid pCAV2018-177, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

361. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP029430 (Klebsiella quasipneumoniae strain CAV2018 plasmid pCAV2018-177, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

362. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP015386 (Klebsiella pneumoniae strain NY9 plasmid pNY9_1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

363. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP020069 (Klebsiella pneumoniae strain AR_0068 plasmid unitig_2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

364. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP012567 (Klebsiella pneumoniae strain UCLAOXA232KP plasmid pUCLAOXA232-6, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

365. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP010154 (Escherichia coli strain D9 plasmid B, complete genome) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

366. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP024537 (Klebsiella pneumoniae strain KSB1_9D plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

367. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP024516 (Klebsiella pneumoniae strain KSB1_10J plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

368. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP032988 (Escherichia coli strain BE2-5 plasmid p2_BE2-5, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

369. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP036443 (Klebsiella pneumoniae strain ABFPV plasmid tig00001208_pilon, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

370. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP050379 (Klebsiella pneumoniae strain 51015 plasmid p51015_CTX_M_15, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

371. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP035906 (Klebsiella pneumoniae strain BA4656 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

372. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP025516 (Klebsiella pneumoniae strain 002SK2 plasmid p002SK2_A, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

373. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP052276 (Klebsiella pneumoniae strain E16KP0241 plasmid pE16KP0241-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

374. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to MF943217 (Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_WCHKP13F2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

375. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP032164 (Klebsiella pneumoniae strain XJ-K1 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

376. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP025457 (Klebsiella pneumoniae strain KP69 plasmid p69-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

377. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP024130 (Escherichia coli strain 14EC001 plasmid p14EC001c, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

378. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP034416 (Klebsiella pneumoniae strain C789 plasmid pVir-CR-hvKP-C789, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

379. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP011429 (Salmonella enterica subsp. enterica serovar Typhimurium strain YU39 isolate YUHS 05-78 plasmid pYU39_IncA/C, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

380. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP034130 (Klebsiella quasipneumoniae strain G4584 plasmid pG4584_218.9Kb, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

381. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP034681 (Klebsiella quasipneumoniae strain D120-1 plasmid pD120-1_296kb, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

382. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to MF918373 (Klebsiella pneumoniae plasmid p1512-dfrA, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

383. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP052423 (Klebsiella pneumoniae strain C16KP0164 plasmid pC16KP0164-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

384. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP052545 (Klebsiella pneumoniae strain B16KP0102 plasmid pB16KP0102-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

385. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP052298 (Klebsiella pneumoniae strain E16KP0204 plasmid pE16KP0204-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

386. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_LR130549 (Klebsiella pneumoniae strain KPC2 isolate KPC2 plasmid 2) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

387. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP032491 (Salmonella enterica subsp. enterica serovar Typhimurium strain SL26 plasmid pSL26_IncA/C2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

388. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP032495 (Salmonella enterica subsp. enterica serovar Typhimurium strain SO21 plasmid pSO21_118, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

389. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP046382 (Klebsiella pneumoniae strain BD_DM_782 plasmid punnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

390. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP022574 (Klebsiella pneumoniae strain BIC-1 plasmid pBIC-1a, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

391. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP050373 (Klebsiella pneumoniae strain 50595 plasmid p50595_IncFII, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

392. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP050174 (Escherichia coli strain STB20-1 plasmid pSTB20-1T, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

393. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP048299 (Salmonella enterica subsp. enterica serovar Schwarzengrund strain WAPHL_SAL-A00527 plasmid pN1566-2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

394. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP052190 (Klebsiella pneumoniae strain F16KP0019 plasmid pF16KP0019-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

395. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP052387 (Klebsiella pneumoniae strain C17KP0055 plasmid pC17KP0055-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

396. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NC_005211 (Serratia marcescens plasmid R478, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

397. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NC_021198 (Klebsiella pneumoniae subsp. pneumoniae KPX plasmid pKPX-1 DNA, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

398. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP012884 (Klebsiella pneumoniae KP-1 plasmid pKP1-19, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

399. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP026661 (Salmonella enterica subsp. enterica strain 15-SA01028 plasmid pSE15-SA01028, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

400. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP018670 (Klebsiella pneumoniae strain CAV1042 plasmid pCAV1042-183, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

401. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP028804 (Klebsiella pneumoniae strain WCHKP7E2 plasmid pCMY2_085072, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

402. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP021713 (Klebsiella pneumoniae strain AR_0129 plasmid tig00000000, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

403. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP030270 (Klebsiella pneumoniae subsp. pneumoniae strain SC-7 plasmid pSC7-vir, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

404. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP030343 (Klebsiella pneumoniae strain AR_362 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

405. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP035384 (Klebsiella pneumoniae strain AP8555 plasmid pAP855, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

406. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP026151 (Klebsiella pneumoniae strain F138 plasmid pF138_2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

407. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP040030 (Klebsiella pneumoniae strain KPC160121 plasmid pQnr-L121, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

408. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP052538 (Klebsiella pneumoniae strain B16KP0141 plasmid pB16KP0141-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

409. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP023917 (Klebsiella pneumoniae strain FDAARGOS_439 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

410. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP018460 (Klebsiella pneumoniae strain Kp_Goe_39795 plasmid pKp_Goe_795-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

411. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP040540 (Klebsiella pneumoniae strain CR-HvKP4 plasmid pCR-HvKP4-VIR, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

412. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to MF116002 (Uncultured bacterium plasmid pLGP4 clone J53, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

413. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP029387 (Klebsiella pneumoniae subsp. pneumoniae strain SCKP040074 plasmid pTetD_040074, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

414. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP011641 (Serratia marcescens strain CAV1492 plasmid pCAV1492-199, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

415. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP020903 (Klebsiella pneumoniae strain K66-45 plasmid pK66-45-2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

416. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP045194 (Klebsiella pneumoniae strain YML0508 plasmid pYML0508_1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

417. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP045675 (Klebsiella pneumoniae strain WSD411 plasmid pWSD411_2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

418. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP047678 (Klebsiella pneumoniae subsp. pneumoniae strain KUH-KPNHVF1 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

419. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP028181 (Klebsiella pneumoniae strain CFSAN054110 plasmid pGMI16-005_01, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

420. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP032173 (Klebsiella pneumoniae strain AR_0160 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

421. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP026166 (Klebsiella pneumoniae strain F81 plasmid pF81_2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

422. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP031103 (Leclercia sp. W17 plasmid pW17-2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

423. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP052441 (Klebsiella pneumoniae strain C16KP0102 plasmid pC16KP0102-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

424. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP052534 (Klebsiella pneumoniae strain B16KP0157 plasmid pB16KP0157-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

425. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_LR025093 (Klebsiella pneumoniae isolate KP9201 plasmid 2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

426. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NC_006671 (Escherichia coli A2363 plasmid pAPEC-O2-R, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

427. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP027603 (UNVERIFIED_ORG: Klebsiella pneumoniae strain AR_0080 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

428. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP017991 (Enterobacter cloacae complex sp. ECNIH7 plasmid pENT-1ac, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

429. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP042521 (Klebsiella pneumoniae strain C2 plasmid pC2_001, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

430. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP042546 (Klebsiella michiganensis strain C52 plasmid pC52_001, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

431. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP046613 (Klebsiella pneumoniae strain WCGKP294 plasmid pWCGKP294-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

432. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP021856 (Klebsiella pneumoniae strain AR_0125 plasmid tig00000001_pilon, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

433. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP024500 (Klebsiella pneumoniae strain KSB1_4E plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

434. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP043734 (Escherichia coli strain CVM N17EC1164 plasmid pN17EC1164-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

435. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP047676 (Klebsiella pneumoniae subsp. pneumoniae strain KUH-KPNHVL1 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

436. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP029724 (Klebsiella pneumoniae strain AR_0140 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

437. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP034138 (Klebsiella quasipneumoniae subsp. similipneumoniae strain G747 plasmid pG747_218.9Kb, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

438. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP027049 (Klebsiella pneumoniae strain 20_GR_12 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

439. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to MN823998 (Klebsiella pneumoniae strain 161116753 plasmid p116753-FIIK, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

440. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to MN823999 (Klebsiella pneumoniae strain 362713 plasmid p362713-FIIK, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

441. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP048303 (Salmonella enterica subsp. enterica serovar Schwarzengrund strain WAPHL-SAL-A00375 plasmid p28945-2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

442. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP052304 (Klebsiella pneumoniae strain E16KP0172 plasmid pE16KP0172-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

443. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP052370 (Klebsiella pneumoniae strain D16KP0087 plasmid pD16KP0087-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

444. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP051274 (Salmonella enterica subsp. enterica serovar Worthington strain OLF-FSR1_WB_Partridge_SW-37 plasmid pSW37-267109, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

445. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP033347 (Salmonella enterica subsp. enterica strain CFSA1096 plasmid pCFSA1096, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

446. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP011634 (Klebsiella oxytoca strain CAV1374 plasmid pCAV1374-228, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

447. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP041453 (Escherichia coli strain YPE3 plasmid pYPE3-92k-tetX4, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

448. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP042541 (Enterobacter hormaechei strain C4 plasmid pC4_001, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

449. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP024508 (Klebsiella pneumoniae strain KSB2_1B plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

450. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP024551 (Klebsiella pneumoniae strain INF163 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

451. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP032209 (Klebsiella pneumoniae strain AR_0109 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

452. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP032186 (Klebsiella pneumoniae strain AR_0075 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

453. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP027152 (Klebsiella pneumoniae strain AR_0363 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

454. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP014697 (Klebsiella quasipneumoniae strain ATCC 700603 isolate K6 plasmid pKQPS1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

455. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to MN842293 (Klebsiella pneumoniae strain 20130907-4 plasmid p309074-1FIIK, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

456. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to MG288679 (Klebsiella pneumoniae plasmid p911021-tetA, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

457. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP052506 (Klebsiella pneumoniae strain B16KP0226 plasmid pB16KP0226-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

458. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP052214 (Klebsiella pneumoniae strain E17KP0079 plasmid pE17KP0079-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

459. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP051271 (Salmonella enterica subsp. enterica serovar Worthington strain OLF-FSR1_WB_Quail_SW-70 plasmid pSW37-267106, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

460. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP052037 (Klebsiella pneumoniae strain KPN41053 plasmid pKPN41953, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

461. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP015823 (Klebsiella pneumoniae isolate blood sample 2 plasmid 1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

462. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP021710 (Klebsiella pneumoniae strain AR_0143 plasmid tig00000853, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

463. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP023488 (Klebsiella pneumoniae subsp. pneumoniae strain ST101:960186733 plasmid p19-10_01, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

464. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP052204 (Klebsiella pneumoniae strain F16KP0002 plasmid pF16KP0002-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

465. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP052504 (Klebsiella pneumoniae strain B17KP0020 plasmid pB17KP0020-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

466. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP053365 (Klebsiella pneumoniae strain BA2275 plasmid p1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

467. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP018365 (Klebsiella pneumoniae strain Kp_Goe_62629 plasmid pKp_Goe_629-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

468. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_AP018673 (Klebsiella pneumoniae strain GSU10-3 plasmid pGSU10-3-2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

469. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP033743 (Citrobacter freundii strain FDAARGOS_549 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

470. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NC_020132 (Klebsiella pneumoniae strain BK32179 plasmid pBK32179, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

471. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NC_024992 (Klebsiella pneumoniae plasmid pKp848CTX, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

472. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP023135 (Klebsiella pneumoniae subsp. pneumoniae strain KpvK54 plasmid pKpvK54, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

473. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP011577 (Klebsiella pneumoniae strain CAV1392 plasmid pCAV1392-131, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

474. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP011623 (Klebsiella pneumoniae strain CAV1344 plasmid pCAV1344-250, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

475. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NC_023025 (Cronobacter malonaticus plasmid p2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

476. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP027161 (Klebsiella pneumoniae strain AR_0361 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

477. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP022495 (Salmonella enterica subsp. enterica serovar Derby strain SA20035215 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

478. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP040595 (Klebsiella pneumoniae subsp. pneumoniae strain KpvST15_NDM plasmid pKpvST15, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

479. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP033798 (Enterobacter roggenkampii strain FDAARGOS_523 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

480. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP018361 (Klebsiella oxytoca strain CAV1752 plasmid pCAV1752-278, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

481. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP035197 (Klebsiella pneumoniae strain LH375 plasmid pLH375_1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

482. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP025009 (Klebsiella pneumoniae strain AUSMDU00008119 plasmid pAUSMDU8119-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

483. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP022917 (Klebsiella pneumoniae strain ST307PT04 plasmid pJYC04A, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

484. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP025577 (Klebsiella pneumoniae strain 08EU827 plasmid p08EU827_1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

485. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP050827 (Klebsiella pneumoniae strain Bckp212 plasmid pBckp212-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

486. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP052237 (Klebsiella pneumoniae strain E17KP0029 plasmid pE17KP0029-2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

487. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP052521 (Klebsiella pneumoniae strain B16KP0198 plasmid pB16KP0198-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

488. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP052178 (Klebsiella pneumoniae strain F16KP0045 plasmid pF16KP0045-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

489. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP048776 (Salmonella enterica subsp. enterica serovar Agona strain SG17-135 plasmid pSG17-135-HI2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

490. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP042883 (Klebsiella pneumoniae strain NMBU-W07E18 plasmid pNMBU-W07E18_01, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

491. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP047573 (Escherichia coli strain 2EC1 plasmid p2EC1-2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

492. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NC_019114 (Salmonella enterica subsp. enterica serovar Heidelberg plasmid pSH111_227, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

493. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP031369 (Klebsiella pneumoniae strain KpvST101_OXA-48 plasmid pKpvST101, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

494. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP041936 (Klebsiella pneumoniae strain KP14003 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

495. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP035209 (Klebsiella quasipneumoniae strain TH114 plasmid pTH114-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

496. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP024133 (Escherichia coli strain 14EC007 plasmid p14EC007b, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

497. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP052435 (Klebsiella pneumoniae strain C16KP0108 plasmid pC16KP0108-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

498. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP052140 (Klebsiella pneumoniae strain F17KP0040 plasmid pF17KP0040-2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

499. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP035211 (Klebsiella pneumoniae strain TH164 plasmid pTH164-2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

500. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP024543 (Klebsiella pneumoniae strain INF042 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

501. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP041629 (Escherichia coli strain PE15 plasmid pPE15-IncF, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

502. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to AP022358 (Klebsiella pneumoniae E278 plasmid pE278_IMP6 DNA, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

503. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP052499 (Klebsiella pneumoniae strain B17KP0021 plasmid pB17KP0021-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

504. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_AP014952 (Klebsiella oxytoca strain JKo3 plasmid pKO_JKo3_1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

505. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP054782 (Klebsiella pneumoniae strain KP20194a plasmid pKP20194a-p2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

506. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP028543 (Klebsiella pneumoniae subsp. pneumoniae strain SCKP020143 plasmid p1_020143, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

507. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP028390 (Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_095132, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

508. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP032842 (Enterobacter hormaechei strain C15117 plasmid pSPRC-Echo1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

509. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP018338 (Klebsiella pneumoniae isolate Kp_Goe_154414 plasmid pKp_Goe_414-2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

510. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP021697 (Klebsiella pneumoniae strain AR_0158 plasmid tig00000161, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

511. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP024483 (Klebsiella pneumoniae strain INF322 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

512. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP024484 (Klebsiella pneumoniae strain INF322 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

513. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP034083 (Klebsiella pneumoniae subsp. pneumoniae strain R210-2 plasmid pR210-2-vir, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

514. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP026851 (UNVERIFIED_ORG: Enterobacter cloacae strain AR_0072 plasmid unnamed1) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

515. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_LR025089 (Klebsiella pneumoniae isolate KP980 plasmid 2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

516. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP050281 (Klebsiella pneumoniae strain 9949 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

517. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP054265 (Klebsiella pneumoniae strain 39427 plasmid pKPN39427.1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

518. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP025340 (Salmonella enterica subsp. enterica serovar Typhimurium strain BL10 plasmid p220k, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

519. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP054764 (Klebsiella pneumoniae strain KP20194b2 plasmid pKP20194b2-p2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

520. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP029383 (Klebsiella pneumoniae subsp. pneumoniae strain SCKP020079 plasmid pVir_020079, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

521. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP028781 (Klebsiella pneumoniae subsp. pneumoniae strain SCKP020046 plasmid pNDM5_020046, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

522. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP043934 (Klebsiella pneumoniae strain 555 plasmid pSCKLB555-2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

523. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP027425 (Klebsiella oxytoca strain FDAARGOS_335 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

524. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP026012 (Klebsiella pneumoniae strain K2044 plasmid pK2044, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

525. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP026024 (Klebsiella pneumoniae strain 11420 plasmid p11420-HVKP, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

526. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP021951 (Klebsiella pneumoniae strain AR_0148 plasmid tig00000168_pilon, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

527. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP050823 (Klebsiella pneumoniae strain Bckp091 plasmid pBckp091-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

528. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP050784 (Salmonella enterica subsp. enterica serovar Indiana strain SI67 plasmid pSI67-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

529. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_AP019549 (Klebsiella pneumoniae strain THC11 plasmid pTHC11-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

530. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP052477 (Klebsiella pneumoniae strain C16KP0050 plasmid pC16KP0050-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

531. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_AP019401 (Klebsiella pneumoniae strain E013 plasmid pE013, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

532. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_AP019405 (Klebsiella pneumoniae strain E196 plasmid pE196_IMP6, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

533. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP054728 (Klebsiella pneumoniae strain KP20194e plasmid pKP20194e-p2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

534. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP025006 (Klebsiella pneumoniae strain AUSMDU00003562 plasmid pAUSMDU3562-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

535. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP025145 (Klebsiella pneumoniae strain NR5632 plasmid NR5632_p2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

536. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP025148 (Klebsiella pneumoniae strain KP1766 plasmid KP1766_p2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

537. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP026716 (Klebsiella oxytoca strain AR_0028 plasmid unitig_1_pilon, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

538. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP052243 (Klebsiella pneumoniae strain E17KP0019 plasmid pE17KP0019-2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

539. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP054734 (Klebsiella pneumoniae strain KP20194d plasmid pKP20194d-p2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

540. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP054722 (Klebsiella pneumoniae strain KP20194f plasmid pKP20194f-p2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

541. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to MH884652 (Salmonella sp. strain Sa27 plasmid pSa27-CIP, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

542. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to MH884653 (Salmonella sp. strain Sa27 plasmid pSa27-TC-CIP, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

543. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP041024 (Klebsiella pneumoniae strain KP1692 plasmid pKP1692, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

544. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP027411 (Salmonella enterica strain FDAARGOS_319 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

545. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP036188 (Klebsiella pneumoniae strain BA1559 plasmid pIncFIBK, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

546. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to CP050276 (Klebsiella pneumoniae strain 10553 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

547. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to MK649822 (Klebsiella pneumoniae strain 2579 plasmid p2579_1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

548. spacer 3.3|2078177|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP026937 (Escherichia coli strain CFS3292 plasmid pCFS3292-2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

549. spacer 3.4|2078238|32|LR134234|CRISPRCasFinder,CRT matches to NZ_KX015668 (Enterobacter cloacae strain CY01 plasmid pCY-CTX, complete sequence) position: , mismatch: 9, identity: 0.719

aagacgacgtgatccgcaaagtcgaaggcacg	CRISPR spacer
aaaacgacgtgatccgcaatgtcgtcaaagcc	Protospacer
**.**************** ****  .. .*

550. spacer 3.4|2078238|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP033346 (Salmonella enterica subsp. enterica serovar Tennessee strain CFSAN076210 plasmid pCFSAN076210, complete sequence) position: , mismatch: 9, identity: 0.719

aagacgacgtgatccgcaaagtcgaaggcacg	CRISPR spacer
aaaacgacgtgatccgcaatgtcgtcaaagcc	Protospacer
**.**************** ****  .. .*

551. spacer 3.4|2078238|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP010386 (Enterobacter hormaechei subsp. xiangfangensis strain 34399 plasmid p34399-121.660kb, complete sequence) position: , mismatch: 9, identity: 0.719

aagacgacgtgatccgcaaagtcgaaggcacg	CRISPR spacer
aaaacgacgtgatccgcaatgtcgtcaaagcc	Protospacer
**.**************** ****  .. .*

552. spacer 3.4|2078238|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP030078 (Enterobacter hormaechei strain 20710 plasmid p4-20710, complete sequence) position: , mismatch: 9, identity: 0.719

aagacgacgtgatccgcaaagtcgaaggcacg	CRISPR spacer
aaaacgacgtgatccgcaatgtcgtcaaagcc	Protospacer
**.**************** ****  .. .*

553. spacer 3.4|2078238|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP029247 (Enterobacter hormaechei subsp. xiangfangensis strain OSUVMCKPC4-2 plasmid pOSUEC_F, complete sequence) position: , mismatch: 9, identity: 0.719

aagacgacgtgatccgcaaagtcgaaggcacg	CRISPR spacer
aaaacgacgtgatccgcaatgtcgtcaaagcc	Protospacer
**.**************** ****  .. .*

554. spacer 3.4|2078238|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP048417 (Citrobacter freundii strain CitB plasmid pA_CitB, complete sequence) position: , mismatch: 9, identity: 0.719

aagacgacgtgatccgcaaagtcgaaggcacg	CRISPR spacer
aaaacgacgtgatccgcaatgtcgtcaaagcc	Protospacer
**.**************** ****  .. .*

555. spacer 3.4|2078238|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP042573 (Enterobacter hormaechei strain E5 plasmid pE5_002, complete sequence) position: , mismatch: 9, identity: 0.719

aagacgacgtgatccgcaaagtcgaaggcacg	CRISPR spacer
aaaacgacgtgatccgcaatgtcgtcaaagcc	Protospacer
**.**************** ****  .. .*

556. spacer 3.4|2078238|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP027605 (UNVERIFIED_ORG: Enterobacter cloacae strain AR_0093 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

aagacgacgtgatccgcaaagtcgaaggcacg	CRISPR spacer
aaaacgacgtgatccgcaatgtcgtcaaagcc	Protospacer
**.**************** ****  .. .*

557. spacer 3.4|2078238|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP051133 (Enterobacter hormaechei strain AMS-38 plasmid pAMS-38a, complete sequence) position: , mismatch: 9, identity: 0.719

aagacgacgtgatccgcaaagtcgaaggcacg	CRISPR spacer
aaaacgacgtgatccgcaatgtcgtcaaagcc	Protospacer
**.**************** ****  .. .*

558. spacer 3.4|2078238|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP014995 (Salmonella enterica subsp. enterica serovar Tennessee strain CFSAN001387 plasmid, complete sequence) position: , mismatch: 9, identity: 0.719

aagacgacgtgatccgcaaagtcgaaggcacg	CRISPR spacer
aaaacgacgtgatccgcaatgtcgtcaaagcc	Protospacer
**.**************** ****  .. .*

559. spacer 3.4|2078238|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP053193 (Enterobacter hormaechei strain EGYMCRVIM plasmid pMS-37c, complete sequence) position: , mismatch: 9, identity: 0.719

aagacgacgtgatccgcaaagtcgaaggcacg	CRISPR spacer
aaaacgacgtgatccgcaatgtcgtcaaagcc	Protospacer
**.**************** ****  .. .*

560. spacer 3.4|2078238|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP023068 (Ensifer sojae CCBAU 05684 plasmid pSJ05684b, complete sequence) position: , mismatch: 9, identity: 0.719

aagacgacgtgatccgcaaagtcgaaggcacg	CRISPR spacer
aagacggcgtgatccgcgaagtccggctcgct	Protospacer
******.**********.***** ..  *.*

561. spacer 3.6|2078360|32|LR134234|CRISPRCasFinder,CRT matches to KT588075 (Acinetobacter phage Ab105-2phi, complete genome) position: , mismatch: 9, identity: 0.719

gaatgatcccaaatttgggttacagaaccagt	CRISPR spacer
tacccatcccaattttgggatacagaacctcc	Protospacer
 * . ******* ****** *********  .

562. spacer 3.12|2078726|32|LR134234|CRISPRCasFinder,CRT matches to NC_019911 (Yersinia phage phi80-18 complete genome) position: , mismatch: 9, identity: 0.719

tgctttcctacgacaaatctggcgatgttgcg	CRISPR spacer
gagtacctaacgacatatatggcgatgttgcg	Protospacer
 . * .*. ****** ** *************

563. spacer 3.12|2078726|32|LR134234|CRISPRCasFinder,CRT matches to NC_047805 (Yersinia phage fHe-Yen3-01, complete genome) position: , mismatch: 9, identity: 0.719

tgctttcctacgacaaatctggcgatgttgcg	CRISPR spacer
gagtacctaacgacatatatggcgatgttgcg	Protospacer
 . * .*. ****** ** *************

564. spacer 3.14|2078848|32|LR134234|CRISPRCasFinder,CRT matches to MN693437 (Marine virus AFVG_25M476, complete genome) position: , mismatch: 9, identity: 0.719

ttgaactgttgatgttatcaaaatatcagctc	CRISPR spacer
ttgatctgttgatgtaatcaaaaactattgtt	Protospacer
**** ********** *******  *    *.

565. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP026049 (Raoultella planticola strain FDAARGOS_64 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

566. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP026283 (Klebsiella oxytoca strain KONIH2 plasmid pKOR-e6bf, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

567. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP018351 (Klebsiella pneumoniae strain CAV1417 plasmid pCAV1417-185, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

568. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP018675 (Klebsiella pneumoniae strain CAV1217 plasmid pKPC_CAV1217, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

569. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP032995 (Escherichia coli strain W5-6 plasmid p3_W5-6, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

570. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP052329 (Klebsiella pneumoniae strain D17KP0032 plasmid pD17KP0032-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

571. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP052168 (Klebsiella pneumoniae strain F16KP0075 plasmid pF16KP0075-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

572. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_KX710093 (Leclercia adecarboxylata strain pP10164 plasmid pP10164-2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

573. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_KY271405 (Klebsiella pneumoniae strain H151440672 plasmid pKPN3-307_typeB, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

574. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_KY271407 (Klebsiella pneumoniae strain CIV-4 plasmid pKPN3-307_typeD, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

575. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP045446 (Salmonella enterica subsp. enterica serovar Schwarzengrund strain 9355 plasmid p280_9355, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

576. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP014073 (Klebsiella quasipneumoniae strain FDAARGOS_93 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

577. spacer 3.18|2078178|32|LR134234|PILER-CR matches to MN783747 (Klebsiella oxytoca plasmid pIron_OXY, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

578. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP032195 (Klebsiella pneumoniae strain AR_0097 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

579. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP050836 (Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

580. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP050847 (Klebsiella pneumoniae strain Bckp206 plasmid pBckp206-2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

581. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP041286 (Escherichia coli strain 54 plasmid p54-tetX, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

582. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_KX636095 (Klebsiella pneumoniae strain RJ119 plasmid pRJ119-NDM1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

583. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_KX129784 (Escherichia coli strain H226B plasmid pH226B, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

584. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP029739 (Klebsiella pneumoniae strain AR_0087 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

585. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP028537 (Enterobacter hormaechei strain SCEH020042 plasmid pQnrB4_020042, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

586. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP035548 (Salmonella enterica subsp. enterica serovar Typhimurium strain YU07-18 plasmid pYU07-18_IncA/C2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

587. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP052485 (Klebsiella pneumoniae strain C16KP0036 plasmid pC16KP0036-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

588. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_KT203286 (Klebsiella pneumoniae strain U25 plasmid PU25001, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

589. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_KR653209 (Escherichia coli strain GDZ13 plasmid pGD0503Z13, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

590. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_KT347600 (Escherichia coli strain EC5207 plasmid pEC5207, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

591. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP042628 (Escherichia coli strain NCYU-25-82 plasmid pNCYU-25-82-1_MCR3, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

592. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP021752 (Klebsiella pneumoniae strain AR_0113 plasmid unitig_1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

593. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP025081 (Klebsiella pneumoniae strain SGH10 plasmid pSGH10, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

594. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP025142 (Klebsiella pneumoniae strain KP1768 plasmid KP1768_p2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

595. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP031258 (Klebsiella quasipneumoniae strain L22 plasmid pL22-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

596. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP026135 (Klebsiella pneumoniae strain F5 plasmid pF5_3, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

597. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP018434 (Klebsiella pneumoniae strain MNCRE53 plasmid pMNCRE53_4, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

598. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP044528 (Klebsiella grimontii strain SS141 plasmid plamid_1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

599. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP052163 (Klebsiella pneumoniae strain F16KP0082 plasmid pF16KP0082-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

600. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP019195 (Salmonella enterica subsp. enterica serovar Senftenberg str. ATCC 43845 plasmid pATCC43845, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

601. spacer 3.18|2078178|32|LR134234|PILER-CR matches to KY486279 (Salmonella sp. strain SH-01 plasmid pSH-01, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

602. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP022125 (Klebsiella pneumoniae strain DHQP1605752_NV plasmid p1605752FIB, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

603. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP018441 (Klebsiella pneumoniae strain Kp_Goe_822917 plasmid pKp_Goe_917-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

604. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP043049 (Klebsiella pneumoniae strain KLP268 plasmid pKLP268-3) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

605. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP019561 (Escherichia coli strain KSC1031 plasmid pMRGN1031, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

606. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP019647 (Salmonella enterica subsp. enterica serovar Typhimurium strain TW-Stm6 plasmid pSTM6-275, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

607. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP040123 (Klebsiella pneumoniae strain LSH-KPN148 plasmid pLSH-KPN148-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

608. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP012256 (Cronobacter sakazakii strain NCTC 8155 plasmid pCS3, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

609. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP013323 (Klebsiella pneumoniae strain CAV1193 plasmid pCAV1193-258, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

610. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP029588 (Klebsiella pneumoniae strain DA33141 plasmid pDA33141-217, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

611. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP030924 (Klebsiella pneumoniae subsp. pneumoniae strain KC-Pl-HB1 plasmid pKC-Pl-HB1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

612. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP034282 (Klebsiella pneumoniae strain I72 plasmid p72_FIBkpn, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

613. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP026022 (Klebsiella pneumoniae strain 11492 plasmid p11492-CTXM, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

614. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP014011 (Klebsiella pneumoniae subsp. pneumoniae strain RJF999 plasmid pRJF999, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

615. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP037442 (Klebsiella sp. PO552 plasmid p1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

616. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP037743 (Klebsiella pneumoniae strain ST23 plasmid pDHQP1701672_hv, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

617. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP052408 (Klebsiella pneumoniae strain C17KP0008 plasmid pC17KP0008-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

618. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP052450 (Klebsiella pneumoniae strain C16KP0077 plasmid pC16KP0077-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

619. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP023417 (Klebsiella pneumoniae strain 1050 plasmid pKp1050-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

620. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP044256 (Salmonella enterica strain CFSAN096147 plasmid pCFSAN096147, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

621. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NC_009649 (Klebsiella pneumoniae subsp. pneumoniae MGH 78578 plasmid pKPN3, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

622. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP035215 (Klebsiella michiganensis strain M82255 plasmid pKOCBH-A, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

623. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP035216 (Klebsiella michiganensis strain M82255 plasmid pKOCBH-B, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

624. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP052491 (Klebsiella pneumoniae strain B17KP0069 plasmid pB17KP0069-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

625. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP052159 (Klebsiella pneumoniae strain F16KP0084 plasmid pF16KP0084-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

626. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP045449 (Salmonella enterica subsp. enterica serovar Schwarzengrund strain 12888 plasmid p280_12888, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

627. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP040652 (Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain SA20070548 plasmid pSA20070548.1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

628. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP014649 (Klebsiella pneumoniae strain KPNIH36 plasmid pKPN-fff, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

629. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP024193 (Klebsiella pneumoniae isolate KSB1_5D plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

630. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP011977 (Klebsiella pneumoniae DMC1097 plasmid pDMC1097-218.836kb, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

631. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NC_014107 (Enterobacter cloacae subsp. cloacae ATCC 13047 plasmid pECL_A, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

632. spacer 3.18|2078178|32|LR134234|PILER-CR matches to MT035874 (Klebsiella pneumoniae strain KP18-3-8 plasmid pKP18-3-8_KPC_vir, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

633. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP052401 (Klebsiella pneumoniae strain C17KP0039 plasmid pC17KP0039-2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

634. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP052572 (Klebsiella pneumoniae strain A16KP0016 plasmid pA16KP0016-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

635. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP053729 (Escherichia coli strain CP61_Sichuan plasmid pCP61-IncFIB, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

636. spacer 3.18|2078178|32|LR134234|PILER-CR matches to MN200128 (Klebsiella pneumoniae strain 17ZR-91 plasmid p17ZR-91-Vir-RC, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

637. spacer 3.18|2078178|32|LR134234|PILER-CR matches to MN200130 (Escherichia coli strain EC600 plasmid p17ZR-91-TC1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

638. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP041928 (Klebsiella pneumoniae strain 18-2374 plasmid pSECR18-2374A, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

639. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP010393 (Klebsiella pneumoniae strain 34618 plasmid p34618-207.543kb, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

640. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP029448 (Serratia marcescens strain CAV1761 plasmid pCAV1761-205, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

641. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP026276 (Klebsiella oxytoca strain KONIH5 plasmid pKOR-ab4d, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

642. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP020508 (Serratia marcescens strain BWH-35 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

643. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP035636 (Enterobacter cloacae strain EN3600 plasmid unnamed4, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

644. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP052296 (Klebsiella pneumoniae strain E16KP0210 plasmid pE16KP0210-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

645. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP053738 (Escherichia coli strain CP8-3_Sichuan plasmid pCP8-3-IncFIB, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

646. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP042507 (Leclercia adecarboxylata strain E1 plasmid pE1_002, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

647. spacer 3.18|2078178|32|LR134234|PILER-CR matches to MN543573 (Klebsiella pneumoniae strain GH44 plasmid pGH44_216, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

648. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP033956 (Klebsiella pneumoniae strain L39_2 plasmid p3_L39, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

649. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP019559 (Escherichia coli strain KSC207 plasmid pMRGN207, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

650. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP047092 (Salmonella sp. S13 plasmid pS13-3, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

651. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NC_022078 (Klebsiella pneumoniae JM45 plasmid p1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

652. spacer 3.18|2078178|32|LR134234|PILER-CR matches to KX023259 (Escherichia coli plasmid pSCE516-4, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

653. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP026170 (Leclercia sp. LSNIH1 plasmid pLEC-000f, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

654. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP051431 (Escherichia sp. SCLE84 plasmid pSCLE1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

655. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP052432 (Klebsiella pneumoniae strain C16KP0122 plasmid pC16KP0122-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

656. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP052144 (Klebsiella pneumoniae strain F17KP0012 plasmid pF17KP0012-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

657. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP052363 (Klebsiella pneumoniae strain D16KP0122 plasmid pD16KP0122-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

658. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NC_009838 (Escherichia coli APEC O1 plasmid pAPEC-O1-R, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

659. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NC_020261 (Cronobacter sakazakii SP291 plasmid pSP291-2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

660. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP046001 (Escherichia coli strain 1916D6 plasmid p1916D6-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

661. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP024882 (Citrobacter freundii strain AR_0022 plasmid unitig_1_pilon, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

662. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP028954 (Klebsiella pneumoniae strain AR_0141 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

663. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP021103 (Escherichia coli strain 13P477T plasmid p13P477T-7, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

664. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP006642 (Escherichia coli PCN061 plasmid PCN061p6, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

665. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP008789 (Klebsiella oxytoca KONIH1 plasmid pKOX-137, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

666. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP033627 (Klebsiella pneumoniae strain 4743 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

667. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP027037 (Klebsiella pneumoniae strain 16_GR_13 plasmid IncFIB IncFII, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

668. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP036302 (Klebsiella pneumoniae subsp. pneumoniae strain WCHKP015093 plasmid p1_015093, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

669. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_LR130542 (Klebsiella pneumoniae strain AJ218 isolate AJ218 plasmid 2) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

670. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NC_023332 (Klebsiella pneumoniae strain ST48 plasmid pKP09085, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

671. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NC_023333 (Klebsiella pneumoniae strain ST23 plasmid pKP007, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

672. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NC_023334 (Klebsiella pneumoniae strain ST15 plasmid pKP02022, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

673. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP009871 (Pantoea sp. PSNIH2 plasmid pPSP-cd6, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

674. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP012682 (Salmonella enterica subsp. enterica serovar Typhimurium strain 33676 plasmid p33676_IncA/C, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

675. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP045188 (Escherichia coli strain NT1F31 plasmid pNT1F31-tetX4, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

676. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP019049 (Klebsiella pneumoniae subsp. pneumoniae strain RJA166 plasmid pRJA166b, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

677. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP020499 (Klebsiella pneumoniae strain BWHC1 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

678. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP020506 (Serratia marcescens strain 95 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

679. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP025038 (Klebsiella pneumoniae strain NU-CRE047 plasmid pNU-CRE047_1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

680. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP031547 (Escherichia coli strain cq9 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

681. spacer 3.18|2078178|32|LR134234|PILER-CR matches to MK347226 (Klebsiella pneumoniae strain K185 plasmid pK185_rmpA2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

682. spacer 3.18|2078178|32|LR134234|PILER-CR matches to MK347227 (Klebsiella pneumoniae strain K187 plasmid pK187_rmpA2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

683. spacer 3.18|2078178|32|LR134234|PILER-CR matches to MK347228 (Klebsiella pneumoniae strain K195 plasmid pK195_rmpA2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

684. spacer 3.18|2078178|32|LR134234|PILER-CR matches to MK347229 (Klebsiella pneumoniae strain K199 plasmid pK199_rmpA2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

685. spacer 3.18|2078178|32|LR134234|PILER-CR matches to MK347230 (Klebsiella pneumoniae strain K202 plasmid pK202_rmpA2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

686. spacer 3.18|2078178|32|LR134234|PILER-CR matches to MK347231 (Klebsiella pneumoniae strain K204 plasmid pK204_rmpA2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

687. spacer 3.18|2078178|32|LR134234|PILER-CR matches to MK347232 (Klebsiella pneumoniae strain K211 plasmid pK211_rmpA2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

688. spacer 3.18|2078178|32|LR134234|PILER-CR matches to MK347233 (Klebsiella pneumoniae strain K214 plasmid pK214_rmpA2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

689. spacer 3.18|2078178|32|LR134234|PILER-CR matches to MK347234 (Klebsiella pneumoniae strain K230 plasmid pK230_rmpA2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

690. spacer 3.18|2078178|32|LR134234|PILER-CR matches to MK347235 (Klebsiella pneumoniae strain K232 plasmid pK232_rmpA2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

691. spacer 3.18|2078178|32|LR134234|PILER-CR matches to MK347236 (Klebsiella pneumoniae strain K234 plasmid pK234_rmpA2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

692. spacer 3.18|2078178|32|LR134234|PILER-CR matches to MK347237 (Klebsiella pneumoniae strain K235 plasmid pK235_rmpA2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

693. spacer 3.18|2078178|32|LR134234|PILER-CR matches to MK347238 (Klebsiella pneumoniae strain K239 plasmid pK239_rmpA2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

694. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP052405 (Klebsiella pneumoniae strain C17KP0020 plasmid pC17KP0020-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

695. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP052137 (Klebsiella pneumoniae strain F17KP0054 plasmid pF17KP0054-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

696. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP018693 (Klebsiella pneumoniae strain Kp_Goe_821588 plasmid pKp_Goe_588-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

697. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP024708 (Klebsiella pneumoniae strain cr-hvkp3 plasmid pPUTH1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

698. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP034776 (Klebsiella pneumoniae strain 18CPO060 plasmid phvKP060, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

699. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP042639 (Escherichia coli strain NCYU-24-74 plasmid pNCYU-24-74-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

700. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP015135 (Klebsiella pneumoniae strain ATCC 35657 plasmid p35657-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

701. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP045662 (Klebsiella pneumoniae strain SMU18037509 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

702. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP020842 (Klebsiella pneumoniae strain KPN1482 plasmid pKPN1482-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

703. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP020855 (Klebsiella pneumoniae strain KPN528 plasmid pKPN528-2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

704. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP044301 (Escherichia coli strain P59A plasmid pP59A-3, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

705. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP031811 (Klebsiella pneumoniae strain INF014-sc-2279884 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

706. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP025277 (Salmonella enterica subsp. enterica strain USDA-ARS-USMARC-60984 plasmid pSJO-60984, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

707. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP017182 (Enterobacter kobei strain DSM 13645 plasmid pDSMZ13645, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

708. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP013942 (Cronobacter malonaticus LMG 23826 plasmid pCMA2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

709. spacer 3.18|2078178|32|LR134234|PILER-CR matches to MN891675 (Klebsiella pneumoniae strain 358573 plasmid p358573-KPC, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

710. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP052357 (Klebsiella pneumoniae strain D16KP0144 plasmid pD16KP0144-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

711. spacer 3.18|2078178|32|LR134234|PILER-CR matches to LC549807 (Klebsiella pneumoniae VNCKp115 plasmid pVNCKp115 DNA, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

712. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_LR134257 (Klebsiella aerogenes strain NCTC9644 plasmid 4, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

713. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP041645 (Klebsiella pneumoniae strain NKU_Kleb8A7 plasmid pKleb8A7, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

714. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP041949 (Klebsiella pneumoniae strain KP2 plasmid pKP2_3, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

715. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP020838 (Klebsiella pneumoniae strain BK13043 plasmid pBK13043-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

716. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP031569 (Enterobacter hormaechei strain 2013_1a plasmid pIncFIB-1301491, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

717. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP031563 (Klebsiella pneumoniae strain 2-1 plasmid pKP21HI1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

718. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP030182 (Salmonella enterica strain SA20030575 plasmid pSA20030575.1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

719. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP028784 (Klebsiella pneumoniae strain SCKP020049 plasmid p1_020049, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

720. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP027054 (Klebsiella pneumoniae strain 2_GR_12 plasmid IncFIB IncFII) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

721. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP052445 (Klebsiella pneumoniae strain C16KP0098 plasmid pC16KP0098-2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

722. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP052570 (Klebsiella pneumoniae strain A16KP0119 plasmid pA16KP0119-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

723. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP052218 (Klebsiella pneumoniae strain E17KP0053 plasmid pE17KP0053-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

724. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP040894 (Leclercia adecarboxylata strain Z96-1 plasmid pZ96-1_3, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

725. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP035380 (Leclercia adecarboxylata strain R25 plasmid pLA-109, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

726. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP014009 (Klebsiella pneumoniae subsp. pneumoniae strain RJF293 plasmid pRJF293, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

727. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP023479 (Klebsiella quasipneumoniae strain KPC142 plasmid pKQPS142a, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

728. spacer 3.18|2078178|32|LR134234|PILER-CR matches to MN310373 (Klebsiella pneumoniae strain BJ20 plasmid pBJ20-tetA, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

729. spacer 3.18|2078178|32|LR134234|PILER-CR matches to MN310374 (Klebsiella pneumoniae strain 2016071221 plasmid p71221-tetA, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

730. spacer 3.18|2078178|32|LR134234|PILER-CR matches to MN310376 (Klebsiella pneumoniae strain 08291 plasmid pW08291-tetA, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

731. spacer 3.18|2078178|32|LR134234|PILER-CR matches to MN310380 (Raoultella ornithinolytica strain 170602815 plasmid p602815-NR, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

732. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP018424 (Klebsiella pneumoniae strain MNCRE69 plasmid pMNCRE69_4, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

733. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP049605 (Klebsiella pneumoniae strain Kp8701 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

734. spacer 3.18|2078178|32|LR134234|PILER-CR matches to MH909331 (Leclercia adecarboxylata plasmid p707804-NDM, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

735. spacer 3.18|2078178|32|LR134234|PILER-CR matches to AP020333 (Salmonella enterica SESen3709 plasmid pSESen3709_1 DNA, complete genome) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

736. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP031736 (Klebsiella pneumoniae subsp. pneumoniae strain Klebsiella pneumoniae plasmid pKPM502, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

737. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP034251 (Salmonella enterica subsp. enterica serovar Derby strain Sa64 plasmid pSa64T-188, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

738. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP035916 (Salmonella enterica strain S61394 plasmid pLS61394-MCR, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

739. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP039577 (Salmonella enterica subsp. enterica serovar Typhimurium strain PNCS014856 plasmid p10-3857.1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

740. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP029591 (Klebsiella pneumoniae strain DA33144 plasmid pDA33144-220, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

741. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP012989 (Klebsiella pneumoniae strain KpN01 plasmid pKpN01-SIL, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

742. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP018818 (Klebsiella pneumoniae strain AR_0049 plasmid unitig_2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

743. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP037966 (Klebsiella pneumoniae strain SCKP020135 plasmid p1_020135, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

744. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP038140 (Escherichia coli strain G3X16-2 plasmid pG3X16-2-3, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

745. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP052321 (Klebsiella pneumoniae strain E16KP0035 plasmid pE16KP0035-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

746. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP052148 (Klebsiella pneumoniae strain F16KP0108 plasmid pF16KP0108-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

747. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP019019 (Escherichia coli strain Ecol_244 plasmid pEC244_1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

748. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NC_021654 (Klebsiella pneumoniae plasmid pKN-LS6, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

749. spacer 3.18|2078178|32|LR134234|PILER-CR matches to LR134211 (Klebsiella aerogenes strain NCTC418 genome assembly, plasmid: 2) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

750. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP041084 (Klebsiella pneumoniae strain Kp202 plasmid pKp202_2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

751. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP042616 (Escherichia coli strain NCYU-26-73 plasmid pNCYU-26-73-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

752. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP026274 (Klebsiella oxytoca strain KONIH4 plasmid pKPC-4b66, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

753. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP031799 (Klebsiella pneumoniae strain QMP B2-170 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

754. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP036337 (Klebsiella pneumoniae strain BP327 plasmid pIncFIBK, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

755. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP050011 (Citrobacter sp. Y3 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

756. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP052415 (Klebsiella pneumoniae strain C16KP0189 plasmid pC16KP0189-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

757. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP052559 (Klebsiella pneumoniae strain A17KP0008 plasmid pA17KP0008-2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

758. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP052270 (Klebsiella pneumoniae strain E16KP0268 plasmid pE16K0268-2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

759. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NC_005249 (Klebsiella pneumoniae CG43 plasmid pLVPK, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

760. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NC_016966 (Klebsiella pneumoniae plasmid pUUH239.2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

761. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP031284 (Escherichia fergusonii strain 40A plasmid p280_40A, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

762. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP041514 (Klebsiella michiganensis strain KNU07 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

763. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP041100 (Klebsiella pneumoniae subsp. pneumoniae strain KPCTRSRTH07 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

764. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP041375 (Klebsiella pneumoniae strain KP58 plasmid pKP58-2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

765. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP042482 (Klebsiella pneumoniae strain C51 plasmid pC51_001, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

766. spacer 3.18|2078178|32|LR134234|PILER-CR matches to MK461930 (Escherichia coli strain 2009_36 plasmid p2009_36_HI2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

767. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP021834 (Klebsiella pneumoniae strain AR_0120 plasmid tig00000500_pilon, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

768. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP027613 (Klebsiella pneumoniae subsp. ozaenae strain AR_0096 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

769. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP024875 (Klebsiella pneumoniae strain NH25 plasmid pNH25.1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

770. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP022692 (Klebsiella pneumoniae subsp. pneumoniae strain AUSMDU00008079 plasmid pAUSMDU00008079_01, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

771. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP022920 (Klebsiella pneumoniae strain ST307PT03 plasmid pJYC03A, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

772. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP034326 (Klebsiella pneumoniae isolate KSH203 plasmid pKSH203-qnrS, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

773. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP035180 (Klebsiella pneumoniae strain BA33875 plasmid pBA33875_IncFIB, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

774. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NC_008573 (Shewanella sp. ANA-3 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

775. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP025212 (Klebsiella pneumoniae strain HZW25 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

776. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP052232 (Klebsiella pneumoniae strain E17KP0033 plasmid pE17KP0033-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

777. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP052873 (Enterobacter cloacae strain 3849 plasmid p3846III, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

778. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP021958 (Klebsiella pneumoniae strain AR_0139 plasmid tig00000002_u) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

779. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP040546 (Klebsiella pneumoniae strain CR-HvKP5 plasmid pCR-HvKP5-VIR, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

780. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP028792 (Klebsiella pneumoniae strain WCHKP020030 plasmid pQnrS1_020030, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

781. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP033823 (Klebsiella sp. FDAARGOS_511 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

782. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP015132 (Klebsiella pneumoniae strain Kpn555 plasmid pKPN-d90, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

783. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP012572 (Klebsiella pneumoniae strain UCLAOXA232KP plasmid pUCLAOXA232-6.X, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

784. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP042513 (Serratia marcescens strain E28 plasmid pE28_001, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

785. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP032241 (Klebsiella pneumoniae strain XJ-K2 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

786. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP046273 (Enterobacter hormaechei strain E70 plasmid pE70-sul2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

787. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP029136 (Klebsiella pneumoniae strain AR376 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

788. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP047460 (Escherichia coli strain ZF31 plasmid pZF31-tetX-119kb, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

789. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP047466 (Escherichia coli strain ZF34 plasmid pZF34-tetX-114kb, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

790. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP052176 (Klebsiella pneumoniae strain F16KP0050 plasmid pF16KP0050-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

791. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP052193 (Klebsiella pneumoniae strain F16KP0014 plasmid pF16KP0014-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

792. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP014121 (Klebsiella pneumoniae strain FDAARGOS_156 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

793. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_LT991959 (Enterobacter cloacae complex sp. isolate C45 plasmid pC45-p2) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

794. spacer 3.18|2078178|32|LR134234|PILER-CR matches to LC511658 (Escherichia coli 2017.03.03CC plasmid p2017_03_03CC DNA, complete genome) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

795. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP029037 (Salmonella enterica subsp. enterica serovar Senftenberg str. 361154004 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

796. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP041640 (Klebsiella pneumoniae strain PIMB15ND2KP27 plasmid pKP27-MPH, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

797. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP043854 (Enterobacter hormaechei strain EB_P6_L3_02.19 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

798. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP026752 (Klebsiella pneumoniae strain AR_0066 plasmid tig00000080_pilon, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

799. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP018886 (Klebsiella pneumoniae subsp. pneumoniae strain BR21 plasmid pIncF, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

800. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP039857 (Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014876 plasmid p15-0756.1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

801. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP039809 (Klebsiella pneumoniae strain C2660 plasmid pC2660-2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

802. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP029101 (Klebsiella pneumoniae strain AR438 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

803. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP040862 (Klebsiella pneumoniae strain Xen39 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

804. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP036191 (Klebsiella pneumoniae strain BA34918 plasmid pvirulence_VBA34918, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

805. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP040025 (Klebsiella pneumoniae strain KPC160132 plasmid pKpn3-L132, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

806. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP052266 (Klebsiella pneumoniae strain E16KP0287 plasmid pE16K0287-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

807. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP052561 (Klebsiella pneumoniae strain A17KP0004 plasmid pA17KP0004-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

808. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP052209 (Klebsiella pneumoniae strain E17KP0085 plasmid pE17KP0085-2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

809. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NC_006625 (Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 plasmid pK2044, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

810. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP022734 (Escherichia coli strain SA186 plasmid pSA186_5, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

811. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP038004 (Klebsiella pneumoniae strain SCKP020009 plasmid pLAP2_020009, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

812. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP007734 (Klebsiella pneumoniae subsp. pneumoniae KPNIH27 plasmid pKPN-262, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

813. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP026175 (Klebsiella pneumoniae strain KPNIH50 plasmid pKPC-0cc9, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

814. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP026179 (Klebsiella pneumoniae strain KPNIH49 plasmid pKPC-224e, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

815. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP026185 (Klebsiella pneumoniae strain KPNIH49 plasmid pKPN-9a0d, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

816. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP026186 (Klebsiella pneumoniae strain KPNIH49 plasmid pKPN-3967, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

817. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP028995 (Klebsiella pneumoniae strain AR_0079 plasmid unnamed6, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

818. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP031815 (Klebsiella pneumoniae strain KSB1_7F-sc-2280268 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

819. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP033402 (Klebsiella pneumoniae strain WCHKP115069 plasmid p1_115069, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

820. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP039526 (Klebsiella pneumoniae subsp. pneumoniae strain HB25-1 plasmid pHB25-1-vir, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

821. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP052302 (Klebsiella pneumoniae strain E16KP0180 plasmid pE16KP0180-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

822. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP018355 (Klebsiella pneumoniae strain CAV1453 plasmid pCAV1453-208, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

823. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP043751 (Escherichia coli strain CVM N62675 plasmid pN62675, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

824. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP031583 (Klebsiella pneumoniae strain N4b plasmid pIncFII-1502320, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

825. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP029598 (Klebsiella quasipneumoniae subsp. similipneumoniae strain ATCC 700603 plasmid pDA33145-152, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

826. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP031614 (Klebsiella pneumoniae strain ZYST1 plasmid pZYST1C1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

827. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP047337 (Klebsiella pneumoniae strain 2019036D plasmid p2019036D-mcr8-345kb, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

828. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP019214 (Escherichia coli strain WCHEC050613 plasmid pMCR_WCHEC050613, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

829. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP021544 (Klebsiella pneumoniae strain AR_0112 plasmid tig00000000, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

830. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP021540 (Klebsiella pneumoniae strain AR_0047 plasmid tig00000001, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

831. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP021686 (Klebsiella pneumoniae strain AR_0146 plasmid tig00001160, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

832. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP043545 (Escherichia coli strain F2_81 plasmid pF2_18C_HI2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

833. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP012169 (Enterobacter hormaechei subsp. steigerwaltii strain 34998 plasmid p34998-210.894kb, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

834. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP022926 (Klebsiella pneumoniae strain ST307PT01 plasmid pJYC01A, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

835. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP036307 (Klebsiella pneumoniae strain WCHKP020098 plasmid p1_020098, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

836. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP022149 (Enterobacter roggenkampii strain 704SK10 plasmid p704SK10_1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

837. spacer 3.18|2078178|32|LR134234|PILER-CR matches to KT896504 (Klebsiella pneumoniae strain I11 plasmid pKPSH11, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

838. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP036176 (Klebsiella huaxiensis strain WCHKl090001 plasmid p1_090001, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

839. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP052380 (Klebsiella pneumoniae strain D16KP0017 plasmid pD16KP0017-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

840. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP052563 (Klebsiella pneumoniae strain A16KP0135 plasmid pA16KP0135-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

841. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP052525 (Klebsiella pneumoniae strain B16KP0177 plasmid pB16KP0177-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

842. spacer 3.18|2078178|32|LR134234|PILER-CR matches to LT009688 (Klebsiella pneumoniae plasmid pIT-06C07, strain O6CO7, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

843. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP030003 (Salmonella enterica subsp. enterica serovar Brandenburg strain SA20064858 plasmid pSA20064858.1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

844. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP030066 (Klebsiella pneumoniae strain IA565 plasmid pDA11912.1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

845. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP028549 (Klebsiella variicola strain WCHKP19 plasmid p1_020019, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

846. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP009865 (Klebsiella pneumoniae subsp. pneumoniae strain KPNIH29 plasmid pKPN-80a, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

847. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP009879 (Klebsiella pneumoniae subsp. pneumoniae strain KPNIH31 plasmid pKPN-c22, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

848. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP009777 (Klebsiella pneumoniae subsp. pneumoniae strain KPNIH32 plasmid pKPN-a68, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

849. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP008800 (Klebsiella pneumoniae subsp. pneumoniae KPNIH24 plasmid pKPN-e44, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

850. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP044036 (Klebsiella pneumoniae strain FDAARGOS_630 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

851. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP024153 (Escherichia coli strain 14EC033 plasmid p14EC033f, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

852. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP046950 (Klebsiella pneumoniae strain BD_DM_914 plasmid punnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

853. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP046940 (Klebsiella pneumoniae strain BD_DM_697 plasmid punnamed1) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

854. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP006927 (Klebsiella pneumoniae 30660/NJST258_1 plasmid pNJST258N1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

855. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP008930 (Klebsiella pneumoniae strain PMK1 plasmid pPMK1-A, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

856. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP007729 (Klebsiella pneumoniae subsp. pneumoniae KPNIH10 plasmid pKPN-498, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

857. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP052282 (Klebsiella pneumoniae strain E16KP0224 plasmid pE16KP0224-2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

858. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP006663 (Klebsiella pneumoniae strain ATCC BAA-2146 plasmid pCuAs, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

859. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP009855 (UNVERIFIED_ORG: Enterobacter cloacae strain ECNIH5 plasmid pENT-22e, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

860. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP024144 (Escherichia coli strain 14EC029 plasmid p14EC029c, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

861. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP026390 (Leclercia sp. LSNIH3 plasmid pLEC-5e18, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

862. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP008907 (Enterobacter hormaechei subsp. hoffmannii ECR091 plasmid pENT-4bd, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

863. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP029143 (Klebsiella michiganensis strain AR375 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

864. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP048380 (Klebsiella variicola strain 118 plasmid p118_A, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

865. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP030920 (Escherichia coli strain KL53 plasmid pKL53-L, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

866. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP026397 (Klebsiella pneumoniae strain KPNIH48 plasmid pKPN-10f7, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

867. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP052288 (Klebsiella pneumoniae strain E16KP0218 plasmid pE16KP0218-2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

868. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP008842 (Klebsiella michiganensis strain M1 plasmid pKOXM1A, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

869. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP026058 (Citrobacter freundii strain FDAARGOS_73 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

870. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP022824 (Klebsiella quasivariicola strain KPN1705 plasmid pKPN1705-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

871. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_AP019666 (Klebsiella pneumoniae strain TA6363 plasmid pTMTA63631, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

872. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP020062 (Klebsiella pneumoniae strain AR_0117 plasmid unitig_1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

873. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP020072 (Klebsiella pneumoniae strain AR_0115 plasmid tig00000002, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

874. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP020109 (Klebsiella pneumoniae strain AR_0098 plasmid tig00000001, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

875. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP047193 (Klebsiella pneumoniae strain Kp36 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

876. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP029435 (Klebsiella quasipneumoniae strain CAV2013 plasmid pCAV2013-156, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

877. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP029430 (Klebsiella quasipneumoniae strain CAV2018 plasmid pCAV2018-177, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

878. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP029430 (Klebsiella quasipneumoniae strain CAV2018 plasmid pCAV2018-177, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

879. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP015386 (Klebsiella pneumoniae strain NY9 plasmid pNY9_1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

880. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP020069 (Klebsiella pneumoniae strain AR_0068 plasmid unitig_2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

881. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP012567 (Klebsiella pneumoniae strain UCLAOXA232KP plasmid pUCLAOXA232-6, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

882. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP010154 (Escherichia coli strain D9 plasmid B, complete genome) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

883. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP024537 (Klebsiella pneumoniae strain KSB1_9D plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

884. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP024516 (Klebsiella pneumoniae strain KSB1_10J plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

885. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP032988 (Escherichia coli strain BE2-5 plasmid p2_BE2-5, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

886. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP036443 (Klebsiella pneumoniae strain ABFPV plasmid tig00001208_pilon, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

887. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP050379 (Klebsiella pneumoniae strain 51015 plasmid p51015_CTX_M_15, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

888. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP035906 (Klebsiella pneumoniae strain BA4656 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

889. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP025516 (Klebsiella pneumoniae strain 002SK2 plasmid p002SK2_A, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

890. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP052276 (Klebsiella pneumoniae strain E16KP0241 plasmid pE16KP0241-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

891. spacer 3.18|2078178|32|LR134234|PILER-CR matches to MF943217 (Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_WCHKP13F2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

892. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP032164 (Klebsiella pneumoniae strain XJ-K1 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

893. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP025457 (Klebsiella pneumoniae strain KP69 plasmid p69-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

894. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP024130 (Escherichia coli strain 14EC001 plasmid p14EC001c, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

895. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP034416 (Klebsiella pneumoniae strain C789 plasmid pVir-CR-hvKP-C789, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

896. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP011429 (Salmonella enterica subsp. enterica serovar Typhimurium strain YU39 isolate YUHS 05-78 plasmid pYU39_IncA/C, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

897. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP034130 (Klebsiella quasipneumoniae strain G4584 plasmid pG4584_218.9Kb, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

898. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP034681 (Klebsiella quasipneumoniae strain D120-1 plasmid pD120-1_296kb, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

899. spacer 3.18|2078178|32|LR134234|PILER-CR matches to MF918373 (Klebsiella pneumoniae plasmid p1512-dfrA, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

900. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP052423 (Klebsiella pneumoniae strain C16KP0164 plasmid pC16KP0164-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

901. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP052545 (Klebsiella pneumoniae strain B16KP0102 plasmid pB16KP0102-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

902. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP052298 (Klebsiella pneumoniae strain E16KP0204 plasmid pE16KP0204-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

903. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_LR130549 (Klebsiella pneumoniae strain KPC2 isolate KPC2 plasmid 2) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

904. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP032491 (Salmonella enterica subsp. enterica serovar Typhimurium strain SL26 plasmid pSL26_IncA/C2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

905. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP032495 (Salmonella enterica subsp. enterica serovar Typhimurium strain SO21 plasmid pSO21_118, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

906. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP046382 (Klebsiella pneumoniae strain BD_DM_782 plasmid punnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

907. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP022574 (Klebsiella pneumoniae strain BIC-1 plasmid pBIC-1a, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

908. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP050373 (Klebsiella pneumoniae strain 50595 plasmid p50595_IncFII, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

909. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP050174 (Escherichia coli strain STB20-1 plasmid pSTB20-1T, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

910. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP048299 (Salmonella enterica subsp. enterica serovar Schwarzengrund strain WAPHL_SAL-A00527 plasmid pN1566-2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

911. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP052190 (Klebsiella pneumoniae strain F16KP0019 plasmid pF16KP0019-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

912. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP052387 (Klebsiella pneumoniae strain C17KP0055 plasmid pC17KP0055-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

913. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NC_005211 (Serratia marcescens plasmid R478, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

914. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NC_021198 (Klebsiella pneumoniae subsp. pneumoniae KPX plasmid pKPX-1 DNA, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

915. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP012884 (Klebsiella pneumoniae KP-1 plasmid pKP1-19, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

916. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP026661 (Salmonella enterica subsp. enterica strain 15-SA01028 plasmid pSE15-SA01028, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

917. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP018670 (Klebsiella pneumoniae strain CAV1042 plasmid pCAV1042-183, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

918. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP028804 (Klebsiella pneumoniae strain WCHKP7E2 plasmid pCMY2_085072, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

919. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP021713 (Klebsiella pneumoniae strain AR_0129 plasmid tig00000000, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

920. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP030270 (Klebsiella pneumoniae subsp. pneumoniae strain SC-7 plasmid pSC7-vir, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

921. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP030343 (Klebsiella pneumoniae strain AR_362 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

922. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP035384 (Klebsiella pneumoniae strain AP8555 plasmid pAP855, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

923. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP026151 (Klebsiella pneumoniae strain F138 plasmid pF138_2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

924. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP040030 (Klebsiella pneumoniae strain KPC160121 plasmid pQnr-L121, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

925. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP052538 (Klebsiella pneumoniae strain B16KP0141 plasmid pB16KP0141-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

926. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP023917 (Klebsiella pneumoniae strain FDAARGOS_439 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

927. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP018460 (Klebsiella pneumoniae strain Kp_Goe_39795 plasmid pKp_Goe_795-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

928. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP040540 (Klebsiella pneumoniae strain CR-HvKP4 plasmid pCR-HvKP4-VIR, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

929. spacer 3.18|2078178|32|LR134234|PILER-CR matches to MF116002 (Uncultured bacterium plasmid pLGP4 clone J53, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

930. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP029387 (Klebsiella pneumoniae subsp. pneumoniae strain SCKP040074 plasmid pTetD_040074, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

931. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP011641 (Serratia marcescens strain CAV1492 plasmid pCAV1492-199, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

932. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP020903 (Klebsiella pneumoniae strain K66-45 plasmid pK66-45-2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

933. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP045194 (Klebsiella pneumoniae strain YML0508 plasmid pYML0508_1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

934. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP045675 (Klebsiella pneumoniae strain WSD411 plasmid pWSD411_2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

935. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP047678 (Klebsiella pneumoniae subsp. pneumoniae strain KUH-KPNHVF1 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

936. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP028181 (Klebsiella pneumoniae strain CFSAN054110 plasmid pGMI16-005_01, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

937. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP032173 (Klebsiella pneumoniae strain AR_0160 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

938. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP026166 (Klebsiella pneumoniae strain F81 plasmid pF81_2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

939. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP031103 (Leclercia sp. W17 plasmid pW17-2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

940. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP052441 (Klebsiella pneumoniae strain C16KP0102 plasmid pC16KP0102-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

941. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP052534 (Klebsiella pneumoniae strain B16KP0157 plasmid pB16KP0157-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

942. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_LR025093 (Klebsiella pneumoniae isolate KP9201 plasmid 2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

943. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NC_006671 (Escherichia coli A2363 plasmid pAPEC-O2-R, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

944. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP027603 (UNVERIFIED_ORG: Klebsiella pneumoniae strain AR_0080 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

945. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP017991 (Enterobacter cloacae complex sp. ECNIH7 plasmid pENT-1ac, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

946. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP042521 (Klebsiella pneumoniae strain C2 plasmid pC2_001, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

947. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP042546 (Klebsiella michiganensis strain C52 plasmid pC52_001, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

948. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP046613 (Klebsiella pneumoniae strain WCGKP294 plasmid pWCGKP294-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

949. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP021856 (Klebsiella pneumoniae strain AR_0125 plasmid tig00000001_pilon, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

950. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP024500 (Klebsiella pneumoniae strain KSB1_4E plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

951. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP043734 (Escherichia coli strain CVM N17EC1164 plasmid pN17EC1164-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

952. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP047676 (Klebsiella pneumoniae subsp. pneumoniae strain KUH-KPNHVL1 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

953. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP029724 (Klebsiella pneumoniae strain AR_0140 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

954. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP034138 (Klebsiella quasipneumoniae subsp. similipneumoniae strain G747 plasmid pG747_218.9Kb, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

955. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP027049 (Klebsiella pneumoniae strain 20_GR_12 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

956. spacer 3.18|2078178|32|LR134234|PILER-CR matches to MN823998 (Klebsiella pneumoniae strain 161116753 plasmid p116753-FIIK, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

957. spacer 3.18|2078178|32|LR134234|PILER-CR matches to MN823999 (Klebsiella pneumoniae strain 362713 plasmid p362713-FIIK, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

958. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP048303 (Salmonella enterica subsp. enterica serovar Schwarzengrund strain WAPHL-SAL-A00375 plasmid p28945-2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

959. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP052304 (Klebsiella pneumoniae strain E16KP0172 plasmid pE16KP0172-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

960. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP052370 (Klebsiella pneumoniae strain D16KP0087 plasmid pD16KP0087-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

961. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP051274 (Salmonella enterica subsp. enterica serovar Worthington strain OLF-FSR1_WB_Partridge_SW-37 plasmid pSW37-267109, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

962. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP033347 (Salmonella enterica subsp. enterica strain CFSA1096 plasmid pCFSA1096, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

963. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP011634 (Klebsiella oxytoca strain CAV1374 plasmid pCAV1374-228, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

964. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP041453 (Escherichia coli strain YPE3 plasmid pYPE3-92k-tetX4, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

965. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP042541 (Enterobacter hormaechei strain C4 plasmid pC4_001, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

966. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP024508 (Klebsiella pneumoniae strain KSB2_1B plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

967. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP024551 (Klebsiella pneumoniae strain INF163 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

968. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP032209 (Klebsiella pneumoniae strain AR_0109 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

969. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP032186 (Klebsiella pneumoniae strain AR_0075 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

970. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP027152 (Klebsiella pneumoniae strain AR_0363 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

971. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP014697 (Klebsiella quasipneumoniae strain ATCC 700603 isolate K6 plasmid pKQPS1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

972. spacer 3.18|2078178|32|LR134234|PILER-CR matches to MN842293 (Klebsiella pneumoniae strain 20130907-4 plasmid p309074-1FIIK, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

973. spacer 3.18|2078178|32|LR134234|PILER-CR matches to MG288679 (Klebsiella pneumoniae plasmid p911021-tetA, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

974. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP052506 (Klebsiella pneumoniae strain B16KP0226 plasmid pB16KP0226-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

975. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP052214 (Klebsiella pneumoniae strain E17KP0079 plasmid pE17KP0079-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

976. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP051271 (Salmonella enterica subsp. enterica serovar Worthington strain OLF-FSR1_WB_Quail_SW-70 plasmid pSW37-267106, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

977. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP052037 (Klebsiella pneumoniae strain KPN41053 plasmid pKPN41953, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

978. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP015823 (Klebsiella pneumoniae isolate blood sample 2 plasmid 1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

979. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP021710 (Klebsiella pneumoniae strain AR_0143 plasmid tig00000853, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

980. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP023488 (Klebsiella pneumoniae subsp. pneumoniae strain ST101:960186733 plasmid p19-10_01, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

981. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP052204 (Klebsiella pneumoniae strain F16KP0002 plasmid pF16KP0002-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

982. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP052504 (Klebsiella pneumoniae strain B17KP0020 plasmid pB17KP0020-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

983. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP053365 (Klebsiella pneumoniae strain BA2275 plasmid p1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

984. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP018365 (Klebsiella pneumoniae strain Kp_Goe_62629 plasmid pKp_Goe_629-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

985. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_AP018673 (Klebsiella pneumoniae strain GSU10-3 plasmid pGSU10-3-2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

986. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP033743 (Citrobacter freundii strain FDAARGOS_549 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

987. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NC_020132 (Klebsiella pneumoniae strain BK32179 plasmid pBK32179, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

988. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NC_024992 (Klebsiella pneumoniae plasmid pKp848CTX, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

989. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP023135 (Klebsiella pneumoniae subsp. pneumoniae strain KpvK54 plasmid pKpvK54, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

990. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP011577 (Klebsiella pneumoniae strain CAV1392 plasmid pCAV1392-131, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

991. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP011623 (Klebsiella pneumoniae strain CAV1344 plasmid pCAV1344-250, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

992. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NC_023025 (Cronobacter malonaticus plasmid p2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

993. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP027161 (Klebsiella pneumoniae strain AR_0361 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

994. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP022495 (Salmonella enterica subsp. enterica serovar Derby strain SA20035215 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

995. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP040595 (Klebsiella pneumoniae subsp. pneumoniae strain KpvST15_NDM plasmid pKpvST15, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

996. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP033798 (Enterobacter roggenkampii strain FDAARGOS_523 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

997. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP018361 (Klebsiella oxytoca strain CAV1752 plasmid pCAV1752-278, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

998. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP035197 (Klebsiella pneumoniae strain LH375 plasmid pLH375_1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

999. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP025009 (Klebsiella pneumoniae strain AUSMDU00008119 plasmid pAUSMDU8119-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1000. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP022917 (Klebsiella pneumoniae strain ST307PT04 plasmid pJYC04A, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1001. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP025577 (Klebsiella pneumoniae strain 08EU827 plasmid p08EU827_1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1002. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP050827 (Klebsiella pneumoniae strain Bckp212 plasmid pBckp212-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1003. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP052237 (Klebsiella pneumoniae strain E17KP0029 plasmid pE17KP0029-2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1004. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP052521 (Klebsiella pneumoniae strain B16KP0198 plasmid pB16KP0198-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1005. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP052178 (Klebsiella pneumoniae strain F16KP0045 plasmid pF16KP0045-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1006. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP048776 (Salmonella enterica subsp. enterica serovar Agona strain SG17-135 plasmid pSG17-135-HI2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1007. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP042883 (Klebsiella pneumoniae strain NMBU-W07E18 plasmid pNMBU-W07E18_01, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1008. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP047573 (Escherichia coli strain 2EC1 plasmid p2EC1-2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1009. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NC_019114 (Salmonella enterica subsp. enterica serovar Heidelberg plasmid pSH111_227, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1010. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP031369 (Klebsiella pneumoniae strain KpvST101_OXA-48 plasmid pKpvST101, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1011. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP041936 (Klebsiella pneumoniae strain KP14003 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1012. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP035209 (Klebsiella quasipneumoniae strain TH114 plasmid pTH114-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1013. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP024133 (Escherichia coli strain 14EC007 plasmid p14EC007b, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1014. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP052435 (Klebsiella pneumoniae strain C16KP0108 plasmid pC16KP0108-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1015. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP052140 (Klebsiella pneumoniae strain F17KP0040 plasmid pF17KP0040-2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1016. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP035211 (Klebsiella pneumoniae strain TH164 plasmid pTH164-2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1017. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP024543 (Klebsiella pneumoniae strain INF042 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1018. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP041629 (Escherichia coli strain PE15 plasmid pPE15-IncF, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1019. spacer 3.18|2078178|32|LR134234|PILER-CR matches to AP022358 (Klebsiella pneumoniae E278 plasmid pE278_IMP6 DNA, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1020. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP052499 (Klebsiella pneumoniae strain B17KP0021 plasmid pB17KP0021-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1021. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_AP014952 (Klebsiella oxytoca strain JKo3 plasmid pKO_JKo3_1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1022. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP054782 (Klebsiella pneumoniae strain KP20194a plasmid pKP20194a-p2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1023. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP028543 (Klebsiella pneumoniae subsp. pneumoniae strain SCKP020143 plasmid p1_020143, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1024. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP028390 (Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_095132, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1025. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP032842 (Enterobacter hormaechei strain C15117 plasmid pSPRC-Echo1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1026. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP018338 (Klebsiella pneumoniae isolate Kp_Goe_154414 plasmid pKp_Goe_414-2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1027. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP021697 (Klebsiella pneumoniae strain AR_0158 plasmid tig00000161, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1028. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP024483 (Klebsiella pneumoniae strain INF322 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1029. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP024484 (Klebsiella pneumoniae strain INF322 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1030. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP034083 (Klebsiella pneumoniae subsp. pneumoniae strain R210-2 plasmid pR210-2-vir, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1031. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP026851 (UNVERIFIED_ORG: Enterobacter cloacae strain AR_0072 plasmid unnamed1) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1032. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_LR025089 (Klebsiella pneumoniae isolate KP980 plasmid 2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1033. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP050281 (Klebsiella pneumoniae strain 9949 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1034. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP054265 (Klebsiella pneumoniae strain 39427 plasmid pKPN39427.1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1035. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP025340 (Salmonella enterica subsp. enterica serovar Typhimurium strain BL10 plasmid p220k, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1036. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP054764 (Klebsiella pneumoniae strain KP20194b2 plasmid pKP20194b2-p2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1037. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP029383 (Klebsiella pneumoniae subsp. pneumoniae strain SCKP020079 plasmid pVir_020079, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1038. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP028781 (Klebsiella pneumoniae subsp. pneumoniae strain SCKP020046 plasmid pNDM5_020046, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1039. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP043934 (Klebsiella pneumoniae strain 555 plasmid pSCKLB555-2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1040. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP027425 (Klebsiella oxytoca strain FDAARGOS_335 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1041. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP026012 (Klebsiella pneumoniae strain K2044 plasmid pK2044, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1042. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP026024 (Klebsiella pneumoniae strain 11420 plasmid p11420-HVKP, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1043. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP021951 (Klebsiella pneumoniae strain AR_0148 plasmid tig00000168_pilon, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1044. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP050823 (Klebsiella pneumoniae strain Bckp091 plasmid pBckp091-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1045. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP050784 (Salmonella enterica subsp. enterica serovar Indiana strain SI67 plasmid pSI67-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1046. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_AP019549 (Klebsiella pneumoniae strain THC11 plasmid pTHC11-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1047. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP052477 (Klebsiella pneumoniae strain C16KP0050 plasmid pC16KP0050-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1048. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_AP019401 (Klebsiella pneumoniae strain E013 plasmid pE013, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1049. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_AP019405 (Klebsiella pneumoniae strain E196 plasmid pE196_IMP6, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1050. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP054728 (Klebsiella pneumoniae strain KP20194e plasmid pKP20194e-p2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1051. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP025006 (Klebsiella pneumoniae strain AUSMDU00003562 plasmid pAUSMDU3562-1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1052. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP025145 (Klebsiella pneumoniae strain NR5632 plasmid NR5632_p2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1053. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP025148 (Klebsiella pneumoniae strain KP1766 plasmid KP1766_p2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1054. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP026716 (Klebsiella oxytoca strain AR_0028 plasmid unitig_1_pilon, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1055. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP052243 (Klebsiella pneumoniae strain E17KP0019 plasmid pE17KP0019-2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1056. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP054734 (Klebsiella pneumoniae strain KP20194d plasmid pKP20194d-p2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1057. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP054722 (Klebsiella pneumoniae strain KP20194f plasmid pKP20194f-p2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1058. spacer 3.18|2078178|32|LR134234|PILER-CR matches to MH884652 (Salmonella sp. strain Sa27 plasmid pSa27-CIP, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1059. spacer 3.18|2078178|32|LR134234|PILER-CR matches to MH884653 (Salmonella sp. strain Sa27 plasmid pSa27-TC-CIP, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1060. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP041024 (Klebsiella pneumoniae strain KP1692 plasmid pKP1692, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1061. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP027411 (Salmonella enterica strain FDAARGOS_319 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1062. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP036188 (Klebsiella pneumoniae strain BA1559 plasmid pIncFIBK, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1063. spacer 3.18|2078178|32|LR134234|PILER-CR matches to CP050276 (Klebsiella pneumoniae strain 10553 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1064. spacer 3.18|2078178|32|LR134234|PILER-CR matches to MK649822 (Klebsiella pneumoniae strain 2579 plasmid p2579_1, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1065. spacer 3.18|2078178|32|LR134234|PILER-CR matches to NZ_CP026937 (Escherichia coli strain CFS3292 plasmid pCFS3292-2, complete sequence) position: , mismatch: 9, identity: 0.719

atcacgataacgctgctgtgattcgtccccgt	CRISPR spacer
atcaagataacgctgctgtgactcaagttgct	Protospacer
**** ****************.**.  ..  *

1066. spacer 3.19|2078239|32|LR134234|PILER-CR matches to NZ_KX015668 (Enterobacter cloacae strain CY01 plasmid pCY-CTX, complete sequence) position: , mismatch: 9, identity: 0.719

aagacgacgtgatccgcaaagtcgaaggcacg	CRISPR spacer
aaaacgacgtgatccgcaatgtcgtcaaagcc	Protospacer
**.**************** ****  .. .*

1067. spacer 3.19|2078239|32|LR134234|PILER-CR matches to NZ_CP033346 (Salmonella enterica subsp. enterica serovar Tennessee strain CFSAN076210 plasmid pCFSAN076210, complete sequence) position: , mismatch: 9, identity: 0.719

aagacgacgtgatccgcaaagtcgaaggcacg	CRISPR spacer
aaaacgacgtgatccgcaatgtcgtcaaagcc	Protospacer
**.**************** ****  .. .*

1068. spacer 3.19|2078239|32|LR134234|PILER-CR matches to NZ_CP010386 (Enterobacter hormaechei subsp. xiangfangensis strain 34399 plasmid p34399-121.660kb, complete sequence) position: , mismatch: 9, identity: 0.719

aagacgacgtgatccgcaaagtcgaaggcacg	CRISPR spacer
aaaacgacgtgatccgcaatgtcgtcaaagcc	Protospacer
**.**************** ****  .. .*

1069. spacer 3.19|2078239|32|LR134234|PILER-CR matches to NZ_CP030078 (Enterobacter hormaechei strain 20710 plasmid p4-20710, complete sequence) position: , mismatch: 9, identity: 0.719

aagacgacgtgatccgcaaagtcgaaggcacg	CRISPR spacer
aaaacgacgtgatccgcaatgtcgtcaaagcc	Protospacer
**.**************** ****  .. .*

1070. spacer 3.19|2078239|32|LR134234|PILER-CR matches to NZ_CP029247 (Enterobacter hormaechei subsp. xiangfangensis strain OSUVMCKPC4-2 plasmid pOSUEC_F, complete sequence) position: , mismatch: 9, identity: 0.719

aagacgacgtgatccgcaaagtcgaaggcacg	CRISPR spacer
aaaacgacgtgatccgcaatgtcgtcaaagcc	Protospacer
**.**************** ****  .. .*

1071. spacer 3.19|2078239|32|LR134234|PILER-CR matches to NZ_CP048417 (Citrobacter freundii strain CitB plasmid pA_CitB, complete sequence) position: , mismatch: 9, identity: 0.719

aagacgacgtgatccgcaaagtcgaaggcacg	CRISPR spacer
aaaacgacgtgatccgcaatgtcgtcaaagcc	Protospacer
**.**************** ****  .. .*

1072. spacer 3.19|2078239|32|LR134234|PILER-CR matches to NZ_CP042573 (Enterobacter hormaechei strain E5 plasmid pE5_002, complete sequence) position: , mismatch: 9, identity: 0.719

aagacgacgtgatccgcaaagtcgaaggcacg	CRISPR spacer
aaaacgacgtgatccgcaatgtcgtcaaagcc	Protospacer
**.**************** ****  .. .*

1073. spacer 3.19|2078239|32|LR134234|PILER-CR matches to NZ_CP027605 (UNVERIFIED_ORG: Enterobacter cloacae strain AR_0093 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

aagacgacgtgatccgcaaagtcgaaggcacg	CRISPR spacer
aaaacgacgtgatccgcaatgtcgtcaaagcc	Protospacer
**.**************** ****  .. .*

1074. spacer 3.19|2078239|32|LR134234|PILER-CR matches to NZ_CP051133 (Enterobacter hormaechei strain AMS-38 plasmid pAMS-38a, complete sequence) position: , mismatch: 9, identity: 0.719

aagacgacgtgatccgcaaagtcgaaggcacg	CRISPR spacer
aaaacgacgtgatccgcaatgtcgtcaaagcc	Protospacer
**.**************** ****  .. .*

1075. spacer 3.19|2078239|32|LR134234|PILER-CR matches to NZ_CP014995 (Salmonella enterica subsp. enterica serovar Tennessee strain CFSAN001387 plasmid, complete sequence) position: , mismatch: 9, identity: 0.719

aagacgacgtgatccgcaaagtcgaaggcacg	CRISPR spacer
aaaacgacgtgatccgcaatgtcgtcaaagcc	Protospacer
**.**************** ****  .. .*

1076. spacer 3.19|2078239|32|LR134234|PILER-CR matches to NZ_CP053193 (Enterobacter hormaechei strain EGYMCRVIM plasmid pMS-37c, complete sequence) position: , mismatch: 9, identity: 0.719

aagacgacgtgatccgcaaagtcgaaggcacg	CRISPR spacer
aaaacgacgtgatccgcaatgtcgtcaaagcc	Protospacer
**.**************** ****  .. .*

1077. spacer 3.19|2078239|32|LR134234|PILER-CR matches to NZ_CP023068 (Ensifer sojae CCBAU 05684 plasmid pSJ05684b, complete sequence) position: , mismatch: 9, identity: 0.719

aagacgacgtgatccgcaaagtcgaaggcacg	CRISPR spacer
aagacggcgtgatccgcgaagtccggctcgct	Protospacer
******.**********.***** ..  *.*

1078. spacer 3.21|2078361|32|LR134234|PILER-CR matches to KT588075 (Acinetobacter phage Ab105-2phi, complete genome) position: , mismatch: 9, identity: 0.719

gaatgatcccaaatttgggttacagaaccagt	CRISPR spacer
tacccatcccaattttgggatacagaacctcc	Protospacer
 * . ******* ****** *********  .

1079. spacer 3.27|2078727|32|LR134234|PILER-CR matches to NC_019911 (Yersinia phage phi80-18 complete genome) position: , mismatch: 9, identity: 0.719

tgctttcctacgacaaatctggcgatgttgcg	CRISPR spacer
gagtacctaacgacatatatggcgatgttgcg	Protospacer
 . * .*. ****** ** *************

1080. spacer 3.27|2078727|32|LR134234|PILER-CR matches to NC_047805 (Yersinia phage fHe-Yen3-01, complete genome) position: , mismatch: 9, identity: 0.719

tgctttcctacgacaaatctggcgatgttgcg	CRISPR spacer
gagtacctaacgacatatatggcgatgttgcg	Protospacer
 . * .*. ****** ** *************

1081. spacer 3.29|2078849|32|LR134234|PILER-CR matches to MN693437 (Marine virus AFVG_25M476, complete genome) position: , mismatch: 9, identity: 0.719

ttgaactgttgatgttatcaaaatatcagctc	CRISPR spacer
ttgatctgttgatgtaatcaaaaactattgtt	Protospacer
**** ********** *******  *    *.

1082. spacer 3.4|2078238|32|LR134234|CRISPRCasFinder,CRT matches to NZ_CP016452 (Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence) position: , mismatch: 10, identity: 0.688

aagacgacgtgatccgcaaagtcgaaggcacg	CRISPR spacer
ggctcgacgtgatcggcaaaggcgaagacggc	Protospacer
..  ********** ****** *****.*.

1083. spacer 3.19|2078239|32|LR134234|PILER-CR matches to NZ_CP016452 (Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence) position: , mismatch: 10, identity: 0.688

aagacgacgtgatccgcaaagtcgaaggcacg	CRISPR spacer
ggctcgacgtgatcggcaaaggcgaagacggc	Protospacer
..  ********** ****** *****.*.

1084. spacer 2.1|2052019|34|LR134234|CRT matches to NZ_CP017563 (Paraburkholderia sprentiae WSM5005 plasmid pl1WSM5005, complete sequence) position: , mismatch: 11, identity: 0.676

tctaagtgatatccatcatcgcatccagtgcgcc	CRISPR spacer
gactcatcgcatccatcatcggttccagtgcgcc	Protospacer
  .  .* ..***********  ***********

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

2203 : 24066

Salmonella_phage(90.32%)

portal,terminase,plate,tail,capsid

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
VED15109.1\|2203_3229_-\|capsid,portal	capsid portal protein	E5G6M3	Salmonella_phage	6.4e-170	87.6
VED15111.1\|3228_3399_-	Terminase, ATPase subunit	E5G6M4	Salmonella_phage	1.5e-23	100.0
VED15113.1\|3430_3712_-	Terminase, ATPase subunit	A0A1S6KZW3	Salmonella_phage	7.2e-47	98.9
VED15115.1\|3683_3938_-	Terminase, ATPase subunit	A0A1S6KZW3	Salmonella_phage	2.2e-39	98.7
VED15117.1\|3964_4204_-	Terminase, ATPase subunit	A0A1S6KZW3	Salmonella_phage	3.3e-37	96.1
VED15121.1\|4453_4999_-	Terminase, ATPase subunit	A0A1S6KZW3	Salmonella_phage	1.9e-99	99.4
VED15126.1\|5141_5729_+\|capsid	capsid scaffolding	A0A1S6KZW9	Salmonella_phage	9.9e-91	91.6
VED15128.1\|5997_6321_+\|capsid	P2 family phage major capsid protein	E5G6M6	Salmonella_phage	1.4e-46	93.3
VED15130.1\|6286_6934_+\|capsid	P2 family phage major capsid protein	E5G6M6	Salmonella_phage	2.7e-105	92.7
VED15132.1\|7061_7703_+\|terminase	small terminase subunit	E5G6M7	Salmonella_phage	1.7e-96	89.3
VED15135.1\|7807_8272_+\|capsid	capsid completion protein	A0A1S6KZW8	Salmonella_phage	6.4e-77	89.6
VED15137.1\|8586_8964_+	glycoside hydrolase family protein	A0A1S6KZY9	Salmonella_phage	4.1e-29	95.3
VED15139.1\|8927_9191_+	glycoside hydrolase family protein	E5G6N1	Salmonella_phage	7.9e-40	89.5
VED15141.1\|9192_9543_+	membrane protein	A0A1S6KZZ2	Salmonella_phage	1.0e-13	40.9
VED15143.1\|9589_9844_+	regulatory protein	A0A1S6KZX8	Salmonella_phage	4.4e-19	72.4
VED15145.1\|10092_10524_+\|tail	phage tail protein	E5G6N3	Salmonella_phage	7.6e-72	93.7
VED15148.1\|10725_10962_+\|tail	phage tail protein	E5G6N4	Salmonella_phage	1.3e-30	86.8
VED15150.1\|11211_11610_+\|plate	phage baseplate assembly protein V	A0A1S6KZX7	Salmonella_phage	8.9e-59	86.2
VED15152.1\|11606_11966_+	GPW/gp25 family protein	A0A1S6KZZ4	Salmonella_phage	2.8e-51	85.7
VED15154.1\|11952_12861_+\|plate	Baseplate assembly protein GpJ	A0A1S6KZY6	Salmonella_phage	2.7e-143	90.7
VED15157.1\|12853_13459_+\|tail	phage tail protein I	A0A1S6L000	Salmonella_phage	2.6e-110	92.5
VED15160.1\|13455_15042_+\|tail	variable tail fiber protein	M1TAS6	Escherichia_phage	1.9e-208	73.5
VED15162.1\|15041_15647_+\|tail	tail fiber assembly protein	M1SV83	Escherichia_phage	1.4e-92	84.4
VED15164.1\|15615_15813_-	Uncharacterised protein	NA	NA	NA	NA
VED15166.1\|16210_16777_+	site-specific DNA recombinase; e14 prophage	A0A1S6L009	Salmonella_phage	4.9e-87	84.2
VED15167.1\|16919_18092_+\|tail	tail sheath protein	A0A1S6KZY7	Salmonella_phage	7.8e-204	90.3
VED15168.1\|18101_18617_+\|tail	phage major tail tube protein	A0A1S6L002	Salmonella_phage	2.1e-89	95.3
VED15169.1\|18671_18974_+\|tail	tail E family protein	A0A1S6KZZ9	Salmonella_phage	1.6e-39	88.0
VED15170.1\|19100_22178_+\|tail	putative phage tail tape measure protein	E5G6Q1	Salmonella_phage	0.0e+00	69.0
VED15171.1\|22174_22660_+\|tail	bacteriophage tail protein GpU	E5G6Q2	Salmonella_phage	1.7e-67	81.2
VED15172.1\|22656_23757_+	Late control protein D protein	A0A1S6KZZ5	Salmonella_phage	6.5e-176	87.7
VED15173.1\|23847_24066_+	prophage P2 OGR-like protein	Q53ZE7	Salmonella_virus	7.5e-20	69.0

DBSCAN-SWA_2

740534 : 793446

Enterobacteria_phage(37.78%)

lysis,portal,head,integrase,terminase,transposase,tail,capsid,coat

attL 765713:765728|attR 798142:798157

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
VED15815.1\|740534_742130_-\|tail	putative tail fiber protein	K7PHC9	Enterobacteria_phage	7.4e-48	66.5
VED15816.1\|742260_742998_+	Uncharacterised protein	NA	NA	NA	NA
VED15817.1\|743559_744159_-	membrane protein, Lom/All family	H6WZM8	Escherichia_phage	2.5e-105	94.0
VED15818.1\|744226_747706_-	Host specificity protein J of prophage	A0A291AWT4	Escherichia_phage	0.0e+00	90.5
VED15819.1\|747766_748339_-\|tail	phage tail assembly protein	A0A0K2FJB0	Escherichia_phage	2.0e-83	98.9
VED15820.1\|748335_749079_-\|tail	putative tail fiber component K of prophage	K7PLW1	Enterobacteria_phage	6.1e-146	96.0
VED15821.1\|749084_749783_-\|tail	phage minor tail protein	A0A0K2FJ01	Enterobacteria_phage	5.6e-133	99.1
VED15822.1\|749782_750112_-\|tail	Minor tail protein M	A0A2R9YJM0	Escherichia_phage	2.5e-59	100.0
VED15823.1\|750108_752688_-\|tail	putative phage tail tape measure protein	A0A2R9YJM8	Escherichia_phage	0.0e+00	95.1
VED15824.1\|752680_753115_-\|tail	minor tail protein T	A0A0K2FJB3	Enterobacteria_phage	6.9e-65	100.0
VED15825.1\|753096_753519_-\|tail	phage minor tail protein	A0A0K2FIQ8	Enterobacteria_phage	2.4e-70	97.1
VED15826.1\|753534_754275_-\|tail	Major tail protein V	A0A0K2FJ05	Enterobacteria_phage	5.2e-129	97.2
VED15827.1\|754282_754678_-\|tail	phage minor tail protein	A0A2R9YJI2	Escherichia_phage	6.5e-70	99.2
VED15828.1\|754674_755253_-\|tail	Minor tail protein Z (GpZ)	A0A2R9YJK4	Escherichia_phage	5.9e-80	99.5
VED15829.1\|755264_755618_-\|capsid	minor capsid protein	A0A2R9YJJ5	Escherichia_phage	6.4e-61	97.4
VED15830.1\|755629_756025_-	DNA packaging protein from bacteriophage origin	A0A2R9YJP4	Escherichia_phage	1.1e-58	95.5
VED15831.1\|756066_757092_-\|head,coat	phage major head protein (major coat protein)	C6ZCY2	Enterobacteria_phage	4.0e-188	97.9
VED15832.1\|757147_757480_-	Head decoration protein from bacteriophage origin	A0A2R9YJN3	Escherichia_phage	2.5e-54	98.2
VED15833.1\|757489_758809_-\|capsid	minor capsid protein C from bacteriophage origin	A0A0K2FI53	Enterobacteria_phage	1.3e-234	98.9
VED15834.1\|758789_760391_-\|capsid,portal	phage portal protein (minor capsid protein)	A0A0K2FJC0	Enterobacteria_phage	1.3e-310	99.4
VED15835.1\|760387_760594_-\|head,tail	head-to-tail joining protein W	A0A2R9YJL2	Escherichia_phage	5.8e-30	100.0
VED15836.1\|760590_762516_-\|terminase	phage terminase large subunit	A0A0K2FJ14	Enterobacteria_phage	0.0e+00	99.7
VED15837.1\|762490_763036_-	prophage qsr' DNA packaging protein NU1-like protein	A0A0K2FIG2	Enterobacteria_phage	5.2e-94	97.8
VED15838.1\|763424_763658_+	Qin prophage	A0A0K2FIR8	Escherichia_phage	5.6e-21	82.5
VED15839.1\|763715_764126_+	Qin prophage	C6ZCX4	Enterobacteria_phage	2.5e-56	79.4
VED15840.1\|764277_764451_-	GnsA/GnsB family transcriptional regulator	NA	NA	NA	NA
VED15841.1\|765699_766197_-	Qin prophage protein	A0A291LBG9	Klebsiella_phage	2.9e-06	29.5
765713:765728	attL	NA	NA	NA	NA
VED15842.1\|766193_766727_-	prophage lysozyme (endolysin)	K7PLY1	Enterobacteria_phage	6.4e-97	93.2
VED15843.1\|766723_767035_-	Qin prophage protein	K7PGU6	Enterobacteria_phage	2.0e-26	64.6
VED15844.1\|767039_767246_-\|lysis	phage lysis protein	A5LH82	Enterobacteria_phage	4.5e-30	94.1
VED15845.1\|767287_767407_+	Uncharacterised protein	NA	NA	NA	NA
VED15846.1\|768524_768737_+	cold shock-like protein CspF	NA	NA	NA	NA
VED15847.1\|769158_769911_-	lambdoid prophage Qin antitermination protein Q-like protein	A0A192Y5X6	Salmonella_phage	7.1e-134	92.8
VED15848.1\|769924_770974_-	putative prophage protein	A0A291AWV9	Escherichia_phage	1.3e-112	57.3
VED15849.1\|771320_771572_-	putative prophage protein	NA	NA	NA	NA
VED15850.1\|771788_771944_-	putative host cell-killing modulation protein	A0A0U2QV81	Escherichia_phage	1.5e-17	96.1
VED15851.1\|772015_772303_-	toxin of the RelE-RelB toxin-antitoxin system	A0A2H4JBF4	uncultured_Caudovirales_phage	1.4e-29	66.0
VED15852.1\|772302_772542_-	antitoxin of the RelE-RelB toxin-antitoxin system and transcriptional repressor of relBEF	A0A2H4JBG1	uncultured_Caudovirales_phage	1.6e-18	54.4
VED15853.1\|773074_773407_+	Qin prophage protein	NA	NA	NA	NA
VED15854.1\|773843_775157_-\|integrase,transposase	putative integrase/transposase	NA	NA	NA	NA
VED15855.1\|775491_775671_-	membrane protein	NA	NA	NA	NA
VED15856.1\|776823_777180_-	putative methyltransferase	H9C170	Pectobacterium_phage	1.6e-38	69.6
VED15857.1\|777176_777599_-	putative prophage protein	A0A0U2QQN3	Escherichia_phage	4.4e-64	92.0
VED15858.1\|777639_778605_-	ybl78	U5P0A0	Shigella_phage	2.2e-55	60.2
VED15859.1\|778585_779107_-	YdfX	NA	NA	NA	NA
VED15860.1\|779090_779321_-	repressor protein of division inhibition gene	NA	NA	NA	NA
VED15861.1\|779404_779812_+	repressor protein of division inhibition gene	K7PM82	Enterobacteria_phage	4.4e-13	54.7
VED15862.1\|779978_780134_+	putative prophage protein	M4QQ57	Salicola_phage	3.0e-07	53.2
VED15863.1\|780135_780264_+	putative prophage protein	NA	NA	NA	NA
VED15864.1\|780293_780512_+	putative prophage protein	NA	NA	NA	NA
VED15865.1\|780515_780680_-	Uncharacterised protein	NA	NA	NA	NA
VED15866.1\|781079_781268_+	division inhibition protein	NA	NA	NA	NA
VED15867.1\|781264_781456_+	putative prophage protein	NA	NA	NA	NA
VED15868.1\|781548_784020_+	putative exonuclease from phage origin	A0A192Y6E0	Salmonella_phage	8.5e-59	56.7
VED15869.1\|784107_784344_+	putative excisionase	S4TND0	Salmonella_phage	6.1e-15	50.7
VED15870.1\|784378_785659_+\|integrase	defective integrase; Qin prophage	B6DZ48	Enterobacteria_phage	3.3e-155	62.1
VED15871.1\|785846_786866_-	dehydrogenase	E3SJ82	Synechococcus_phage	9.7e-17	25.9
VED15872.1\|786880_788092_-	starvation sensing protein RspA	Q6A202	Oenococcus_phage	1.8e-46	29.0
VED15873.1\|788297_788624_-	inner membrane protein	A0A218MNG8	uncultured_virus	9.9e-24	55.6
VED15874.1\|788758_789100_+	protein	NA	NA	NA	NA
VED15875.1\|789134_789695_+	spermidine N1-acetyltransferase	NA	NA	NA	NA
VED15876.1\|789697_790444_-	lipoprotein	NA	NA	NA	NA
VED15877.1\|790515_790821_+	protein	NA	NA	NA	NA
VED15878.1\|791019_793446_+	putative dimethyl sulfoxide reductase, oxidoreductase subunit	A0A077SK27	Escherichia_phage	2.7e-214	49.2
798142:798157	attR	NA	NA	NA	NA

DBSCAN-SWA_3

1258577 : 1269799

Acanthocystis_turfacea_Chlorella_virus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
VED16546.1\|1258577_1259744_-	UDP-glucose 6-dehydrogenase	M1I798	Paramecium_bursaria_Chlorella_virus	1.9e-109	51.9
VED16548.1\|1259991_1261398_-	6-phosphogluconate dehydrogenase	M4QQM4	Ostreococcus_lucimarinus_virus	1.4e-37	28.3
VED16550.1\|1261560_1262931_-	phosphomannomutase CpsG	A0A127AWJ1	Bacillus_phage	1.3e-32	28.2
VED16552.1\|1262955_1263702_-	putative glycosyltransferase	A0A1V0SAH6	Catovirus	2.1e-08	41.6
VED16554.1\|1263785_1265171_-	putative mannose-1-phosphate guanylyltransferase	A0A1V0SH58	Hokovirus	1.4e-47	29.5
VED16556.1\|1265182_1265638_-	GDP-mannose mannosyl hydrolase	NA	NA	NA	NA
VED16558.1\|1265640_1266606_-	GDP-L-fucose synthetase	M1I5W5	Acanthocystis_turfacea_Chlorella_virus	9.9e-88	51.7
VED16560.1\|1266609_1267731_-	GDP-mannose 4,6-dehydratase	M1HVG7	Acanthocystis_turfacea_Chlorella_virus	2.5e-130	64.4
VED16562.1\|1267741_1268770_-	putative glycosyl transferase	NA	NA	NA	NA
VED16564.1\|1268785_1269799_-	UDP-glucose 4-epimerase	A0A2K9L5H6	Tupanvirus	2.7e-88	52.0

DBSCAN-SWA_4

1369964 : 1379406

Enterobacteria_phage(85.71%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
VED16724.1\|1369964_1371101_+	von Willebrand factor type A domain protein YehP	Q9EYF7	Enterobacteria_phage	1.1e-162	97.7
VED16726.1\|1371097_1373098_+	zinc finger SWIM domain-containing protein	Q9EYF6	Enterobacteria_phage	0.0e+00	95.8
VED16727.1\|1373222_1373684_+	lipoprotein yehR	Q9EYF5	Enterobacteria_phage	1.9e-76	100.0
VED16729.1\|1373724_1374195_-	conserved protein, DUF1456 family	Q9EYF4	Enterobacteria_phage	1.8e-82	100.0
VED16731.1\|1374241_1374961_-	two-component response-regulatory protein YehT	NA	NA	NA	NA
VED16733.1\|1374957_1376643_-	sensor histidine kinase	Q9EYF3	Enterobacteria_phage	2.5e-304	99.6
VED16735.1\|1376864_1377596_+	MerR family transcriptional regulator	Q9EYF2	Enterobacteria_phage	9.7e-112	99.5
VED16737.1\|1377655_1377763_+	putative inner membrane protein	NA	NA	NA	NA
VED16739.1\|1377743_1378475_-	ABC transporter permease	NA	NA	NA	NA
VED16741.1\|1378479_1379406_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.8e-23	30.8

DBSCAN-SWA_5

1578937 : 1655940

Enterobacteria_phage(50.79%)

portal,integrase,terminase,tRNA,tail,holin,coat

attL 1576142:1576158|attR 1630969:1630985

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1576142:1576158	attL	NA	NA	NA	NA
VED17122.1\|1578937_1579750_-\|tRNA	tRNA pseudouridine synthase A	NA	NA	NA	NA
VED17124.1\|1579749_1580763_-	putative semialdehyde dehydrogenase	NA	NA	NA	NA
VED17126.1\|1580828_1581965_-	erythronate-4-phosphate dehydrogenase	A0A2R8FDS8	Brazilian_cedratvirus	5.9e-23	29.1
VED17128.1\|1582063_1583059_+	cell division protein	NA	NA	NA	NA
VED17130.1\|1583055_1584234_-	major facilitator superfamily protein	NA	NA	NA	NA
VED17132.1\|1584526_1585747_-	3-oxoacyl-ACP synthase	NA	NA	NA	NA
VED17134.1\|1585905_1587912_+\|tRNA	tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC	NA	NA	NA	NA
VED17136.1\|1588032_1588311_-	protein	NA	NA	NA	NA
VED17138.1\|1588344_1588893_-	putative transporting ATPase	NA	NA	NA	NA
VED17140.1\|1588892_1589702_-	inner membrane protein	NA	NA	NA	NA
VED17142.1\|1589701_1590526_-	penicillin-insensitive murein endopeptidase	NA	NA	NA	NA
VED17144.1\|1590529_1591615_-	chorismate synthase	A0A291AU41	Pandoravirus	9.1e-90	48.4
VED17146.1\|1591649_1592582_-	N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase	NA	NA	NA	NA
VED17148.1\|1592747_1593299_+	Smr protein/MutS2	NA	NA	NA	NA
VED17151.1\|1593371_1594226_-	putative fimbrial adhesin protein	NA	NA	NA	NA
VED17153.1\|1594227_1594767_-	fimbrial protein	NA	NA	NA	NA
VED17155.1\|1594763_1595252_-	putative fimbrial subunit protein	NA	NA	NA	NA
VED17157.1\|1595248_1595758_-	putative fimbrial protein	NA	NA	NA	NA
VED17159.1\|1595773_1596526_-	pili assembly chaperone	NA	NA	NA	NA
VED17161.1\|1596545_1599191_-	fimbrial outer membrane usher protein StfC	NA	NA	NA	NA
VED17163.1\|1599272_1599836_-	fimbrial-like adhesin protein	NA	NA	NA	NA
VED17165.1\|1600519_1601005_-	phosphohistidine phosphatase	NA	NA	NA	NA
VED17167.1\|1601210_1603352_-	fatty acid oxidation complex alpha subunit [includes: enoyl-CoA hydratase; 3-hydroxyacyl-CoA dehydrogenase; 3-hydroxybutyryl-CoA epimerase]	NA	NA	NA	NA
VED17169.1\|1603351_1604662_-	fatty acid oxidation comple beta subunit (3 -ketoacyl-CoA thiolase)	NA	NA	NA	NA
VED17171.1\|1604841_1605126_-	protein YfcZ	NA	NA	NA	NA
VED17173.1\|1605497_1606838_+	long-chain fatty acid transport protein	NA	NA	NA	NA
VED17175.1\|1607203_1608262_+	Uncharacterised protein	NA	NA	NA	NA
VED17177.1\|1608443_1609199_-	lipoprotein	NA	NA	NA	NA
VED17179.1\|1609492_1610425_+	transporter protein	E7DYY8	Enterobacteria_phage	1.2e-167	100.0
VED17181.1\|1610736_1611894_+\|integrase	integrase	A5VW56	Enterobacteria_phage	5.7e-223	100.0
VED17183.1\|1612394_1613324_+	CPS-53 (KpLE1) prophage; bactoprenol glucosyl transferase	M1FQW5	Enterobacteria_phage	3.9e-158	90.5
VED17185.1\|1613313_1615125_+	Uncharacterised protein	NA	NA	NA	NA
VED17187.1\|1615189_1617118_-\|tail	putative tail spike protein	X4YDU4	Salmonella_phage	7.5e-212	67.7
VED17189.1\|1617253_1617505_+	putative transcriptional repressor	E7C9U8	Salmonella_phage	6.6e-36	91.6
VED17191.1\|1617520_1618489_-	P63C domain	A9YX09	Burkholderia_phage	8.5e-71	48.6
VED17193.1\|1618570_1618834_+	Uncharacterised protein	NA	NA	NA	NA
VED17195.1\|1618851_1621080_-	prophage protein	A0A088CQ71	Enterobacteria_phage	0.0e+00	99.3
VED17197.1\|1621079_1622483_-	DNA transfer protein GP20	I1TEJ5	Salmonella_phage	5.2e-146	64.7
VED17199.1\|1622492_1623185_-	putative DNA transfer protein	G5DA80	Enterobacteria_phage	2.1e-111	99.1
VED17201.1\|1623187_1623643_-	Head assembly protein	A0A2D1GLX4	Escherichia_phage	6.7e-87	99.3
VED17203.1\|1623642_1624344_-	Packaged DNA stabilization protein from phage	A0A2D1GLK3	Escherichia_phage	1.9e-120	99.6
VED17205.1\|1624343_1625762_-	Packaged DNA stabilization protein from phage	Q9AYZ4	Salmonella_phage	4.2e-276	99.6
VED17207.1\|1625762_1626263_-	DNA stabilization protein GP4	G8EYJ2	Enterobacteria_phage	1.2e-89	98.2
VED17209.1\|1626240_1626483_-	Uncharacterised protein	A0A2D1GLK1	Escherichia_phage	3.0e-25	88.6
VED17211.1\|1626527_1627823_-\|coat	putative coat protein	A0A2D1GLV2	Escherichia_phage	1.0e-241	98.6
VED17213.1\|1627822_1628734_-	Scaffolding protein (Protein gp8)	A0A2D1GLN7	Escherichia_phage	1.3e-161	100.0
VED17215.1\|1628747_1630913_-\|portal	portal protein (protein gp1)	A0A2D1GLJ6	Escherichia_phage	0.0e+00	99.9
VED17217.1\|1630913_1632413_-\|terminase	DNA packaging protein gp2 (terminase large subunit)	A0A2D1GLW6	Escherichia_phage	4.8e-307	100.0
1630969:1630985	attR	NA	NA	NA	NA
VED17219.1\|1632390_1632879_-	DNA packaging protein gp3 (Terminase small subunit)	G8EYI7	Enterobacteria_phage	4.1e-90	99.4
VED17221.1\|1632914_1633157_-	Protein of uncharacterised function (DUF2560)	A0A0M4R322	Salmonella_phage	7.5e-37	100.0
VED17223.1\|1633304_1633520_-	Protein of uncharacterised function (DUF551)	A0A193GZ43	Enterobacter_phage	3.1e-26	75.7
VED17225.1\|1633959_1634427_-	Endopeptidase from phage origin (Lysis protein Rz)	A0A291AWW3	Escherichia_phage	7.2e-76	96.8
VED17227.1\|1634423_1634900_-	phage endolysin	K7PKV2	Enterobacteria_phage	1.7e-88	100.0
VED17229.1\|1634883_1635207_-\|holin	holin	G5DA93	Enterobacteria_phage	1.3e-52	100.0
VED17231.1\|1635640_1636264_-	late gene regulator	K7P6X1	Enterobacteria_phage	3.0e-114	100.0
VED17233.1\|1636260_1636449_-	prophage protein	K7PH29	Enterobacteria_phage	1.9e-27	100.0
VED17235.1\|1636445_1636808_-	prophage holliday junction resolvase	A5VW85	Enterobacteria_phage	9.2e-63	100.0
VED17237.1\|1636804_1637095_-	82 prophage-derived uncharacterized protein ybcO	K7PKV0	Enterobacteria_phage	3.4e-52	100.0
VED17239.1\|1637094_1637817_-	DNA-binding protein	K7PL51	Enterobacteria_phage	3.9e-121	92.9
VED17244.1\|1637809_1637986_-	NinF family protein	A0A220NRM2	Escherichia_phage	1.9e-26	100.0
VED17246.1\|1637978_1638335_-	putative protein ninx	A0A088CQ65	Enterobacteria_phage	1.8e-39	62.5
VED17248.1\|1638650_1639241_-	adenine methylase	A0A193GYV6	Enterobacter_phage	2.5e-86	76.5
VED17250.1\|1639237_1639681_-	recombination protein ninB from phage origin	A0A2I6PIF6	Escherichia_phage	2.5e-78	97.2
VED17252.1\|1639658_1639823_-	Uncharacterised protein	A0A1R3Y6Z7	Salmonella_virus	2.1e-19	90.7
VED17254.1\|1639825_1640077_-	Uncharacterised protein	A0A220NQX3	Salmonella_phage	2.9e-23	65.5
VED17256.1\|1640373_1641810_-	P protein; replicative DNA helicase	G5DA90	Enterobacteria_phage	2.0e-273	99.0
VED17258.1\|1641799_1642690_-	replication protein O	G5DA89	Enterobacteria_phage	1.7e-158	99.3
VED17260.1\|1642676_1642838_-	prophage protein	Q76H53	Enterobacteria_phage	1.3e-21	100.0
VED17262.1\|1642872_1643154_-	transcriptional activator protein	K7PMG0	Enterobacteria_phage	7.4e-44	98.9
VED17264.1\|1643270_1643486_-	repressor protein	A0A0N7C2U7	Escherichia_phage	8.2e-35	98.6
VED17266.1\|1643561_1644257_+	Repressor protein CI from phage origin	A0A0N7BTS4	Escherichia_phage	1.3e-129	96.5
VED17268.1\|1644679_1645012_+	prophage protein	Q716D8	Shigella_phage	1.4e-54	99.1
VED17270.1\|1645281_1645482_+	restriction alleviation protein	A0A0K2FJE6	Enterobacteria_phage	7.1e-33	98.5
VED17272.1\|1645521_1645815_+	Uncharacterised protein	A0A1R3Y5U4	Salmonella_virus	4.7e-33	75.0
VED17274.1\|1645814_1645973_+	Uncharacterised protein	K7PMD4	Enterobacterial_phage	9.9e-22	100.0
VED17276.1\|1646156_1646291_+	prophage regulatory protein cIII	K7PHK2	Enterobacteria_phage	3.1e-16	100.0
VED17278.1\|1646275_1646428_+	putative host killing protein	A5VWA5	Enterobacteria_phage	4.7e-21	100.0
VED17280.1\|1646503_1646674_+	Uncharacterised protein	A5VWA7	Enterobacteria_phage	4.2e-26	100.0
VED17282.1\|1646682_1647390_+	Rad52/22 double-strand break repair protein	K7PKU3	Enterobacteria_phage	2.9e-137	99.6
VED17284.1\|1647390_1647858_+	Uncharacterised protein	A0A2I7QWC6	Vibrio_phage	1.2e-46	62.0
VED17286.1\|1647854_1648361_+	single-stranded DNA-binding protein	K7PHK1	Enterobacteria_phage	6.8e-80	98.8
VED17288.1\|1648374_1648668_+	Anti-RecBCD protein 2	G8C7L1	Escherichia_phage	2.5e-50	99.0
VED17290.1\|1648678_1648969_+	Gene 24 protein	K7P7M4	Enterobacteria_phage	4.8e-46	99.0
VED17292.1\|1648965_1649130_+	prophage protein	K7P7R0	Enterobacteria_phage	1.9e-23	98.1
VED17294.1\|1649126_1649576_+	CPS-53 (KpLE1) prophage protein	K7PMI0	Enterobacteria_phage	1.0e-63	85.9
VED17296.1\|1649572_1650016_+	EA22-like protein	K7P6J7	Enterobacteria_phage	1.4e-57	56.3
VED17298.1\|1650017_1650209_+	Uncharacterised protein	G9L660	Escherichia_phage	2.3e-25	98.4
VED17300.1\|1650211_1650892_+	prophage protein (fragment)	K7P7E4	Enterobacteria_phage	6.6e-54	50.6
VED17302.1\|1651102_1651270_+	Uncharacterised protein	A0A0K2FJ46	Enterobacteria_phage	1.3e-27	100.0
VED17304.1\|1651327_1651528_+	response regulator inhibitor for tor operon	K7P7V0	Enterobacteria_phage	2.4e-33	100.0
VED17306.1\|1652057_1653305_-	galactoside permease	NA	NA	NA	NA
VED17308.1\|1653376_1654291_-	aminoimidazole riboside kinase	NA	NA	NA	NA
VED17310.1\|1654506_1655940_+	sucrose-6-phosphate hydrolase	F8WPR5	Bacillus_phage	7.0e-29	25.4

DBSCAN-SWA_6

1922407 : 1939527

Enterobacteria_phage(50.0%)

transposase,integrase

attL 1918951:1918964|attR 1936960:1936973

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1918951:1918964	attL	NA	NA	NA	NA
VED17794.1\|1922407_1923628_+\|integrase	integrase family protein	A0A1B5FPC6	Escherichia_phage	8.4e-108	49.9
VED17796.1\|1923715_1923934_-	Uncharacterised protein	NA	NA	NA	NA
VED17798.1\|1923947_1925255_-	Uncharacterised protein	NA	NA	NA	NA
VED17800.1\|1925788_1926361_-	prophage polarity suppression protein	Q7M2A1	Enterobacteria_phage	2.2e-95	97.3
VED17802.1\|1926434_1926935_-	transcriptional activator Ogr/delta	NA	NA	NA	NA
VED17804.1\|1926931_1927666_-	glycoprotein 3	Q7M2A2	Enterobacteria_phage	5.2e-129	98.8
VED17807.1\|1928217_1928484_+	prophage regulatory protein	Q7M299	Enterobacteria_phage	1.6e-43	97.7
VED17809.1\|1929063_1929351_+	prophage derepression protein	Q7M2A0	Enterobacteria_phage	8.6e-48	97.9
VED17812.1\|1929343_1929799_+	putative prophage protein	Q7M298	Enterobacteria_phage	1.6e-64	99.1
VED17818.1\|1929934_1930255_+	P4 phage protein	NA	NA	NA	NA
VED17823.1\|1930269_1932603_+	putative prophage DNA primase	Q7M2A8	Enterobacteria_phage	0.0e+00	98.8
VED17826.1\|1933284_1934514_+\|integrase	integrase	A0A1B5FPC6	Escherichia_phage	1.5e-234	100.0
VED17830.1\|1934552_1934969_+	Uncharacterised protein	A0A1B5FPM5	Escherichia_phage	1.1e-72	100.0
VED17832.1\|1935040_1936789_-	Uncharacterised protein	A0A1B5FPH1	Escherichia_phage	0.0e+00	99.8
VED17834.1\|1936790_1938509_-	putative histidine kinase-like protein	A0A1B5FPD5	Escherichia_phage	3.2e-307	99.8
1936960:1936973	attR	NA	NA	NA	NA
VED17836.1\|1938660_1939527_-\|transposase	IS3 element transposase	A0A0P0I4A4	Acinetobacter_phage	2.3e-51	40.6

DBSCAN-SWA_7

2026940 : 2035697

Escherichia_phage(71.43%)

integrase,tRNA

attL 2024483:2024496|attR 2038024:2038037

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2024483:2024496	attL	NA	NA	NA	NA
VED18025.1\|2026940_2028512_-\|integrase	phage integrase	A0A0R6PGY7	Moraxella_phage	4.8e-23	28.0
VED18027.1\|2028551_2031119_+	DNA mismatch repair protein MutS	E3T5Q7	Cafeteria_roenbergensis_virus	3.9e-30	20.4
VED18029.1\|2031224_2031881_+	serine/threonine-specific protein phosphatase 2	A0A222YWF0	Escherichia_phage	4.3e-50	46.7
VED18031.1\|2031931_2032699_-	DeoR family transcriptional regulator	A0A077SK06	Escherichia_phage	3.3e-70	56.7
VED18033.1\|2032894_2033803_+	oxidoreductase YgbJ	A0A077SLF7	Escherichia_phage	3.0e-118	76.9
VED18035.1\|2033799_2035062_+\|tRNA	paral putative tRNA synthase	A0A077SLJ7	Escherichia_phage	1.3e-135	61.4
VED18037.1\|2035058_2035697_+	aldolase	A0A077SK32	Escherichia_phage	1.4e-82	75.0
2038024:2038037	attR	NA	NA	NA	NA

DBSCAN-SWA_8

3123357 : 3133319

Enterobacteria_phage(100.0%)

integrase

attL 3123175:3123197|attR 3133797:3133819

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3123175:3123197	attL	NA	NA	NA	NA
VED21869.1\|3123357_3124527_+\|integrase	integrase	Q7M297	Enterobacteria_phage	4.6e-204	90.2
VED21871.1\|3124596_3125466_+	phosphoglycolate phosphatase	NA	NA	NA	NA
VED21873.1\|3125465_3126110_+	Uncharacterised protein	NA	NA	NA	NA
VED21875.1\|3126495_3127068_-	prophage polarity suppression protein	Q7M2A1	Enterobacteria_phage	2.7e-93	95.2
VED21877.1\|3127141_3127642_-	transcriptional activator Ogr/delta	NA	NA	NA	NA
VED21879.1\|3127638_3128373_-	glycoprotein 3	Q7M2A2	Enterobacteria_phage	2.3e-129	98.8
VED21881.1\|3128924_3129191_+	prophage regulatory protein	Q7M299	Enterobacteria_phage	4.9e-45	100.0
VED21883.1\|3129779_3130067_+	prophage derepression protein	Q7M2A0	Enterobacteria_phage	8.6e-48	97.9
VED21885.1\|3130059_3130515_+	putative prophage protein	Q7M298	Enterobacteria_phage	7.2e-65	100.0
VED21887.1\|3130650_3130971_+	P4 phage protein	NA	NA	NA	NA
VED21889.1\|3130985_3133319_+	putative prophage DNA primase	Q7M2A8	Enterobacteria_phage	0.0e+00	99.0
3133797:3133819	attR	NA	NA	NA	NA

DBSCAN-SWA_9

3382191 : 3461050

Escherichia_phage(45.65%)

lysis,holin,integrase,terminase,plate,tRNA,protease,tail,capsid

attL 3376268:3376285|attR 3462626:3462643

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3376268:3376285	attL	NA	NA	NA	NA
VED22336.1\|3382191_3383064_+\|tRNA	tRNA-processing ribonuclease BN	NA	NA	NA	NA
VED22338.1\|3383060_3383498_+\|tRNA	D-tyrosyl-tRNA(Tyr) deacylase	NA	NA	NA	NA
VED22340.1\|3383542_3384484_+	putative acetyltransferase	NA	NA	NA	NA
VED22342.1\|3384547_3385456_-	lipase	NA	NA	NA	NA
VED22344.1\|3385684_3385996_+	transcription elongation factor GreB	NA	NA	NA	NA
VED22346.1\|3385996_3386287_+	transcriptional regulator	NA	NA	NA	NA
VED22348.1\|3386372_3386465_+	Uncharacterised protein	NA	NA	NA	NA
VED22350.1\|3386891_3387110_+	CopG-family DNA-binding protein	NA	NA	NA	NA
VED22352.1\|3387328_3387571_+	YiiF protein	NA	NA	NA	NA
VED22354.1\|3387570_3387681_+	enterobactin synthase multienzyme complex phosphopantetheinyltransferase	NA	NA	NA	NA
VED22356.1\|3387900_3388830_-	putative formate dehydrogenase formation protein	NA	NA	NA	NA
VED22358.1\|3388826_3389462_-	formate dehydrogenase, cytochrome b556(fdo) subunit	NA	NA	NA	NA
VED22360.1\|3389458_3390361_-	formate dehydrogenase-O	NA	NA	NA	NA
VED22362.1\|3393617_3394451_+	formate dehydrogenase accessory protein	NA	NA	NA	NA
VED22364.1\|3394603_3395644_+	putative lipoprotein	NA	NA	NA	NA
VED22366.1\|3395693_3397442_-	frv operon regulatory protein	NA	NA	NA	NA
VED22368.1\|3397441_3398512_-	fructose-specific phosphotransferase system protein FrvX	NA	NA	NA	NA
VED22370.1\|3398501_3399953_-	PTS system subunit IIC	NA	NA	NA	NA
VED22372.1\|3399963_3400410_-	fructose-like phosphotransferase system subunit EIIA	NA	NA	NA	NA
VED22374.1\|3400722_3401037_-	L-rhamnose mutarotase	NA	NA	NA	NA
VED22376.1\|3401046_3401871_-	rhamnulose-1-phosphate aldolase	NA	NA	NA	NA
VED22378.1\|3402045_3403305_-	L-rhamnose isomerase	NA	NA	NA	NA
VED22380.1\|3403301_3404771_-	rhamnulokinase	NA	NA	NA	NA
VED22382.1\|3405058_3405895_+	L-rhamnose operon regulatory protein	NA	NA	NA	NA
VED22384.1\|3405878_3406817_+	transcriptional activator RhaR	NA	NA	NA	NA
VED22386.1\|3406813_3407848_-	L rhamnose-proton symporter	NA	NA	NA	NA
VED22388.1\|3408132_3408753_+	Mn dependent superoxide dismutase	Q56AR7	Bacillus_thuringiensis_phage	4.9e-64	59.8
VED22390.1\|3409012_3409996_+	2-keto-3-deoxygluconate permease	NA	NA	NA	NA
VED22392.1\|3410144_3410819_+	MOSC domain-containing protein	NA	NA	NA	NA
VED22394.1\|3410924_3412298_-	two-component sensor kinase	W8CYF6	Bacillus_phage	3.8e-16	25.9
VED22396.1\|3412294_3412993_-	transcriptional regulatory protein CpxR	Q6XM27	Feldmannia_irregularis_virus	5.3e-06	30.3
VED22398.1\|3413142_3413643_+	repressor CpxP	NA	NA	NA	NA
VED22400.1\|3413829_3414810_-\|integrase	site-specific recombinase, phage integrase family protein	S4TP66	Salmonella_phage	4.7e-186	100.0
VED22402.1\|3414879_3415173_-	Helix-turn-helix domain protein	Q1JS37	Enterobacteria_phage	2.7e-49	100.0
VED22404.1\|3415309_3415582_+	Regulatory phage protein cox	Q1JS36	Enterobacteria_phage	1.4e-47	100.0
VED22406.1\|3415751_3416252_+	Phage protein B	M1SV55	Escherichia_phage	2.6e-92	100.0
VED22408.1\|3416315_3416540_+	Protein of uncharacterised function (DUF2732)	S4TP68	Salmonella_phage	1.0e-32	98.6
VED22410.1\|3416539_3416839_+	Uncharacterised protein	S4TUD1	Salmonella_phage	6.0e-44	98.0
VED22412.1\|3416841_3417066_+	C4-type zinc finger protein, DksA/TraR family	S4TRY6	Salmonella_phage	2.9e-35	100.0
VED22414.1\|3417062_3417338_+	relication initiation protein	U5N3W1	Enterobacteria_phage	3.3e-44	98.9
VED22416.1\|3417327_3419604_+	Replication gene A protein (GpA)	A0A0F7LBQ2	Escherichia_phage	0.0e+00	98.0
VED22418.1\|3419805_3420750_+	HsdRM	Q7Y4B5	Escherichia_virus	2.5e-144	76.1
VED22420.1\|3420757_3421747_-	Uncharacterised protein	NA	NA	NA	NA
VED22422.1\|3421736_3422282_-	Uncharacterised protein	Q858T2	Yersinia_virus	2.0e-24	55.0
VED22424.1\|3422259_3422859_-	ParB/RepB/Spo0J family partition protein	Q858T2	Yersinia_virus	7.3e-65	65.6
VED22426.1\|3423273_3424308_-\|capsid	phage capsid protein	U5N087	Enterobacteria_phage	1.6e-200	99.1
VED22428.1\|3424307_3426080_-	Terminase, ATPase subunit (GpP)	A0A0F7LCK3	Escherichia_phage	0.0e+00	99.8
VED22430.1\|3426253_3427108_+\|capsid	phage capsid scaffolding protein	Q94MI4	Enterobacteria_phage	1.3e-139	100.0
VED22432.1\|3427166_3428240_+\|capsid	major capsid protein	Q94MH9	Enterobacteria_phage	2.5e-201	98.9
VED22434.1\|3428243_3428987_+\|terminase	small terminase subunit	Q94MK6	Enterobacteria_phage	8.6e-124	98.4
VED22436.1\|3429086_3429596_+\|capsid	capsid completion protein	U5N0S3	Enterobacteria_phage	3.3e-90	99.4
VED22438.1\|3429595_3429799_+\|tail	phage tail protein X	U5N3E7	Enterobacteria_phage	4.0e-31	100.0
VED22440.1\|3429802_3430084_+\|holin,lysis	phage lysis holin	A0A0F7LDF8	Escherichia_phage	3.7e-43	100.0
VED22442.1\|3430083_3430581_+	phage lysin	A0A0F7LBS0	Escherichia_phage	3.1e-93	100.0
VED22444.1\|3430595_3431021_+	LysA protein	U5N096	Enterobacteria_phage	1.2e-58	96.5
VED22446.1\|3431008_3431434_+	LysB protein	U5N3W5	Enterobacteria_phage	6.1e-66	95.7
VED22448.1\|3431420_3431579_+\|lysis	phage lysis protein	A0A0F7LCN5	Escherichia_phage	2.6e-22	100.0
VED22450.1\|3431541_3432009_+\|tail	tail protein	A0A0F7LA33	Escherichia_phage	1.5e-81	98.7
VED22452.1\|3432001_3432454_+\|tail	tail protein	A0A0F7LBV9	Escherichia_phage	6.3e-77	100.0
VED22454.1\|3432520_3433156_+\|plate	Baseplate assembly protein V (GpV)	Q7Y4D8	Escherichia_virus	2.4e-106	100.0
VED22456.1\|3433152_3433500_+\|plate	phage baseplate protein	A0A0F7L9X3	Escherichia_phage	1.7e-58	100.0
VED22458.1\|3433504_3434413_+\|plate	baseplate assembly protein	A0A0F7LCQ9	Escherichia_phage	7.5e-162	99.3
VED22460.1\|3434405_3435017_+\|tail	phage P2-related tail formation protein	A0A0F7LA36	Escherichia_phage	1.4e-116	99.0
VED22462.1\|3435013_3436306_+\|tail	phage tail fiber protein	M1TAS6	Escherichia_phage	1.4e-182	70.6
VED22464.1\|3436305_3436899_+\|tail	tail fiber assembly protein from lambdoid prophage	Q9MCR5	Enterobacteria_phage	6.6e-58	63.3
VED22467.1\|3436870_3437311_-	CPS-53 (KpLE1) prophage protein	A0A0F7LDZ0	Escherichia_phage	7.5e-51	66.7
VED22469.1\|3437739_3438333_+	Resolvase domain-containing protein	A0A0F7LA37	Escherichia_phage	1.2e-104	98.0
VED22471.1\|3438392_3439583_+\|tail	major tail sheath protein FI	A0A0F7LBW9	Escherichia_phage	1.4e-224	99.5
VED22473.1\|3439595_3440114_+\|tail	phage major tail tube protein FII	A0A0F7LDZ1	Escherichia_phage	1.4e-93	100.0
VED22475.1\|3440170_3440446_+\|tail	tail protein E (GpE)	A0A0F7LDQ8	Escherichia_phage	5.7e-41	100.0
VED22477.1\|3440590_3443038_+\|tail	phage related tail protein	A0A0F7LCI6	Escherichia_phage	0.0e+00	96.0
VED22479.1\|3443052_3443532_+	gpU phage protein	O64315	Escherichia_phage	5.1e-85	100.0
VED22481.1\|3443531_3444695_+	phage protein D	A0A0F7LDZ2	Escherichia_phage	1.0e-203	98.4
VED22483.1\|3444776_3444995_+	transcriptional activator Ogr/delta	A0A0F7LDQ9	Escherichia_phage	4.7e-38	100.0
VED22485.1\|3445231_3446134_+	ferrous-iron efflux pump	NA	NA	NA	NA
VED22487.1\|3446079_3446184_-	Uncharacterised protein	NA	NA	NA	NA
VED22489.1\|3446314_3447277_+	6-phosphofructokinase	NA	NA	NA	NA
VED22491.1\|3447596_3448586_+	sulfate-binding protein (sulfate starvation-induced protein 2)	NA	NA	NA	NA
VED22493.1\|3448691_3449447_+	CDP-diacylglycerol pyrophosphatase	NA	NA	NA	NA
VED22495.1\|3449501_3450269_-	triosephosphate isomerase	NA	NA	NA	NA
VED22497.1\|3450376_3450976_-	Protein of uncharacterised function (DUF1454)	NA	NA	NA	NA
VED22499.1\|3451076_3451517_+	inner membrane protein	NA	NA	NA	NA
VED22501.1\|3451728_3452028_+	conserved protein, UPF0381 family	NA	NA	NA	NA
VED22503.1\|3452054_3452483_+	universal stress protein D	NA	NA	NA	NA
VED22505.1\|3452487_3453234_-	ferredoxin--NADP reductase	NA	NA	NA	NA
VED22507.1\|3453330_3454341_-	fructose 1,6-bisphosphatase II	NA	NA	NA	NA
VED22509.1\|3454476_3455985_-	glycerol kinase	NA	NA	NA	NA
VED22511.1\|3456007_3456853_-	glycerol uptake facilitator protein	M1HWZ0	Paramecium_bursaria_Chlorella_virus	4.4e-15	28.0
VED22513.1\|3457283_3457523_+	cell division factor ZapB	NA	NA	NA	NA
VED22515.1\|3457607_3458093_-	ribonuclease activity regulator protein RraA	NA	NA	NA	NA
VED22517.1\|3458185_3459112_-	1,4-dihydroxy-2-naphthoate octaprenyltransferase	NA	NA	NA	NA
VED22519.1\|3459178_3460510_-\|protease	ATP-dependent hslVU protease ATP-binding subunit HslU	A0A191ZC11	Erwinia_phage	1.7e-45	29.9
VED22521.1\|3460519_3461050_-\|protease	ATP-dependent hslVU protease peptidase subunit HslV	NA	NA	NA	NA
3462626:3462643	attR	NA	NA	NA	NA

DBSCAN-SWA_10

3833953 : 3849972

Enterobacteria_phage(61.54%)

integrase

attL 3832124:3832139|attR 3857673:3857688

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3832124:3832139	attL	NA	NA	NA	NA
VED22859.1\|3833953_3835456_-	ATPase	A0A248XCZ8	Klebsiella_phage	6.1e-84	44.8
VED22860.1\|3835585_3836605_-	oxidoreductase	A0A0G2Y405	Acanthamoeba_polyphaga_mimivirus	1.9e-44	30.4
VED22861.1\|3837048_3838305_+\|integrase	site-specific recombinase, phage integrase family	B7SYF8	Stenotrophomonas_phage	9.6e-75	42.2
VED22862.1\|3838348_3839179_+	Uncharacterised protein	A0A0F7L9X0	Escherichia_phage	3.6e-46	35.9
VED22863.1\|3839613_3840186_-	prophage polarity suppression protein	Q7M2A1	Enterobacteria_phage	2.9e-95	97.3
VED22864.1\|3840200_3840446_-	putative prophage regulatory protein	Q7M294	Enterobacteria_phage	1.8e-41	100.0
VED22865.1\|3840442_3841177_-	glycoprotein 3	Q7M2A2	Enterobacteria_phage	8.8e-129	98.0
VED22866.1\|3841728_3841995_+	prophage regulatory protein	Q7M299	Enterobacteria_phage	4.9e-45	100.0
VED22867.1\|3842583_3842871_+	prophage derepression protein	Q7M2A0	Enterobacteria_phage	8.6e-48	97.9
VED22868.1\|3842863_3843319_+	putative prophage protein	Q7M298	Enterobacteria_phage	1.0e-63	98.2
VED22869.1\|3843454_3843775_+	P4 phage protein	NA	NA	NA	NA
VED22870.1\|3843789_3846123_+	putative prophage DNA primase	Q7M2A8	Enterobacteria_phage	0.0e+00	98.8
VED22871.1\|3846376_3846673_+	Uncharacterised protein	Q38404	Enterobacteria_phage	2.4e-24	100.0
VED22872.1\|3846635_3846815_-	Uncharacterised protein	NA	NA	NA	NA
VED22873.1\|3847080_3849972_+	putative helicase	A0A2H4J643	uncultured_Caudovirales_phage	4.3e-288	53.5
3857673:3857688	attR	NA	NA	NA	NA

DBSCAN-SWA_11

4534309 : 4591436

Enterobacteria_phage(61.11%)

portal,head,integrase,terminase,tRNA,protease,tail,capsid,coat

attL 4544471:4544517|attR 4591861:4591907

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
VED23469.1\|4534309_4535695_+\|tRNA	cysteinyl-tRNA synthetase	M1PG92	Moumouvirus	3.9e-45	34.8
VED23470.1\|4535730_4536252_-	putative membrane-bound metal-dependent hydrolase	NA	NA	NA	NA
VED23471.1\|4536359_4536572_-	putative RNA-binding protein	NA	NA	NA	NA
VED23472.1\|4536573_4537440_-	5,10-methylene-tetrahydrofolate dehydrogenase	A0A249XZQ2	Enterococcus_phage	1.7e-30	37.5
VED23473.1\|4537920_4538463_+	fimbrial-like protein	NA	NA	NA	NA
VED23474.1\|4538682_4539375_+	fimbrial chaperone	NA	NA	NA	NA
VED23475.1\|4539405_4542015_+	fimbrial outer membrane usher protein	NA	NA	NA	NA
VED23476.1\|4542027_4543035_+	fimbrial protein	NA	NA	NA	NA
VED23477.1\|4543045_4543561_+	fimbrial protein	NA	NA	NA	NA
VED23478.1\|4543563_4544196_-	two component transcriptional regulator, LuxR family	NA	NA	NA	NA
4544471:4544517	attL	NA	NA	NA	NA
VED23479.1\|4544530_4545694_-\|integrase	site-specific recombinase, phage integrase family protein	A0A088CD23	Shigella_phage	3.0e-200	86.6
VED23480.1\|4545892_4546171_-	bacteriophage protein	M1FPC8	Enterobacteria_phage	4.9e-48	97.8
VED23481.1\|4546218_4546437_-	ybl16	M1FQT7	Enterobacteria_phage	7.5e-36	100.0
VED23482.1\|4546535_4546751_-	ybl17	A0A1I9LJM7	Stx_converting_phage	1.0e-32	100.0
VED23483.1\|4546990_4547173_-	phage protein	A0A1U8QQC1	Enterobacteria_phage	6.9e-27	96.7
VED23484.1\|4547169_4547850_-	exonuclease	B6DZ61	Enterobacteria_phage	5.1e-131	98.2
VED23485.1\|4547846_4548632_-	bacteriophage recombination protein	A0A1I9LJN0	Stx_converting_phage	6.3e-149	100.0
VED23486.1\|4548637_4548934_-	host-nuclease inhibitor protein Gam	A0A1I9LJN1	Stx_converting_phage	8.9e-48	98.0
VED23487.1\|4549009_4549216_-	prophage Kil protein	K7P6H3	Enterobacteria_phage	2.1e-27	83.8
VED23488.1\|4549765_4550044_-	Uncharacterised protein	NA	NA	NA	NA
VED23489.1\|4550221_4550485_-	Uncharacterised protein	A0A2H4FNC7	Salmonella_phage	4.2e-41	95.4
VED23490.1\|4550567_4551053_-	Regulatory protein CI from bacteriophage origin	Q76H56	Enterobacteria_phage	3.1e-74	84.5
VED23491.1\|4551370_4551598_+	represror Cro	Q76H55	Enterobacteria_phage	6.4e-22	67.6
VED23492.1\|4551628_4552168_+	bacteriophage regulatory protein CII	M9NZI6	Enterobacteria_phage	6.8e-62	66.7
VED23493.1\|4552179_4553184_+	replication protein O	A0A0M5M7Y1	Salmonella_phage	1.9e-110	63.8
VED23494.1\|4553180_4553882_+	replication protein P of bacteriophage	K7P6G2	Enterobacteria_phage	1.1e-128	99.1
VED23495.1\|4553878_4554181_+	Ren protein from phage origin	A0A0N6WES4	Escherichia_phage	1.1e-42	95.7
VED23496.1\|4554248_4554581_+	Multidrug transporter emrE	NA	NA	NA	NA
VED23497.1\|4554837_4556364_+	site-specific invertase; DLP12 prophage	Q3HQV4	Burkholderia_phage	7.9e-31	27.7
VED23498.1\|4556583_4556793_+	antirepressor protein	NA	NA	NA	NA
VED23499.1\|4556998_4557928_+	Uncharacterised protein	A0A1R3Y6Z6	Salmonella_virus	3.0e-57	40.0
VED23500.1\|4558124_4558580_+	DLP12 prophage; DNA base-flipping protein	I6PD71	Cronobacter_phage	9.2e-60	66.9
VED23501.1\|4558579_4558750_+	prophage protein NinE	K7P7K0	Enterobacteria_phage	2.4e-13	69.8
VED23502.1\|4558742_4559033_+	DLP12 prophage	K7PGZ6	Enterobacteria_phage	2.5e-47	93.8
VED23503.1\|4559029_4559392_+	endodeoxyribonuclease RUS	K7PM48	Enterobacteria_phage	1.6e-59	95.7
VED23504.1\|4559614_4559992_+	putative antitermination protein Q-like protein; DLP12 prophage	Q777W5	Enterobacteria_phage	1.6e-54	84.2
VED23505.1\|4560147_4560672_-	lipoprotein	A0A1W6JNX6	Morganella_phage	4.2e-48	54.1
VED23506.1\|4560864_4561824_+	putative pathogenicity island protein	NA	NA	NA	NA
VED23507.1\|4562142_4562874_+	putative araC-type regulatory protein from bacteriophage origin	NA	NA	NA	NA
VED23508.1\|4563041_4563257_+	Lysis protein S	M1FN85	Enterobacteria_phage	4.5e-33	94.4
VED23509.1\|4563256_4563754_+	phage lysozome	A5LH83	Enterobacteria_phage	4.9e-91	98.8
VED23510.1\|4563750_4564212_+	Rz endopeptidase from lambdoid prophage DLP12	A0A0K2FJD0	Enterobacteria_phage	2.4e-76	99.3
VED23511.1\|4564243_4564537_-	lambdoid prophage DLP12 Bor-like protein	A0A2R2X2B2	Escherichia_phage	5.7e-47	97.9
VED23512.1\|4564827_4565238_-	putative envelope protein	C6ZCX4	Enterobacteria_phage	2.7e-71	98.5
VED23513.1\|4565523_4565730_+	DLP12 prophage; predicted protein	A0A0K2FJ18	Enterobacteria_phage	5.8e-30	100.0
VED23514.1\|4566477_4567023_+	prophage qsr' DNA packaging protein NU1-like protein	A0A0K2FIG2	Enterobacteria_phage	1.4e-94	98.9
VED23515.1\|4566997_4568923_+\|terminase	phage terminase large subunit	A0A0K2FJ14	Enterobacteria_phage	0.0e+00	99.5
VED23516.1\|4568919_4569126_+\|head,tail	head-to-tail joining protein W	A0A2R9YJL2	Escherichia_phage	5.8e-30	100.0
VED23517.1\|4569122_4570724_+\|capsid,portal	phage portal protein (minor capsid protein)	A0A0K2FJC0	Enterobacteria_phage	2.5e-309	99.2
VED23518.1\|4570704_4572024_+\|capsid	minor capsid protein C from bacteriophage origin	A0A2I6TC87	Escherichia_phage	1.2e-229	97.3
VED23519.1\|4572033_4572366_+	Head decoration protein from bacteriophage origin	C6ZCY1	Enterobacteria_phage	2.2e-55	100.0
VED23520.1\|4572421_4573447_+\|head,coat	phage major head protein (major coat protein)	C6ZCY2	Enterobacteria_phage	2.8e-189	98.2
VED23521.1\|4573488_4573884_+	DNA packaging protein from bacteriophage origin	A0A2R9YJP4	Escherichia_phage	5.2e-59	96.2
VED23522.1\|4573895_4574249_+\|capsid	minor capsid protein	A0A2R9YJJ5	Escherichia_phage	6.4e-61	97.4
VED23523.1\|4574260_4574839_+\|tail	minor tail protein	A0A2R9YJK4	Escherichia_phage	7.8e-80	97.9
VED23524.1\|4574835_4575231_+\|tail	phage minor tail protein	A0A0K2FIF4	Enterobacteria_phage	1.0e-70	100.0
VED23525.1\|4575238_4575979_+\|tail	Major tail protein V	A0A0K2FJ05	Enterobacteria_phage	7.3e-131	98.8
VED23526.1\|4575994_4576417_+\|tail	phage minor tail protein	A0A0K2FIQ8	Enterobacteria_phage	3.1e-70	96.4
VED23527.1\|4576398_4576833_+\|tail	minor tail protein T	A0A0K2FJB3	Enterobacteria_phage	2.5e-62	98.3
VED23528.1\|4576825_4579387_+\|tail	tail component of prophage	A0A0K2FI43	Enterobacteria_phage	0.0e+00	97.5
VED23529.1\|4579383_4579713_+\|tail	Minor tail protein M	A0A0K2FIE9	Enterobacteria_phage	9.6e-59	100.0
VED23530.1\|4579712_4580411_+\|tail	phage minor tail protein	A0A0K2FJ01	Enterobacteria_phage	7.3e-133	99.1
VED23531.1\|4580416_4581160_+\|tail	putative tail fiber component K of prophage	K7PLW1	Enterobacteria_phage	1.2e-149	97.6
VED23532.1\|4581156_4581729_+\|tail	phage tail assembly protein	A0A0K2FJB0	Escherichia_phage	6.7e-84	99.5
VED23533.1\|4581789_4585188_+	Host specificity protein J	K7PKJ2	Enterobacteria_phage	0.0e+00	89.8
VED23534.1\|4585254_4585854_+	outer membrane precursor Lom	A0A0P0ZCF6	Stx2-converting_phage	4.8e-109	97.0
VED23535.1\|4585918_4588945_+\|tail	tail fiber protein	U5N099	Enterobacteria_phage	3.6e-67	81.4
VED23536.1\|4589583_4590240_-	methylase	NA	NA	NA	NA
VED23537.1\|4590482_4591136_-\|protease	outer membrane protease	NA	NA	NA	NA
VED23538.1\|4591187_4591436_-\|protease	outer membrane protease	NA	NA	NA	NA
4591861:4591907	attR	NA	NA	NA	NA

DBSCAN-SWA_12

4878783 : 4942606

Salmonella_phage(78.26%)

portal,integrase,terminase,plate,transposase,tail,capsid

attL 4882984:4883000|attR 4934855:4934871

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
VED23787.1\|4878783_4879764_+\|transposase	IS621, transposase	NA	NA	NA	NA
VED23788.1\|4880019_4881285_-	protein	NA	NA	NA	NA
VED23789.1\|4881436_4882252_-	putative hydrolase	NA	NA	NA	NA
VED23790.1\|4882397_4884830_-	putative formate acetyltransferase 3 (pyruvate formate lyase 3)	A0A076YHZ7	Citrobacter_phage	6.1e-09	43.5
4882984:4883000	attL	NA	NA	NA	NA
VED23791.1\|4884835_4885735_-	putative pyruvate formate-lyase 3-activating enzyme	NA	NA	NA	NA
VED23792.1\|4885865_4886528_+	fructose-6-phosphate aldolase	A0A0E3HJ81	Synechococcus_phage	5.7e-26	34.6
VED23793.1\|4886603_4887353_-	molybdopterin biosynthesis protein	NA	NA	NA	NA
VED23794.1\|4887352_4888588_-	molybdopterin biosynthesis protein	NA	NA	NA	NA
VED23795.1\|4888791_4889757_+	putative L-asparaginase	NA	NA	NA	NA
VED23796.1\|4889743_4891615_+	glutathione transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.0e-16	29.7
VED23797.1\|4891634_4893173_+	putative binding protein yliB precursor	NA	NA	NA	NA
VED23798.1\|4893190_4894111_+	ABC transporter permease	NA	NA	NA	NA
VED23799.1\|4894113_4895025_+	ABC transporter permease	NA	NA	NA	NA
VED23800.1\|4895202_4897551_+	cyclic di-GMP phosphodiesterase	NA	NA	NA	NA
VED23801.1\|4897558_4898887_+	putative signaling protein	NA	NA	NA	NA
VED23802.1\|4898933_4900259_-	radical SAM superfamily protein	NA	NA	NA	NA
VED23803.1\|4900471_4900855_+	biofilm formation regulatory protein BssR	NA	NA	NA	NA
VED23804.1\|4900965_4902081_+	aldose sugar dehydrogenase	NA	NA	NA	NA
VED23805.1\|4902077_4902704_-	glutathione S-transferase	NA	NA	NA	NA
VED23806.1\|4902950_4904153_+	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	8.2e-100	48.0
VED23807.1\|4904199_4904958_-	deoxyribose operon repressor	NA	NA	NA	NA
VED23808.1\|4905015_4905612_-	putative phosphatase	NA	NA	NA	NA
VED23809.1\|4905896_4907129_+	multidrug translocase mdfA	NA	NA	NA	NA
VED23810.1\|4907169_4907448_-	protein	NA	NA	NA	NA
VED23811.1\|4907539_4908355_-	putative hydrolase	NA	NA	NA	NA
VED23812.1\|4908354_4909482_-	DEOR-type transcriptional regulator	NA	NA	NA	NA
VED23813.1\|4909646_4910183_+	DEOR-type transcriptional regulator	NA	NA	NA	NA
VED23814.1\|4910422_4911406_-	Uncharacterised protein	NA	NA	NA	NA
VED23815.1\|4911513_4912533_-\|integrase	integrase	A0A218M4I3	Erwinia_phage	3.2e-105	57.0
VED23816.1\|4912721_4912913_-	Uncharacterised protein	A0A0R6PIH8	Moraxella_phage	6.8e-09	65.9
VED23817.1\|4912928_4913498_-	repressor protein	A0A1S6KZZ7	Salmonella_phage	1.7e-39	43.9
VED23818.1\|4913623_4913845_+	ybl30	NA	NA	NA	NA
VED23819.1\|4913877_4914387_+	phage regulatory protein CII	E5G6L3	Salmonella_phage	5.8e-87	98.8
VED23820.1\|4914394_4914595_+	Protein of uncharacterised function (DUF2724)	E5G6L4	Salmonella_phage	6.0e-32	97.0
VED23821.1\|4914558_4914900_+	Uncharacterised protein	E5G6L5	Salmonella_phage	4.6e-56	99.1
VED23822.1\|4914967_4915201_+	Protein of uncharacterised function (DUF2732)	E5G6L6	Salmonella_phage	3.5e-31	94.8
VED23823.1\|4915200_4915428_+	TraR/DksA family transcriptional regulator	E5G6L7	Salmonella_phage	2.7e-36	100.0
VED23824.1\|4915424_4916282_+	site-specific DNA-methyltransferase	E5G6L8	Salmonella_phage	7.6e-156	94.7
VED23825.1\|4916278_4918693_+	putative replication protein for prophage	E5G6L9	Salmonella_phage	0.0e+00	97.4
VED23826.1\|4918846_4919035_+	Uncharacterised protein	E5G6M0	Salmonella_phage	5.5e-27	98.4
VED23827.1\|4919045_4919279_+	Prophage protein	E5G6M1	Salmonella_phage	2.3e-35	98.7
VED23828.1\|4919454_4920513_-	Uncharacterised protein	NA	NA	NA	NA
VED23829.1\|4921164_4922925_+	RNA-directed DNA polymerase	Q7M2A9	Enterobacteria_phage	1.2e-11	28.8
VED23830.1\|4922966_4923992_-\|capsid,portal	capsid portal protein	E5G6M3	Salmonella_phage	6.4e-170	87.6
VED23831.1\|4923991_4925758_-	Terminase, ATPase subunit	A0A1S6KZW3	Salmonella_phage	0.0e+00	99.3
VED23832.1\|4925900_4926734_+\|capsid	capsid scaffolding	A0A1S6KZW9	Salmonella_phage	3.1e-122	92.1
VED23833.1\|4926750_4927809_+\|capsid	P2 family phage major capsid protein	E5G6M6	Salmonella_phage	8.4e-181	93.1
VED23834.1\|4927812_4928463_+\|terminase	small terminase subunit	E5G6M7	Salmonella_phage	2.8e-110	94.4
VED23835.1\|4928558_4929023_+\|capsid	capsid completion protein	A0A1S6KZW8	Salmonella_phage	6.4e-77	89.6
VED23836.1\|4929022_4929226_+\|tail	tail X family protein	E5G6M9	Salmonella_phage	1.4e-31	92.5
VED23837.1\|4929229_4929445_+	putative secretory protein	E5G6N0	Salmonella_phage	4.1e-26	77.5
VED23838.1\|4929425_4929938_+	glycoside hydrolase family protein	E5G6N1	Salmonella_phage	5.2e-88	91.7
VED23839.1\|4929939_4930317_+	membrane protein	A0A1S6KZZ2	Salmonella_phage	6.7e-16	38.4
VED23840.1\|4930313_4930742_+	regulatory protein	E5G6N2	Salmonella_phage	5.4e-46	74.5
VED23841.1\|4930837_4931269_+\|tail	phage tail protein	E5G6N3	Salmonella_phage	7.6e-72	93.7
VED23842.1\|4931261_4931708_+\|tail	phage tail protein	A0A1S6L001	Salmonella_phage	2.3e-63	86.3
VED23843.1\|4931776_4932355_+\|plate	phage baseplate assembly protein V	A0A1S6KZX7	Salmonella_phage	4.4e-91	85.4
VED23844.1\|4932351_4932711_+	GPW/gp25 family protein	A0A1S6KZZ4	Salmonella_phage	2.8e-51	85.7
VED23845.1\|4932697_4933606_+\|plate	Baseplate assembly protein GpJ	A0A1S6KZY6	Salmonella_phage	2.7e-143	90.7
VED23846.1\|4933598_4934204_+\|tail	phage tail protein I	A0A1S6L000	Salmonella_phage	2.6e-110	92.5
VED23847.1\|4934200_4935592_+\|tail	putative variable tail fiber protein	M1TAS6	Escherichia_phage	4.4e-161	77.4
4934855:4934871	attR	NA	NA	NA	NA
VED23848.1\|4935578_4935776_+	Uncharacterised protein	NA	NA	NA	NA
VED23849.1\|4935744_4936350_-\|tail	tail fiber assembly protein	M1SV83	Escherichia_phage	1.4e-92	84.4
VED23850.1\|4936349_4936925_-\|tail	putative tail fiber/collar phage protein	A0A0F7LCR3	Escherichia_phage	7.3e-54	62.3
VED23851.1\|4936955_4937522_+	site-specific DNA recombinase; e14 prophage	A0A1S6L009	Salmonella_phage	4.9e-87	84.2
VED23852.1\|4937664_4938837_+\|tail	tail sheath protein	A0A1S6KZY7	Salmonella_phage	7.8e-204	90.3
VED23853.1\|4938846_4939362_+\|tail	phage major tail tube protein	A0A1S6L002	Salmonella_phage	2.1e-89	95.3
VED23854.1\|4939416_4939719_+\|tail	tail E family protein	A0A1S6KZZ9	Salmonella_phage	1.6e-39	88.0
VED23855.1\|4939845_4940358_+\|tail	putative phage tail tape measure protein	A0A1S6L010	Salmonella_phage	1.9e-29	81.1
VED23856.1\|4940502_4941219_+\|tail	putative phage tail tape measure protein	E5G6Q1	Salmonella_phage	5.2e-102	87.3
VED23857.1\|4941199_4941562_+\|tail	putative phage tail tape measure protein	E5G6Q1	Salmonella_phage	9.2e-47	84.5
VED23858.1\|4941564_4942158_+\|tail	TP901 family phage tail tape measure protein	E5G6Q1	Salmonella_phage	3.1e-07	55.6
VED23859.1\|4942102_4942606_+\|tail	TP901 family phage tail tape measure protein	E5G6Q1	Salmonella_phage	4.0e-56	68.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. LR134234

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection