CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
LR134275	Streptococcus vestibularis strain NCTC12167 genome assembly, chromosome: 1	1 crisprs	DEDDh,csa3,cas9,cas1,cas2,csn2,DinG,WYL,cas3	0	9	14	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: LR134275_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

LR134275_1

700377-701072

TypeII

Consensus_repeat	Method
GTTTTTGTACTCTCAAGATTTAAGTAACTGTACAAC	PILER-CR
GTTTTTGTACTCTCAAGATTTAAGTAACTGTACAAC	CRISPRCasFinder
GTTTTTGTACTCTCAAGATTTAAGTAACTGTACAAC	CRT

10 spacers

csn2,cas2,cas1,cas9

The CRISPR arrays of LR134275_1

>merge|LR134275|1|700377-701072|PILER-CR,CRISPRCasFinder,CRT
GTTTTTGTACTCTCAAGATTTAAGTAACTGTACAACTTCCCAGTCGTTGATTTTTATTGAATACCCGTTTTTGTACTCTCAAGATTTAAGTAACTGTACAACGGACATCGAACAAGTCAATGCCGTAAGCTTGTTTTTGTACTCTCAAGATTTAAGTAACTGTACAACAATCTTTAACCGGATTGTAGAACCGTTCGGGTTTTTGTACTCTCAAGATTTAAGTAACTGTACAACTGCCTTTAAAATAACTAGATTTTACCATCAGTTTTTGTACTCTCAAGATTTAAGTAACTGTACAACGAGCAAGCACAAGCAAGCTTTACTATCCTGTTTTTGTACTCTCAAGATTTAAGTAACTGTACAACCAGATTGGTTTATCGAACAAGGTCGCAAGTGTTTTTGTACTCTCAAGATTTAAGTAACTGTACAACCAAAAGCTGTTGGTTAACGGTGCTTTGGGCAGTTTTTGTACTCTCAAGATTTAAGTAACTGTACAACCTTGTTTTTCCTCTGGGGTCTCTGCGACTTGTTTTTGTACTCTCAAGATTTAAGTAACTGTACAACGAAATAAACTGCCCAAACATTTTTATTTTCGTTTTTGTACTCTCAAGATTTAAGTAACTGTACAACTGAGTAAGCGACAAGCTAGAAATCAAGTCAGTTTTTGTACTCTCAAGATTTAAGTAACTGTACAGT

>LR134275|1|1|700377-701072|PILER-CR
GTTTTTGTACTCTCAAGATTTAAGTAACTGTACAAC	TTCCCAGTCGTTGATTTTTATTGAATACCC
GTTTTTGTACTCTCAAGATTTAAGTAACTGTACAAC	GGACATCGAACAAGTCAATGCCGTAAGCTT
GTTTTTGTACTCTCAAGATTTAAGTAACTGTACAAC	AATCTTTAACCGGATTGTAGAACCGTTCGG
GTTTTTGTACTCTCAAGATTTAAGTAACTGTACAAC	TGCCTTTAAAATAACTAGATTTTACCATCA
GTTTTTGTACTCTCAAGATTTAAGTAACTGTACAAC	GAGCAAGCACAAGCAAGCTTTACTATCCT
GTTTTTGTACTCTCAAGATTTAAGTAACTGTACAAC	CAGATTGGTTTATCGAACAAGGTCGCAAGT
GTTTTTGTACTCTCAAGATTTAAGTAACTGTACAAC	CAAAAGCTGTTGGTTAACGGTGCTTTGGGCA
GTTTTTGTACTCTCAAGATTTAAGTAACTGTACAAC	CTTGTTTTTCCTCTGGGGTCTCTGCGACTT
GTTTTTGTACTCTCAAGATTTAAGTAACTGTACAAC	GAAATAAACTGCCCAAACATTTTTATTTTC
GTTTTTGTACTCTCAAGATTTAAGTAACTGTACAAC	TGAGTAAGCGACAAGCTAGAAATCAAGTCA
GTTTTTGTACTCTCAAGATTTAAGTAACTGTACAGT

>LR134275|1|1|700377-701072|CRISPRCasFinder
GTTTTTGTACTCTCAAGATTTAAGTAACTGTACAAC	TTCCCAGTCGTTGATTTTTATTGAATACCC
GTTTTTGTACTCTCAAGATTTAAGTAACTGTACAAC	GGACATCGAACAAGTCAATGCCGTAAGCTT
GTTTTTGTACTCTCAAGATTTAAGTAACTGTACAAC	AATCTTTAACCGGATTGTAGAACCGTTCGG
GTTTTTGTACTCTCAAGATTTAAGTAACTGTACAAC	TGCCTTTAAAATAACTAGATTTTACCATCA
GTTTTTGTACTCTCAAGATTTAAGTAACTGTACAAC	GAGCAAGCACAAGCAAGCTTTACTATCCT
GTTTTTGTACTCTCAAGATTTAAGTAACTGTACAAC	CAGATTGGTTTATCGAACAAGGTCGCAAGT
GTTTTTGTACTCTCAAGATTTAAGTAACTGTACAAC	CAAAAGCTGTTGGTTAACGGTGCTTTGGGCA
GTTTTTGTACTCTCAAGATTTAAGTAACTGTACAAC	CTTGTTTTTCCTCTGGGGTCTCTGCGACTT
GTTTTTGTACTCTCAAGATTTAAGTAACTGTACAAC	GAAATAAACTGCCCAAACATTTTTATTTTC
GTTTTTGTACTCTCAAGATTTAAGTAACTGTACAAC	TGAGTAAGCGACAAGCTAGAAATCAAGTCA
GTTTTTGTACTCTCAAGATTTAAGTAACTGTACAGT

>LR134275|1|1|700377-701072|CRT
GTTTTTGTACTCTCAAGATTTAAGTAACTGTACAAC	TTCCCAGTCGTTGATTTTTATTGAATACCC
GTTTTTGTACTCTCAAGATTTAAGTAACTGTACAAC	GGACATCGAACAAGTCAATGCCGTAAGCTT
GTTTTTGTACTCTCAAGATTTAAGTAACTGTACAAC	AATCTTTAACCGGATTGTAGAACCGTTCGG
GTTTTTGTACTCTCAAGATTTAAGTAACTGTACAAC	TGCCTTTAAAATAACTAGATTTTACCATCA
GTTTTTGTACTCTCAAGATTTAAGTAACTGTACAAC	GAGCAAGCACAAGCAAGCTTTACTATCCT
GTTTTTGTACTCTCAAGATTTAAGTAACTGTACAAC	CAGATTGGTTTATCGAACAAGGTCGCAAGT
GTTTTTGTACTCTCAAGATTTAAGTAACTGTACAAC	CAAAAGCTGTTGGTTAACGGTGCTTTGGGCA
GTTTTTGTACTCTCAAGATTTAAGTAACTGTACAAC	CTTGTTTTTCCTCTGGGGTCTCTGCGACTT
GTTTTTGTACTCTCAAGATTTAAGTAACTGTACAAC	GAAATAAACTGCCCAAACATTTTTATTTTC
GTTTTTGTACTCTCAAGATTTAAGTAACTGTACAAC	TGAGTAAGCGACAAGCTAGAAATCAAGTCA
GTTTTTGTACTCTCAAGATTTAAGTAACTGTACAGT

Protein	Signature genes	Signature genes Name	Protein_function
LR134275.1\|VED87482.1\|691825_692245_-\|lipoprotein	unknown	unknown	gnl\|CDD\|371947
LR134275.1\|VED87497.1\|701113_701929_-\|membrane-protein	unknown	unknown	gnl\|CDD\|226214
LR134275.1\|VED87501.1\|702836_702968_-\|Uncharacterised-protein	unknown	unknown	unknown
LR134275.1\|VED87489.1\|694464_697851_+\|CRISPR-associated-endonuclease,-Csn1-family	cas9	cd09643_cas9_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|187774
LR134275.1\|VED87480.1\|691173_691485_+\|Uncharacterised-protein	unknown	unknown	unknown
LR134275.1\|VED87509.1\|707192_707984_+\|prolipoprotein-diacylglyceryl-transferase	unknown	unknown	gnl\|CDD\|183527
LR134275.1\|VED87505.1\|705873_706137_+\|stress-responsive-transcriptional-regulator-PspC	unknown	unknown	gnl\|CDD\|224894
LR134275.1\|VED87485.1\|692901_693147_-\|Uncharacterised-protein	unknown	unknown	unknown
LR134275.1\|VED87503.1\|703248_705381_+\|protein-tex	unknown	unknown	gnl\|CDD\|225094
LR134275.1\|VED87487.1\|693596_694211_+\|Uncharacterised-protein	unknown	unknown	unknown
LR134275.1\|VED87493.1\|698940_699264_+\|CRISPR-associated-endoribonuclease-Cas2	cas2	COG3512_cas2_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|226043
LR134275.1\|VED87507.1\|706263_707193_+\|HPr(Ser)-kinase/phosphatase	unknown	unknown	gnl\|CDD\|235459
LR134275.1\|VED87491.1\|698027_698939_+\|CRISPR-associated-protein,-Cas1-family	cas1	cd09720_cas1_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|187851
LR134275.1\|VED87514.1\|708519_708960_+\|gas-vesicle-protein	unknown	unknown	gnl\|CDD\|378938
LR134275.1\|VED87478.1\|690192_691032_+\|membrane-associated-lipoprotein	unknown	unknown	gnl\|CDD\|379488
LR134275.1\|VED87511.1\|708108_708507_+\|methyl-accepting-chemotaxis-like-domain-containing-protein	unknown	unknown	gnl\|CDD\|227109
LR134275.1\|VED87518.1\|709017_709314_-\|membrane-protein	unknown	unknown	gnl\|CDD\|371663
LR134275.1\|VED87495.1\|699260_700313_+\|CRISPR-associated-protein-Cas7	csn2	cd12217_csn2_CAS-II-A	gnl\|CDD\|213410
LR134275.1\|VED87499.1\|701928_702831_-\|putative-permease	unknown	unknown	gnl\|CDD\|223773
LR134275.1\|VED87476.1\|688820_690059_+\|Uncharacterised-protein	unknown	unknown	gnl\|CDD\|374270

Protein	Function_ID	Function_description	E-value
LR134275.1\|VED87482.1\|691825_692245_-\|lipoprotein	gnl\|CDD\|371947	pfam12182, DUF3642, Bacterial lipoprotein. This domain family is found in bacteria, and is approximately 60 amino acids in length. There is a single completely conserved Y residue that may be functionally important. This domain is from a bacterial lipoprotein, a major virulence factor in Gram negative bacteria.	1.68327e-23
LR134275.1\|VED87497.1\|701113_701929_-\|membrane-protein	gnl\|CDD\|226214	COG3689, COG3689, Predicted membrane protein [Function unknown].	2.7647e-106
LR134275.1\|VED87489.1\|694464_697851_+\|CRISPR-associated-endonuclease,-Csn1-family	gnl\|CDD\|187774	cd09643, Csn1, CRISPR/Cas system-associated protein Cas9. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Very large protein containing McrA/HNH-nuclease related domain and a RuvC-like nuclease domain; signature gene for type II.	0
LR134275.1\|VED87507.1\|706263_707193_+\|HPr(Ser)-kinase/phosphatase	gnl\|CDD\|235459	PRK05428, PRK05428, HPr kinase/phosphorylase; Provisional.	1.00337e-170
LR134275.1\|VED87509.1\|707192_707984_+\|prolipoprotein-diacylglyceryl-transferase	gnl\|CDD\|183527	PRK12437, PRK12437, prolipoprotein diacylglyceryl transferase; Reviewed.	5.01326e-100
LR134275.1\|VED87505.1\|705873_706137_+\|stress-responsive-transcriptional-regulator-PspC	gnl\|CDD\|224894	COG1983, PspC, Putative stress-responsive transcriptional regulator [Transcription / Signal transduction mechanisms].	8.64057e-19
LR134275.1\|VED87503.1\|703248_705381_+\|protein-tex	gnl\|CDD\|225094	COG2183, Tex, Transcriptional accessory protein [Transcription].	0
LR134275.1\|VED87493.1\|698940_699264_+\|CRISPR-associated-endoribonuclease-Cas2	gnl\|CDD\|226043	COG3512, COG3512, CRISPR-associated protein, Cas2 homolog [Defense mechanisms].	1.0368e-27
LR134275.1\|VED87491.1\|698027_698939_+\|CRISPR-associated-protein,-Cas1-family	gnl\|CDD\|187851	cd09720, Cas1_II, CRISPR/Cas system-associated protein Cas1. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas1 is the most universal CRISPR system protein thought to be involved in spacer intergration. Cas1 is metal-dependent deoxyribonuclease, also binds RNA; Shown to possess a unique fold consisting of a N-terminal beta-strand domain and a C-terminal alpha-helical domain.	2.34208e-135
LR134275.1\|VED87514.1\|708519_708960_+\|gas-vesicle-protein	gnl\|CDD\|378938	pfam12732, YtxH, YtxH-like protein. This family of proteins is found in bacteria. Proteins in this family are typically between 100 and 143 amino acids in length. The N-terminal region is the most conserved. Proteins is this family are functionally uncharacterized.	9.83238e-08
LR134275.1\|VED87478.1\|690192_691032_+\|membrane-associated-lipoprotein	gnl\|CDD\|379488	pfam14133, DUF4300, Domain of unknown function (DUF4300). This family of lipoproteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 281 and 303 amino acids in length. There are two conserved sequence motifs: NCR and PYQ.	4.50784e-94
LR134275.1\|VED87511.1\|708108_708507_+\|methyl-accepting-chemotaxis-like-domain-containing-protein	gnl\|CDD\|227109	COG4768, COG4768, Uncharacterized protein containing a divergent version of the methyl-accepting chemotaxis-like domain [General function prediction only].	1.66671e-33
LR134275.1\|VED87518.1\|709017_709314_-\|membrane-protein	gnl\|CDD\|371663	pfam11674, DUF3270, Protein of unknown function (DUF3270). This family of proteins with unknown function appears to be restricted to Streptococcus.	3.24407e-27
LR134275.1\|VED87495.1\|699260_700313_+\|CRISPR-associated-protein-Cas7	gnl\|CDD\|213410	cd12217, Stu0660_Csn2, Stu0660-like CRISPR/Cas system-associated protein Csn2. Csn2 is a Nmeni subtype-specific Cas protein, which may function in the adaptation process which mediates the incorporation of foreign nucleic acids into the microbial host genome. Csn 2 may interact directly with double-stranded DNA. This family of Csn2 proteins includes Stu0660, the proteins are larger than other (canonical) Csn2 proteins as they have an additional alpha-helical C-terminal domain. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA. Csn2 has been predicted to be a functional analog of Cas4 based on anti-correlated phyletic patterns; also known as SPy1049 family.	6.6085e-132
LR134275.1\|VED87499.1\|701928_702831_-\|putative-permease	gnl\|CDD\|223773	COG0701, COG0701, Predicted permeases [General function prediction only].	1.15203e-78
LR134275.1\|VED87476.1\|688820_690059_+\|Uncharacterised-protein	gnl\|CDD\|374270	pfam15983, DUF4767, Domain of unknown function (DUF4767). This domain family is found in bacteria, and is approximately 140 amino acids in length. There is a single completely conserved residue Q that may be functionally important.	5.98295e-28

>LR134275.1|VED87495.1|699260_700313_+|CRISPR-associated-protein-Cas7
MKFFVQHPYKERIELNIGVITQIVGQNNELKYYTWQILSWYFGGRKYSSEDLSIFDYEEPTILDETGEIVKRSSYHYIDISSFKDLLEQMEYKKGTLAHDYLSKVVNQVDIVAHLERINEQVELIEETMNRHINLNCGQVEYHLENRPLTLDQLLTKNFSPFFTIENMNLSFEWVSNTDKLSLFLEMLDRLLSQTTEKYLILLKNIDSFISEDSYDSFYKQIDQLVKKYPNLTFILFPSDQGYLKIDEENSKFVNILSDQVEHLYDVEFMYESVAKHYPSNNFPTREDFRISLETVTPYLLTKMLRQPSLSVVDSVILNILNQLFHFSYRIRYSQTSDEKLLQKFLESKD
>LR134275.1|VED87493.1|698940_699264_+|CRISPR-associated-endoribonuclease-Cas2
MRYEALRLLCFFDLPMESKDEKRIYRNFRKELISNGFEMLQFSVYYRTCPNRSFANKFYKKLKMSNLPAGNVRLLAVTEKQFSEMTLIIGGKTKQEEIVSDNKLVVI
>LR134275.1|VED87491.1|698027_698939_+|CRISPR-associated-protein,-Cas1-family
MTWRVVHVSQSEKMRLKLDNLLVQKMGQEFTVPLSDISIIVAEGGDTIVTLRLLSALSKYNIALVVCDNEHLPTGIYHSQNGHFRAYKRLKEQMDWSQKQKDKAWQIVTYYKINNQEDVLAMFEKSLDNIRLLSDYKEQIEPGDRTNREGHAAKVYFNELFGKQFVRVTQQEADVINAGLNYGYAIMRAQMARIVAGYGLNGLLGIFHKNEYNQFNLVDDLMEPFRQIVDVWVYDNLRDQEFLKYEYRLGLTDLLNAKIKYGKETCSVTVAMDKYVKGFIKYISEKDSSKFHCPVVSSLEWRK
>LR134275.1|VED87489.1|694464_697851_+|CRISPR-associated-endonuclease,-Csn1-family
MSDLVLGLDIGIGSVGVGILNKVTGEIIHKNSRIFPAAQAENNVERRTNRQGRRLTRRKKHRRVRLNHLFEESGLITDFTKVSINLNPYQLRVKGLIDELSNEELFIALKNMVKHRGISYLDDASDDGNSSVGDYAQIVKENSKQLETKTPGQIQLERYQKYGQLRGDFTVEEDGKKHRLINVFPTSAYRSEALRILQTQKEFNPQITDEFINRYLEILTGKRKYYHGPGNEKSRTDYGRYTTKKDSENEYITLDNIFGILIGKCTFYPEEYRAAKASYTAQEFNLLNDLNNLTVPTETKKLSEEQKNQIINYVKNEKAMGPAKLFKYIAKLLSCDVADIKGYRIDKSDKAEIHTFEAYRKMKTLETIDFEKMSRDQLDKLAYVLTLNTEREGIQEALEHEFADGNFIQEQIDELVQFRKANSSIFGKGWHNFSVKLMMELIPELYATSEEQMTILTRLGKQKTTSSSNKTKYIDEKLLTEEIYNPVVAKSVRQAIKIVNAAIKEYGDFDNIVIEMARETNEDDEKKAIQKIQKANKDEKDAAMLKAANQYNGRAELPHSVFHGHKQLATKIRLWHQQGERCLYTGKTISIHDLINNPNQFEIDHILPLSITFDDSLANKVLVYATANQEKGQRTPYQALDSMDDAWSFRELKAFVRESKSLSNKKKEYLLTEEDISRFDVRKKFIERNLVDTRYASRVVLNALQEHFRAHKTDTKVSVVRGQFTSQLRRHWGIEKTRDTYHHHAVDALIIAASSQLNLWKKQKNTLVNYSENQLLDIETGELISDDEYKESVFKAPYQHFVDTLKSKEFEDSILFSYQVDSKFNRKISDATIYATRQAKVGKDKKDETYVLGKIKDIYSQTGYDAFIKIYQKDKSKFLMYRHDPQTFEKVIEPILENYPNKEMNEKGKEVPCNPFLKYKEEHGDYIRKYSKKGNGPEIKSLKYYDSKLGNHIDITPKDSNNKVVLQSVSPWRADVYFNKTTGKYEILGLKYADLQFEKGTGTYKISQEKYNVIKKKEGVDSDSEFKFTLYKNDLLLIKDTETKEQQLFRFLSRTKPNVKHYVELKPYDKQKFEGNESLINVLGAVAKGGQCQKGINKPNISIYKVRTDVLGNQHIIKNEGDKPKLDF
>LR134275.1|VED87487.1|693596_694211_+|Uncharacterised-protein
MWKWFKRLIVLVTVLFFAMVALLIPDKIDSQDQLKNVSTQTSLVDLVQAGIGETSLSSGDLSTEINLDSNQFRQVLKASIAESNDETLKNSTVELNDSYLTAKVPVSLGPIESTFSLDFTVSTNKEVILLDLSGAHLGRLPVPKPLVLPYLKKSIAQSSSGVRVVNNQIQLKLPEIGYEIEQATINNSKMKVKLNIPISLPTSW
>LR134275.1|VED87485.1|692901_693147_-|Uncharacterised-protein
MLSISLLGHNISTHIDEKLGRLQIQNQGKDMLEKFIRIQTTDDSIIDDIVNTSTPSNFTNGKKLHEREAGEEYLSLDGDLI
>LR134275.1|VED87482.1|691825_692245_-|lipoprotein
MTLSKKLTLSLASMAVLGLLAACSNQKAQTPESSASTQQSSSKVSPSQSSEASKQTNGLDGTYKGTDESDRITLTISGNTGTWEEDEADGEKDSKSVTVNPANQSLTIGDDIKYYKLDGNQLTIEDDDRDPNDTIILTK
>LR134275.1|VED87480.1|691173_691485_+|Uncharacterised-protein
MELKDFTEKEQEQINQGLSTAEISDKEAAKKLLDLVPLEWIKRIPFFVRGHATTKTVERVAKQYPELYAVAKRQGDLPEKEREELRKIMTAIFEEKMNKHKIK
>LR134275.1|VED87478.1|690192_691032_+|membrane-associated-lipoprotein
MKYLKKQTLILLSISSLFLVGLAVSTHFHKKEKQPSYSNLNSKVSLSEVRSILSKHLDEGSVDSFINLVKDYNDTVGSVGLTGDFKPFTKTDYDVEKISSLWTAKHGDFIGTNCRINTYTLLKGKIKIPQVKSDSELLFQDKDAIDKGKIFDAKEQANFEILFSRVKTEPTQVVKVHAKHMEDYYKQFTFDDKARMLSVVVHDNLDGDSLFVGHVGVLVPTTDGYLFVEKLTFEEPYQAIKFASKKDCYKYLTTKYKDYTGPGLAKPFIMDNGKWVDMD
>LR134275.1|VED87476.1|688820_690059_+|Uncharacterised-protein
MKAEEWLTYFMKIYGRRPKMTEVDEAIQNGSLLANRAEVEALLPASKKGFWESLSQFVATHKVVASIVAVFCVTLLGGGVIFVWHSHNSQTQKQPSLTVASSNSQTFSLDKSKQSSSKASESSSSYSSQSQSASSVAKTPAMDVEAIRNSDFSSIEGDWVSDSGHVVTITKSGLTKSEETGSTDGKTVIKDFKGQPMFYFADNSPGHGVNPFVPVPANQAAPSPDNSVKDTDRLVQIPELAGPGVVYTSYYRVKSKSQSSQNSPTNTTALWNSDKAAKLASYMVEFGHKMNQESYRRLTPNGSDDFYGAMSFAKNNRITVGEKTEQNAPMTNQQKVDVAFSDDGTGTADYIIVDSYGYAGSAMILYHFTIHNGQPVVLVSLQNQGNPENMYYMYPTNNKDIQEAFANIVNGK
>LR134275.1|VED87497.1|701113_701929_-|membrane-protein
MLRFLILSGYFELVMYLQVSGKLNQYINIHYSYLAYISMVLSFILAVVQLIVWMKQMKVHSHLSGRVAKVASIVLLAFPVLTGLLVPTVTLDANTVSAKGYHFPLAAGSDPNQADQEGTTIQYLKPDTSSYFTSSAYEKEMTKELAKYKGHETIQITTENYMEVMELIYLYPNDFVGKKVTYTGFVYNDPQTKGYQFIFRFGIIHCIADSGVYGLATRGSDQTFKDNTWVKVTGTITVDYYQNLKQSLPILNLTEVKEVGQPDNPYVYRVF
>LR134275.1|VED87499.1|701928_702831_-|putative-permease
MAIFHQLPDSVLQLLAVFLSIIIEALPFVLLGSILSGFIEVFVTPEKVQNFLPKNKVLAILFGTLVGFIFPSCECGIVPIITRFLEKKVPSYTAIPFMATAPIINPVVLFATYTAFGNSWYYVILRFLGAFLIAMILGILLGFVVDDQILKDNRKTSHVHDYSGLSAGKKVFQALVHAVDEFFDTGRYLIFGSLVAAGMQTYLPTRILTTIGHNSVTAILIMMLLAFILSLCSEADAFIGASLLSSFGVAPTVAFLIIGPMVDIKNLIMMKHQFKTRFVGLFVGTASLVTIIYCLLLGVI
>LR134275.1|VED87501.1|702836_702968_-|Uncharacterised-protein
MAVIQKKTNELESMMASFAAIPDFEKAGTDPKKDKRLQEDKKK
>LR134275.1|VED87503.1|703248_705381_+|protein-tex
MENRNLETLAQELGLKKQQVETVLELTAEGNTIPFIARYRKEKTGNLDETQIKAIIDMDKSLTALQDRKETVLAKIEAQGKLTDQLKAAIEAAEKLADVEELYLPYKEKRRTKATIAREAGLFPLARLILQNSPNLKAEAEKLTSEAFPTADKALAGAVDILVEAFSEDNSLRSWTYNEIWNNSDITSTLKDQSLDEKETFKIYYDFEDKVSKLQGYRTLALNRGEKLGVVKVAFKHNLEKMHRFYSARFKQKNDYIEEVINQSLKKKIIPAMERRIRSELTEAAEDGAIQLFSQNLRSLLLVSPLKGKMVLGFDPAFRTGAKLAVVDQTGKLITTQVIYPVAPASQAKIAQAKKDLADLIKKHAIEIIAIGNGTASRESEAFVAEVLKDFPETSYVIVNESGASVYSASELARHEFPDLTVEKRSAISIARRLQDPLAELVKIDPKSIGVGQYQHDVSQKKLSENLDFVVDTVVNQVGVNVNTASSTLLSHVSGLNKTISENIVAYREENGEIASRAEIKKVPRLGAKAFEQAAGFLRIPNAKNILDNTGVHPESYPAVKDLFKQLDITDLDDSAKEKLKALNLKETAEELGLGQETLKDIIADLLKPGRDLRDDFEAPVLRQDVLELKDLSVGQKLEGTVRNVVDFGAFVDIGVHEDGLIHISEMSKSFVNHPSQVVSVGDLVTVWVSKVDLEHEKLNLSLVNPRESN
>LR134275.1|VED87505.1|705873_706137_+|stress-responsive-transcriptional-regulator-PspC
MSNRFYKTRKNRLVAGVVAGLADKFGWDLTLARILAIILMVSTQFGIFLYLVLAFLLPYKEDIYPEIKLKDGRKRKNAEPVEDEWNW
>LR134275.1|VED87507.1|706263_707193_+|HPr(Ser)-kinase/phosphatase
MTVTVKMLVDKLKLKVVYGNEKLLSKPITTADISRPGLEMTGYFDYYSPERLQLVGMKEWSYLKTMTDNNRYSVFANMFKAETPAVIVARGLEIPEEMLQAAKENGVAVLQGRNGTSSLSGDMSWYLNSQLAERTSVHGVLVDIYGMGVLIQGDSGIGKSETGLELVKRGHRLVADDRVDVYAKDEETLWGEPAEILRHLLEIRGVGIIDVMSLYGASAVRNSSQVQLGIYLENFENGKVFDRLGNSNEEIELQGVKIPRIRIPVKTGRNVSVVIEAAAMNYRAKQMGFDATKTFNDRLTNLISKNGEE
>LR134275.1|VED87509.1|707192_707984_+|prolipoprotein-diacylglyceryl-transferase
MLATIDPIALRLGPISIHWYAICIVSGLLLAVYLVQRWAPEKGIDPEHILDFILLAFPIAIVGARLYYVIFQWSYYSQNPSEIFAIWNGGIAIYGGLIGGAVVLYWFAKRHAISVLDFLDIAAPGVMIAQSIGRWGNFVNQEAYGKAVSHLNYLPEIIRQQMFIDGSYRVPTFLYESLWNLVGFSIILGLRRFNKGLRQGDVTSFYLIWYGLGRFVIEGMRTDSLMFAGLRVSQWVSISIIILGAVLLYFRKQRPKADYKMKS
>LR134275.1|VED87511.1|708108_708507_+|methyl-accepting-chemotaxis-like-domain-containing-protein
MAEIAFLIIAIALAAFLIALIPTLLRTRHVVKEVEETVAVLRTDINVTLHQTNEILAKANVLVEDVNEKVQTIDPLFVAVAELSESVSDLNTEARYLGTKASAAGASVGKAGSAFAIGKIASKLFGKKDKKK
>LR134275.1|VED87514.1|708519_708960_+|gas-vesicle-protein
MSKFLNTLIIGAASGAAAAYFFTTEKGKAVKVRIDEEFASFKEDPKAYQNQVVGKASDYKELAVDTFQDYKTKFENGDITVDDLTKAVQEKTAQVADFAKESFELIKEKTAQVTPEQADVEAETKAIVDDIVIDIKDISEEVAEVK
>LR134275.1|VED87518.1|709017_709314_-|membrane-protein
MADNLHRQFDHIEDFETERPQTTNYQDYQGLNNNSIKLQDMIFFGRISSFCVSTVLVAFLFLVAQVASFWAFFWAITISVIGQIGIYVLIKYYKAQKR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
LR134275_1	1.6\|700742\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700742-700771	30	MK448755	Streptococcus phage Javan423, complete genome	4360-4389	1	0.967
LR134275_1	1.6\|700742\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700742-700771	30	MK448829	Streptococcus phage Javan7, complete genome	5252-5281	1	0.967
LR134275_1	1.6\|700742\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700742-700771	30	MH853355	Streptococcus phage LF1, complete genome	33530-33559	1	0.967
LR134275_1	1.6\|700742\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700742-700771	30	MK448756	Streptococcus phage Javan425, complete genome	4360-4389	1	0.967
LR134275_1	1.6\|700742\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700742-700771	30	MH853358	Streptococcus phage LF4, complete genome	33530-33559	1	0.967
LR134275_1	1.6\|700742\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700742-700771	30	JX409895	Streptococcus phage JX01, complete genome	9841-9870	1	0.967
LR134275_1	1.7\|700808\|31\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700808-700838	31	MG708274	Streptococcus phage vB_SthS_VA214, complete genome	9612-9642	1	0.968
LR134275_1	1.7\|700808\|31\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700808-700838	31	MH937495	Streptococcus phage CHPC1045, complete genome	24115-24145	1	0.968
LR134275_1	1.7\|700808\|31\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700808-700838	31	MH937496	Streptococcus phage CHPC1046, complete genome	24509-24539	1	0.968
LR134275_1	1.7\|700808\|31\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700808-700838	31	MH937507	Streptococcus phage CHPC1152, complete genome	26174-26204	1	0.968
LR134275_1	1.7\|700808\|31\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700808-700838	31	KY705273	Streptococcus phage P7602, complete genome	26066-26096	1	0.968
LR134275_1	1.7\|700808\|31\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700808-700838	31	MH892373	Streptococcus phage SW27, complete genome	24547-24577	1	0.968
LR134275_1	1.7\|700808\|31\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700808-700838	31	MF161328	Streptococcus phage D4276, complete genome	30070-30100	1	0.968
LR134275_1	1.7\|700808\|31\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700808-700838	31	KX879642	Streptococcus phage CHPC926, complete genome	20372-20402	1	0.968
LR134275_1	1.7\|700808\|31\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700808-700838	31	KY705270	Streptococcus phage P7573, complete genome	27142-27172	1	0.968
LR134275_1	1.7\|700808\|31\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700808-700838	31	MH937458	Streptococcus phage CHPC572, complete genome	26330-26360	1	0.968
LR134275_1	1.7\|700808\|31\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700808-700838	31	MH892353	Streptococcus phage SW2, complete genome	27096-27126	1	0.968
LR134275_1	1.7\|700808\|31\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700808-700838	31	MH937511	Streptococcus phage CHPC1247, complete genome	25031-25061	1	0.968
LR134275_1	1.7\|700808\|31\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700808-700838	31	KY705277	Streptococcus phage P7951, complete genome	24496-24526	1	0.968
LR134275_1	1.7\|700808\|31\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700808-700838	31	KY705252	Streptococcus phage P0092, complete genome	22493-22523	1	0.968
LR134275_1	1.7\|700808\|31\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700808-700838	31	MF580773	Streptococcus phage STP1, complete genome	24880-24910	1	0.968
LR134275_1	1.7\|700808\|31\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700808-700838	31	MH937480	Streptococcus phage CHPC954, complete genome	26192-26222	1	0.968
LR134275_1	1.7\|700808\|31\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700808-700838	31	MH937477	Streptococcus phage CHPC950, complete genome	25010-25040	1	0.968
LR134275_1	1.7\|700808\|31\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700808-700838	31	MH937467	Streptococcus phage CHPC877, complete genome	29247-29277	1	0.968
LR134275_1	1.7\|700808\|31\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700808-700838	31	MH937487	Streptococcus phage CHPC1029, complete genome	24370-24400	1	0.968
LR134275_1	1.7\|700808\|31\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700808-700838	31	MH937481	Streptococcus phage CHPC979, complete genome	24129-24159	1	0.968
LR134275_1	1.7\|700808\|31\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700808-700838	31	KY705281	Streptococcus phage P7955, complete genome	27134-27164	1	0.968
LR134275_1	1.7\|700808\|31\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700808-700838	31	MH973661	Streptococcus phage SW5, complete genome	26859-26889	1	0.968
LR134275_1	1.7\|700808\|31\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700808-700838	31	MH937485	Streptococcus phage CHPC1014, complete genome	25089-25119	1	0.968
LR134275_1	1.7\|700808\|31\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700808-700838	31	MF580774	Streptococcus phage STP2, complete genome	24896-24926	1	0.968
LR134275_1	1.7\|700808\|31\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700808-700838	31	MH937497	Streptococcus phage CHPC1048, complete genome	24532-24562	1	0.968
LR134275_1	1.7\|700808\|31\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700808-700838	31	MH973663	Streptococcus phage SW24, complete genome	22192-22222	1	0.968
LR134275_1	1.7\|700808\|31\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700808-700838	31	KY705262	Streptococcus phage P7132, complete genome	25172-25202	1	0.968
LR134275_1	1.7\|700808\|31\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700808-700838	31	MH937491	Streptococcus phage CHPC1037, partial genome	25256-25286	1	0.968
LR134275_1	1.7\|700808\|31\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700808-700838	31	MH892352	Streptococcus phage SW1, complete genome	25276-25306	1	0.968
LR134275_1	1.9\|700941\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700941-700970	30	MF580775	Streptococcus phage V2, complete genome	32019-32048	1	0.967
LR134275_1	1.9\|700941\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700941-700970	30	KY705255	Streptococcus phage P0095, complete genome	30304-30333	1	0.967
LR134275_1	1.9\|700941\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700941-700970	30	MF580769	Streptococcus phage L5A1, complete genome	31671-31700	1	0.967
LR134275_1	1.9\|700941\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700941-700970	30	MF580762	Streptococcus phage 9B4, complete genome	31966-31995	1	0.967
LR134275_1	1.9\|700941\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700941-700970	30	MH937458	Streptococcus phage CHPC572, complete genome	31724-31753	1	0.967
LR134275_1	1.9\|700941\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700941-700970	30	MF580760	Streptococcus phage 7T, complete genome	32606-32635	1	0.967
LR134275_1	1.9\|700941\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700941-700970	30	MF580768	Streptococcus phage C0, complete genome	28588-28617	1	0.967
LR134275_1	1.9\|700941\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700941-700970	30	MF580773	Streptococcus phage STP1, complete genome	30253-30282	1	0.967
LR134275_1	1.9\|700941\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700941-700970	30	MH892359	Streptococcus phage SW10, complete genome	32375-32404	1	0.967
LR134275_1	1.9\|700941\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700941-700970	30	MF580766	Streptococcus phage B0, complete genome	31743-31772	1	0.967
LR134275_1	1.9\|700941\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700941-700970	30	MF580763	Streptococcus phage 16B8, complete genome	31374-31403	1	0.967
LR134275_1	1.9\|700941\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700941-700970	30	MH892358	Streptococcus phage SW9, complete genome	32086-32115	1	0.967
LR134275_1	1.9\|700941\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700941-700970	30	MF580772	Streptococcus phage R1, complete genome	31974-32003	1	0.967
LR134275_1	1.9\|700941\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700941-700970	30	MF580774	Streptococcus phage STP2, complete genome	30258-30287	1	0.967
LR134275_1	1.9\|700941\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700941-700970	30	MF580764	Streptococcus phage 31B4, complete genome	33919-33948	1	0.967
LR134275_1	1.9\|700941\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700941-700970	30	MF580765	Streptococcus phage A0, complete genome	30268-30297	1	0.967
LR134275_1	1.9\|700941\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700941-700970	30	MF580759	Streptococcus phage 7A5, complete genome	30723-30752	1	0.967
LR134275_1	1.9\|700941\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700941-700970	30	MH892352	Streptococcus phage SW1, complete genome	32691-32720	1	0.967
LR134275_1	1.9\|700941\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700941-700970	30	MF580767	Streptococcus phage B5, complete genome	30794-30823	1	0.967
LR134275_1	1.3\|700545\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700545-700574	30	MK202161	Streptococcus phage CHPC1282, complete genome	29588-29617	2	0.933
LR134275_1	1.3\|700545\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700545-700574	30	MH892351	Streptococcus phage SW6, complete genome	30067-30096	2	0.933
LR134275_1	1.3\|700545\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700545-700574	30	MH892375	Streptococcus phage SW30, complete genome	30252-30281	2	0.933
LR134275_1	1.4\|700611\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700611-700640	30	NC_008501	Streptococcus thermophilus LMD-9 plasmid 2, complete sequence	2726-2755	2	0.933
LR134275_1	1.4\|700611\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700611-700640	30	NC_019231	Streptococcus thermophilus plasmid pK1002C2, complete sequence	1306-1335	2	0.933
LR134275_1	1.4\|700611\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700611-700640	30	NC_019232	Streptococcus thermophilus plasmid pK2007C6, complete sequence	1306-1335	2	0.933
LR134275_1	1.6\|700742\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700742-700771	30	MH937504	Streptococcus phage CHPC1091, complete genome	27040-27069	2	0.933
LR134275_1	1.6\|700742\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700742-700771	30	MH892385	Streptococcus phage SW33, complete genome	29291-29320	2	0.933
LR134275_1	1.6\|700742\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700742-700771	30	NC_000872	Streptococcus phage Sfi21, complete genome	30016-30045	2	0.933
LR134275_1	1.6\|700742\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700742-700771	30	MH937460	Streptococcus phage CHPC640, complete genome	31262-31291	2	0.933
LR134275_1	1.6\|700742\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700742-700771	30	MH892384	Streptococcus phage SW32, complete genome	29291-29320	2	0.933
LR134275_1	1.6\|700742\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700742-700771	30	KY705256	Streptococcus phage P3681, complete genome	27527-27556	2	0.933
LR134275_1	1.6\|700742\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700742-700771	30	MH937493	Streptococcus phage CHPC1041, complete genome	28062-28091	2	0.933
LR134275_1	1.6\|700742\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700742-700771	30	MH892376	Streptococcus phage SW1151, complete genome	26335-26364	2	0.933
LR134275_1	1.6\|700742\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700742-700771	30	NC_000871	Streptococcus phage Sfi19, complete genome	28788-28817	2	0.933
LR134275_1	1.6\|700742\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700742-700771	30	AF004379	Streptococcus thermophilus bacteriophage Sfi21 DNA replication module	775-804	2	0.933
LR134275_1	1.6\|700742\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700742-700771	30	MH937492	Streptococcus phage CHPC1040, complete genome	26444-26473	2	0.933
LR134275_1	1.6\|700742\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700742-700771	30	U88974	Streptococcus thermophilus temperate bacteriophage O1205, complete genome	4375-4404	2	0.933
LR134275_1	1.6\|700742\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700742-700771	30	AF158601	Streptococcus thermophilus bacteriophage SFi18 lysin, gp111, gp183, gp47, gp54, gp71, gp145, gp69, gp40, gp229, gp157, gp233, putative helicase, gp151, gp271, putative primase, gp143, gp106, gp89, gp57, gp51, gp66, gp192, putative DNA binding protein, gp99, and gp235 genes, complete cds	5857-5886	2	0.933
LR134275_1	1.6\|700742\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700742-700771	30	MH937463	Streptococcus phage CHPC676, complete genome	31366-31395	2	0.933
LR134275_1	1.6\|700742\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700742-700771	30	KY705263	Streptococcus phage P7133, complete genome	24611-24640	2	0.933
LR134275_1	1.6\|700742\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700742-700771	30	KY705278	Streptococcus phage P7952, complete genome	29653-29682	2	0.933
LR134275_1	1.6\|700742\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700742-700771	30	MH892357	Streptococcus phage SW8, complete genome	26186-26215	2	0.933
LR134275_1	1.6\|700742\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700742-700771	30	AF115103	Streptococcus thermophilus bacteriophage Sfi21, complete genome	30016-30045	2	0.933
LR134275_1	1.6\|700742\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700742-700771	30	NC_004303	Streptococcus phage O1205, complete genome	4375-4404	2	0.933
LR134275_1	1.6\|700742\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700742-700771	30	AF115102	Streptococcus thermophilus bacteriophage Sfi19, complete genome	28788-28817	2	0.933
LR134275_1	1.6\|700742\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700742-700771	30	AF077306	Streptococcus thermophilus bacteriophage Sfi19 gp157, gp233, putative helicase, gp151, gp271, putative primase, and gp143 genes, complete cds	760-789	2	0.933
LR134275_1	1.6\|700742\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700742-700771	30	MH892383	Streptococcus phage SW31, complete genome	29291-29320	2	0.933
LR134275_1	1.6\|700742\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700742-700771	30	KY705280	Streptococcus phage P7954, complete genome	27882-27911	2	0.933
LR134275_1	1.6\|700742\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700742-700771	30	NC_002214	Streptococcus thermophilus bacteriophage Sfi11, complete genome	30783-30812	2	0.933
LR134275_1	1.6\|700742\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700742-700771	30	KY705279	Streptococcus phage P7953, complete genome	28077-28106	2	0.933
LR134275_1	1.6\|700742\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700742-700771	30	MH892362	Streptococcus phage SW13, complete genome	29308-29337	2	0.933
LR134275_1	1.6\|700742\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700742-700771	30	MH937502	Streptococcus phage CHPC1083, complete genome	28075-28104	2	0.933
LR134275_1	1.6\|700742\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700742-700771	30	MH937469	Streptococcus phage CHPC919, complete genome	27108-27137	2	0.933
LR134275_1	1.6\|700742\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700742-700771	30	MH937478	Streptococcus phage CHPC951, complete genome	28050-28079	2	0.933
LR134275_1	1.6\|700742\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700742-700771	30	KY705257	Streptococcus phage P3684, complete genome	26379-26408	2	0.933
LR134275_1	1.7\|700808\|31\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700808-700838	31	KY705259	Streptococcus phage P5641, complete genome	26351-26381	2	0.935
LR134275_1	1.7\|700808\|31\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700808-700838	31	MH937471	Streptococcus phage CHPC927, complete genome	26470-26500	2	0.935
LR134275_1	1.7\|700808\|31\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700808-700838	31	MH937499	Streptococcus phage CHPC1062, complete genome	29288-29318	2	0.935
LR134275_1	1.9\|700941\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700941-700970	30	MF580770	Streptococcus phage M19, complete genome	27940-27969	2	0.933
LR134275_1	1.9\|700941\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700941-700970	30	MH892371	Streptococcus phage SW25, complete genome	25748-25777	2	0.933
LR134275_1	1.9\|700941\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700941-700970	30	MH892372	Streptococcus phage SW26, complete genome	25444-25473	2	0.933
LR134275_1	1.9\|700941\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700941-700970	30	MH892368	Streptococcus phage SW20, complete genome	26697-26726	2	0.933
LR134275_1	1.9\|700941\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700941-700970	30	MH937471	Streptococcus phage CHPC927, complete genome	31586-31615	2	0.933
LR134275_1	1.9\|700941\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700941-700970	30	KU678389	Streptococcus virus 9871, complete genome	26563-26592	2	0.933
LR134275_1	1.9\|700941\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700941-700970	30	MH892350	Streptococcus phage SW16, complete genome	26035-26064	2	0.933
LR134275_1	1.9\|700941\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700941-700970	30	MH892374	Streptococcus phage SW28, complete genome	26170-26199	2	0.933
LR134275_1	1.9\|700941\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700941-700970	30	KU678391	Streptococcus virus 9873, complete genome	26648-26677	2	0.933
LR134275_1	1.9\|700941\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700941-700970	30	MH937467	Streptococcus phage CHPC877, complete genome	34084-34113	2	0.933
LR134275_1	1.9\|700941\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700941-700970	30	MH892369	Streptococcus phage SW22, complete genome	25807-25836	2	0.933
LR134275_1	1.9\|700941\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700941-700970	30	NC_031094	Streptococcus virus 9872, complete genome	26940-26969	2	0.933
LR134275_1	1.9\|700941\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700941-700970	30	MH892370	Streptococcus phage SW23, complete genome	25584-25613	2	0.933
LR134275_1	1.9\|700941\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700941-700970	30	MH892354	Streptococcus phage SW3, complete genome	32800-32829	2	0.933
LR134275_1	1.9\|700941\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700941-700970	30	MH892365	Streptococcus phage SW17, complete genome	26166-26195	2	0.933
LR134275_1	1.6\|700742\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700742-700771	30	MK448970	Streptococcus phage Javan516, complete genome	8903-8932	3	0.9
LR134275_1	1.6\|700742\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700742-700771	30	MK448953	Streptococcus phage Javan474, complete genome	7490-7519	3	0.9
LR134275_1	1.6\|700742\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700742-700771	30	MK448945	Streptococcus phage Javan454, complete genome	8074-8103	3	0.9
LR134275_1	1.6\|700742\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700742-700771	30	MK448941	Streptococcus phage Javan446, complete genome	8837-8866	3	0.9
LR134275_1	1.6\|700742\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700742-700771	30	MK448957	Streptococcus phage Javan484, complete genome	8470-8499	3	0.9
LR134275_1	1.6\|700742\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700742-700771	30	NC_028666	Streptococcus phage Str-PAP-1, complete genome	5135-5164	3	0.9
LR134275_1	1.4\|700611\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700611-700640	30	NC_001757	Lactobacillus reuteri 100-23 plasmid pGT232, complete sequence	1865-1894	5	0.833
LR134275_1	1.4\|700611\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700611-700640	30	NZ_CP021504	Lactobacillus plantarum strain SRCM102022 plasmid pPL2022-3 sequence	1562-1591	6	0.8
LR134275_1	1.4\|700611\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700611-700640	30	NZ_CP021504	Lactobacillus plantarum strain SRCM102022 plasmid pPL2022-3 sequence	3536-3565	6	0.8
LR134275_1	1.4\|700611\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700611-700640	30	NZ_CP012654	Lactobacillus plantarum strain HFC8 isolate Lactobacillus plantarum plasmid pMK10, complete sequence	331-360	6	0.8
LR134275_1	1.4\|700611\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700611-700640	30	NZ_CP012654	Lactobacillus plantarum strain HFC8 isolate Lactobacillus plantarum plasmid pMK10, complete sequence	2392-2421	6	0.8
LR134275_1	1.4\|700611\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700611-700640	30	NZ_CP015127	Lactobacillus plantarum strain CAUH2 plasmid pCAUH201, complete sequence	569-598	6	0.8
LR134275_1	1.4\|700611\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700611-700640	30	NC_011136	Lactobacillus plantarum plasmid pLR1, complete sequence	1088-1117	6	0.8
LR134275_1	1.4\|700611\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700611-700640	30	NZ_CP012100	Bacillus thuringiensis strain HS18-1 plasmid pHS18-1, complete sequence	403904-403933	6	0.8
LR134275_1	1.4\|700611\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700611-700640	30	NZ_CP029455	Bacillus cereus strain FORC087 plasmid pFORC087.1, complete sequence	205882-205911	6	0.8
LR134275_1	1.4\|700611\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700611-700640	30	NZ_CP022346	Bacillus thuringiensis strain c25 plasmid unnamed1, complete sequence	79069-79098	6	0.8
LR134275_1	1.2\|700479\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700479-700508	30	NZ_CP011515	Mitsuaria sp. 7 plasmid, complete sequence	189450-189479	7	0.767
LR134275_1	1.4\|700611\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700611-700640	30	NZ_CP046704	Nostoc sp. ATCC 53789 plasmid pNsp_a, complete sequence	319382-319411	7	0.767
LR134275_1	1.5\|700677\|29\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700677-700705	29	NZ_CP011641	Serratia marcescens strain CAV1492 plasmid pCAV1492-199, complete sequence	27102-27130	7	0.759
LR134275_1	1.6\|700742\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700742-700771	30	NC_048066	Vibrio phage 1.202.O._10N.222.45.E8, partial genome	27868-27897	7	0.767
LR134275_1	1.9\|700941\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700941-700970	30	NZ_CP043832	Bacillus sp. BS98 plasmid unnamed2	264636-264665	7	0.767
LR134275_1	1.9\|700941\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700941-700970	30	NZ_CP020434	Bacillus sp. FDAARGOS_235 plasmid 1, complete sequence	109788-109817	7	0.767
LR134275_1	1.1\|700413\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700413-700442	30	NZ_CP016915	Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence	52751-52780	8	0.733
LR134275_1	1.1\|700413\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700413-700442	30	NZ_CP023017	Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence	1994970-1994999	8	0.733
LR134275_1	1.1\|700413\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700413-700442	30	NZ_CP022781	Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence	1419965-1419994	8	0.733
LR134275_1	1.1\|700413\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700413-700442	30	NZ_CP015116	Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence	756947-756976	8	0.733
LR134275_1	1.1\|700413\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700413-700442	30	NZ_CP016555	Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence	254593-254622	8	0.733
LR134275_1	1.1\|700413\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700413-700442	30	NZ_CP052071	Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence	616482-616511	8	0.733
LR134275_1	1.1\|700413\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700413-700442	30	NZ_CP052075	Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence	616482-616511	8	0.733
LR134275_1	1.1\|700413\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700413-700442	30	NZ_CP052095	Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence	606723-606752	8	0.733
LR134275_1	1.1\|700413\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700413-700442	30	NZ_CP052105	Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence	616483-616512	8	0.733
LR134275_1	1.1\|700413\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700413-700442	30	NZ_CP052097	Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence	606723-606752	8	0.733
LR134275_1	1.1\|700413\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700413-700442	30	NZ_CP052115	Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence	616485-616514	8	0.733
LR134275_1	1.1\|700413\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700413-700442	30	NZ_CP052093	Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence	606723-606752	8	0.733
LR134275_1	1.1\|700413\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700413-700442	30	NZ_CP052101	Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence	606723-606752	8	0.733
LR134275_1	1.1\|700413\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700413-700442	30	NZ_CP052099	Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence	606723-606752	8	0.733
LR134275_1	1.1\|700413\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700413-700442	30	NZ_CP052107	Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence	616485-616514	8	0.733
LR134275_1	1.1\|700413\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700413-700442	30	NZ_CP052117	Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence	616485-616514	8	0.733
LR134275_1	1.1\|700413\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700413-700442	30	NZ_CP022756	Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence	602683-602712	8	0.733
LR134275_1	1.1\|700413\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700413-700442	30	NZ_CP052129	Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence	606710-606739	8	0.733
LR134275_1	1.1\|700413\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700413-700442	30	NZ_CP052121	Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence	616485-616514	8	0.733
LR134275_1	1.1\|700413\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700413-700442	30	NZ_CP052073	Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence	616479-616508	8	0.733
LR134275_1	1.1\|700413\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700413-700442	30	NZ_CP052109	Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence	616485-616514	8	0.733
LR134275_1	1.1\|700413\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700413-700442	30	NZ_CP052091	Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence	606725-606754	8	0.733
LR134275_1	1.1\|700413\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700413-700442	30	NZ_CP052103	Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence	616485-616514	8	0.733
LR134275_1	1.1\|700413\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700413-700442	30	NZ_CP052119	Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence	616485-616514	8	0.733
LR134275_1	1.4\|700611\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700611-700640	30	NZ_LR214939	Mycoplasma salivarium strain NCTC10113 plasmid 2	515477-515506	8	0.733
LR134275_1	1.4\|700611\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700611-700640	30	AP013738	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C40-MedDCM-OCT-S40-C68, * SEQUENCING IN PROGRESS *	16668-16697	8	0.733
LR134275_1	1.7\|700808\|31\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700808-700838	31	NZ_CP032366	Bacillus wiedmannii strain SR52 plasmid unnamed1, complete sequence	129443-129473	8	0.742
LR134275_1	1.9\|700941\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700941-700970	30	NZ_CP046704	Nostoc sp. ATCC 53789 plasmid pNsp_a, complete sequence	298320-298349	8	0.733
LR134275_1	1.1\|700413\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700413-700442	30	KF562340	Escherichia phage vB_EcoP_PhAPEC7, complete genome	5075-5104	9	0.7
LR134275_1	1.1\|700413\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700413-700442	30	MT682708	Escherichia phage vB_EcoP_SP5M, complete genome	6036-6065	9	0.7
LR134275_1	1.1\|700413\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700413-700442	30	KF192075	Escherichia phage vB_EcoP_PhAPEC5, complete genome	4595-4624	9	0.7
LR134275_1	1.4\|700611\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700611-700640	30	NZ_CP006909	Clostridium botulinum CDC_1436 plasmid pCBG, complete sequence	237506-237535	9	0.7
LR134275_1	1.4\|700611\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700611-700640	30	NC_012654	Clostridium botulinum Ba4 str. 657 plasmid pCLJ, complete sequence	2980-3009	9	0.7
LR134275_1	1.4\|700611\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700611-700640	30	NZ_CP031095	Clostridium botulinum strain CFSAN034200 plasmid p1_CDC51232, complete sequence	109152-109181	9	0.7
LR134275_1	1.8\|700875\|30\|LR134275\|PILER-CR,CRISPRCasFinder,CRT	700875-700904	30	MK448506	Streptococcus satellite phage Javan462, complete genome	6092-6121	9	0.7

1. spacer 1.6|700742|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MK448755 (Streptococcus phage Javan423, complete genome) position: , mismatch: 1, identity: 0.967

cagattggtttatcgaacaaggtcgcaagt	CRISPR spacer
cagactggtttatcgaacaaggtcgcaagt	Protospacer
****.*************************

2. spacer 1.6|700742|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MK448829 (Streptococcus phage Javan7, complete genome) position: , mismatch: 1, identity: 0.967

cagattggtttatcgaacaaggtcgcaagt	CRISPR spacer
cagactggtttatcgaacaaggtcgcaagt	Protospacer
****.*************************

3. spacer 1.6|700742|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MH853355 (Streptococcus phage LF1, complete genome) position: , mismatch: 1, identity: 0.967

cagattggtttatcgaacaaggtcgcaagt	CRISPR spacer
cagactggtttatcgaacaaggtcgcaagt	Protospacer
****.*************************

4. spacer 1.6|700742|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MK448756 (Streptococcus phage Javan425, complete genome) position: , mismatch: 1, identity: 0.967

cagattggtttatcgaacaaggtcgcaagt	CRISPR spacer
cagactggtttatcgaacaaggtcgcaagt	Protospacer
****.*************************

5. spacer 1.6|700742|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MH853358 (Streptococcus phage LF4, complete genome) position: , mismatch: 1, identity: 0.967

cagattggtttatcgaacaaggtcgcaagt	CRISPR spacer
cagactggtttatcgaacaaggtcgcaagt	Protospacer
****.*************************

6. spacer 1.6|700742|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to JX409895 (Streptococcus phage JX01, complete genome) position: , mismatch: 1, identity: 0.967

cagattggtttatcgaacaaggtcgcaagt	CRISPR spacer
cagactggtttatcgaacaaggtcgcaagt	Protospacer
****.*************************

7. spacer 1.7|700808|31|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MG708274 (Streptococcus phage vB_SthS_VA214, complete genome) position: , mismatch: 1, identity: 0.968

caaaagctgttggttaacggtgctttgggca	CRISPR spacer
caaaagctgttggttaacggtgctttgagca	Protospacer
***************************.***

8. spacer 1.7|700808|31|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MH937495 (Streptococcus phage CHPC1045, complete genome) position: , mismatch: 1, identity: 0.968

caaaagctgttggttaacggtgctttgggca	CRISPR spacer
caaaagctgttggttaacggtgctttgagca	Protospacer
***************************.***

9. spacer 1.7|700808|31|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MH937496 (Streptococcus phage CHPC1046, complete genome) position: , mismatch: 1, identity: 0.968

caaaagctgttggttaacggtgctttgggca	CRISPR spacer
caaaagctgttggttaacggtgctttgagca	Protospacer
***************************.***

10. spacer 1.7|700808|31|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MH937507 (Streptococcus phage CHPC1152, complete genome) position: , mismatch: 1, identity: 0.968

caaaagctgttggttaacggtgctttgggca	CRISPR spacer
caaaagctgttggttaacggtgctttgagca	Protospacer
***************************.***

11. spacer 1.7|700808|31|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to KY705273 (Streptococcus phage P7602, complete genome) position: , mismatch: 1, identity: 0.968

caaaagctgttggttaacggtgctttgggca	CRISPR spacer
caaaagctgttggttaacggtgctttgagca	Protospacer
***************************.***

12. spacer 1.7|700808|31|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MH892373 (Streptococcus phage SW27, complete genome) position: , mismatch: 1, identity: 0.968

caaaagctgttggttaacggtgctttgggca	CRISPR spacer
caaaagctgttggttaacggtgctttgagca	Protospacer
***************************.***

13. spacer 1.7|700808|31|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MF161328 (Streptococcus phage D4276, complete genome) position: , mismatch: 1, identity: 0.968

caaaagctgttggttaacggtgctttgggca	CRISPR spacer
caaaagctgttggttaacggtgctttgagca	Protospacer
***************************.***

14. spacer 1.7|700808|31|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to KX879642 (Streptococcus phage CHPC926, complete genome) position: , mismatch: 1, identity: 0.968

caaaagctgttggttaacggtgctttgggca	CRISPR spacer
caaaagctgttggttaacggtgctttgagca	Protospacer
***************************.***

15. spacer 1.7|700808|31|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to KY705270 (Streptococcus phage P7573, complete genome) position: , mismatch: 1, identity: 0.968

caaaagctgttggttaacggtgctttgggca	CRISPR spacer
caaaagctgttggttaacggtgctttgagca	Protospacer
***************************.***

16. spacer 1.7|700808|31|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MH937458 (Streptococcus phage CHPC572, complete genome) position: , mismatch: 1, identity: 0.968

caaaagctgttggttaacggtgctttgggca	CRISPR spacer
caaaagctgttggttaacggtgctttgagca	Protospacer
***************************.***

17. spacer 1.7|700808|31|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MH892353 (Streptococcus phage SW2, complete genome) position: , mismatch: 1, identity: 0.968

caaaagctgttggttaacggtgctttgggca	CRISPR spacer
caaaagctgttggttaacggtgctttgagca	Protospacer
***************************.***

18. spacer 1.7|700808|31|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MH937511 (Streptococcus phage CHPC1247, complete genome) position: , mismatch: 1, identity: 0.968

caaaagctgttggttaacggtgctttgggca	CRISPR spacer
caaaagctgttggttaacggtgctttgagca	Protospacer
***************************.***

19. spacer 1.7|700808|31|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to KY705277 (Streptococcus phage P7951, complete genome) position: , mismatch: 1, identity: 0.968

caaaagctgttggttaacggtgctttgggca	CRISPR spacer
caaaagctgttggttaacggtgctttgagca	Protospacer
***************************.***

20. spacer 1.7|700808|31|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to KY705252 (Streptococcus phage P0092, complete genome) position: , mismatch: 1, identity: 0.968

caaaagctgttggttaacggtgctttgggca	CRISPR spacer
caaaagctgttggttaacggtgctttgagca	Protospacer
***************************.***

21. spacer 1.7|700808|31|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MF580773 (Streptococcus phage STP1, complete genome) position: , mismatch: 1, identity: 0.968

caaaagctgttggttaacggtgctttgggca	CRISPR spacer
caaaagctgttggttaacggtgctttgagca	Protospacer
***************************.***

22. spacer 1.7|700808|31|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MH937480 (Streptococcus phage CHPC954, complete genome) position: , mismatch: 1, identity: 0.968

caaaagctgttggttaacggtgctttgggca	CRISPR spacer
caaaagctgttggttaacggtgctttgagca	Protospacer
***************************.***

23. spacer 1.7|700808|31|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MH937477 (Streptococcus phage CHPC950, complete genome) position: , mismatch: 1, identity: 0.968

caaaagctgttggttaacggtgctttgggca	CRISPR spacer
caaaagctgttggttaacggtgctttgagca	Protospacer
***************************.***

24. spacer 1.7|700808|31|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MH937467 (Streptococcus phage CHPC877, complete genome) position: , mismatch: 1, identity: 0.968

caaaagctgttggttaacggtgctttgggca	CRISPR spacer
caaaagctgttggttaacggtgctttgagca	Protospacer
***************************.***

25. spacer 1.7|700808|31|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MH937487 (Streptococcus phage CHPC1029, complete genome) position: , mismatch: 1, identity: 0.968

caaaagctgttggttaacggtgctttgggca	CRISPR spacer
caaaagctgttggttaacggtgctttgagca	Protospacer
***************************.***

26. spacer 1.7|700808|31|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MH937481 (Streptococcus phage CHPC979, complete genome) position: , mismatch: 1, identity: 0.968

caaaagctgttggttaacggtgctttgggca	CRISPR spacer
caaaagctgttggttaacggtgctttgagca	Protospacer
***************************.***

27. spacer 1.7|700808|31|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to KY705281 (Streptococcus phage P7955, complete genome) position: , mismatch: 1, identity: 0.968

caaaagctgttggttaacggtgctttgggca	CRISPR spacer
caaaagctgttggttaacggtgctttgagca	Protospacer
***************************.***

28. spacer 1.7|700808|31|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MH973661 (Streptococcus phage SW5, complete genome) position: , mismatch: 1, identity: 0.968

caaaagctgttggttaacggtgctttgggca	CRISPR spacer
caaaagctgttggttaacggtgctttgagca	Protospacer
***************************.***

29. spacer 1.7|700808|31|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MH937485 (Streptococcus phage CHPC1014, complete genome) position: , mismatch: 1, identity: 0.968

caaaagctgttggttaacggtgctttgggca	CRISPR spacer
caaaagctgttggttaacggtgctttgagca	Protospacer
***************************.***

30. spacer 1.7|700808|31|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MF580774 (Streptococcus phage STP2, complete genome) position: , mismatch: 1, identity: 0.968

caaaagctgttggttaacggtgctttgggca	CRISPR spacer
caaaagctgttggttaacggtgctttgagca	Protospacer
***************************.***

31. spacer 1.7|700808|31|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MH937497 (Streptococcus phage CHPC1048, complete genome) position: , mismatch: 1, identity: 0.968

caaaagctgttggttaacggtgctttgggca	CRISPR spacer
caaaagctgttggttaacggtgctttgagca	Protospacer
***************************.***

32. spacer 1.7|700808|31|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MH973663 (Streptococcus phage SW24, complete genome) position: , mismatch: 1, identity: 0.968

caaaagctgttggttaacggtgctttgggca	CRISPR spacer
caaaagctgttggttaacggtgctttgagca	Protospacer
***************************.***

33. spacer 1.7|700808|31|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to KY705262 (Streptococcus phage P7132, complete genome) position: , mismatch: 1, identity: 0.968

caaaagctgttggttaacggtgctttgggca	CRISPR spacer
caaaagctgttggttaacggtgctttgagca	Protospacer
***************************.***

34. spacer 1.7|700808|31|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MH937491 (Streptococcus phage CHPC1037, partial genome) position: , mismatch: 1, identity: 0.968

caaaagctgttggttaacggtgctttgggca	CRISPR spacer
caaaagctgttggttaacggtgctttgagca	Protospacer
***************************.***

35. spacer 1.7|700808|31|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MH892352 (Streptococcus phage SW1, complete genome) position: , mismatch: 1, identity: 0.968

caaaagctgttggttaacggtgctttgggca	CRISPR spacer
caaaagctgttggttaacggtgctttgagca	Protospacer
***************************.***

36. spacer 1.9|700941|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MF580775 (Streptococcus phage V2, complete genome) position: , mismatch: 1, identity: 0.967

gaaataaactgcccaaacatttttattttc	CRISPR spacer
gaaataaaccgcccaaacatttttattttc	Protospacer
*********.********************

37. spacer 1.9|700941|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to KY705255 (Streptococcus phage P0095, complete genome) position: , mismatch: 1, identity: 0.967

gaaataaactgcccaaacatttttattttc	CRISPR spacer
gaaataaaccgcccaaacatttttattttc	Protospacer
*********.********************

38. spacer 1.9|700941|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MF580769 (Streptococcus phage L5A1, complete genome) position: , mismatch: 1, identity: 0.967

gaaataaactgcccaaacatttttattttc	CRISPR spacer
gaaataaaccgcccaaacatttttattttc	Protospacer
*********.********************

39. spacer 1.9|700941|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MF580762 (Streptococcus phage 9B4, complete genome) position: , mismatch: 1, identity: 0.967

gaaataaactgcccaaacatttttattttc	CRISPR spacer
gaaataaaccgcccaaacatttttattttc	Protospacer
*********.********************

40. spacer 1.9|700941|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MH937458 (Streptococcus phage CHPC572, complete genome) position: , mismatch: 1, identity: 0.967

gaaataaactgcccaaacatttttattttc	CRISPR spacer
gaaataaaccgcccaaacatttttattttc	Protospacer
*********.********************

41. spacer 1.9|700941|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MF580760 (Streptococcus phage 7T, complete genome) position: , mismatch: 1, identity: 0.967

gaaataaactgcccaaacatttttattttc	CRISPR spacer
gaaataaaccgcccaaacatttttattttc	Protospacer
*********.********************

42. spacer 1.9|700941|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MF580768 (Streptococcus phage C0, complete genome) position: , mismatch: 1, identity: 0.967

gaaataaactgcccaaacatttttattttc	CRISPR spacer
gaaataaaccgcccaaacatttttattttc	Protospacer
*********.********************

43. spacer 1.9|700941|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MF580773 (Streptococcus phage STP1, complete genome) position: , mismatch: 1, identity: 0.967

gaaataaactgcccaaacatttttattttc	CRISPR spacer
gaaataaaccgcccaaacatttttattttc	Protospacer
*********.********************

44. spacer 1.9|700941|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MH892359 (Streptococcus phage SW10, complete genome) position: , mismatch: 1, identity: 0.967

gaaataaactgcccaaacatttttattttc	CRISPR spacer
gaaataaaccgcccaaacatttttattttc	Protospacer
*********.********************

45. spacer 1.9|700941|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MF580766 (Streptococcus phage B0, complete genome) position: , mismatch: 1, identity: 0.967

gaaataaactgcccaaacatttttattttc	CRISPR spacer
gaaataaaccgcccaaacatttttattttc	Protospacer
*********.********************

46. spacer 1.9|700941|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MF580763 (Streptococcus phage 16B8, complete genome) position: , mismatch: 1, identity: 0.967

gaaataaactgcccaaacatttttattttc	CRISPR spacer
gaaataaaccgcccaaacatttttattttc	Protospacer
*********.********************

47. spacer 1.9|700941|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MH892358 (Streptococcus phage SW9, complete genome) position: , mismatch: 1, identity: 0.967

gaaataaactgcccaaacatttttattttc	CRISPR spacer
gaaataaaccgcccaaacatttttattttc	Protospacer
*********.********************

48. spacer 1.9|700941|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MF580772 (Streptococcus phage R1, complete genome) position: , mismatch: 1, identity: 0.967

gaaataaactgcccaaacatttttattttc	CRISPR spacer
gaaataaaccgcccaaacatttttattttc	Protospacer
*********.********************

49. spacer 1.9|700941|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MF580774 (Streptococcus phage STP2, complete genome) position: , mismatch: 1, identity: 0.967

gaaataaactgcccaaacatttttattttc	CRISPR spacer
gaaataaaccgcccaaacatttttattttc	Protospacer
*********.********************

50. spacer 1.9|700941|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MF580764 (Streptococcus phage 31B4, complete genome) position: , mismatch: 1, identity: 0.967

gaaataaactgcccaaacatttttattttc	CRISPR spacer
gaaataaaccgcccaaacatttttattttc	Protospacer
*********.********************

51. spacer 1.9|700941|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MF580765 (Streptococcus phage A0, complete genome) position: , mismatch: 1, identity: 0.967

gaaataaactgcccaaacatttttattttc	CRISPR spacer
gaaataaaccgcccaaacatttttattttc	Protospacer
*********.********************

52. spacer 1.9|700941|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MF580759 (Streptococcus phage 7A5, complete genome) position: , mismatch: 1, identity: 0.967

gaaataaactgcccaaacatttttattttc	CRISPR spacer
gaaataaaccgcccaaacatttttattttc	Protospacer
*********.********************

53. spacer 1.9|700941|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MH892352 (Streptococcus phage SW1, complete genome) position: , mismatch: 1, identity: 0.967

gaaataaactgcccaaacatttttattttc	CRISPR spacer
gaaataaaccgcccaaacatttttattttc	Protospacer
*********.********************

54. spacer 1.9|700941|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MF580767 (Streptococcus phage B5, complete genome) position: , mismatch: 1, identity: 0.967

gaaataaactgcccaaacatttttattttc	CRISPR spacer
gaaataaaccgcccaaacatttttattttc	Protospacer
*********.********************

55. spacer 1.3|700545|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MK202161 (Streptococcus phage CHPC1282, complete genome) position: , mismatch: 2, identity: 0.933

aatctttaaccggattgtagaaccgttcgg	CRISPR spacer
aatctttaactggattgtagaaccgttcag	Protospacer
**********.*****************.*

56. spacer 1.3|700545|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MH892351 (Streptococcus phage SW6, complete genome) position: , mismatch: 2, identity: 0.933

aatctttaaccggattgtagaaccgttcgg	CRISPR spacer
aatctttaactggattgtagaaccgttccg	Protospacer
**********.***************** *

57. spacer 1.3|700545|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MH892375 (Streptococcus phage SW30, complete genome) position: , mismatch: 2, identity: 0.933

aatctttaaccggattgtagaaccgttcgg	CRISPR spacer
aatctttaactggattgtagaaccgttccg	Protospacer
**********.***************** *

58. spacer 1.4|700611|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to NC_008501 (Streptococcus thermophilus LMD-9 plasmid 2, complete sequence) position: , mismatch: 2, identity: 0.933

tgcctttaaaataactagattttaccatca	CRISPR spacer
cacctttaaaataactagattttaccatca	Protospacer
..****************************

59. spacer 1.4|700611|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to NC_019231 (Streptococcus thermophilus plasmid pK1002C2, complete sequence) position: , mismatch: 2, identity: 0.933

tgcctttaaaataactagattttaccatca	CRISPR spacer
cacctttaaaataactagattttaccatca	Protospacer
..****************************

60. spacer 1.4|700611|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to NC_019232 (Streptococcus thermophilus plasmid pK2007C6, complete sequence) position: , mismatch: 2, identity: 0.933

tgcctttaaaataactagattttaccatca	CRISPR spacer
cacctttaaaataactagattttaccatca	Protospacer
..****************************

61. spacer 1.6|700742|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MH937504 (Streptococcus phage CHPC1091, complete genome) position: , mismatch: 2, identity: 0.933

cagattggtttatcgaacaaggtcgcaagt	CRISPR spacer
cagattggtttattgagcaaggtcgcaagt	Protospacer
*************.**.*************

62. spacer 1.6|700742|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MH892385 (Streptococcus phage SW33, complete genome) position: , mismatch: 2, identity: 0.933

cagattggtttatcgaacaaggtcgcaagt	CRISPR spacer
cagattggtttattgagcaaggtcgcaagt	Protospacer
*************.**.*************

63. spacer 1.6|700742|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to NC_000872 (Streptococcus phage Sfi21, complete genome) position: , mismatch: 2, identity: 0.933

cagattggtttatcgaacaaggtcgcaagt	CRISPR spacer
cagattggtttattgagcaaggtcgcaagt	Protospacer
*************.**.*************

64. spacer 1.6|700742|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MH937460 (Streptococcus phage CHPC640, complete genome) position: , mismatch: 2, identity: 0.933

cagattggtttatcgaacaaggtcgcaagt	CRISPR spacer
cagattggtttattgagcaaggtcgcaagt	Protospacer
*************.**.*************

65. spacer 1.6|700742|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MH892384 (Streptococcus phage SW32, complete genome) position: , mismatch: 2, identity: 0.933

cagattggtttatcgaacaaggtcgcaagt	CRISPR spacer
cagattggtttattgagcaaggtcgcaagt	Protospacer
*************.**.*************

66. spacer 1.6|700742|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to KY705256 (Streptococcus phage P3681, complete genome) position: , mismatch: 2, identity: 0.933

cagattggtttatcgaacaaggtcgcaagt	CRISPR spacer
cagattggtttattgagcaaggtcgcaagt	Protospacer
*************.**.*************

67. spacer 1.6|700742|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MH937493 (Streptococcus phage CHPC1041, complete genome) position: , mismatch: 2, identity: 0.933

cagattggtttatcgaacaaggtcgcaagt	CRISPR spacer
cagattggtttattgagcaaggtcgcaagt	Protospacer
*************.**.*************

68. spacer 1.6|700742|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MH892376 (Streptococcus phage SW1151, complete genome) position: , mismatch: 2, identity: 0.933

cagattggtttatcgaacaaggtcgcaagt	CRISPR spacer
cagattggtttattgagcaaggtcgcaagt	Protospacer
*************.**.*************

69. spacer 1.6|700742|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to NC_000871 (Streptococcus phage Sfi19, complete genome) position: , mismatch: 2, identity: 0.933

cagattggtttatcgaacaaggtcgcaagt	CRISPR spacer
cagattggtttattgagcaaggtcgcaagt	Protospacer
*************.**.*************

70. spacer 1.6|700742|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to AF004379 (Streptococcus thermophilus bacteriophage Sfi21 DNA replication module) position: , mismatch: 2, identity: 0.933

cagattggtttatcgaacaaggtcgcaagt	CRISPR spacer
cagattggtttattgagcaaggtcgcaagt	Protospacer
*************.**.*************

71. spacer 1.6|700742|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MH937492 (Streptococcus phage CHPC1040, complete genome) position: , mismatch: 2, identity: 0.933

cagattggtttatcgaacaaggtcgcaagt	CRISPR spacer
cagattggtttattgagcaaggtcgcaagt	Protospacer
*************.**.*************

72. spacer 1.6|700742|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to U88974 (Streptococcus thermophilus temperate bacteriophage O1205, complete genome) position: , mismatch: 2, identity: 0.933

cagattggtttatcgaacaaggtcgcaagt	CRISPR spacer
cagattggtttattgagcaaggtcgcaagt	Protospacer
*************.**.*************

73. spacer 1.6|700742|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to AF158601 (Streptococcus thermophilus bacteriophage SFi18 lysin, gp111, gp183, gp47, gp54, gp71, gp145, gp69, gp40, gp229, gp157, gp233, putative helicase, gp151, gp271, putative primase, gp143, gp106, gp89, gp57, gp51, gp66, gp192, putative DNA binding protein, gp99, and gp235 genes, complete cds) position: , mismatch: 2, identity: 0.933

cagattggtttatcgaacaaggtcgcaagt	CRISPR spacer
cagattggtttattgagcaaggtcgcaagt	Protospacer
*************.**.*************

74. spacer 1.6|700742|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MH937463 (Streptococcus phage CHPC676, complete genome) position: , mismatch: 2, identity: 0.933

cagattggtttatcgaacaaggtcgcaagt	CRISPR spacer
cagattggtttattgagcaaggtcgcaagt	Protospacer
*************.**.*************

75. spacer 1.6|700742|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to KY705263 (Streptococcus phage P7133, complete genome) position: , mismatch: 2, identity: 0.933

cagattggtttatcgaacaaggtcgcaagt	CRISPR spacer
cagattggtttattgagcaaggtcgcaagt	Protospacer
*************.**.*************

76. spacer 1.6|700742|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to KY705278 (Streptococcus phage P7952, complete genome) position: , mismatch: 2, identity: 0.933

cagattggtttatcgaacaaggtcgcaagt	CRISPR spacer
cagattggtttattgagcaaggtcgcaagt	Protospacer
*************.**.*************

77. spacer 1.6|700742|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MH892357 (Streptococcus phage SW8, complete genome) position: , mismatch: 2, identity: 0.933

cagattggtttatcgaacaaggtcgcaagt	CRISPR spacer
cagattggtttattgagcaaggtcgcaagt	Protospacer
*************.**.*************

78. spacer 1.6|700742|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to AF115103 (Streptococcus thermophilus bacteriophage Sfi21, complete genome) position: , mismatch: 2, identity: 0.933

cagattggtttatcgaacaaggtcgcaagt	CRISPR spacer
cagattggtttattgagcaaggtcgcaagt	Protospacer
*************.**.*************

79. spacer 1.6|700742|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to NC_004303 (Streptococcus phage O1205, complete genome) position: , mismatch: 2, identity: 0.933

cagattggtttatcgaacaaggtcgcaagt	CRISPR spacer
cagattggtttattgagcaaggtcgcaagt	Protospacer
*************.**.*************

80. spacer 1.6|700742|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to AF115102 (Streptococcus thermophilus bacteriophage Sfi19, complete genome) position: , mismatch: 2, identity: 0.933

cagattggtttatcgaacaaggtcgcaagt	CRISPR spacer
cagattggtttattgagcaaggtcgcaagt	Protospacer
*************.**.*************

81. spacer 1.6|700742|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to AF077306 (Streptococcus thermophilus bacteriophage Sfi19 gp157, gp233, putative helicase, gp151, gp271, putative primase, and gp143 genes, complete cds) position: , mismatch: 2, identity: 0.933

cagattggtttatcgaacaaggtcgcaagt	CRISPR spacer
cagattggtttattgagcaaggtcgcaagt	Protospacer
*************.**.*************

82. spacer 1.6|700742|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MH892383 (Streptococcus phage SW31, complete genome) position: , mismatch: 2, identity: 0.933

cagattggtttatcgaacaaggtcgcaagt	CRISPR spacer
cagattggtttattgagcaaggtcgcaagt	Protospacer
*************.**.*************

83. spacer 1.6|700742|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to KY705280 (Streptococcus phage P7954, complete genome) position: , mismatch: 2, identity: 0.933

cagattggtttatcgaacaaggtcgcaagt	CRISPR spacer
cagattggtttattgagcaaggtcgcaagt	Protospacer
*************.**.*************

84. spacer 1.6|700742|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to NC_002214 (Streptococcus thermophilus bacteriophage Sfi11, complete genome) position: , mismatch: 2, identity: 0.933

cagattggtttatcgaacaaggtcgcaagt	CRISPR spacer
cagattggtttattgagcaaggtcgcaagt	Protospacer
*************.**.*************

85. spacer 1.6|700742|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to KY705279 (Streptococcus phage P7953, complete genome) position: , mismatch: 2, identity: 0.933

cagattggtttatcgaacaaggtcgcaagt	CRISPR spacer
cagattggtttattgagcaaggtcgcaagt	Protospacer
*************.**.*************

86. spacer 1.6|700742|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MH892362 (Streptococcus phage SW13, complete genome) position: , mismatch: 2, identity: 0.933

cagattggtttatcgaacaaggtcgcaagt	CRISPR spacer
cagattggtttattgagcaaggtcgcaagt	Protospacer
*************.**.*************

87. spacer 1.6|700742|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MH937502 (Streptococcus phage CHPC1083, complete genome) position: , mismatch: 2, identity: 0.933

cagattggtttatcgaacaaggtcgcaagt	CRISPR spacer
cagattggtttattgagcaaggtcgcaagt	Protospacer
*************.**.*************

88. spacer 1.6|700742|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MH937469 (Streptococcus phage CHPC919, complete genome) position: , mismatch: 2, identity: 0.933

cagattggtttatcgaacaaggtcgcaagt	CRISPR spacer
cagattggtttattgagcaaggtcgcaagt	Protospacer
*************.**.*************

89. spacer 1.6|700742|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MH937478 (Streptococcus phage CHPC951, complete genome) position: , mismatch: 2, identity: 0.933

cagattggtttatcgaacaaggtcgcaagt	CRISPR spacer
cagattggtttattgagcaaggtcgcaagt	Protospacer
*************.**.*************

90. spacer 1.6|700742|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to KY705257 (Streptococcus phage P3684, complete genome) position: , mismatch: 2, identity: 0.933

cagattggtttatcgaacaaggtcgcaagt	CRISPR spacer
cagattggtttattgagcaaggtcgcaagt	Protospacer
*************.**.*************

91. spacer 1.7|700808|31|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to KY705259 (Streptococcus phage P5641, complete genome) position: , mismatch: 2, identity: 0.935

caaaagctgttggttaacggtgctttgggca	CRISPR spacer
caaaagctgttggttaacggtactttgagca	Protospacer
*********************.*****.***

92. spacer 1.7|700808|31|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MH937471 (Streptococcus phage CHPC927, complete genome) position: , mismatch: 2, identity: 0.935

caaaagctgttggttaacggtgctttgggca	CRISPR spacer
caaaagctgttggttaacagtgctttgagca	Protospacer
******************.********.***

93. spacer 1.7|700808|31|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MH937499 (Streptococcus phage CHPC1062, complete genome) position: , mismatch: 2, identity: 0.935

caaaagctgttggttaacggtgctttgggca	CRISPR spacer
caaaagctgttggttaacggtactttgagca	Protospacer
*********************.*****.***

94. spacer 1.9|700941|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MF580770 (Streptococcus phage M19, complete genome) position: , mismatch: 2, identity: 0.933

gaaataaactgcccaaacatttttattttc	CRISPR spacer
gaaataaaccgcccaaacatttttattttt	Protospacer
*********.*******************.

95. spacer 1.9|700941|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MH892371 (Streptococcus phage SW25, complete genome) position: , mismatch: 2, identity: 0.933

gaaataaactgcccaaacatttttattttc	CRISPR spacer
gaaataaaccgcccaaacatttttattttt	Protospacer
*********.*******************.

96. spacer 1.9|700941|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MH892372 (Streptococcus phage SW26, complete genome) position: , mismatch: 2, identity: 0.933

gaaataaactgcccaaacatttttattttc	CRISPR spacer
gaaataaaccgcccaaacatttttattttt	Protospacer
*********.*******************.

97. spacer 1.9|700941|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MH892368 (Streptococcus phage SW20, complete genome) position: , mismatch: 2, identity: 0.933

gaaataaactgcccaaacatttttattttc	CRISPR spacer
gaaataaaccgcccaaacatttttattttt	Protospacer
*********.*******************.

98. spacer 1.9|700941|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MH937471 (Streptococcus phage CHPC927, complete genome) position: , mismatch: 2, identity: 0.933

gaaataaactgcccaaacatttttattttc	CRISPR spacer
aaaataaaccgcccaaacatttttattttc	Protospacer
.********.********************

99. spacer 1.9|700941|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to KU678389 (Streptococcus virus 9871, complete genome) position: , mismatch: 2, identity: 0.933

gaaataaactgcccaaacatttttattttc	CRISPR spacer
gaaataaaccgcccaaacatttttattttt	Protospacer
*********.*******************.

100. spacer 1.9|700941|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MH892350 (Streptococcus phage SW16, complete genome) position: , mismatch: 2, identity: 0.933

gaaataaactgcccaaacatttttattttc	CRISPR spacer
gaaataaaccgcccaaacatttttattttt	Protospacer
*********.*******************.

101. spacer 1.9|700941|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MH892374 (Streptococcus phage SW28, complete genome) position: , mismatch: 2, identity: 0.933

gaaataaactgcccaaacatttttattttc	CRISPR spacer
gaaataaaccgcccaaacatttttattttt	Protospacer
*********.*******************.

102. spacer 1.9|700941|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to KU678391 (Streptococcus virus 9873, complete genome) position: , mismatch: 2, identity: 0.933

gaaataaactgcccaaacatttttattttc	CRISPR spacer
gaaataaaccgcccaaacatttttattttt	Protospacer
*********.*******************.

103. spacer 1.9|700941|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MH937467 (Streptococcus phage CHPC877, complete genome) position: , mismatch: 2, identity: 0.933

gaaataaactgcccaaacatttttattttc	CRISPR spacer
aaaataaaccgcccaaacatttttattttc	Protospacer
.********.********************

104. spacer 1.9|700941|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MH892369 (Streptococcus phage SW22, complete genome) position: , mismatch: 2, identity: 0.933

gaaataaactgcccaaacatttttattttc	CRISPR spacer
gaaataaaccgcccaaacatttttattttt	Protospacer
*********.*******************.

105. spacer 1.9|700941|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to NC_031094 (Streptococcus virus 9872, complete genome) position: , mismatch: 2, identity: 0.933

gaaataaactgcccaaacatttttattttc	CRISPR spacer
gaaataaaccgcccaaacatttttattttt	Protospacer
*********.*******************.

106. spacer 1.9|700941|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MH892370 (Streptococcus phage SW23, complete genome) position: , mismatch: 2, identity: 0.933

gaaataaactgcccaaacatttttattttc	CRISPR spacer
gaaataaaccgcccaaacatttttattttt	Protospacer
*********.*******************.

107. spacer 1.9|700941|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MH892354 (Streptococcus phage SW3, complete genome) position: , mismatch: 2, identity: 0.933

gaaataaactgcccaaacatttttattttc	CRISPR spacer
gaaataaaccgcccaaacatttttattttt	Protospacer
*********.*******************.

108. spacer 1.9|700941|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MH892365 (Streptococcus phage SW17, complete genome) position: , mismatch: 2, identity: 0.933

gaaataaactgcccaaacatttttattttc	CRISPR spacer
gaaataaaccgcccaaacatttttattttt	Protospacer
*********.*******************.

109. spacer 1.6|700742|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MK448970 (Streptococcus phage Javan516, complete genome) position: , mismatch: 3, identity: 0.9

cagattggtttatcgaacaaggtcgcaagt	CRISPR spacer
cagactggtttatcgaacaaggtcgtaaat	Protospacer
****.********************.**.*

110. spacer 1.6|700742|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MK448953 (Streptococcus phage Javan474, complete genome) position: , mismatch: 3, identity: 0.9

cagattggtttatcgaacaaggtcgcaagt	CRISPR spacer
cagactggtttatcgaacaaggtcgtaaat	Protospacer
****.********************.**.*

111. spacer 1.6|700742|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MK448945 (Streptococcus phage Javan454, complete genome) position: , mismatch: 3, identity: 0.9

cagattggtttatcgaacaaggtcgcaagt	CRISPR spacer
cagactggtttatcgaacaaggtcgtaaat	Protospacer
****.********************.**.*

112. spacer 1.6|700742|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MK448941 (Streptococcus phage Javan446, complete genome) position: , mismatch: 3, identity: 0.9

cagattggtttatcgaacaaggtcgcaagt	CRISPR spacer
cagactggtttatcgaacaaggtcgtaaat	Protospacer
****.********************.**.*

113. spacer 1.6|700742|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MK448957 (Streptococcus phage Javan484, complete genome) position: , mismatch: 3, identity: 0.9

cagattggtttatcgaacaaggtcgcaagt	CRISPR spacer
cagactggtttatcgaacaaggtcgtaaat	Protospacer
****.********************.**.*

114. spacer 1.6|700742|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to NC_028666 (Streptococcus phage Str-PAP-1, complete genome) position: , mismatch: 3, identity: 0.9

cagattggtttatcgaacaaggtcgcaagt	CRISPR spacer
ctgactggtttatcgaacaaggtcgtaagt	Protospacer
* **.********************.****

115. spacer 1.4|700611|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to NC_001757 (Lactobacillus reuteri 100-23 plasmid pGT232, complete sequence) position: , mismatch: 5, identity: 0.833

tgcctt--taaaataactagattttaccatca	CRISPR spacer
--ccttagaaaaataactagatttcaccatta	Protospacer
  ****   ***************.*****.*

116. spacer 1.4|700611|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP021504 (Lactobacillus plantarum strain SRCM102022 plasmid pPL2022-3 sequence) position: , mismatch: 6, identity: 0.8

tgcctttaaaataactagattttaccatca	CRISPR spacer
ccccggtaaaataactagattttacaaaca	Protospacer
. **  ******************* * **

117. spacer 1.4|700611|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP021504 (Lactobacillus plantarum strain SRCM102022 plasmid pPL2022-3 sequence) position: , mismatch: 6, identity: 0.8

tgcctttaaaataactagattttaccatca	CRISPR spacer
ccccggtaaaataactagattttacaaaca	Protospacer
. **  ******************* * **

118. spacer 1.4|700611|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP012654 (Lactobacillus plantarum strain HFC8 isolate Lactobacillus plantarum plasmid pMK10, complete sequence) position: , mismatch: 6, identity: 0.8

tgcctttaaaataactagattttaccatca	CRISPR spacer
ccccggtaaaataactagattttacaaaca	Protospacer
. **  ******************* * **

119. spacer 1.4|700611|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP012654 (Lactobacillus plantarum strain HFC8 isolate Lactobacillus plantarum plasmid pMK10, complete sequence) position: , mismatch: 6, identity: 0.8

tgcctttaaaataactagattttaccatca	CRISPR spacer
ccccggtaaaataactagattttacaaaca	Protospacer
. **  ******************* * **

120. spacer 1.4|700611|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP015127 (Lactobacillus plantarum strain CAUH2 plasmid pCAUH201, complete sequence) position: , mismatch: 6, identity: 0.8

tgcctttaaaataactagattttaccatca	CRISPR spacer
ccccggtaaaataactagattttacaaaca	Protospacer
. **  ******************* * **

121. spacer 1.4|700611|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to NC_011136 (Lactobacillus plantarum plasmid pLR1, complete sequence) position: , mismatch: 6, identity: 0.8

tgcctttaaaataactagattttaccatca	CRISPR spacer
ccccggtaaaataactagattttacaaaca	Protospacer
. **  ******************* * **

122. spacer 1.4|700611|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP012100 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-1, complete sequence) position: , mismatch: 6, identity: 0.8

tgcctttaaaataactagattttaccatca--	CRISPR spacer
tgcctttaaactaactatatttt--tattatg	Protospacer
********** ****** *****  .**.*

123. spacer 1.4|700611|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP029455 (Bacillus cereus strain FORC087 plasmid pFORC087.1, complete sequence) position: , mismatch: 6, identity: 0.8

tgcctttaaaataactagattttaccatca--	CRISPR spacer
tgcctttaaactaactatatttt--tattatg	Protospacer
********** ****** *****  .**.*

124. spacer 1.4|700611|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022346 (Bacillus thuringiensis strain c25 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

tgcctttaaaataactagattttaccatca--	CRISPR spacer
tgcctttaaactaactatatttt--tattatg	Protospacer
********** ****** *****  .**.*

125. spacer 1.2|700479|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP011515 (Mitsuaria sp. 7 plasmid, complete sequence) position: , mismatch: 7, identity: 0.767

ggacatcgaacaagtcaatgccgtaagctt	CRISPR spacer
ggacatcgaacaaatcaatgcgatcggcaa	Protospacer
*************.******* .* .**

126. spacer 1.4|700611|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP046704 (Nostoc sp. ATCC 53789 plasmid pNsp_a, complete sequence) position: , mismatch: 7, identity: 0.767

tgcctttaaaataactagattttaccatca	CRISPR spacer
aaagcttaaaataactagatttttcaatca	Protospacer
 .  .****************** * ****

127. spacer 1.5|700677|29|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP011641 (Serratia marcescens strain CAV1492 plasmid pCAV1492-199, complete sequence) position: , mismatch: 7, identity: 0.759

gagcaagcacaagcaagctttactatcct	CRISPR spacer
gagcaagcgcaagcaacctttactggata	Protospacer
********.******* *******.  .

128. spacer 1.6|700742|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to NC_048066 (Vibrio phage 1.202.O._10N.222.45.E8, partial genome) position: , mismatch: 7, identity: 0.767

cagattggtttatcgaacaaggtcgcaagt	CRISPR spacer
aagattggtttatcgaagaaggtttcttgg	Protospacer
 **************** *****. *  *

129. spacer 1.9|700941|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP043832 (Bacillus sp. BS98 plasmid unnamed2) position: , mismatch: 7, identity: 0.767

---gaaataaactgcccaaacatttttattttc	CRISPR spacer
tccgattt---ttgcccaaatatttttattttc	Protospacer
   **  *   .********.************

130. spacer 1.9|700941|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP020434 (Bacillus sp. FDAARGOS_235 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.767

---gaaataaactgcccaaacatttttattttc	CRISPR spacer
tccgattt---ttgcccaaatatttttattttc	Protospacer
   **  *   .********.************

131. spacer 1.1|700413|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP016915 (Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

ttcccagtcgttgatttttattgaataccc	CRISPR spacer
ggctaagtcgttgatttttatggaatcagc	Protospacer
  *. **************** ****   *

132. spacer 1.1|700413|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP023017 (Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

ttcccagtcgttgatttttattgaataccc	CRISPR spacer
ggctaagtcgttgatttttatggaatcagc	Protospacer
  *. **************** ****   *

133. spacer 1.1|700413|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022781 (Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

ttcccagtcgttgatttttattgaataccc	CRISPR spacer
ggctaagtcgttgatttttatggaatcagc	Protospacer
  *. **************** ****   *

134. spacer 1.1|700413|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP015116 (Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

ttcccagtcgttgatttttattgaataccc	CRISPR spacer
ggctaagtcgttgatttttatggaatcagc	Protospacer
  *. **************** ****   *

135. spacer 1.1|700413|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP016555 (Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence) position: , mismatch: 8, identity: 0.733

ttcccagtcgttgatttttattgaataccc	CRISPR spacer
ggctaagtcgttgatttttatggaatcagc	Protospacer
  *. **************** ****   *

136. spacer 1.1|700413|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052071 (Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.733

ttcccagtcgttgatttttattgaataccc	CRISPR spacer
ggctaagtcgttgatttttatggaatcagc	Protospacer
  *. **************** ****   *

137. spacer 1.1|700413|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052075 (Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.733

ttcccagtcgttgatttttattgaataccc	CRISPR spacer
ggctaagtcgttgatttttatggaatcagc	Protospacer
  *. **************** ****   *

138. spacer 1.1|700413|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052095 (Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.733

ttcccagtcgttgatttttattgaataccc	CRISPR spacer
ggctaagtcgttgatttttatggaatcagc	Protospacer
  *. **************** ****   *

139. spacer 1.1|700413|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052105 (Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.733

ttcccagtcgttgatttttattgaataccc	CRISPR spacer
ggctaagtcgttgatttttatggaatcagc	Protospacer
  *. **************** ****   *

140. spacer 1.1|700413|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052097 (Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.733

ttcccagtcgttgatttttattgaataccc	CRISPR spacer
ggctaagtcgttgatttttatggaatcagc	Protospacer
  *. **************** ****   *

141. spacer 1.1|700413|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052115 (Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.733

ttcccagtcgttgatttttattgaataccc	CRISPR spacer
ggctaagtcgttgatttttatggaatcagc	Protospacer
  *. **************** ****   *

142. spacer 1.1|700413|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052093 (Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.733

ttcccagtcgttgatttttattgaataccc	CRISPR spacer
ggctaagtcgttgatttttatggaatcagc	Protospacer
  *. **************** ****   *

143. spacer 1.1|700413|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052101 (Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.733

ttcccagtcgttgatttttattgaataccc	CRISPR spacer
ggctaagtcgttgatttttatggaatcagc	Protospacer
  *. **************** ****   *

144. spacer 1.1|700413|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052099 (Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.733

ttcccagtcgttgatttttattgaataccc	CRISPR spacer
ggctaagtcgttgatttttatggaatcagc	Protospacer
  *. **************** ****   *

145. spacer 1.1|700413|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052107 (Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.733

ttcccagtcgttgatttttattgaataccc	CRISPR spacer
ggctaagtcgttgatttttatggaatcagc	Protospacer
  *. **************** ****   *

146. spacer 1.1|700413|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052117 (Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.733

ttcccagtcgttgatttttattgaataccc	CRISPR spacer
ggctaagtcgttgatttttatggaatcagc	Protospacer
  *. **************** ****   *

147. spacer 1.1|700413|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022756 (Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

ttcccagtcgttgatttttattgaataccc	CRISPR spacer
ggctaagtcgttgatttttatggaatcagc	Protospacer
  *. **************** ****   *

148. spacer 1.1|700413|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052129 (Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.733

ttcccagtcgttgatttttattgaataccc	CRISPR spacer
ggctaagtcgttgatttttatggaatcagc	Protospacer
  *. **************** ****   *

149. spacer 1.1|700413|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052121 (Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.733

ttcccagtcgttgatttttattgaataccc	CRISPR spacer
ggctaagtcgttgatttttatggaatcagc	Protospacer
  *. **************** ****   *

150. spacer 1.1|700413|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052073 (Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.733

ttcccagtcgttgatttttattgaataccc	CRISPR spacer
ggctaagtcgttgatttttatggaatcagc	Protospacer
  *. **************** ****   *

151. spacer 1.1|700413|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052109 (Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.733

ttcccagtcgttgatttttattgaataccc	CRISPR spacer
ggctaagtcgttgatttttatggaatcagc	Protospacer
  *. **************** ****   *

152. spacer 1.1|700413|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052091 (Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.733

ttcccagtcgttgatttttattgaataccc	CRISPR spacer
ggctaagtcgttgatttttatggaatcagc	Protospacer
  *. **************** ****   *

153. spacer 1.1|700413|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052103 (Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.733

ttcccagtcgttgatttttattgaataccc	CRISPR spacer
ggctaagtcgttgatttttatggaatcagc	Protospacer
  *. **************** ****   *

154. spacer 1.1|700413|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052119 (Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.733

ttcccagtcgttgatttttattgaataccc	CRISPR spacer
ggctaagtcgttgatttttatggaatcagc	Protospacer
  *. **************** ****   *

155. spacer 1.4|700611|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to NZ_LR214939 (Mycoplasma salivarium strain NCTC10113 plasmid 2) position: , mismatch: 8, identity: 0.733

tgcctttaaaataactagattttaccatca	CRISPR spacer
aatcattaaaataactagatttttgcattg	Protospacer
 ..* ******************  ***..

156. spacer 1.4|700611|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to AP013738 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C40-MedDCM-OCT-S40-C68, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 8, identity: 0.733

tgcctttaaaataactagattttaccatca	CRISPR spacer
tgcctttaaaatatctaaattttctaaaac	Protospacer
************* ***.***** . *

157. spacer 1.7|700808|31|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032366 (Bacillus wiedmannii strain SR52 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

caaaagctgttggttaacggtgctttgggca	CRISPR spacer
gaaaagattttggttaacggtgctatcttct	Protospacer
 ***** * *************** *   *

158. spacer 1.9|700941|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP046704 (Nostoc sp. ATCC 53789 plasmid pNsp_a, complete sequence) position: , mismatch: 8, identity: 0.733

gaaataaactgcccaaacatttttattttc	CRISPR spacer
agctttttctgcccaagcatttttattttc	Protospacer
..  *   ********.*************

159. spacer 1.1|700413|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to KF562340 (Escherichia phage vB_EcoP_PhAPEC7, complete genome) position: , mismatch: 9, identity: 0.7

ttcccagtcgttgatttttattgaataccc	CRISPR spacer
gaggcagtaattgatttttattgaatagga	Protospacer
    **** .*****************

160. spacer 1.1|700413|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MT682708 (Escherichia phage vB_EcoP_SP5M, complete genome) position: , mismatch: 9, identity: 0.7

ttcccagtcgttgatttttattgaataccc	CRISPR spacer
gaggcagtaattgatttttattgaatagga	Protospacer
    **** .*****************

161. spacer 1.1|700413|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to KF192075 (Escherichia phage vB_EcoP_PhAPEC5, complete genome) position: , mismatch: 9, identity: 0.7

ttcccagtcgttgatttttattgaataccc	CRISPR spacer
gaggcagtaattgatttttattgaatagga	Protospacer
    **** .*****************

162. spacer 1.4|700611|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP006909 (Clostridium botulinum CDC_1436 plasmid pCBG, complete sequence) position: , mismatch: 9, identity: 0.7

tgcctttaaaataactagattttaccatca	CRISPR spacer
ataaattaaaataactagatattaacatag	Protospacer
     *************** *** *** .

163. spacer 1.4|700611|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to NC_012654 (Clostridium botulinum Ba4 str. 657 plasmid pCLJ, complete sequence) position: , mismatch: 9, identity: 0.7

tgcctttaaaataactagattttaccatca	CRISPR spacer
ataaattaaaataactagatattagcatag	Protospacer
     *************** *** *** .

164. spacer 1.4|700611|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP031095 (Clostridium botulinum strain CFSAN034200 plasmid p1_CDC51232, complete sequence) position: , mismatch: 9, identity: 0.7

tgcctttaaaataactagattttaccatca	CRISPR spacer
ataaattaaaataactagatattagcatag	Protospacer
     *************** *** *** .

165. spacer 1.8|700875|30|LR134275|PILER-CR,CRISPRCasFinder,CRT matches to MK448506 (Streptococcus satellite phage Javan462, complete genome) position: , mismatch: 9, identity: 0.7

cttgtttttcctctggggtctctgcgactt	CRISPR spacer
gttgtttttcctctggcgtctcagttttaa	Protospacer
 *************** ***** *.  .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

15466 : 90518

Streptococcus_phage(19.05%)

transposase,protease,tRNA

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
VED86508.1\|15466_16174_+\|transposase	transposase	NA	NA	NA	NA
VED86509.1\|23285_24116_+	rod shape-determining protein MreC	NA	NA	NA	NA
VED86510.1\|24117_24642_+	rod shape-determining protein MreD	NA	NA	NA	NA
VED86511.1\|24726_26127_+	glucan binding protein	NA	NA	NA	NA
VED86512.1\|26365_27559_-\|transposase	transposase	A0A1X9I619	Streptococcus_phage	4.8e-193	85.6
VED86513.1\|28229_29087_-\|transposase	transposase	A0A1S5SBP9	Streptococcus_phage	7.2e-82	54.7
VED86514.1\|29576_29852_-\|transposase	transposase	NA	NA	NA	NA
VED86515.1\|30106_31072_+	ribose-phosphate pyrophosphokinase	A0A2K9L2G2	Tupanvirus	1.5e-38	34.4
VED86516.1\|31113_32358_-\|transposase	IS1193 transposase	A0A1S5SBP9	Streptococcus_phage	9.4e-123	55.1
VED86517.1\|32569_33745_+	aromatic amino acid aminotransferase	NA	NA	NA	NA
VED86518.1\|33731_34505_+	DNA repair protein RecO	NA	NA	NA	NA
VED86519.1\|34680_35685_+	fatty acid/phospholipid synthesis protein PlsX	NA	NA	NA	NA
VED86520.1\|35684_35915_+	acyl carrier protein	NA	NA	NA	NA
VED86521.1\|36212_36920_+	phosphoribosylaminoimidazole-succinocarboxamide synthetase	A0A1D7SEW9	Cyanophage	3.0e-41	40.9
VED86522.1\|36975_40701_+	phosphoribosylformylglycinamidine synthase II (FGAM synthetase)	A6N228	Microbacterium_phage	1.6e-40	26.5
VED86523.1\|40869_42309_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	8.8e-56	35.2
VED86524.1\|42520_43543_+	phosphoribosylaminoimidazole synthetase	A0A1D7SE90	Cyanophage	1.4e-63	43.4
VED86525.1\|43727_44276_+	phosphoribosylglycinamide (GAR) formyltransferase	M4QRX9	Synechococcus_phage	1.2e-24	36.1
VED86526.1\|44275_45040_+	Uncharacterised protein	NA	NA	NA	NA
VED86527.1\|45049_46597_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	E3SNU8	Prochlorococcus_phage	9.4e-48	53.4
VED86528.1\|46789_47629_-	CHAP domain protein	A0A1S5PRY3	Streptococcus_phage	2.0e-07	35.8
VED86529.1\|47936_49199_+	phosphoribosylglycinamide synthetase	NA	NA	NA	NA
VED86530.1\|49397_49889_+	phosphoribosylaminoimidazole carboxylase catalytic subunit	A0A2P0VNU7	Tetraselmis_virus	5.5e-18	44.2
VED86531.1\|49875_50967_+	phosphoribosylaminoimidazole carboxylase ATPase subunit	NA	NA	NA	NA
VED86532.1\|50975_51275_+	Uncharacterised protein	NA	NA	NA	NA
VED86533.1\|51286_52144_+	Uncharacterised protein	NA	NA	NA	NA
VED86534.1\|52286_53741_+	Uncharacterised protein	NA	NA	NA	NA
VED86535.1\|53765_55064_+	adenylosuccinate lyase	A0A1B3B081	Gordonia_phage	2.9e-18	32.5
VED86536.1\|55943_57635_-\|tRNA	arginyl-tRNA synthetase	A0A2I2L3K1	Orpheovirus	1.4e-76	32.7
VED86537.1\|57792_58218_+	arginine repressor ArgR	NA	NA	NA	NA
VED86538.1\|58217_58577_+	membrane protein	NA	NA	NA	NA
VED86539.1\|58569_61128_+	DNA mismatch repair protein MutS	A0A2P0VN50	Tetraselmis_virus	5.7e-42	24.3
VED86540.1\|61161_61617_-	integral membrane protein	NA	NA	NA	NA
VED86541.1\|61613_62051_-	response regulator of the LytR/AlgR family protein	NA	NA	NA	NA
VED86542.1\|62229_62535_+	Uncharacterised protein	NA	NA	NA	NA
VED86543.1\|62584_64528_+	DNA mismatch repair protein MutL	A0A1B2LRQ5	Wolbachia_phage	2.1e-60	30.0
VED86544.1\|64658_64880_+	Uncharacterised protein	NA	NA	NA	NA
VED86545.1\|65037_65628_+	Holliday junction ATP-dependent DNA helicase RuvA	NA	NA	NA	NA
VED86546.1\|65636_66191_+	DNA-3-methyladenine glycosylase I	NA	NA	NA	NA
VED86547.1\|66287_67559_+	putative competence-damage inducible protein	NA	NA	NA	NA
VED86548.1\|67594_68734_+	recombinase A	A0A0S2MVG1	Bacillus_phage	5.8e-119	63.8
VED86549.1\|68910_69309_+	transcriptional regulator Spx	NA	NA	NA	NA
VED86550.1\|75718_80113_+	DNA polymerase III subunit alpha	A0A0K2SUJ2	Clostridium_phage	9.0e-19	32.8
VED86551.1\|80276_81518_+	aminopeptidase PepS	NA	NA	NA	NA
VED86552.1\|81537_81768_+	integral membrane protein	NA	NA	NA	NA
VED86553.1\|81900_82329_+	MarR family transcriptional regulator	NA	NA	NA	NA
VED86554.1\|82415_82961_+	NADPH-dependent FMN reductase, putative	NA	NA	NA	NA
VED86555.1\|83294_83585_-	Alkyl hydroperoxide reductase protein F	A0A2I2L5E1	Orpheovirus	1.4e-08	38.7
VED86556.1\|83848_84325_-	Alkyl hydroperoxide reductase protein F	G3MA85	Bacillus_virus	3.8e-08	36.9
VED86557.1\|84349_84526_-	Alkyl hydroperoxide reductase protein F	NA	NA	NA	NA
VED86558.1\|84800_85568_+	30S ribosomal protein S2	NA	NA	NA	NA
VED86559.1\|85678_86719_+	elongation factor Ts	NA	NA	NA	NA
VED86560.1\|86824_87295_-	small multidrug export protein	NA	NA	NA	NA
VED86561.1\|87611_88067_+	CtsR family transcriptional regulator	NA	NA	NA	NA
VED86562.1\|88067_90518_+\|protease	ATP-dependent Clp protease, ATP-binding subunit	A0A223W0B1	Agrobacterium_phage	3.4e-124	39.5

DBSCAN-SWA_2

97578 : 145596

Streptococcus_phage(36.36%)

integrase,transposase,tRNA

attL 104042:104070|attR 110696:110724

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
VED86569.1\|97578_98922_+\|tRNA	cysteinyl-tRNA synthetase	F1C979	Terra1_virus	4.3e-49	36.6
VED86570.1\|98914_99316_+	ribonuclease III family protein	NA	NA	NA	NA
VED86571.1\|100035_100779_+	TrmH family RNA methyltransferase	NA	NA	NA	NA
VED86572.1\|100781_101297_+	RNA-binding protein containing a PIN domain	NA	NA	NA	NA
VED86573.1\|101305_102166_+	fatty acid-binding protein, DegV family	NA	NA	NA	NA
VED86574.1\|102796_102979_+	HTH-type transcriptional regulator	NA	NA	NA	NA
VED86575.1\|103225_103672_+	50S ribosomal protein L13	NA	NA	NA	NA
VED86576.1\|103699_104092_+	SSU ribosomal protein S9p (S16e)	NA	NA	NA	NA
104042:104070	attL	NA	NA	NA	NA
VED86577.1\|104224_105379_-\|integrase	phage integrase family site specific recombinase	A0A1S5S7K9	Streptococcus_phage	9.8e-50	33.8
VED86578.1\|105430_105949_-	immunity repressor protein	NA	NA	NA	NA
VED86579.1\|106096_106378_+	DNA-binding protein	NA	NA	NA	NA
VED86580.1\|106386_107226_+	gp49 bacteriophage-like protein	Q7Y4K5	Streptococcus_phage	5.5e-50	58.3
VED86581.1\|107585_107918_+\|transposase	transposase	NA	NA	NA	NA
VED86582.1\|107898_108093_+	Uncharacterised protein	NA	NA	NA	NA
VED86583.1\|109384_109999_+	cadmium resistance protein	NA	NA	NA	NA
VED86584.1\|110010_110349_+	cadmium efflux system accessory protein	E4ZFI8	Streptococcus_phage	5.8e-11	33.3
VED86585.1\|111004_111388_+	ABC transporter, membrane-spanning protein	NA	NA	NA	NA
110696:110724	attR	NA	NA	NA	NA
VED86586.1\|111449_111752_+	membrane protein	S5MNN8	Brevibacillus_phage	4.6e-07	48.0
VED86587.1\|112029_113079_+	membrane protein	NA	NA	NA	NA
VED86588.1\|113939_114425_+	transcriptional regulator in ATPase CF(0) region	NA	NA	NA	NA
VED86589.1\|114702_115167_+\|transposase	transposase of family protein	W0UUZ0	Sulfolobus_monocaudavirus	6.1e-19	40.5
VED86590.1\|115315_116686_-	drug transporter, major facilitator superfamily (MFS) multidrug efflux pump	NA	NA	NA	NA
VED86591.1\|116726_116852_-	3-hydroxyacyl-ACP dehydratase	NA	NA	NA	NA
VED86592.1\|116954_117284_+	transcriptional regulator	NA	NA	NA	NA
VED86593.1\|118331_118982_+	amylase-binding protein AbpA	NA	NA	NA	NA
VED86594.1\|119068_119905_+	sortase B putative	NA	NA	NA	NA
VED86595.1\|120070_121288_+	enzyme of poly-gamma-glutamate biosynthesis	A0A0N9SJ77	Staphylococcus_phage	5.7e-32	29.3
VED86596.1\|121608_121875_+	ACT domain-containing protein	NA	NA	NA	NA
VED86597.1\|121892_123230_+	glycerol-3-phosphate dehydrogenase	NA	NA	NA	NA
VED86598.1\|123346_124051_+	2,3-bisphosphoglycerate-dependent phosphoglycerate mutase	NA	NA	NA	NA
VED86599.1\|124037_124835_+	D-alanyl-D-alanine-carboxypeptidase	NA	NA	NA	NA
VED86600.1\|124831_125413_+	peptidoglycan hydrolase	A0A160LKR7	Bacillus_phage	1.3e-05	27.3
VED86601.1\|125605_126640_+	heat-inducible transcription repressor	NA	NA	NA	NA
VED86602.1\|126679_127204_+	heat shock protein GrpE	NA	NA	NA	NA
VED86603.1\|127289_129113_+	molecular chaperone DnaK	A0A0N9QXN8	Chrysochromulina_ericina_virus	1.2e-134	47.5
VED86604.1\|129457_130612_+	chaperone protein DnaJ	A0A0P0YNN4	Yellowstone_lake_phycodnavirus	4.3e-21	27.3
VED86605.1\|130718_131468_+\|tRNA	tRNA pseudouridine synthase A	NA	NA	NA	NA
VED86606.1\|131457_132219_+	phosphomethylpyrimidine kinase	NA	NA	NA	NA
VED86607.1\|132208_132682_+	integral membrane protein	NA	NA	NA	NA
VED86608.1\|143907_144207_-\|transposase	transposase, ISSmu2	A0A1S5SBP9	Streptococcus_phage	2.2e-09	47.8
VED86609.1\|145092_145374_+\|transposase	ISSth1, transposase (orf1), IS3 family	NA	NA	NA	NA
VED86610.1\|145398_145596_+\|transposase	ISSth1, transposase (orf1), IS3 family	NA	NA	NA	NA

DBSCAN-SWA_3

356478 : 361940

Streptococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
VED86874.1\|356478_357243_+	branched-chain amino acid ABC transporter ATPase	A0A2H4PQG7	Staphylococcus_phage	5.2e-15	25.2
VED86876.1\|357242_357953_+	high-affinity branched-chain amino acid transport ATP-binding protein livF	A0A2H4PQG7	Staphylococcus_phage	8.2e-15	26.9
VED86878.1\|358087_358747_+	AcuB family protein	M1NSC5	Streptococcus_phage	1.8e-64	59.8
VED86880.1\|358911_359838_-	cysteine synthase	A0A1X9I5K7	Streptococcus_phage	1.5e-141	80.2
VED86882.1\|359939_360566_-	Xaa-Pro dipeptidase	A0A1X9I5T8	Streptococcus_phage	5.7e-68	61.4
VED86883.1\|360620_361940_+	late competence protein required for DNA uptake	A0A1X9I5S6	Streptococcus_phage	9.9e-123	53.0

DBSCAN-SWA_4

392686 : 402410

Streptococcus_phage(70.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
VED86942.1\|392686_393691_-	virulence protein	Q9JMN3	Wolbachia_phage	2.9e-82	47.6
VED86944.1\|393941_394760_-	Uncharacterised protein	NA	NA	NA	NA
VED86946.1\|394807_395392_-	transcriptional regulator	NA	NA	NA	NA
VED86948.1\|395556_395754_+	transcriptional regulator, XRE family	A0A1X9I5U5	Streptococcus_phage	2.4e-17	69.2
VED86950.1\|395956_396541_+	BRO family, N- domain-containing protein	A0A0E3T6E1	Bacillus_phage	1.2e-24	52.5
VED86952.1\|396531_397179_+	phage protein	R9QNB1	Lactococcus_phage	1.9e-26	38.6
VED86954.1\|397381_397672_+	cytosolic protein	NA	NA	NA	NA
VED86956.1\|397689_397896_+	Uncharacterised protein	A0A1X9I725	Streptococcus_phage	1.5e-06	47.7
VED86958.1\|397938_398250_+	phage related protein	NA	NA	NA	NA
VED86960.1\|398251_398524_+	phage related protein	A0A1X9I5U9	Streptococcus_phage	1.2e-09	39.3
VED86962.1\|398539_399400_+	replication protein, phage-plasmid associated	A0A1X9I6L2	Streptococcus_phage	2.6e-103	63.5
VED86964.1\|399389_400787_+	prophage ps2 protein 15	M1PKI6	Streptococcus_phage	1.8e-53	31.8
VED86966.1\|401395_401836_+	Uncharacterised protein	A0A1X9I5V5	Streptococcus_phage	6.1e-69	92.4
VED86967.1\|401906_402410_+	phage protein	A0A1X9I5V2	Streptococcus_phage	8.9e-40	47.6

DBSCAN-SWA_5

495604 : 502365

Streptococcus_phage(66.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
VED87140.1\|495604_496069_+\|transposase	transposase of family protein	W0UUZ0	Sulfolobus_monocaudavirus	6.1e-19	40.5
VED87142.1\|496429_497626_+	elongation factor Tu	A0A076FFS6	Aureococcus_anophage	3.6e-31	29.3
VED87144.1\|497877_498636_+	triosephosphate isomerase	NA	NA	NA	NA
VED87146.1\|498872_499502_+	thymidylate kinase	M1PSC7	Streptococcus_phage	3.6e-70	65.5
VED87148.1\|499510_500386_+	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	3.7e-73	51.0
VED87150.1\|500382_501189_+	regulator of signaling phosphorelay	NA	NA	NA	NA
VED87152.1\|501175_501496_+	regulator of replication initiation timing	M1PFV3	Streptococcus_phage	5.5e-27	57.0
VED87154.1\|501498_502365_+	tetrapyrrole methylase family protein	M1PLC5	Streptococcus_phage	3.0e-120	77.0

DBSCAN-SWA_6

602309 : 665300

Streptococcus_phage(50.0%)

protease,integrase,capsid,tRNA,transposase

attL 629729:629744|attR 674760:674775

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
VED87302.1\|602309_603536_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	2.7e-138	60.4
VED87304.1\|603545_604145_+	ribosome biogenesis GTP-binding protein YsxC	NA	NA	NA	NA
VED87306.1\|604272_605649_+	amino acid permease	NA	NA	NA	NA
VED87308.1\|605660_606611_+	homocysteine methyltransferase	NA	NA	NA	NA
VED87310.1\|606723_606978_+	Galactose mutarotase and related enzyme	NA	NA	NA	NA
VED87312.1\|607052_607403_+	cytoplasmic protein	NA	NA	NA	NA
VED87314.1\|607520_608162_-	acyl-phosphate glycerol 3-phosphate acyltransferase	NA	NA	NA	NA
VED87315.1\|608299_610249_+	DNA topoisomerase IV subunit B	G3M9Z3	Bacillus_virus	7.8e-124	42.4
VED87317.1\|610776_613197_+	DNA topoisomerase IV subunit A	G3M9Z5	Bacillus_virus	8.0e-94	33.1
VED87319.1\|613362_614385_+	branched-chaiN-amino-acid aminotransferase	NA	NA	NA	NA
VED87321.1\|614503_614734_+	Protein of uncharacterised function (DUF2969)	NA	NA	NA	NA
VED87323.1\|615135_616338_+	30S ribosomal protein S1	NA	NA	NA	NA
VED87325.1\|617166_617787_+	phage protein	NA	NA	NA	NA
VED87327.1\|618215_618542_+	membrane protein	NA	NA	NA	NA
VED87329.1\|618519_619755_+	peptidoglycan branched peptide synthesis protein,alanine adding enzyme	NA	NA	NA	NA
VED87331.1\|619852_620815_+	NAD-dependent oxidoreductase	NA	NA	NA	NA
VED87333.1\|620854_621157_-	cytosolic protein	NA	NA	NA	NA
VED87336.1\|621166_621625_-	nudix family hydrolase	NA	NA	NA	NA
VED87338.1\|621767_624038_-\|protease	ATP-dependent Clp protease	K4FB40	Cronobacter_phage	4.6e-128	40.7
VED87340.1\|624279_625260_+	ornithine carbamoyltransferase	NA	NA	NA	NA
VED87342.1\|625328_625559_+	Protein of uncharacterised function (DUF1797)	NA	NA	NA	NA
VED87344.1\|625825_626506_+	ABC-type amino acid transport system, permease component	NA	NA	NA	NA
VED87347.1\|626505_627240_+	glutamine transport ATP-binding protein GlnQ	G9BWD6	Planktothrix_phage	5.1e-36	41.4
VED87349.1\|627411_627888_+	FeoA domain-containing protein	NA	NA	NA	NA
VED87351.1\|627884_630023_+	ferrous iron transport protein B	NA	NA	NA	NA
629729:629744	attL	NA	NA	NA	NA
VED87353.1\|630040_630181_+	membrane protein	NA	NA	NA	NA
VED87355.1\|630319_630544_+	lysophospholipase	NA	NA	NA	NA
VED87357.1\|631235_632090_+	bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase	A0A249XZQ2	Enterococcus_phage	1.9e-42	41.9
VED87359.1\|632093_632930_+	sugar kinase	NA	NA	NA	NA
VED87361.1\|633051_635166_+	cell division protein FtsI/penicillin-binding protein 2	NA	NA	NA	NA
VED87363.1\|635275_635872_+	recombination protein recR	NA	NA	NA	NA
VED87365.1\|636040_636514_+\|transposase	transposase-like protein	A0A1P8BMC0	Lactococcus_phage	5.0e-16	32.6
VED87367.1\|636719_637208_+	transcription antiterminator LicT	NA	NA	NA	NA
VED87369.1\|637241_637556_+	BglG family transcriptional antiterminator, truncated	NA	NA	NA	NA
VED87371.1\|637777_638275_+\|protease	putative metalloprotease ykjF	NA	NA	NA	NA
VED87373.1\|638255_638660_+	diacylglycerol kinase	NA	NA	NA	NA
VED87375.1\|638678_639578_+	GTP-binding protein Era	NA	NA	NA	NA
VED87377.1\|639624_640446_+	formamidopyrimidine-DNA glycosylase	A0A127AWE5	Bacillus_phage	8.3e-19	27.9
VED87379.1\|640442_641036_+	dephospho-CoA kinase	NA	NA	NA	NA
VED87381.1\|641086_642310_+	multi-drug resistance efflux pump	NA	NA	NA	NA
VED87383.1\|642491_642728_+	preprotein translocase subunit SecG	NA	NA	NA	NA
VED87384.1\|642790_645244_+	ribonuclease R	Q0GXV6	Lactococcus_phage	3.4e-92	40.1
VED87386.1\|645265_645730_+	SsrA-binding protein	W5RAM5	Staphylococcus_phage	1.1e-41	56.4
VED87387.1\|645884_647291_+	putative bifunctional phosphatase/peptidyl-prolyl cis-trans isomerase	A0A1V0S9I2	Catovirus	1.2e-25	43.5
VED87389.1\|647292_647658_+	general stress protein GSP13	NA	NA	NA	NA
VED87391.1\|647759_648845_-	Xaa-Pro dipeptidase	NA	NA	NA	NA
VED87393.1\|649159_650161_+	catabolite control protein	C6ZCU4	Enterobacteria_phage	1.3e-21	27.9
VED87394.1\|650220_651288_+	MmcQ protein	NA	NA	NA	NA
VED87397.1\|651300_652416_+	glycerate kinase	W6LM47	Streptococcus_phage	9.9e-140	87.3
VED87399.1\|652446_652902_-	glycogen synthase	W6LLD2	Streptococcus_phage	2.3e-66	83.4
VED87401.1\|653107_654406_+	Enolase	W6LP63	Streptococcus_phage	1.0e-236	96.1
VED87403.1\|654462_655629_-\|integrase	phage integrase family protein	W6LMU7	Streptococcus_phage	6.2e-201	92.2
VED87406.1\|655780_657037_-\|transposase	transposase	A0A1S5SBP9	Streptococcus_phage	8.8e-129	57.6
VED87408.1\|657233_657389_+	Uncharacterised protein	A0A286QP26	Streptococcus_phage	5.0e-10	78.6
VED87410.1\|657415_657703_+	putative scaffolding protein	A0A2H4JBH4	uncultured_Caudovirales_phage	1.0e-16	73.0
VED87412.1\|657699_658614_+\|capsid	phage minor capsid 2 family protein	A0A286QMS2	Streptococcus_phage	1.2e-69	68.3
VED87414.1\|658601_658829_+	Uncharacterised protein	A0A1S5S916	Streptococcus_phage	1.5e-18	63.5
VED87416.1\|658984_659602_+	putative scaffolding protein	A0A286QP26	Streptococcus_phage	5.8e-73	77.1
VED87418.1\|659609_659762_+	Uncharacterised protein	NA	NA	NA	NA
VED87420.1\|659998_660457_+	phage super infection exclusion	NA	NA	NA	NA
VED87423.1\|660763_660949_-\|tRNA	Isoleucyl-tRNA synthetase, putative	W6LMT3	Streptococcus_phage	2.1e-23	90.2
VED87425.1\|661120_663301_-	glycerol phosphate lipoteichoic acid synthase 2	W6LM83	Streptococcus_phage	0.0e+00	95.3
VED87427.1\|663354_664626_+	methyltransferase	W6LLI2	Streptococcus_phage	4.5e-213	95.9
VED87430.1\|664622_665300_+	3-dehydroquinate dehydratase	W6LP76	Streptococcus_phage	4.3e-114	92.9
674760:674775	attR	NA	NA	NA	NA

DBSCAN-SWA_7

778148 : 787067

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
VED87659.1\|778148_778751_+	Sua5/YciO/YrdC family protein	S4VW33	Pandoravirus	2.1e-19	32.0
VED87661.1\|778845_780096_+	serine hydroxymethyltransferase	A0A240F3L3	Aeromonas_phage	1.2e-96	52.3
VED87663.1\|780102_781080_+	phosphoenolpyruvate carboxylase	NA	NA	NA	NA
VED87665.1\|781081_781693_+	lytic murein transglycosylase	A0A223LKM8	Bacillus_phage	3.5e-22	41.4
VED87667.1\|781724_783464_+	multidrug ABC transporter ATPase/permease	W8CYL7	Bacillus_phage	8.1e-48	28.1
VED87669.1\|783453_785202_+	ABC transporter ATP-binding protein/permease	W8CYL7	Bacillus_phage	7.1e-52	30.7
VED87671.1\|785516_787067_+	D-alanine--poly(phosphoribitol) ligase, subunit 1	A0A2K9KZV5	Tupanvirus	1.2e-42	29.1

DBSCAN-SWA_8

820867 : 851584

Streptococcus_phage(33.33%)

transposase,tRNA,integrase

attL 836820:836841|attR 856422:856443

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
VED87731.1\|820867_822214_+\|tRNA	asparaginyl-tRNA synthetase	A0A2P1EMB4	Moumouvirus	5.1e-58	32.3
VED87733.1\|822240_822648_+	glycosyltransferase	NA	NA	NA	NA
VED87735.1\|822756_823137_+	translation initiation inhibitor	NA	NA	NA	NA
VED87736.1\|823311_823965_+	ExsB protein	A0A2H4J8Q7	uncultured_Caudovirales_phage	2.6e-63	56.8
VED87738.1\|823964_824408_+	6-pyruvoyl-tetrahydropterin synthase	J9PV91	Bacillus_phage	1.9e-41	58.5
VED87740.1\|824400_825117_+	pyruvate-formate lyase-activating enzyme	A0A1U9WRB6	Streptococcus_virus	9.0e-62	47.3
VED87742.1\|825239_825731_+	7-cyano-7-deazaguanine reductase	E7DN65	Pneumococcus_phage	2.8e-46	57.3
VED87744.1\|826216_826441_+	SCP-like extracellular protein	NA	NA	NA	NA
VED87746.1\|826584_826839_+	SCP-like extracellular protein	NA	NA	NA	NA
VED87748.1\|827437_828208_+	membrane protein	NA	NA	NA	NA
VED87750.1\|828188_829079_+	P-loop ATPase	A0A0R8VB27	Thermobifida_phage	2.5e-05	28.9
VED87752.1\|829075_830050_+	transporter	A1IMD5	Streptococcus_phage	7.6e-136	73.1
VED87754.1\|830046_830958_+	Putative sporulation transcription regulator whiA	Q7AWZ3	Streptococcus_phage	7.9e-103	64.7
VED87756.1\|830975_832373_+	dipeptidase A	NA	NA	NA	NA
VED87758.1\|832456_832858_+\|transposase	IS861 transposase Orf1	NA	NA	NA	NA
VED87760.1\|832862_833264_+\|transposase	transposase	A0A1B1P773	Bacillus_phage	5.5e-24	50.0
VED87762.1\|833332_833551_+\|transposase	transposase OrfB	A0A2I6AZV9	Macacine_betaherpesvirus	7.6e-12	50.7
VED87764.1\|833608_834430_-	repair protein	NA	NA	NA	NA
VED87766.1\|834586_836131_+	zinc-binding lipoprotein AdcA	NA	NA	NA	NA
VED87768.1\|836351_836750_+	Uncharacterised protein	NA	NA	NA	NA
836820:836841	attL	NA	NA	NA	NA
VED87770.1\|836993_837422_-\|transposase	transposase	A0A1X9I619	Streptococcus_phage	9.2e-70	92.9
VED87772.1\|837554_837800_-	maltose/maltodextrin ABC transporter / tnp1167 hybrid protein, truncated	A0A1S5SBP9	Streptococcus_phage	3.6e-10	76.6
VED87774.1\|837966_838974_-	membrane protein	NA	NA	NA	NA
VED87776.1\|839146_839860_+	peptidoglycan hydrolase	Q332B8	Clostridium_botulinum_C_phage	4.7e-10	33.5
VED87778.1\|839994_840153_+\|transposase	transposase	NA	NA	NA	NA
VED87780.1\|840312_840501_+\|transposase	Putative transposase, ISSmu1	NA	NA	NA	NA
VED87782.1\|840615_840834_+\|transposase	transposase	A0A1B1P773	Bacillus_phage	3.4e-12	60.3
VED87784.1\|840931_841840_-	fhu operon transcription regulator	NA	NA	NA	NA
VED87786.1\|842046_843855_+	glucosamine-fructose-6-phosphate aminotransferase	A7IW18	Paramecium_bursaria_Chlorella_virus	2.1e-99	39.1
VED87788.1\|843964_844297_+	putative alkylphosphonate utilization operon protein PhnA	NA	NA	NA	NA
VED87790.1\|844496_845138_+	ABC transporter permease	NA	NA	NA	NA
VED87792.1\|845146_845776_+	glutamine transport ATP-binding protein GlnQ	G9BWD6	Planktothrix_phage	2.6e-28	36.8
VED87794.1\|845788_846640_+	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
VED87796.1\|846752_848168_+	SOS responce UmuC protein	M1Q231	Streptococcus_phage	9.4e-196	71.1
VED87798.1\|848164_848542_+	Uncharacterised protein	A0A1B0RXA8	Streptococcus_phage	3.8e-19	43.3
VED87800.1\|848519_848801_+	Uncharacterised protein	M1PG86	Streptococcus_phage	1.6e-22	59.6
VED87802.1\|848962_849982_+	alcohol dehydrogenase 1 (Alcohol dehydrogenase I) (ADH I)	A0A2K9L339	Tupanvirus	9.3e-28	25.8
VED87804.1\|850288_851584_-\|integrase	integrase	A0A1B2AQ00	Phage_Wrath	1.2e-19	24.1
856422:856443	attR	NA	NA	NA	NA

DBSCAN-SWA_9

957409 : 968202

Acinetobacter_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
VED88023.1\|957409_959950_+	aminopeptidase N	A0A0P0IY26	Acinetobacter_phage	1.5e-66	27.4
VED88025.1\|960111_961182_-	tyrosine recombinase XerC	NA	NA	NA	NA
VED88027.1\|961465_962455_-	lipoate-protein ligase	A0A2H4UVX5	Bodo_saltans_virus	2.6e-11	27.2
VED88030.1\|962546_963452_-	type II restriction enzyme DPNII homolog	A0A2H4JAL2	uncultured_Caudovirales_phage	1.2e-23	29.9
VED88031.1\|963578_964169_-	Uncharacterised protein	NA	NA	NA	NA
VED88032.1\|964165_964978_-	DNA adenine methylase	A0A249XUJ2	Enterococcus_phage	1.0e-29	34.5
VED88033.1\|965006_965849_-	site-specific DNA-methyltransferase	A0A1S5PRR3	Streptococcus_phage	1.2e-92	61.1
VED88034.1\|965940_968202_-	glycogen phosphorylase	Q8B3H5	Iris_mild_mosaic_virus	2.5e-09	37.9

DBSCAN-SWA_10

1161661 : 1242198

Streptococcus_phage(20.0%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
VED88432.1\|1161661_1164217_-\|tRNA	lysyl-tRNA synthetase	NA	NA	NA	NA
VED88434.1\|1164213_1164933_-	alpha/beta superfamily hydrolase	A0A249XTE1	Mycobacterium_phage	5.8e-08	34.7
VED88437.1\|1165147_1167067_-	ABC transporter ATP-binding protein	A0A2K9L3Z8	Tupanvirus	7.8e-52	28.1
VED88439.1\|1167103_1167739_-	uridine kinase	A0A1V0SAA3	Catovirus	5.4e-34	38.7
VED88441.1\|1167830_1168913_+	superfamily II DNA and RNA helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	2.1e-30	31.0
VED88443.1\|1168965_1170129_-	carbamoylphosphate synthase large subunit	NA	NA	NA	NA
VED88445.1\|1170174_1170915_-	esterase superfamily protein	NA	NA	NA	NA
VED88447.1\|1170966_1171794_-	hydrolase, alpha/beta family	NA	NA	NA	NA
VED88449.1\|1171909_1173343_-	NADP-dependent glyceraldehyde-3-phosphate dehydrogenase	NA	NA	NA	NA
VED88451.1\|1173561_1175295_-	PTS family porter, enzyme I	NA	NA	NA	NA
VED88453.1\|1175299_1175563_-	Phosphotransferase system, phosphocarrier protein HPr	NA	NA	NA	NA
VED88455.1\|1175824_1177000_-	isocitrate dehydrogenase	NA	NA	NA	NA
VED88457.1\|1177013_1178138_-	citrate synthase 2	NA	NA	NA	NA
VED88459.1\|1178139_1180803_-	aconitate hydratase 1	NA	NA	NA	NA
VED88462.1\|1181134_1181359_+	ribonucleoside-diphosphate reductase class Ib glutaredoxin subunit	A0A0E3T8B5	Gordonia_phage	1.1e-10	38.6
VED88464.1\|1181449_1183609_+	ribonucleoside-diphosphate reductase subunit alpha	A8E2R1	Enterococcus_phage	9.5e-264	63.0
VED88466.1\|1183766_1184729_+	ribonucleoside-diphosphate reductase subunit beta	A0A096XT60	Enterococcus_phage	3.4e-128	69.3
VED88469.1\|1184909_1185095_-\|transposase	IS3-Spn1 transposase	NA	NA	NA	NA
VED88471.1\|1185347_1185485_-\|transposase	IS861, transposase (orf1), IS3 family, truncated	NA	NA	NA	NA
VED88473.1\|1185448_1185832_-\|transposase	transposase	NA	NA	NA	NA
VED88475.1\|1185984_1187241_+\|transposase	transposase	A0A1S5SBP9	Streptococcus_phage	6.3e-127	57.3
VED88477.1\|1187512_1188715_+\|transposase	transposase	A0A1X9I619	Streptococcus_phage	2.0e-194	85.5
VED88479.1\|1189052_1198664_-	cell wall surface anchor family protein	NA	NA	NA	NA
VED88481.1\|1198881_1200366_+	M protein trans-acting positive transcriptional regulator	NA	NA	NA	NA
VED88483.1\|1201513_1202482_-	Extracellular protein	NA	NA	NA	NA
VED88485.1\|1202595_1202997_-	lactoylglutathione lyase or related lyase	NA	NA	NA	NA
VED88487.1\|1203033_1203795_-	sortase	NA	NA	NA	NA
VED88489.1\|1203794_1206263_-	DNA gyrase subunit A	G3M9Z5	Bacillus_virus	2.6e-108	35.2
VED88491.1\|1206483_1207470_+	L-lactate dehydrogenase 1	NA	NA	NA	NA
VED88493.1\|1207562_1208936_-	NADH oxidase (H2O-forming)	A0A2K5B2C5	Erysipelothrix_phage	1.9e-07	23.3
VED88495.1\|1209251_1210790_-	ABC transporter ATP-binding protein	A0A2K9L3Z8	Tupanvirus	1.3e-52	29.6
VED88497.1\|1210928_1211459_-	membrane protein	NA	NA	NA	NA
VED88499.1\|1211448_1212306_-	pyridoxal kinase	NA	NA	NA	NA
VED88501.1\|1212306_1212816_-	Predicted membrane protein	NA	NA	NA	NA
VED88503.1\|1212955_1213486_-	Uncharacterised protein	NA	NA	NA	NA
VED88505.1\|1213645_1214911_+	transcriptional regulator	A0A1X9I5H2	Streptococcus_phage	1.3e-111	52.3
VED88507.1\|1214954_1215293_-	anaerobic ribonucleoside-triphosphate reductase	A0A248SK58	Salicola_phage	4.3e-06	36.8
VED88509.1\|1215383_1215965_-	Uncharacterised protein	NA	NA	NA	NA
VED88511.1\|1216033_1218442_-\|tRNA	phenylalanyl-tRNA synthetase subunit beta	NA	NA	NA	NA
VED88513.1\|1218744_1219263_-	acetyltransferase	NA	NA	NA	NA
VED88515.1\|1219279_1220323_-\|tRNA	phenylalanyl-tRNA synthetase subunit alpha	A0A2K9L3A8	Tupanvirus	2.7e-30	34.3
VED88517.1\|1220833_1224367_-	chromosome segregation protein SMC	NA	NA	NA	NA
VED88519.1\|1224369_1225059_-	ribonuclease III	A0A1V0SDK0	Indivirus	3.8e-25	36.5
VED88521.1\|1225215_1226151_-	dihydrodipicolinate synthase	NA	NA	NA	NA
VED88522.1\|1226534_1227611_-	aspartate-semialdehyde dehydrogenase	NA	NA	NA	NA
VED88523.1\|1227906_1228560_-	putative DNA alkylation repair enzyme	NA	NA	NA	NA
VED88525.1\|1228575_1230150_-	cardiolipin synthetase	NA	NA	NA	NA
VED88527.1\|1230279_1230792_-	phosphinothricin N-acetyltransferase	A0A2H4J136	uncultured_Caudovirales_phage	5.5e-37	49.4
VED88529.1\|1230872_1232318_-	cardiolipin synthetase (Cardiolipin synthase) (CL synthase)	NA	NA	NA	NA
VED88531.1\|1233015_1234566_+	glycine betaine transporter opuD	A0A2I7QNT1	Vibrio_phage	2.1e-18	25.3
VED88551.1\|1234816_1235140_+	ion transport protein, putative	A0A1B0Y2S3	Lactobacillus_phage	5.4e-06	34.0
VED88553.1\|1235704_1237489_-	excinuclease ABC subunit C	NA	NA	NA	NA
VED88554.1\|1237560_1238256_-	2-haloalkanoic acid dehalogenase	NA	NA	NA	NA
VED88556.1\|1238531_1239203_+	L-serine dehydratase subunit beta	NA	NA	NA	NA
VED88558.1\|1239215_1240085_+	L-serine dehydratase, iron-sulfur-dependent subunit alpha	NA	NA	NA	NA
VED88560.1\|1240941_1242198_+\|transposase	transposase	A0A1S5SBP9	Streptococcus_phage	3.1e-126	57.1

DBSCAN-SWA_11

1304604 : 1392707

Bacillus_phage(40.0%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
VED88680.1\|1304604_1306089_+\|protease	ATP-dependent Zn protease	NA	NA	NA	NA
VED88682.1\|1306309_1306654_-	Uncharacterised protein	NA	NA	NA	NA
VED88683.1\|1306912_1308106_+	oxidoreductase NAD-binding subunit	NA	NA	NA	NA
VED88685.1\|1308157_1309141_-	igG binding protein	NA	NA	NA	NA
VED88687.1\|1309154_1309529_-	dihydroxyacetone kinase, phosphotransfer subunit	NA	NA	NA	NA
VED88689.1\|1309532_1310108_-	dihydroxyacetone kinase subunit DhaL	NA	NA	NA	NA
VED88691.1\|1310138_1311128_-	dihydroxyacetone kinase subunit DhaK	NA	NA	NA	NA
VED88693.1\|1311453_1312713_+	Uncharacterized conserved protein	NA	NA	NA	NA
VED88695.1\|1312862_1313189_-	peptide methionine sulfoxide reductase	NA	NA	NA	NA
VED88697.1\|1313511_1313985_-\|transposase	transposase-like protein	A0A1P8BMC0	Lactococcus_phage	3.5e-14	29.9
VED88699.1\|1314483_1314846_-	30S ribosomal protein S4	NA	NA	NA	NA
VED88701.1\|1315034_1316069_-	histidine protein kinase	W8CYF6	Bacillus_phage	1.3e-24	29.8
VED88703.1\|1316065_1316764_-	DNA-binding response regulator	W8CYM9	Bacillus_phage	3.7e-36	37.8
VED88705.1\|1316844_1318929_-	LPXTG cell wall surface protein	NA	NA	NA	NA
VED88707.1\|1319698_1320292_-	glutamine amidotransferase subunit PdxT	NA	NA	NA	NA
VED88709.1\|1320292_1321165_-	pyridoxine biosynthesis protein	NA	NA	NA	NA
VED88711.1\|1321567_1321801_-	glutamine amidotransferase subunit PdxT	NA	NA	NA	NA
VED88713.1\|1322207_1322471_-\|protease	CAAX amino protease family protein	NA	NA	NA	NA
VED88715.1\|1322628_1324014_-	permease of the major facilitator family protein	NA	NA	NA	NA
VED88717.1\|1324068_1324446_-	transcriptional regulator	NA	NA	NA	NA
VED88719.1\|1324597_1325161_-	maltose O-acetyltransferase	NA	NA	NA	NA
VED88721.1\|1325595_1325766_-	putative HAD-superfamily hydrolase	NA	NA	NA	NA
VED88723.1\|1326237_1329324_+	Uncharacterised protein	NA	NA	NA	NA
VED88725.1\|1333328_1334330_-	Glycosyl transferase	NA	NA	NA	NA
VED88727.1\|1334365_1334590_-	Uncharacterised protein	NA	NA	NA	NA
VED88729.1\|1334594_1334774_-	Uncharacterised protein	NA	NA	NA	NA
VED88731.1\|1334766_1336119_-	GtfB	NA	NA	NA	NA
VED88733.1\|1336115_1337624_-	glycosyltransferase	NA	NA	NA	NA
VED88735.1\|1337636_1340012_-	protein translocase subunit secA	NA	NA	NA	NA
VED88737.1\|1340004_1340451_-	accessory Sec system protein Asp3	NA	NA	NA	NA
VED88738.1\|1340453_1341992_-	accessory Sec system protein Asp2	NA	NA	NA	NA
VED88740.1\|1341978_1343550_-	putative accessory secretory protein Asp1	NA	NA	NA	NA
VED88742.1\|1343650_1344877_-	preprotein translocase subunit secY	NA	NA	NA	NA
VED88744.1\|1344971_1347137_-	glycosyl transferase family protein	NA	NA	NA	NA
VED88747.1\|1347386_1350566_-	ATP-dependent dsDNA exonuclease	NA	NA	NA	NA
VED88749.1\|1350562_1351771_-	ATP-dependent dsDNA exonuclease	NA	NA	NA	NA
VED88751.1\|1352718_1353921_-\|transposase	transposase	A0A1X9I619	Streptococcus_phage	7.0e-184	82.0
VED88753.1\|1354208_1357226_-	beta-galactosidase	L0N6M2	Herpes_simplex_virus	2.3e-143	32.8
VED88755.1\|1357228_1359133_-	Lactose and galactose permease, GPH translocator family	NA	NA	NA	NA
VED88758.1\|1359235_1360282_-	aldose 1-epimerase	NA	NA	NA	NA
VED88760.1\|1360351_1361353_-	UDP-glucose 4-epimerase	A0A2K9L1R4	Tupanvirus	2.6e-46	36.4
VED88762.1\|1361382_1362864_-	galactose-1-phosphate uridylyltransferase	NA	NA	NA	NA
VED88764.1\|1362883_1364050_-	galactokinase	NA	NA	NA	NA
VED88766.1\|1364190_1365186_+	galactose operon repressor	NA	NA	NA	NA
VED88767.1\|1365754_1365997_-\|transposase	transposase	NA	NA	NA	NA
VED88769.1\|1366169_1372139_-	LPXTG-motif cell wall anchor domain-containing protein	NA	NA	NA	NA
VED88771.1\|1373212_1375081_-	ABC-type multidrug/protein/lipid transport system, ATPase component	W8CYL7	Bacillus_phage	5.3e-45	28.2
VED88772.1\|1375070_1376816_-	ABC transporter ATP-binding protein yfiB	W8CYL7	Bacillus_phage	2.8e-40	25.6
VED88774.1\|1377451_1379716_+	amino acid ligase	NA	NA	NA	NA
VED88776.1\|1379777_1380416_-	Uncharacterised protein	NA	NA	NA	NA
VED88778.1\|1380354_1381884_-	Protein of uncharacterised function (DUF3114)	NA	NA	NA	NA
VED88780.1\|1381989_1382550_-	GNAT family acetyltransferase	NA	NA	NA	NA
VED88782.1\|1382588_1383302_-	glycogen phosphorylase	NA	NA	NA	NA
VED88784.1\|1383298_1383424_-	glycogen phosphorylase	NA	NA	NA	NA
VED88786.1\|1383636_1385067_-	glycogen synthase	NA	NA	NA	NA
VED88788.1\|1385063_1386200_-	glucose-1-phosphate adenylyltransferase, GlgD subunit	NA	NA	NA	NA
VED88790.1\|1386189_1387332_-	glucose-1-phosphate adenylyltransferase	A0A1D7XFC1	Escherichia_phage	1.9e-08	25.9
VED88792.1\|1387522_1389403_-	1,4-alpha-glucan-branching protein	NA	NA	NA	NA
VED88794.1\|1389574_1391770_-	pullulanase, type I	NA	NA	NA	NA
VED88796.1\|1392023_1392707_+\|transposase	IS1193 transposase	A0A1S5SBP9	Streptococcus_phage	1.5e-58	50.9

DBSCAN-SWA_12

1459177 : 1515845

Streptococcus_phage(47.06%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
VED88951.1\|1459177_1460113_-\|protease	CAAX amino protease family protein	NA	NA	NA	NA
VED88953.1\|1460311_1462510_+	glutamine ABC transporter permease	NA	NA	NA	NA
VED88955.1\|1462509_1463250_+	glutamine transport ATP-binding protein GlnQ	G9BWD6	Planktothrix_phage	1.7e-34	41.9
VED88957.1\|1463328_1463526_-	GTPase ObgE	NA	NA	NA	NA
VED88960.1\|1463653_1464967_-	GTP-binding protein Obg	NA	NA	NA	NA
VED88962.1\|1465270_1466002_-	ribosomal small subunit pseudouridine synthase A	NA	NA	NA	NA
VED88964.1\|1466002_1466203_-	AraC family transcriptional regulator	NA	NA	NA	NA
VED88966.1\|1466602_1466986_-	Thioesterase family protein	NA	NA	NA	NA
VED88968.1\|1467453_1467696_+	Uncharacterised protein	NA	NA	NA	NA
VED88970.1\|1467863_1468754_+	permease	NA	NA	NA	NA
VED88972.1\|1468844_1469033_-	Uncharacterised protein	NA	NA	NA	NA
VED88974.1\|1469427_1470630_-\|transposase	transposase	A0A1X9I619	Streptococcus_phage	7.0e-184	82.0
VED88976.1\|1470880_1471531_-	phosphoserine phosphatase SerB	NA	NA	NA	NA
VED88982.1\|1471641_1473366_-	septation ring formation regulator EzrA	NA	NA	NA	NA
VED88984.1\|1473462_1475415_-	DNA gyrase subunit B	G3M9Z3	Bacillus_virus	4.4e-143	45.1
VED88986.1\|1475415_1476021_-	HAD superfamily hydrolase	NA	NA	NA	NA
VED88988.1\|1476061_1476757_-	putative effector of murein hydrolase	NA	NA	NA	NA
VED88990.1\|1476749_1477124_-	putative effector of murein hydrolase LrgA	NA	NA	NA	NA
VED88992.1\|1477379_1477589_-\|transposase	transposase-like protein	NA	NA	NA	NA
VED88994.1\|1478149_1478503_-	Spx/MgsR family transcriptional regulator	M1PLC0	Streptococcus_phage	9.6e-41	67.5
VED88996.1\|1478537_1479032_-	methylated-DNA--protein-cysteine methyltransferase	M1PFU9	Streptococcus_phage	2.5e-34	44.4
VED88998.1\|1479090_1480269_-	phosphoglycerate dehydrogenase	M1NSB9	Streptococcus_phage	5.7e-178	79.8
VED89000.1\|1480287_1480845_-	GNAT family acetyltransferase	M1PSC3	Streptococcus_phage	1.1e-54	58.4
VED89002.1\|1480857_1481952_-	phosphoserine transaminase	M1Q1P2	Streptococcus_phage	3.6e-171	80.7
VED89004.1\|1482105_1482999_-	transcriptional regulator	NA	NA	NA	NA
VED89006.1\|1483114_1483510_+	lactoylglutathione lyase	NA	NA	NA	NA
VED89008.1\|1483552_1484452_-	spfh domain/band 7 family protein	A0A1V0SL90	Klosneuvirus	1.8e-35	32.8
VED89010.1\|1484759_1485827_-	spermidine/putrescine ABC transporter periplasmic protein	NA	NA	NA	NA
VED89012.1\|1485819_1486599_-	spermidine/putrescine ABC transporter permease	NA	NA	NA	NA
VED89014.1\|1486595_1487390_-	spermidine/putrescine ABC transporter permease	NA	NA	NA	NA
VED89016.1\|1487373_1488528_-	putrescine/spermidine ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	8.9e-35	42.2
VED89018.1\|1488572_1489475_-	UDP-N-acetylenolpyruvoylglucosamine reductase	NA	NA	NA	NA
VED89020.1\|1489664_1490156_-	hydroxymethylpterin pyrophosphokinase	NA	NA	NA	NA
VED89022.1\|1490152_1490512_-	dihydroneopterin aldolase	NA	NA	NA	NA
VED89024.1\|1490732_1492184_+	alpha-amylase	NA	NA	NA	NA
VED89026.1\|1492214_1493015_-	dihydropteroate synthase	NA	NA	NA	NA
VED89028.1\|1493023_1493587_-	GTP cyclohydrolase I	E7DN69	Pneumococcus_phage	8.4e-47	53.6
VED89030.1\|1493824_1494289_-\|transposase	transposase of family protein	W0UUZ0	Sulfolobus_monocaudavirus	6.1e-19	40.5
VED89032.1\|1494500_1495004_+\|transposase	transposase of IS905	NA	NA	NA	NA
VED89034.1\|1495438_1496170_-	Uncharacterised protein	NA	NA	NA	NA
VED89036.1\|1496166_1496883_-	lantibiotic transport ATP-binding protein srtF	A0A2H4PQG7	Staphylococcus_phage	1.1e-27	37.3
VED89038.1\|1496885_1497629_-	ABC transporter permease	NA	NA	NA	NA
VED89040.1\|1497621_1498542_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	3.9e-17	25.8
VED89042.1\|1498538_1499432_-	Uncharacterised protein	NA	NA	NA	NA
VED89045.1\|1499418_1500558_-	molybdopterin biosynthesis protein (HesA/MoeB/ThiF family protein)	A0A1V0SAV8	Catovirus	6.6e-14	28.1
VED89047.1\|1501093_1501681_+	transcriptional regulator, TetR family protein	NA	NA	NA	NA
VED89050.1\|1502525_1502645_-	Uncharacterised protein	NA	NA	NA	NA
VED89052.1\|1502948_1504793_-	aminoacid specific permease	NA	NA	NA	NA
VED89054.1\|1504859_1506122_-	folylpolyglutamate synthase	NA	NA	NA	NA
VED89056.1\|1506287_1506536_-	putative RNA-binding protein	NA	NA	NA	NA
VED89058.1\|1506547_1506820_-	30S ribosomal protein S16	NA	NA	NA	NA
VED89060.1\|1507247_1508126_+	SAM-dependent methyltransferase	NA	NA	NA	NA
VED89062.1\|1509383_1510211_+	exodeoxyribonuclease III	M1PSC0	Streptococcus_phage	1.9e-127	80.6
VED89064.1\|1510283_1510763_+	citrulline cluster-linked gene	NA	NA	NA	NA
VED89066.1\|1510802_1512431_-	Uncharacterised protein	NA	NA	NA	NA
VED89068.1\|1512427_1513159_-	Uncharacterised protein	NA	NA	NA	NA
VED89070.1\|1513204_1513324_-	Uncharacterised protein	NA	NA	NA	NA
VED89072.1\|1513397_1514108_-	Uncharacterised protein	NA	NA	NA	NA
VED89074.1\|1514127_1514394_-	Uncharacterised protein	NA	NA	NA	NA
VED89076.1\|1514606_1515845_+\|transposase	transposase	A0A1S5SBP9	Streptococcus_phage	8.7e-121	56.1

DBSCAN-SWA_13

1721519 : 1812651

102

Streptococcus_phage(28.57%)

protease,integrase,bacteriocin,tRNA,transposase

attL 1752321:1752335|attR 1795229:1795243

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
VED89472.1\|1721519_1721735_-\|transposase	transposase	NA	NA	NA	NA
VED89474.1\|1721846_1722389_-	CvpA family protein	NA	NA	NA	NA
VED89476.1\|1722385_1722625_-	Cell division protein ZapA	NA	NA	NA	NA
VED89478.1\|1723014_1723905_+	ribonuclease HIII (RNase HIII)	NA	NA	NA	NA
VED89480.1\|1723923_1724565_+	signal peptidase I	NA	NA	NA	NA
VED89482.1\|1724625_1727130_+	RecD/TraA family helicase	A0A218KCE8	Bacillus_phage	1.1e-50	26.7
VED89484.1\|1727184_1727511_-	Branched-chain amino acid transport protein azlD	NA	NA	NA	NA
VED89486.1\|1727497_1728190_-	amino acid permease	NA	NA	NA	NA
VED89488.1\|1728241_1729255_-	putative O-sialoglycoprotein endopeptidase	A0A0R6PI74	Moraxella_phage	3.9e-58	39.8
VED89490.1\|1729254_1729695_-	ribosomal-protein-alanine acetyltransferase	NA	NA	NA	NA
VED89491.1\|1729669_1730356_-	glycoprotein endopeptidase	NA	NA	NA	NA
VED89493.1\|1730616_1730847_+	Putative transcriptional regulator	NA	NA	NA	NA
VED89495.1\|1730851_1732534_+	metallo-beta-lactamase superfamily protein,putative mRNA degradation ribonucleases J1/J2	S0A5H7	Cellulophaga_phage	1.8e-07	30.6
VED89496.1\|1733160_1734504_-	glutamine synthetase	NA	NA	NA	NA
VED89497.1\|1734552_1734927_-	protein GlnR	NA	NA	NA	NA
VED89499.1\|1735100_1735604_-	membrane protein	NA	NA	NA	NA
VED89501.1\|1735757_1736957_-	phosphoglycerate kinase	NA	NA	NA	NA
VED89503.1\|1737307_1737730_+	Uncharacterised protein	NA	NA	NA	NA
VED89505.1\|1737912_1738926_-	glyceraldehyde-3-phosphate dehydrogenase	NA	NA	NA	NA
VED89507.1\|1739113_1741195_-	elongation factor G	E4ZFJ7	Streptococcus_phage	1.1e-64	28.7
VED89508.1\|1741407_1741878_-	SSU ribosomal protein S7p (S5e)	NA	NA	NA	NA
VED89510.1\|1741896_1742310_-	SSU ribosomal protein S12p (S23e)	NA	NA	NA	NA
VED89511.1\|1742529_1743354_-	pur operon repressor	A0A1X9I6E2	Streptococcus_phage	1.8e-05	28.8
VED89513.1\|1743447_1744389_-	CMP-binding factor	NA	NA	NA	NA
VED89515.1\|1744378_1745653_-	RmuC domain-containing protein	NA	NA	NA	NA
VED89517.1\|1745654_1746287_-	thiamine diphosphokinase	NA	NA	NA	NA
VED89519.1\|1746279_1746939_-	ribulose-phosphate 3-epimerase	NA	NA	NA	NA
VED89521.1\|1746946_1747819_-	ribosome small subunit-dependent GTPase A	NA	NA	NA	NA
VED89523.1\|1748076_1748949_-	dimethyladenosine transferase	NA	NA	NA	NA
VED89525.1\|1749092_1749653_-	primase-like protein	NA	NA	NA	NA
VED89527.1\|1749645_1750422_-	deoxyribonuclease yabD	NA	NA	NA	NA
VED89529.1\|1750475_1750907_-	CoA binding protein	NA	NA	NA	NA
VED89531.1\|1750967_1751282_-	thioredoxin	A0A1J0GW78	Streptomyces_phage	1.1e-16	45.2
VED89533.1\|1751477_1752260_+	protein in Tap1-dppD intergenic region	A0A2K9L8X2	Tupanvirus	4.3e-25	36.5
1752321:1752335	attL	NA	NA	NA	NA
VED89535.1\|1752768_1753044_+\|transposase	transposase, IS5 family	A0A1X9I5T2	Streptococcus_phage	1.5e-20	65.5
VED89537.1\|1753015_1753357_+\|transposase	transposase	A0A1X9I5T2	Streptococcus_phage	1.8e-44	75.5
VED89539.1\|1753644_1753893_+\|transposase	putative transposase	NA	NA	NA	NA
VED89541.1\|1754329_1754665_-\|bacteriocin	bacteriocin transport accessory protein	NA	NA	NA	NA
VED89543.1\|1760759_1761902_-\|tRNA	queuine tRNA-ribosyltransferase	A0A1B1IVQ4	uncultured_Mediterranean_phage	4.2e-85	43.1
VED89545.1\|1762282_1762492_-\|transposase	transposase-like protein	NA	NA	NA	NA
VED89547.1\|1762931_1763066_-	LSU ribosomal protein L34p	NA	NA	NA	NA
VED89549.1\|1763415_1763577_-	Flavodoxin-like fold protein	NA	NA	NA	NA
VED89551.1\|1764289_1764874_+\|integrase	integrase	A0A0N9SIX5	Staphylococcus_phage	1.4e-39	62.0
VED89553.1\|1764950_1766000_-	DNA/RNA-binding protein	NA	NA	NA	NA
VED89555.1\|1766011_1766866_-	preprotein translocase subunit YidC	NA	NA	NA	NA
VED89557.1\|1766933_1767269_-	ribonuclease P protein component	NA	NA	NA	NA
VED89559.1\|1767353_1768808_-	argininosuccinate lyase	NA	NA	NA	NA
VED89561.1\|1769065_1770265_-	argininosuccinate synthase	NA	NA	NA	NA
VED89563.1\|1771587_1771836_-	putative histidine kinase of the competence regulon, ComD	NA	NA	NA	NA
VED89565.1\|1772139_1773594_-\|tRNA	glutamyl-tRNA synthetase	A0A2K9L481	Tupanvirus	6.9e-08	30.3
VED89567.1\|1773775_1775746_-	oligopeptide binding protein 3	NA	NA	NA	NA
VED89569.1\|1775926_1776616_-	50S ribosomal protein L1	NA	NA	NA	NA
VED89571.1\|1776715_1777141_-	50S ribosomal protein L11	NA	NA	NA	NA
VED89574.1\|1777312_1777666_+	integral membrane protein	NA	NA	NA	NA
VED89575.1\|1777760_1778258_-	carbonate dehydratase	NA	NA	NA	NA
VED89577.1\|1778408_1779104_-	HTH DNA-binding protein	NA	NA	NA	NA
VED89579.1\|1779192_1780440_-	DNA repair protein	NA	NA	NA	NA
VED89580.1\|1780732_1781179_-	deoxyuridine 5'-triphosphate nucleotidohydrolase	Q332E8	Clostridium_botulinum_C_phage	1.2e-32	50.0
VED89582.1\|1781393_1781996_+	NADPH-dependent fmn reductase	A0A2P0ZL77	Lactobacillus_phage	1.1e-55	54.7
VED89584.1\|1782014_1783265_+	flavin reductase	A0A2P0ZL82	Lactobacillus_phage	7.6e-56	52.7
VED89586.1\|1783380_1784172_+	formate/nitrite transporter family protein	NA	NA	NA	NA
VED89588.1\|1784180_1784741_+	membrane-bound protein	NA	NA	NA	NA
VED89590.1\|1784856_1785882_+	glycerol-3-phosphate dehydrogenase [NAD(P)+]	NA	NA	NA	NA
VED89592.1\|1785899_1786814_+	UTP--glucose-1-phosphate uridylyltransferase (UDP-glucose pyrophosphorylase) (UDPGP) (Alpha-D-glucosyl-1-phosphate uridylyltransferase) (Uridine diphosphoglucose pyrophosphorylase)	A0A127AW70	Bacillus_phage	6.3e-76	51.5
VED89593.1\|1786859_1787534_-	peptidase, S54 family	NA	NA	NA	NA
VED89595.1\|1787524_1788052_-	5-formyltetrahydrofolate cyclo-ligase	NA	NA	NA	NA
VED89597.1\|1788120_1789254_-	aminoacylase/N-acyl-L-amino acid amidohydrolase/hippurate hydrolase	NA	NA	NA	NA
VED89599.1\|1789331_1790030_-	2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase	NA	NA	NA	NA
VED89600.1\|1790115_1790700_-	haloacid dehalogenase-like hydrolase	NA	NA	NA	NA
VED89602.1\|1790980_1791820_-	methyltransferase domain protein	NA	NA	NA	NA
VED89604.1\|1792175_1792340_+\|bacteriocin	class IIb bacteriocin, lactobin A/cerein 7B family	NA	NA	NA	NA
VED89606.1\|1792387_1792525_+\|bacteriocin	class IIb bacteriocin, lactobin A/cerein 7B family	NA	NA	NA	NA
VED89607.1\|1792577_1792841_+	Uncharacterised protein	NA	NA	NA	NA
VED89609.1\|1792921_1793440_-\|tRNA	tRNA-specific adenosine deaminase	NA	NA	NA	NA
VED89611.1\|1794138_1794531_-	single-strand binding protein	A1EAD1	Streptococcus_phage	8.8e-27	49.2
VED89613.1\|1794735_1794963_-	putative redox protein, regulator of disulfide bond formation	NA	NA	NA	NA
VED89615.1\|1794977_1796009_-	putative transporter component	NA	NA	NA	NA
1795229:1795243	attR	NA	NA	NA	NA
VED89617.1\|1796146_1796770_-	emap domain protein	NA	NA	NA	NA
VED89618.1\|1796779_1797094_-	thioredoxin	NA	NA	NA	NA
VED89620.1\|1797090_1797375_-	membrane protein	NA	NA	NA	NA
VED89622.1\|1797474_1798542_+	glutamyl aminopeptidase	NA	NA	NA	NA
VED89624.1\|1798557_1799328_+	pyrroline-5-carboxylate reductase	A0A1X9I6T5	Streptococcus_phage	1.8e-31	35.4
VED89626.1\|1799357_1800020_-\|protease	metal-dependent membrane protease	NA	NA	NA	NA
VED89628.1\|1800119_1800413_-	membrane protein	NA	NA	NA	NA
VED89630.1\|1800576_1800774_-	transcriptional regulator	NA	NA	NA	NA
VED89632.1\|1801001_1802195_-	acetate kinase	NA	NA	NA	NA
VED89634.1\|1802251_1803208_-	adenine-specific DNA methylase	NA	NA	NA	NA
VED89636.1\|1803252_1803570_-	late competence protein ComGG	NA	NA	NA	NA
VED89638.1\|1803547_1803985_-	competence protein ComGF	NA	NA	NA	NA
VED89640.1\|1803971_1804202_-	type II secretory pathway, pseudopilin PulG	NA	NA	NA	NA
VED89642.1\|1804233_1804671_-	prepilin-type cleavage/methylation N-terminal domain protein	NA	NA	NA	NA
VED89644.1\|1804621_1804948_-	competence protein ComGC	NA	NA	NA	NA
VED89646.1\|1804944_1805808_-	type II secretory pathway/competence component	NA	NA	NA	NA
VED89648.1\|1805926_1806868_-	late competence protein, ABC transporter subunit	NA	NA	NA	NA
VED89650.1\|1807051_1807516_-\|transposase	transposase of family protein	W0UUZ0	Sulfolobus_monocaudavirus	6.1e-19	40.5
VED89652.1\|1807714_1808077_-	DNA binding protein	NA	NA	NA	NA
VED89654.1\|1808249_1809986_-	multidrug ABC transporter ATPase and permease	W8CYL7	Bacillus_phage	2.2e-53	29.5
VED89656.1\|1810003_1810762_-	amino acid transporter	NA	NA	NA	NA
VED89658.1\|1810764_1811652_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.8e-19	29.0
VED89660.1\|1811638_1811830_-	Uncharacterised protein	NA	NA	NA	NA
VED89662.1\|1811838_1812063_-	Uncharacterised protein	NA	NA	NA	NA
VED89664.1\|1812075_1812651_-\|protease	metal-dependent membrane protease	NA	NA	NA	NA

DBSCAN-SWA_14

1875161 : 1940327

Streptococcus_phage(36.0%)

integrase,protease,transposase,tRNA

attL 1869191:1869205|attR 1910721:1910735

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1869191:1869205	attL	NA	NA	NA	NA
VED89805.1\|1875161_1876301_+\|integrase	integrase/recombinase, phage associated protein	Q77YW7	Streptococcus_phage	1.4e-35	28.4
VED89807.1\|1876741_1878010_-	ATPase	A0A127AWE7	Bacillus_phage	8.4e-95	46.4
VED89809.1\|1878179_1878368_+	LSU ribosomal protein L28p	NA	NA	NA	NA
VED89811.1\|1878492_1878759_+	UPF0297 protein SSU05	NA	NA	NA	NA
VED89812.1\|1878758_1879178_+	Holliday junction resolvase-like protein	NA	NA	NA	NA
VED89814.1\|1879285_1879591_+	Ortholog of S. aureus MRSA252 (BX571856) SAR1694	NA	NA	NA	NA
VED89816.1\|1879803_1881450_+	4-amino-4-deoxy-L-arabinose transferase	NA	NA	NA	NA
VED89818.1\|1881548_1883753_+	anaerobic ribonucleoside-triphosphate reductase	A0A0C5KKX3	Enterococcus_phage	2.0e-277	66.2
VED89821.1\|1883842_1883974_+	30S ribosomal protein S10	NA	NA	NA	NA
VED89823.1\|1883975_1884476_+	GNAT family acetyltransferase	NA	NA	NA	NA
VED89825.1\|1884480_1885086_+	anaerobic ribonucleoside-triphosphate reductase activating protein	A0A0C5K925	Enterococcus_phage	5.0e-53	57.2
VED89827.1\|1885105_1885846_-	putative uncharacterized protein conserved in bacteria	A0A1X9I5I0	Streptococcus_phage	3.2e-38	36.7
VED89829.1\|1885931_1886873_-\|tRNA	tyrosyl-tRNA synthetase	NA	NA	NA	NA
VED89831.1\|1886865_1888605_-\|tRNA	aspartyl-tRNA synthetase	A0A1V0SAC0	Catovirus	3.6e-11	28.2
VED89833.1\|1888726_1889149_-	Uncharacterised protein	NA	NA	NA	NA
VED89835.1\|1889156_1890437_-\|tRNA	histidyl-tRNA synthetase	A0A2K9L0H9	Tupanvirus	8.4e-26	25.5
VED89838.1\|1890686_1891799_-	methionine synthase II	A0A218MNE0	uncultured_virus	7.9e-73	42.8
VED89840.1\|1892028_1892211_+	LSU ribosomal protein L32p	NA	NA	NA	NA
VED90035.1\|1892226_1892376_+	LSU ribosomal protein L33p @ LSU ribosomal protein L33p, zinc-independent	NA	NA	NA	NA
VED90040.1\|1892331_1892544_-	Uncharacterised protein	NA	NA	NA	NA
VED90045.1\|1892892_1894377_+	divergent AAA family protein	NA	NA	NA	NA
VED90047.1\|1894432_1895479_-	restriction enzyme BgcI subunit beta	NA	NA	NA	NA
VED90052.1\|1895595_1897668_-	restriction enzyme BgcI subunit alpha	A0A2H4JBT5	uncultured_Caudovirales_phage	1.0e-89	37.6
VED90055.1\|1897648_1898224_-	Uncharacterised protein	NA	NA	NA	NA
VED90057.1\|1898234_1899125_-	Uncharacterised protein	NA	NA	NA	NA
VED90059.1\|1899479_1899911_+	RNA polymerase sigma factor, sigma-70 family	NA	NA	NA	NA
VED90061.1\|1900161_1900482_+	suB0782 undefined product 764400:764714 forward MW:11955	NA	NA	NA	NA
VED90063.1\|1900481_1901570_+	FtsK/SpoIIIE family subfamily	NA	NA	NA	NA
VED90065.1\|1901573_1902173_+	membrane protein	NA	NA	NA	NA
VED90067.1\|1902319_1902934_+	replication protein	NA	NA	NA	NA
VED90069.1\|1902920_1903172_+	phage protein	NA	NA	NA	NA
VED90071.1\|1903258_1904524_+	DNA polymerase III subunit beta	Q9AZK8	Lactococcus_phage	7.2e-54	34.1
VED90073.1\|1904831_1905296_+\|transposase	transposase of family protein	W0UUZ0	Sulfolobus_monocaudavirus	4.0e-18	39.7
VED90074.1\|1905750_1906365_-	NUDIX family hydrolase	NA	NA	NA	NA
VED90076.1\|1906527_1906854_+	PadR family transcriptional regulator	NA	NA	NA	NA
VED90078.1\|1906840_1907425_+	membrane protein	NA	NA	NA	NA
VED90080.1\|1907421_1908267_+	signal peptide	NA	NA	NA	NA
VED90082.1\|1908305_1910675_-	membrane protein	NA	NA	NA	NA
VED90083.1\|1910802_1911342_+	transcriptional regulator	NA	NA	NA	NA
1910721:1910735	attR	NA	NA	NA	NA
VED90085.1\|1911416_1911779_-	membrane protein	NA	NA	NA	NA
VED90088.1\|1911894_1912083_+	Uncharacterised protein	NA	NA	NA	NA
VED90090.1\|1912269_1912881_-	30S ribosomal protein S4	NA	NA	NA	NA
VED90092.1\|1913078_1913381_-\|protease	CAAX amino protease family protein	NA	NA	NA	NA
VED90094.1\|1913404_1914766_-	replicative DNA helicase	A0A1P8VVQ6	Streptococcus_phage	4.6e-155	64.1
VED90096.1\|1914809_1915268_-	50S ribosomal protein L9	NA	NA	NA	NA
VED90098.1\|1915269_1917234_-	signaling protein	NA	NA	NA	NA
VED90100.1\|1917307_1919209_-\|tRNA	tRNA uridine 5-carboxymethylaminomethyl modification protein GidA	NA	NA	NA	NA
VED90102.1\|1919509_1920631_-\|tRNA	tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase	NA	NA	NA	NA
VED90104.1\|1921143_1921563_-	membrane protein	NA	NA	NA	NA
VED90106.1\|1921505_1921913_-	major facilitator superfamily permease	NA	NA	NA	NA
VED90108.1\|1922682_1923072_+\|transposase	truncated IS1193 transposase	A0A1S5SBP9	Streptococcus_phage	4.2e-29	54.1
VED90110.1\|1923141_1923366_+\|transposase	Putative transposase, ISSmu2	NA	NA	NA	NA
VED90112.1\|1923331_1923940_+\|transposase	transposase	A0A1S5SBP9	Streptococcus_phage	1.0e-61	62.3
VED90113.1\|1924211_1925414_+\|transposase	transposase	A0A1X9I619	Streptococcus_phage	1.0e-195	85.8
VED90114.1\|1925639_1926338_-	Immunodominant antigen A	Q4Z8Z7	Staphylococcus_phage	8.6e-25	70.5
VED90115.1\|1926521_1927094_-	LysM domain-containing protein	A0A249XZV3	Enterococcus_phage	9.2e-25	55.4
VED90117.1\|1927390_1928185_-	cobalt ABC transporter permease CbiQ-like protein	NA	NA	NA	NA
VED90119.1\|1928177_1929020_-	cobalt import ATP-binding protein CbiO 1	W6JKT0	Anomala_cuprea_entomopoxvirus	1.2e-17	27.4
VED90121.1\|1928995_1929826_-	cobalt import ATP-binding protein CbiO 2	G9BWD6	Planktothrix_phage	2.4e-21	32.7
VED90122.1\|1929838_1930381_-	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase	NA	NA	NA	NA
VED90124.1\|1930483_1930681_-	XRE-family DNA-binding domain-containing protein	NA	NA	NA	NA
VED90128.1\|1930693_1931251_-	XRE-family DNA-binding domain-containing protein	NA	NA	NA	NA
VED90133.1\|1931309_1932587_-	peptidase	A0A167R9K4	Powai_lake_megavirus	1.3e-21	30.0
VED90137.1\|1932588_1933839_-	peptidase M16 inactive domain protein	A0A1X9I714	Streptococcus_phage	9.5e-91	39.6
VED90141.1\|1933916_1934294_+	S4 domain-containing protein YaaA	A0A1X9I5V8	Streptococcus_phage	3.0e-24	72.4
VED90144.1\|1934296_1935397_+	DNA replication and repair protein RecF	NA	NA	NA	NA
VED90146.1\|1935579_1937061_-	inositol-5-monophosphate dehydrogenase	A0A1V0SHK8	Klosneuvirus	1.3e-94	40.0
VED90148.1\|1937335_1937626_-\|transposase	transposase of family protein	A0A1P8BMC0	Lactococcus_phage	1.0e-08	37.8
VED90150.1\|1938003_1939026_-\|tRNA	tryptophanyl-tRNA synthetase	NA	NA	NA	NA
VED90151.1\|1939454_1940327_+	YitT family protein	M1Q1P6	Streptococcus_phage	2.2e-30	32.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage