CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
LR134419	Legionella adelaidensis strain NCTC12735 genome assembly, plasmid: 10	0 crisprs	NA	0	0
LR134432	Legionella adelaidensis strain NCTC12735 genome assembly, plasmid: 23	0 crisprs	cas3	0	0
LR134428	Legionella adelaidensis strain NCTC12735 genome assembly, plasmid: 19	0 crisprs	DEDDh	0	0
LR134418	Legionella adelaidensis strain NCTC12735 genome assembly, plasmid: 9	0 crisprs	DinG,WYL,csa3	0	1
LR134423	Legionella adelaidensis strain NCTC12735 genome assembly, plasmid: 14	0 crisprs	NA	0	0
LR134417	Legionella adelaidensis strain NCTC12735 genome assembly, plasmid: 8	0 crisprs	NA	0	0
LR134412	Legionella adelaidensis strain NCTC12735 genome assembly, plasmid: 3	0 crisprs	NA	0	0
LR134437	Legionella adelaidensis strain NCTC12735 genome assembly, plasmid: 28	0 crisprs	NA	0	0
LR134435	Legionella adelaidensis strain NCTC12735 genome assembly, plasmid: 26	0 crisprs	NA	0	0
LR134411	Legionella adelaidensis strain NCTC12735 genome assembly, plasmid: 2	0 crisprs	NA	0	0
LR134422	Legionella adelaidensis strain NCTC12735 genome assembly, plasmid: 13	0 crisprs	NA	0	1
LR134421	Legionella adelaidensis strain NCTC12735 genome assembly, plasmid: 12	0 crisprs	cas3	0	1
LR134415	Legionella adelaidensis strain NCTC12735 genome assembly, plasmid: 6	0 crisprs	NA	0	0
LR134436	Legionella adelaidensis strain NCTC12735 genome assembly, plasmid: 27	0 crisprs	NA	0	0
LR134426	Legionella adelaidensis strain NCTC12735 genome assembly, plasmid: 17	0 crisprs	NA	0	0
LR134413	Legionella adelaidensis strain NCTC12735 genome assembly, plasmid: 4	0 crisprs	NA	0	0
LR134420	Legionella adelaidensis strain NCTC12735 genome assembly, plasmid: 11	0 crisprs	NA	0	1
LR134438	Legionella adelaidensis strain NCTC12735 genome assembly, plasmid: 29	0 crisprs	NA	0	0
LR134434	Legionella adelaidensis strain NCTC12735 genome assembly, plasmid: 25	0 crisprs	NA	0	0
LR134416	Legionella adelaidensis strain NCTC12735 genome assembly, plasmid: 7	0 crisprs	NA	0	0
LR134425	Legionella adelaidensis strain NCTC12735 genome assembly, plasmid: 16	0 crisprs	NA	0	0
LR134427	Legionella adelaidensis strain NCTC12735 genome assembly, plasmid: 18	1 crisprs	NA	1	0
LR134429	Legionella adelaidensis strain NCTC12735 genome assembly, plasmid: 20	0 crisprs	NA	0	0
LR134431	Legionella adelaidensis strain NCTC12735 genome assembly, plasmid: 22	0 crisprs	cas3	0	0
LR134410	Legionella adelaidensis strain NCTC12735 genome assembly, chromosome: 1	0 crisprs	NA	0	0
LR134430	Legionella adelaidensis strain NCTC12735 genome assembly, plasmid: 21	0 crisprs	NA	0	0
LR134414	Legionella adelaidensis strain NCTC12735 genome assembly, plasmid: 5	0 crisprs	NA	0	0
LR134433	Legionella adelaidensis strain NCTC12735 genome assembly, plasmid: 24	0 crisprs	cas3	0	0
LR134424	Legionella adelaidensis strain NCTC12735 genome assembly, plasmid: 15	0 crisprs	NA	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: LR134427_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

LR134427_1

6321-6406

Orphan

Consensus_repeat	Method
AAAAAATAAAAATACCGATTAAAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of LR134427_1

>merge|LR134427|1|6321-6406|CRISPRCasFinder
AAAAAATAAAAATACCGATTAAAATTAATTCTTTACTCATTTACGCCGCAAGCAAGTTCGCCAAAAAATAAAAATACCCATTAAAA

>LR134427|1|1|6321-6406|CRISPRCasFinder
AAAAAATAAAAATACCGATTAAAA	TTAATTCTTTACTCATTTACGCCGCAAGCAAGTTCGCC
AAAAAATAAAAATACCCATTAAAA

Protein	Signature genes	Signature genes Name	Protein_function
LR134427.1\|VEH85522.1\|3552_5340_+\|Superfamily-II-DNA-helicase	unknown	unknown	gnl\|CDD\|273594
LR134427.1\|VEH85523.1\|5480_5687_-\|protein-with-a-Dodecin-like-topology	unknown	unknown	gnl\|CDD\|377810
LR134427.1\|VEH85521.1\|2288_3446_-\|acyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173851
LR134427.1\|VEH85527.1\|7258_9211_-\|cytochrome-C-type-biogenesis-protein-CcmF	unknown	unknown	gnl\|CDD\|224061
LR134427.1\|VEH85531.1\|10658_11330_-\|heme-exporter-protein-CcmB	unknown	unknown	gnl\|CDD\|200083
LR134427.1\|VEH85518.1\|78_456_+\|glycoxylase	unknown	unknown	gnl\|CDD\|319911
LR134427.1\|VEH85535.1\|13648_14233_-\|Uncharacterised-protein	unknown	unknown	unknown
LR134427.1\|VEH85526.1\|6729_7266_-\|cytochrome-C-biogenesis-protein	unknown	unknown	gnl\|CDD\|239308
LR134427.1\|VEH85532.1\|11326_11923_-\|heme-exporter-protein-CcmA	unknown	unknown	gnl\|CDD\|184127
LR134427.1\|VEH85533.1\|11927_12860_-\|signal-peptide-peptidase-SppA	unknown	unknown	gnl\|CDD\|236978
LR134427.1\|VEH85534.1\|13161_13473_+\|Uncharacterised-protein	unknown	unknown	unknown
LR134427.1\|VEH85519.1\|448_1498_-\|enoyl-CoA-hydratase/carnithine-racemase	unknown	unknown	gnl\|CDD\|379770
LR134427.1\|VEH85530.1\|9798_10542_-\|heme-exporter-protein-CcmC	unknown	unknown	gnl\|CDD\|273492
LR134427.1\|VEH85520.1\|1501_2278_-\|enoyl-CoA-hydratase	unknown	unknown	gnl\|CDD\|180270
LR134427.1\|VEH85528.1\|9212_9644_-\|cytochrome-c-type-biogenesis-protein-CcmE	unknown	unknown	gnl\|CDD\|237317
LR134427.1\|VEH85529.1\|9640_9802_-\|heme-exporter-protein-CcmD	unknown	unknown	gnl\|CDD\|274445

Protein	Function_ID	Function_description	E-value
LR134427.1\|VEH85522.1\|3552_5340_+\|Superfamily-II-DNA-helicase	gnl\|CDD\|273594	TIGR01389, recQ, ATP-dependent DNA helicase RecQ. The ATP-dependent DNA helicase RecQ of E. coli is about 600 residues long. This model represents bacterial proteins with a high degree of similarity in domain architecture and in primary sequence to E. coli RecQ. The model excludes eukaryotic and archaeal proteins with RecQ-like regions, as well as more distantly related bacterial helicases related to RecQ. [DNA metabolism, DNA replication, recombination, and repair].	0
LR134427.1\|VEH85523.1\|5480_5687_-\|protein-with-a-Dodecin-like-topology	gnl\|CDD\|377810	pfam07311, Dodecin, Dodecin. Dodecin is a flavin-binding protein,found in several bacteria and few archaea and represents a stand-alone version of the SHS2 domain. It most closely resembles the SHS2 domains of FtsA and Rpb7p, and represents a single domain small-molecule binding form.	1.32378e-22
LR134427.1\|VEH85521.1\|2288_3446_-\|acyl-CoA-dehydrogenase	gnl\|CDD\|173851	cd01162, IBD, Isobutyryl-CoA dehydrogenase. Isobutyryl-CoA dehydrogenase (IBD) catalyzes the alpha, beta- dehydrogenation of short branched chain acyl-CoA intermediates in valine catabolism. It is predicted to be a homotetramer.	0
LR134427.1\|VEH85527.1\|7258_9211_-\|cytochrome-C-type-biogenesis-protein-CcmF	gnl\|CDD\|224061	COG1138, CcmF, Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones].	0
LR134427.1\|VEH85531.1\|10658_11330_-\|heme-exporter-protein-CcmB	gnl\|CDD\|200083	TIGR01190, Heme_exporter_protein_B, heme exporter protein CcmB. This model describes the cyt c biogenesis protein encoded by ccmB in bacteria. Bacterial c-type cytochromes are located on the periplasmic side of the cytoplasmic membrane. Several gene products encoded in a locus designated as 'ccm' are implicated in the transport and assembly of the functional cytochrome C. This cluster includes genes: ccmA;B;C;D;E;F;G and H. The posttranslational pathway includes the transport of heme moiety, the secretion of the apoprotein and the covalent attachment of the heme with the apoprotein. The proteins ccmA and B represent an ABC transporter; ccmC and D participate in heme transfer to ccmE, which function as a periplasmic heme chaperone. The presence of ccmF, G and H is suggested to be obligatory for the final functional assembly of cytochrome C. [Protein fate, Protein and peptide secretion and trafficking, Transport and binding proteins, Other].	2.54948e-43
LR134427.1\|VEH85518.1\|78_456_+\|glycoxylase	gnl\|CDD\|319911	cd07247, SgaA_N_like, N-terminal domain of Streptomyces griseus SgaA and similar domains. SgaA suppresses the growth disturbances caused by high osmolarity and a high concentration of A-factor, a microbial hormone, during the early growth phase in Streptomyces griseus. A-factor (2-isocapryloyl-3R-hydroxymethyl-gamma-butyrolactone) controls morphological differentiation and secondary metabolism in Streptomyces griseus. It is a chemical signaling molecule that at a very low concentration acts as a switch for yellow pigment production, aerial mycelium formation, streptomycin production, and streptomycin resistance. The structure and amino acid sequence of SgaA are closely related to a group of antibiotics resistance proteins, including bleomycin resistance protein, mitomycin resistance protein, and fosfomycin resistance proteins. SgaA might also function as a streptomycin resistance protein.	1.63867e-29
LR134427.1\|VEH85526.1\|6729_7266_-\|cytochrome-C-biogenesis-protein	gnl\|CDD\|239308	cd03010, TlpA_like_DsbE, TlpA-like family, DsbE (also known as CcmG and CycY) subfamily; DsbE is a membrane-anchored, periplasmic TRX-like reductase containing a CXXC motif that specifically donates reducing equivalents to apocytochrome c via CcmH, another cytochrome c maturation (Ccm) factor with a redox active CXXC motif. Assembly of cytochrome c requires the ligation of heme to reduced thiols of the apocytochrome. In bacteria, this assembly occurs in the periplasm. The reductase activity of DsbE in the oxidizing environment of the periplasm is crucial in the maturation of cytochrome c.	3.09336e-56
LR134427.1\|VEH85532.1\|11326_11923_-\|heme-exporter-protein-CcmA	gnl\|CDD\|184127	PRK13540, PRK13540, cytochrome c biogenesis protein CcmA; Provisional.	6.09734e-64
LR134427.1\|VEH85533.1\|11927_12860_-\|signal-peptide-peptidase-SppA	gnl\|CDD\|236978	PRK11778, PRK11778, putative inner membrane peptidase; Provisional.	3.6511e-178
LR134427.1\|VEH85519.1\|448_1498_-\|enoyl-CoA-hydratase/carnithine-racemase	gnl\|CDD\|379770	pfam16113, ECH_2, Enoyl-CoA hydratase/isomerase. This family contains a diverse set of enzymes including: enoyl-CoA hydratase, napthoate synthase, carnitate racemase, 3-hydroxybutyryl-CoA dehydratase and dodecanoyl-CoA delta-isomerase. This family differs from pfam00378 in the structure of it's C-terminus.	1.88011e-167
LR134427.1\|VEH85530.1\|9798_10542_-\|heme-exporter-protein-CcmC	gnl\|CDD\|273492	TIGR01191, Heme_exporter_protein_C, heme exporter protein CcmC. This model describes the cyt c biogenesis protein encoded by ccmC in bacteria. It must be noted an arabidopsis, a tritcum and a piscum plant proteins were recognizable in the clade. Quite likely they are of organellar origin. Bacterial c-type cytocromes are located on the periplasmic side of the cytoplasmic membrane. Several gene products encoded in a locus designated as 'ccm' are implicated in the transport and assembly of the functional cytochrome C. This cluster includes genes, ccmA;B;C;D;E;F;G and H. The posttranslational pathway includes the transport of heme moiety, the secretion of the apoprotein and the covalent attachment of the heme with the apoprotein. The proteins ccmA and B represent an ABC transporter; ccmC and D participate in the heme transfer to ccmE, which function as a periplasmic heme chaperone. The presence of ccmF, G and H is suggested to be obligatory for the final functional assembly of cytochrome c. [Protein fate, Protein and peptide secretion and trafficking, Transport and binding proteins, Other].	1.19397e-71
LR134427.1\|VEH85520.1\|1501_2278_-\|enoyl-CoA-hydratase	gnl\|CDD\|180270	PRK05809, PRK05809, short-chain-enoyl-CoA hydratase.	1.2509e-87
LR134427.1\|VEH85528.1\|9212_9644_-\|cytochrome-c-type-biogenesis-protein-CcmE	gnl\|CDD\|237317	PRK13254, PRK13254, cytochrome c maturation protein CcmE.	4.37234e-65
LR134427.1\|VEH85529.1\|9640_9802_-\|heme-exporter-protein-CcmD	gnl\|CDD\|274445	TIGR03141, cytochro_ccmD, heme exporter protein CcmD. The model for this protein family describes a small, hydrophobic, and only moderately well-conserved protein, tricky to identify accurately for all of these reasons. However, members are found as part of large operons involved in heme export across the inner membrane for assembly of c-type cytochromes in a large number of bacteria. The gray zone between the trusted cutoff (13.0) and noise cutoff (4.75) includes both low-scoring examples and false-positive matches to hydrophobic domains of longer proteins.	2.51848e-11

>LR134427.1|VEH85523.1|5480_5687_-|protein-with-a-Dodecin-like-topology
MVDKVYQVIELVGTSQSNIEDAINNAIAQAAKSHGKLDWYEVLETRGFIDGSRSKYYQVHLKIGCHTH
>LR134427.1|VEH85522.1|3552_5340_+|Superfamily-II-DNA-helicase
MESQKPTNAREILKKYYGFDSFRSSQEEIINDLTAGSDILVLMPTGGGKSLCYQIPSLLREGVGIVVSPLIALMEDQVSALKTLGIKAAYYNSSLNASESKEVLSNLHRGDLNLLYVAPERLLSESFLSRLQECPIALFAIDEAHCISQWGHDFRPEYAALGVLKKRFPTVPIIALTATADKQTQQDIVQKLHFIPKQYIASFNRPNIYYQVIAKNKPFHQLITFLEKEKQQSGIIYCGTRATVERVTEKLIECGHKARAYHAGLMHKERKEVQHLFRYDQIDIVVATIAFGMGIDKPNVRFVIHVDLPKNIESYYQETGRAGRDGMPSKALLLYEPGDSARIRVFIEGLSQEEQKKIEHHKLNHMLAFAEASACRRQVLLQYFNETFASKCNYCDICDNPPEMTDATINAQKFLSCVYRLRQTFGLNHIIDVLRGSASEKLQKLAHHQLSTFGIGKDYPTTYWKHLAWQLIHREYCYQDINQYHVVRLTSKAVPLLRGEEKINLAIFKDKDKQTVKNKKDYSKASLNPLFEKLRLLRRQLAEEEDKPPFMIFSDATLHDMIKVNPKTLDEMLEVSGVGQHKLELYGERFLEALM
>LR134427.1|VEH85521.1|2288_3446_-|acyl-CoA-dehydrogenase
MDFQLSEENRAFRQMAADFARDKIQPYADSWDEDHHFPVEVFKQAAQLGMGGIVANEDIGGAGLPRLASALIFEQLATGCVSTSAYLSIHNMVVSLIDRYGSDELRRVWGPKLTSMDVLASYCLTEPESGSDAASLRTTAKREGDYYLVNGTKAFISGAGVSDVYLCMVRTGNEKHHGITSLLIEKDTLGLSFGKLEKKMGWRNQPTAMIYFENCRVPVKNRVGDEGQGFKIALNALNGGRVSIAACALGGALSCLRLTQSYMHERKQFGKALKEMQGLRFYFADMLTNFDAARLMVYRAADSLDRNNAKAPMYCAMAKQLATDFAFAISDKAMQLHGGYGYLRDYQIERIFRDLRVHQILEGTNEIMREIIAKSVLDDEKYFLE
>LR134427.1|VEH85520.1|1501_2278_-|enoyl-CoA-hydratase
MSVIEQQLNDSGILTITLNRPEKLNALNNEVLQALRELLSYAKDKESVKALLITGKGKAFCAGADINRLAECDAESGYQFASFGQEVFRQFETLGKPSIAAINGFAFGGGCELAMATTIRIASQNAQFGQPEVKLGVIPGYGGTQRLARLVGKGRALDLCLTGRFIDAQTALQWGLVTHVIEEDKLLDEAEKLLKGILSMAPLAVRGVMEVIDHGYDLALNEALHLEAIHFAKTCASADKAEGVQAFLEKRAATFKGK
>LR134427.1|VEH85519.1|448_1498_-|enoyl-CoA-hydratase/carnithine-racemase
MNDSILFTQEKHIGLITLNRPTALNALTLPMILALQEQLSAWEQDNSIHAVVIKAEEGKAFCAGGDVRWLYEAGKSNDPQQMQFFLHEYRLNHYINQYKKPYIALMNGITMGGGVGISLHGSHPVASENFLFAMPETGIGFFPDIGASHLLSRCPYEFGTYLALTGHRLQAEEAYHVGLVKYLVTANEMNTLLAALINTDLSQNPAQEVDACIKRFAFSITSQVPQDATKIASIFNKSTMEEILAQLDANEHNFFQTTKDILNQKAPLSLKVTLRQIKQAKHLSMGECVKMDYCLVSHFMTASDFYEGVRALLIDKDKNPQWSPQTLSEVTNDQVEAYFTCKDRPLLLT
>LR134427.1|VEH85518.1|78_456_+|glycoxylase
MPKPGEFAWNRLMARDINEAKAFYGSLFGWETIETNIEGEPFYIFKKEKTLIAGLRRLSDVPGATIPHWMSYITVNDIHATIQKAERLGAKLTTRVLTISNLGRVAVLLDPGGAYIGFFEPTTLK
>LR134427.1|VEH85526.1|6729_7266_-|cytochrome-C-biogenesis-protein
MTKLWKLTPLLIFAILGVFFWRGLFTNPHLIPSVQVGKPLAKVTLPLLDKPNNHAPIDSLKGKIHILNVWASWCSSCSEEQYFLVDLAHQGVPILGLNYKDSPIDAKKWLQDWGNPYQQVFTDEKGKVAIELGVYGTPETFLIDKKGIILYRHAGVLNSAIWQKEFLPRILNAEKVNA
>LR134427.1|VEH85527.1|7258_9211_-|cytochrome-C-type-biogenesis-protein-CcmF
MVAEIGVFSLILALLFALLIAILPSLGMWLKKPDYIASVSIYVNVHFFFIAISYLCLTFCFLTNDFSVWYVLNNSSLSLPWFYKLCAVWGGHEGSMLLWVAILSVWMLGVNFFSDSLPQRIRSKVLVILGVISAGFILFLLATSNPFLRQFQILDSVGRDLNPLLQDPGFLFHPPMLYMGYVGFSVAFAFALAALWEGKIESAWAKWTRPWTLAAWCCLTTGITLGSWWAYRELGWGGWWFWDPVENASFMPWLVGTALIHSLAVSEQRQQFKAWTLLLAISAFSLSLIGTFLVRSGVLTSVHAFAVDPARGLYILLFLLFVIGGSLTLFAFRVQTVKNHTRPALFSKESALLLNNVFLVVAMLTVLLGTTYPLLIDGLGLGKLSVGAPYFNTVFIPLMIPLFLLMGLGIHLRWGEDNVGSLFTKTRNLIGIAVAGGCFVLYFFAPHVELSVLVGVILSSWIFVSTFNLILRRVKERGFDGINQAFWGMVTAHFGVAITVIGISVSTGYGIVKDVRLAPGESVQMAGYLIQFGEERELNGPNYHGTQARFLITSKGKEKTIYPEKRIYNIGQMPMTDAAIDANPFRDIYIALAEPVDDNAWAVRIYYKPFIRWIWGGGFFILFGGVIALSDRRYYLTNRKIAKKHEVVYD
>LR134427.1|VEH85528.1|9212_9644_-|cytochrome-c-type-biogenesis-protein-CcmE
MKASRKRRLILSVTLTASLGLVAGLILYALRQNVSLFYSPTQIVNNEAPLHHIIRAGGVVQKGSLVREKNSLSVHFLLTDFKNTIEVSYEGSLPDLFREGQGVVAFGQLIDDKHFKAREILAKHDENYMPPEVKSALEKNEVG
>LR134427.1|VEH85529.1|9640_9802_-|heme-exporter-protein-CcmD
MSQFFQWLSMGGYSLYIWPAYGLVCVVLVMNLLGIKWQKERTFKKLQQWFKRQ
>LR134427.1|VEH85530.1|9798_10542_-|heme-exporter-protein-CcmC
MWKFLYRLASPKNFYQFSERWTFTVGISSLLLITIGIVWGLCFAPADYQQGDAFRIIYIHVPGAFLSMALYAGMGFLAFLLLVWQIKLAGLLISVFAQLGAAMAFIALITGSLWGKPMWGTWWIWDARLTSELILLLLYAAIIATSNAYQNKDQSDKMVAILVLVGLVDLPIIHYSVYWWNTLHQGATLTLFSKPKIHSSMLYPLLINLFGFTLYCIFAILLKARAELLSRERRQSWVKEIVEGVKQ
>LR134427.1|VEH85531.1|10658_11330_-|heme-exporter-protein-CcmB
MKSLFIQQVQRELLLNSRQYNLLINSCLFYLMILVFFPLSMPADPQLLRTIAPGIFWMALLLSLLLSAERLFQQDYEDGVLEQWIVAGTSMSLLVCAKIITQWVLNIIPIILFTPLIALLFDLKAFEIFILEVSLFLGSPAILYLCALVAAFSLGIKQKGIFMALILLPLTIPILIFGSSALQLAMQQLPTNGILALLLAISLIAITLLPFAIASVIRFSLAE
>LR134427.1|VEH85532.1|11326_11923_-|heme-exporter-protein-CcmA
MLAVKNLCFDYADNPLLGDVTFTVQAGELLHLRGANGSGKTTLIRLLAGILSPQSGEISYNQKPIHQQLAEYHQHICYVGHKPSISLFLTPKENCEFEFKKKHAADYKKLMDELFLHEVSDLPCGLLSAGQRRKVGLLRLQLTQSKLWLLDEPFVALDQDSIYIIGKWCNEHLLQGGQIVLTSHQDLPFSYSCKEYLL
>LR134427.1|VEH85533.1|11927_12860_-|signal-peptide-peptidase-SppA
MEFLANYGLFALKTFTLVIAVLLLTAGIFAISRKPRPKLEIIPLNKQYQKIKLRMQKEILGKSEKIKKEKARKPSVFVIDFNGDIRASQTEQLREEVSAILAIAKPEDEIVVRVESPGGAVNGYGLAASQLHRIRQKGIKLTACIDKMAASGGYLMACVANKVIAAPFAILGSIGVVAQIPNFHRWLKKNDIDVELLTAGEYKRTLTLFGENTEKGRQKFQEDLEQIHATFKEYVLKNREELDIHKVATGEHWLAKDAMDLKLVDELKTSDEYLAEKMADYNLYQIKVHGKQSFLDKLLKPGMKLLHPWG
>LR134427.1|VEH85534.1|13161_13473_+|Uncharacterised-protein
MSDLKSKLPDLKELGSMTSKLFKDLKSSVGEIIDDYKKKREQAEVEAKTTEVKTEAKPAEPAKTASTEPTPETAEKKQAQVVEEPPPATQEPPVPPTDVDKEA
>LR134427.1|VEH85535.1|13648_14233_-|Uncharacterised-protein
MFAKLFCFLSVFFLSFSIQAQEAAEKEFYRNFWYPTYHGKRLNYCSFKGKCGQPVATRYCQMLGYKDANKQVIDYNVGLTNFLGTRAECRGWRCSGFKLITCVGKIGHKPAEKYYYRYRRFPLPRFQHYRVDWCYKNGTGCGQRAAYSYCRMLGYSKTKDYKIEPHVPATKALGNQRLCFGNQCNGFSYISCYR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
LR134427_1	1.1\|6345\|38\|LR134427\|CRISPRCasFinder	6345-6382	38	NZ_LR134427	Legionella adelaidensis strain NCTC12735 genome assembly, plasmid: 18	6345-6382	0	1.0

1. spacer 1.1|6345|38|LR134427|CRISPRCasFinder matches to NZ_LR134427 (Legionella adelaidensis strain NCTC12735 genome assembly, plasmid: 18) position: , mismatch: 0, identity: 1.0

ttaattctttactcatttacgccgcaagcaagttcgcc	CRISPR spacer
ttaattctttactcatttacgccgcaagcaagttcgcc	Protospacer
**************************************

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

187633 : 253318

Moraxella_phage(10.53%)

integrase,protease,tRNA,transposase

attL 192991:193016|attR 259237:259262

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
VEH84778.1\|187633_188701_-\|protease	membrane associated zinc metalloprotease	NA	NA	NA	NA
VEH84779.1\|188720_188999_-	Uncharacterised protein	NA	NA	NA	NA
VEH84780.1\|189139_190408_+\|tRNA	glutamyl tRNA reductase	NA	NA	NA	NA
VEH84781.1\|190391_191480_+	peptide chain release factor	NA	NA	NA	NA
VEH84782.1\|191472_192348_+	HemK protein	NA	NA	NA	NA
VEH84783.1\|192485_192962_+	DnaK suppressor protein	NA	NA	NA	NA
192991:193016	attL	NA	NA	NA	NA
VEH84784.1\|193101_194352_-	3-deoxy-D-manno-oct-2-ulosonic acid transferase	NA	NA	NA	NA
VEH84785.1\|194629_195481_+	DNA binding protein DnaJ, heat shock protein	NA	NA	NA	NA
VEH84786.1\|195589_196504_-	lysophospholipase A	NA	NA	NA	NA
VEH84787.1\|196793_198455_-	ATP-dependent RNA helicase DeaD	A0A1V0SBR7	Catovirus	1.7e-55	33.1
VEH84788.1\|198613_200641_-	2,4-dienoyl-CoA reductase FadH	NA	NA	NA	NA
VEH84789.1\|200656_201961_-	adenylosuccinate synthetase	A0A2R8FF47	Brazilian_cedratvirus	4.6e-72	36.6
VEH84790.1\|202162_203083_-	HflC protein	A0A220BZZ1	Staphylococcus_phage	4.3e-08	27.3
VEH84791.1\|203082_204237_-\|protease	protease subunit HflK	NA	NA	NA	NA
VEH84792.1\|204597_208815_-	SdhA, GRIP coiled-coil protein GCC185	NA	NA	NA	NA
VEH84793.1\|208824_209502_-\|tRNA	tRNA (m7G46) methyltransferase, SAM-dependent	NA	NA	NA	NA
VEH84794.1\|209713_209950_+	50S ribosomal protein L28	NA	NA	NA	NA
VEH84795.1\|209967_210132_+	50S ribosomal protein L33	NA	NA	NA	NA
VEH84796.1\|210391_211780_+	RNA polymerase sigma-54 factor (sigma-L)	NA	NA	NA	NA
VEH84797.1\|211807_212104_+	ribosome-associated, sigma 54 modulation protein	NA	NA	NA	NA
VEH84798.1\|212176_212446_+	sugar transport PTS system phosphocarrier HPr protein	NA	NA	NA	NA
VEH84799.1\|212646_213396_-	CDP-diacylglycerol-serine-O- phosphatidyltransferase	NA	NA	NA	NA
VEH84800.1\|213575_213866_+	PhnO-related protein	NA	NA	NA	NA
VEH84801.1\|213965_214475_-	Uncharacterised protein	NA	NA	NA	NA
VEH84802.1\|214496_215027_-	protein IcmC (DotV)-like protein	NA	NA	NA	NA
VEH84803.1\|215147_215891_+	phenol hydroxylase	NA	NA	NA	NA
VEH84804.1\|215905_216916_+	fructose-bisphosphate aldolase, class I	A0A0K0KVJ8	Prochlorococcus_phage	8.3e-69	46.5
VEH84805.1\|216942_217704_-	endonuclease/exonuclease/phosphatase family protein	NA	NA	NA	NA
VEH84806.1\|217768_219394_-\|protease	zinc metalloprotease	NA	NA	NA	NA
VEH84807.1\|219638_220067_+	3-dehydroquinate dehydratase	NA	NA	NA	NA
VEH84808.1\|220086_220554_+	acetyl-CoA carboxylase biotin carboxyl carrier protein	NA	NA	NA	NA
VEH84809.1\|220562_221912_+	acetyl CoA carboxylase, biotin carboxylase subunit	NA	NA	NA	NA
VEH84810.1\|221904_222762_+	ribosomal protein L11 methyltransferase	NA	NA	NA	NA
VEH84811.1\|222784_223804_-	malate dehydrogenase	NA	NA	NA	NA
VEH84812.1\|223875_225012_+	oxygen-independent coproporphyrinogen III oxidase	NA	NA	NA	NA
VEH84813.1\|225106_225835_+	transmembrane protein	NA	NA	NA	NA
VEH84814.1\|225831_226953_-	O-sialoglycoprotein endopeptidase	A0A0R6PI74	Moraxella_phage	2.3e-88	49.7
VEH84815.1\|227132_227360_+	30S ribosomal protein S21	NA	NA	NA	NA
VEH84816.1\|227362_227821_+	Transamidase GatB domain protein	A0A292GL36	Xanthomonas_phage	1.9e-20	47.4
VEH84817.1\|227839_229573_+	DNA primase	A0A0K1LMQ9	Caulobacter_phage	8.3e-61	34.7
VEH84818.1\|229674_231552_+	RNA polymerase sigma 70 factor (RpoD)	A0A2I7SAT0	Vibrio_phage	7.7e-36	34.1
VEH84819.1\|231948_234369_-	Uncharacterised protein	NA	NA	NA	NA
VEH84820.1\|234371_235370_-	Uncharacterised protein	NA	NA	NA	NA
VEH84821.1\|235862_236930_+\|integrase	phage integrase	A4PE72	Ralstonia_virus	5.5e-31	33.7
VEH84822.1\|236940_237600_+	Uncharacterised protein	NA	NA	NA	NA
VEH84823.1\|237780_238002_+	Uncharacterised protein	NA	NA	NA	NA
VEH84824.1\|238004_238301_+	Uncharacterised protein	NA	NA	NA	NA
VEH84825.1\|238302_239139_+	Uncharacterised protein	U6C6J3	Ralstonia_phage	1.9e-26	28.1
VEH84826.1\|239140_240985_+	DNA primase (bacterial type)	A0A0U4B0G9	Pseudomonas_phage	5.0e-165	48.3
VEH84827.1\|241014_241479_+	Uncharacterised protein	NA	NA	NA	NA
VEH84828.1\|241562_242009_+	Uncharacterized phage-associated protein	I6R0L8	Salmonella_phage	2.9e-42	57.0
VEH84829.1\|242010_242424_+	Uncharacterised protein	NA	NA	NA	NA
VEH84830.1\|242480_242747_-	Regulatory protein munI	NA	NA	NA	NA
VEH84831.1\|242909_243263_+	Uncharacterised protein	NA	NA	NA	NA
VEH84832.1\|243277_243541_-	Uncharacterised protein	NA	NA	NA	NA
VEH84833.1\|243744_244542_+	Uncharacterised protein	NA	NA	NA	NA
VEH84834.1\|244658_244904_+	Uncharacterised protein	NA	NA	NA	NA
VEH84835.1\|245193_245556_-\|integrase	integrase	A0A2H4IYV5	uncultured_Caudovirales_phage	1.4e-15	60.6
VEH84836.1\|245500_246370_-\|transposase	transposase-like protein	A0A1S5SBP9	Streptococcus_phage	2.9e-14	25.8
VEH84837.1\|246707_247187_-\|integrase	integrase	A0A059VF45	Pseudomonas_phage	3.8e-32	47.1
VEH84838.1\|247289_247595_+\|transposase	transposase	NA	NA	NA	NA
VEH84839.1\|247591_248278_+\|transposase	transposase	A0A0P0I4A4	Acinetobacter_phage	1.1e-40	45.1
VEH84840.1\|248390_248567_-	Uncharacterised protein	NA	NA	NA	NA
VEH84841.1\|248667_249093_-	Antitoxin HigA	A0A0P0ZCT8	Stx2-converting_phage	1.9e-06	35.0
VEH84842.1\|249095_249383_-	mRNA interferase HigB	NA	NA	NA	NA
VEH84843.1\|249520_249802_-\|integrase	prophage CP4-6 integrase	A0A0R6PGY7	Moraxella_phage	3.0e-13	45.6
VEH84844.1\|249858_250497_-\|integrase	phage integrase	NA	NA	NA	NA
VEH84845.1\|250757_251024_+	ATPase	NA	NA	NA	NA
VEH84846.1\|251191_251713_-	Uncharacterised protein	NA	NA	NA	NA
VEH84847.1\|251703_252672_-	Uncharacterised protein	NA	NA	NA	NA
VEH84848.1\|252967_253318_+\|transposase	transposase	A0A0P0I4A4	Acinetobacter_phage	1.3e-16	50.0
259237:259262	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. LR134421

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

10798 : 19193

Staphylococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
VEH85230.1\|10798_11722_+	exonuclease involved in removal of stalled replication fork	A0A222YY21	Escherichia_phage	6.7e-33	31.0
VEH85231.1\|11749_12010_+	Uncharacterised protein	NA	NA	NA	NA
VEH85232.1\|12112_12340_+	Uncharacterised protein	NA	NA	NA	NA
VEH85233.1\|12476_13238_-	competence lipoprotein ComL	NA	NA	NA	NA
VEH85234.1\|13594_14416_-	2-dehydro-3-deoxyphosphooctonate aldolase	E3T537	Cafeteria_roenbergensis_virus	7.2e-55	44.0
VEH85235.1\|14412_16056_-	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	5.9e-157	52.6
VEH85236.1\|16285_17497_-	Riboflavin biosynthesis protein	A0A2H4PQS2	Staphylococcus_phage	5.8e-101	48.6
VEH85237.1\|17515_18124_-	riboflavin synthase subunit alpha	A0A2H4PQS5	Staphylococcus_phage	2.9e-24	36.4
VEH85238.1\|18125_19193_-	riboflavin biosynthesis protein RibD	A0A1V0SE20	Indivirus	2.0e-33	28.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. LR134420

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

66257 : 72954

Acinetobacter_phage(42.86%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
VEH85104.1\|66257_67055_-	putative ABC transport system ATP-binding protein	G9BWD6	Planktothrix_phage	3.5e-22	32.9
VEH85105.1\|67327_68290_+	arabinose 5-phosphate isomerase	A0A0A0Q3B9	Pectobacterium_bacteriophage	1.4e-20	38.5
VEH85106.1\|68302_68830_+	hydrolase	A0A140XBD6	Dickeya_phage	3.2e-24	45.0
VEH85107.1\|68826_69402_+	Uncharacterized protein YrbK clustered with lipopolysaccharide transporters	NA	NA	NA	NA
VEH85108.1\|69382_69892_+	lipopolysaccharide export system protein LptA	NA	NA	NA	NA
VEH85109.1\|69888_70614_+	lipopolysaccharide transport protein B: ATP-binding component of ABC superfamily	W5SAS9	Pithovirus	1.4e-22	30.6
VEH85110.1\|70622_71201_+	anthranilate synthase component II	A0A0P0IKJ1	Acinetobacter_phage	1.7e-55	55.8
VEH85111.1\|71184_72189_+	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	4.8e-77	47.4
VEH85112.1\|72189_72954_+	indole-3-glycerol phosphate synthase	A0A0P0IR83	Acinetobacter_phage	1.4e-55	47.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

5. LR134422

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

122892 : 137137

Acidithiobacillus_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
VEH85422.1\|122892_124764_+	aminopeptidase	A0A0P0IY26	Acinetobacter_phage	1.3e-27	26.2
VEH85423.1\|125075_125528_+	DNA binding domain, excisionase family	K4ICM4	Acidithiobacillus_phage	4.4e-22	41.5
VEH85424.1\|125524_125995_+	Uncharacterised protein	K4HZX4	Acidithiobacillus_phage	6.0e-38	51.4
VEH85425.1\|126236_126365_-\|transposase	transposase (resolvase, DNA invertase)	NA	NA	NA	NA
VEH85426.1\|126682_133630_+	Polyketide synthase module	D0R7J2	Paenibacillus_phage	3.1e-50	34.8
VEH85427.1\|133659_135687_+	sensory box histidine kinase/response regulator	A0A1V0SGX0	Hokovirus	4.6e-34	28.0
VEH85428.1\|135770_136235_+	sensory histidine-kinase / response regulator	NA	NA	NA	NA
VEH85429.1\|136255_137137_-	beta-lactamase	A0A1B0VBP7	Salmonella_phage	6.1e-60	44.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. LR134427

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. LR134418

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. LR134421

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. LR134420

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

5. LR134422

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection