CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
LR215004	Mycoplasma conjunctivae strain NCTC10147 genome assembly, plasmid: 8	0 crisprs	NA	0	0
LR215007	Mycoplasma conjunctivae strain NCTC10147 genome assembly, plasmid: 11	0 crisprs	NA	0	0
LR215001	Mycoplasma conjunctivae strain NCTC10147 genome assembly, plasmid: 5	0 crisprs	NA	0	0
LR215006	Mycoplasma conjunctivae strain NCTC10147 genome assembly, plasmid: 10	0 crisprs	NA	0	0
LR215002	Mycoplasma conjunctivae strain NCTC10147 genome assembly, plasmid: 6	0 crisprs	DEDDh	0	0
LR214997	Mycoplasma conjunctivae strain NCTC10147 genome assembly, chromosome: 1	1 crisprs	NA	0	1
LR214998	Mycoplasma conjunctivae strain NCTC10147 genome assembly, plasmid: 2	0 crisprs	NA	0	0
LR215000	Mycoplasma conjunctivae strain NCTC10147 genome assembly, plasmid: 4	0 crisprs	NA	0	0
LR215005	Mycoplasma conjunctivae strain NCTC10147 genome assembly, plasmid: 9	0 crisprs	NA	0	1
LR215003	Mycoplasma conjunctivae strain NCTC10147 genome assembly, plasmid: 7	0 crisprs	DEDDh	0	3
LR214999	Mycoplasma conjunctivae strain NCTC10147 genome assembly, plasmid: 3	1 crisprs	NA	1	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

19649 : 33113

Bacillus_phage(37.5%)

tRNA

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
VEU67625.1\|19649_22220_+	DNA gyrase, A subunit	A0A172JHV7	Bacillus_phage	1.1e-88	30.4
VEU67626.1\|22318_22843_+	phosphoesterase	NA	NA	NA	NA
VEU67627.1\|22914_23847_+	COF family HAD hydrolase protein	NA	NA	NA	NA
VEU67628.1\|23849_24599_+	ribonuclease HII	NA	NA	NA	NA
VEU67629.1\|24868_26626_+	chaperone protein DnaK	A0A0G2YAL1	Acanthamoeba_polyphaga_mimivirus	2.7e-123	44.9
VEU67630.1\|26814_27492_+	ATPase	A0A127AWE7	Bacillus_phage	1.0e-22	32.2
VEU67631.1\|27573_28029_+	ATPase	A0A127AWE7	Bacillus_phage	5.3e-23	40.9
VEU67632.1\|28030_28993_+\|tRNA	phenylalanyl-tRNA synthetase subunit alpha	A0A2H4UW22	Bodo_saltans_virus	2.8e-26	37.0
VEU67633.1\|28982_29654_+	uracil-DNA glycosylase	A0A172DS90	Canid_alphaherpesvirus	6.1e-28	36.0
VEU67634.1\|29655_31842_+\|tRNA	Phenylalanine--tRNA ligase beta subunit	A0A1L3IZU3	BeAn_58058_virus	1.8e-15	41.7
VEU67635.1\|31850_33113_+	Serine hydroxymethyltransferase	A0A240F2Y9	Aeromonas_phage	3.2e-94	50.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. LR214999

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: LR214999_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

LR214999_1

100504-100605

Orphan

Consensus_repeat	Method
TTTGACACTTTTGTAAAAGTTTC	CRISPRCasFinder

1 spacers

The CRISPR arrays of LR214999_1

>merge|LR214999|1|100504-100605|CRISPRCasFinder
TTTGACACTTTTGTAAAAGTTTCTTCCTACATATATTTTACATTATTATGTAACAAAAAAGAAGATTATAAAATTAATTTTTTACACTTTTGTAAAAGTTTC

>LR214999|1|1|100504-100605|CRISPRCasFinder
TTTGACACTTTTGTAAAAGTTTC	TTCCTACATATATTTTACATTATTATGTAACAAAAAAGAAGATTATAAAATTAATT
TTTTACACTTTTGTAAAAGTTTC

Protein	Signature genes	Signature genes Name	Protein_function
LR214999.1\|VEU66758.1\|101779_102454_-\|Uncharacterised-protein	unknown	unknown	unknown
LR214999.1\|VEU66759.1\|102496_103654_-\|Uncharacterised-protein	unknown	unknown	unknown
LR214999.1\|VEU66757.1\|100804_101725_-\|COF-family-HAD-hydrolase-protein	unknown	unknown	gnl\|CDD\|369792
LR214999.1\|VEU66750.1\|92597_93941_-\|Uncharacterised-protein	unknown	unknown	unknown
LR214999.1\|VEU66765.1\|108474_109908_+\|type-i-restriction-modification-system,-s-subunit,-putative	unknown	unknown	gnl\|CDD\|341133
LR214999.1\|VEU66756.1\|99231_100482_-\|ATPase	unknown	unknown	gnl\|CDD\|224292
LR214999.1\|VEU66754.1\|96889_97363_+\|ABC-transporter-ATP-binding-protein-C-terminal-domain-protein	unknown	unknown	gnl\|CDD\|224055
LR214999.1\|VEU66747.1\|89985_91428_-\|Magnesium-transporter-mgtE	unknown	unknown	gnl\|CDD\|225148
LR214999.1\|VEU66748.1\|91429_92011_-\|membrane-protein	unknown	unknown	gnl\|CDD\|376789
LR214999.1\|VEU66760.1\|103833_104178_-\|Uncharacterised-protein	unknown	unknown	unknown
LR214999.1\|VEU66766.1\|110114_110501_-\|Uncharacterised-protein	unknown	unknown	unknown
LR214999.1\|VEU66763.1\|106914_107427_-\|type-i-restriction-modification-system,-s-subunit	unknown	unknown	gnl\|CDD\|341141
LR214999.1\|VEU66749.1\|92020_92323_-\|Uncharacterised-protein	unknown	unknown	unknown
LR214999.1\|VEU66762.1\|105669_106704_+\|EcoKI-restriction-modification-system-protein-HsdS	unknown	unknown	gnl\|CDD\|341163
LR214999.1\|VEU66755.1\|97362_99195_+\|ABC-type-multidrug/protein/lipid-transport-system-ATPase-component	unknown	unknown	gnl\|CDD\|224055
LR214999.1\|VEU66764.1\|107557_108319_-\|Tyrosine-recombinase-XerC	unknown	unknown	gnl\|CDD\|271191
LR214999.1\|VEU66753.1\|95545_96715_+\|Putative-multidrug-export-ATP-binding/permease-protein-SAV1866	unknown	unknown	gnl\|CDD\|349992
LR214999.1\|VEU66751.1\|94051_95248_-\|Divergent-AAA-domain	unknown	unknown	gnl\|CDD\|225420
LR214999.1\|VEU66761.1\|104550_105186_-\|T5orf172-domain	unknown	unknown	gnl\|CDD\|214947
LR214999.1\|VEU66752.1\|95237_95336_-\|Uncharacterised-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
LR214999.1\|VEU66765.1\|108474_109908_+\|type-i-restriction-modification-system,-s-subunit,-putative	gnl\|CDD\|341133	cd17244, RMtype1_S_Apa101655I-TRD2-CR2_like, Type I restriction-modification system specificity (S) subunit Target Recognition Domain-ConseRved domain (TRD-CR), similar to Acetobacter pasteurianus S subunit (S.Apa101655I) TRD2-CR2. The S. Apa101655I S subunit recognizes 5'... TTAGNNNNNNTTC... 3'. The restriction-modification (RM) system S subunit consists of two variable target recognition domains (TRD1 and 2) and two conserved regions (CR1 and CR2) which separate the TRDs. The TRDs each bind to different specific sequences in the DNA. RM systems protect a bacterial cell against invasion of foreign DNA by endonucleolytic cleavage of DNA that lacks a site specific modification. The host genome is protected from cleavage by methylation of specific nucleotides in the target sites. In type I systems, both restriction and modification activities are present in one enzyme complex composed of one DNA specificity (S) subunit (this family), two modification (M) subunits and two restriction (R) subunits. This model contains both TRD1-CR1 and TRD2-CR2. It may also include TRD-CR-like sequence-recognition domains of various type II restriction enzymes and methyltransferases and type I DNA methyltransferases.	3.72451e-39
LR214999.1\|VEU66757.1\|100804_101725_-\|COF-family-HAD-hydrolase-protein	gnl\|CDD\|369792	pfam08282, Hydrolase_3, haloacid dehalogenase-like hydrolase. This family contains haloacid dehalogenase-like hydrolase enzymes.	1.53531e-45
LR214999.1\|VEU66753.1\|95545_96715_+\|Putative-multidrug-export-ATP-binding/permease-protein-SAV1866	gnl\|CDD\|349992	cd18548, ABC_6TM_Tm287_like, Six-transmembrane helical domain Tm287 of a heterodimeric ABC transporter Tm287/288 from Thermotoga maritima and similar proteins. This group represents the six-transmembrane helical domain (Tm287) of a heterodimeric ABC transporter Tm287/288 from Thermotoga maritima and similar proteins. This TMD possesses the ATP-binding cassette (ABC) exporter fold, which is characterized by 6 TM helices per subunit (domain), or a total of 12 TM helices for the complete transporter. The ABC exporters are found in both prokaryotes and eukaryotes, where they mediate the cellular secretion of toxic compounds, a various type of lipids and polypeptides. ABC transporters typically consist of two transmembrane domains (TMDs) and two nucleotide-binding domains (NBDs). The sequences and structures of the TMDs are quite varied between the different type of transporters, suggesting significant structural diversity of the translocated substrates, while NBDs are conserved among all ABC transporters. The two NBDs together bind and hydrolyze ATP, thereby providing the driving force for transport, while the TMDs participate in substrate recognition and translocation across the lipid membrane by alternating between inward- and outward-facing conformations. Moreover, some ABC genes are organized as half-transporters, which must form either homodimers or heterodimers to form a functional transporter. The ABC exporters play a role in multidrug resistance to antibiotics and anticancer agents, and mutations in these proteins have been shown to cause severe human diseases such as cystic fibrosis.	1.61348e-45
LR214999.1\|VEU66756.1\|99231_100482_-\|ATPase	gnl\|CDD\|224292	COG1373, COG1373, Predicted ATPase (AAA+ superfamily) [General function prediction only].	1.34595e-54
LR214999.1\|VEU66754.1\|96889_97363_+\|ABC-transporter-ATP-binding-protein-C-terminal-domain-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	5.12047e-49
LR214999.1\|VEU66747.1\|89985_91428_-\|Magnesium-transporter-mgtE	gnl\|CDD\|225148	COG2239, MgtE, Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism].	1.86073e-108
LR214999.1\|VEU66748.1\|91429_92011_-\|membrane-protein	gnl\|CDD\|376789	pfam02457, DisA_N, DisA bacterial checkpoint controller nucleotide-binding. The DisA protein is a bacterial checkpoint protein that dimerizes into an octameric complex. The protein consists of three distinct domains. This domain is the first and is a globular, nucleotide-binding region; the next 146-289 residues constitute the DisA-linker family, pfam10635, that consists of an elongated bundle of three alpha helices (alpha-6, alpha-10, and alpha-11), one side of which carries an additional three helices (alpha7-9), which thus forms a spine like-linker between domains 1 and 3. The C-terminal residues, of domain 3, are represented by family HHH, pfam00633, the specific DNA-binding domain. The octameric complex thus has structurally linked nucleotide-binding and DNA-binding HhH domains and the nucleotide-binding domains are bound to a cyclic di-adenosine phosphate such that DisA is a specific di-adenylate cyclase. The di-adenylate cyclase activity is strongly suppressed by binding to branched DNA, but not to duplex or single-stranded DNA, suggesting a role for DisA as a monitor of the presence of stalled replication forks or recombination intermediates via DNA structure-modulated c-di-AMP synthesis.	3.9092e-50
LR214999.1\|VEU66762.1\|105669_106704_+\|EcoKI-restriction-modification-system-protein-HsdS	gnl\|CDD\|341163	cd17274, RMtype1_S_Eco540ANI-TRD1-CR1_like, Type I restriction-modification system specificity (S) subunit Target Recognition Domain-ConseRved domain (TRD-CR), similar to S.Eco540ANI TRD1-CR1, S.Eco2747AII TRD1-CR1, S.Eco540AI TRD1-CR1, S.Eco2747II TRD1-CR1, and S.Eco540I TRD1-CR1. Escherichia coli ST540AN S subunit (S.Eco540ANI ), Escherichia coli ST540A S subunit (S.Eco540AI), and Escherichia coli ST540 S subunit (S.Eco540I) recognize 5'... GAANNNNNNRTCG ... 3'. Escherichia coli ST2747A S subunit (S.Eco2747AII) and Escherichia coli ST2747 S subunit (S.Eco2747II) recognize 5'... GAANNNNNNNTAAA ... 3'. The restriction-modification (RM) system S subunit consists of two variable target recognition domains (TRD1 and 2) and two conserved regions (CR1 and CR2) which separate the TRDs. The TRDs each bind to different specific sequences in the DNA. RM systems protect a bacterial cell against invasion of foreign DNA by endonucleolytic cleavage of DNA that lacks a site specific modification. The host genome is protected from cleavage by methylation of specific nucleotides in the target sites. In type I systems, both restriction and modification activities are present in one enzyme complex composed of one DNA specificity (S) subunit (this family), two modification (M) subunits and two restriction (R) subunits. This model contains both TRD1-CR1 and TRD2-CR2. It may also include TRD-CR-like sequence-recognition domains of various type II restriction enzymes and methyltransferases and type I DNA methyltransferases.	2.46558e-13
LR214999.1\|VEU66755.1\|97362_99195_+\|ABC-type-multidrug/protein/lipid-transport-system-ATPase-component	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	3.32948e-132
LR214999.1\|VEU66764.1\|107557_108319_-\|Tyrosine-recombinase-XerC	gnl\|CDD\|271191	cd01191, INT_C_like_2, Uncharacterized site-specific tyrosine recombinase, C-terminal catalytic domain. Tyrosine recombinase (integrase) belongs to a DNA breaking-rejoining enzyme superfamily. The catalytic domain contains six conserved active site residues. The recombination reaction involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA. Many DNA breaking-rejoining enzymes also have N-terminal domains, which show little sequence or structure similarity.	1.87076e-110
LR214999.1\|VEU66761.1\|104550_105186_-\|T5orf172-domain	gnl\|CDD\|214947	smart00974, T5orf172, This entry represents the putative helicase A859L.	3.27418e-12
LR214999.1\|VEU66751.1\|94051_95248_-\|Divergent-AAA-domain	gnl\|CDD\|225420	COG2865, COG2865, Predicted transcriptional regulator containing an HTH domain and an uncharacterized domain shared with the mammalian protein Schlafen [Transcription].	1.99783e-21
LR214999.1\|VEU66763.1\|106914_107427_-\|type-i-restriction-modification-system,-s-subunit	gnl\|CDD\|341141	cd17252, RMtype1_S_EcoKI-TRD1-CR1_like, Type I restriction-modification system specificity (S) subunit Target Recognition Domain-ConseRved domain (TRD-CR), similar to S.EcoKI TRD1-CR1, S.StySPI TRD1-CR1, S.Ara36733II TRD1-CR1, and S.Eco3722I TRD1-CR1. Escherichia coli str. K-12 substr. MG1655 S subunit (S.EcoKI) and Escherichia coli NCM3722 S subunit (S.Eco3722I) recognize 5'... AACNNNNNNGTGC ... 3', Salmonella enterica subsp. enterica serovar Potsdam S subunit (S.StySPI) recognizes 5'... AACNNNNNNGTRC ... 3', and Actinomyces radicidentis S subunit (S.Ara36733II) recognizes 5'... CATCNNNNNNCTC ... 3'. The restriction-modification (RM) system S subunit consists of two variable target recognition domains (TRD1 and 2) and two conserved regions (CR1 and CR2) which separate the TRDs. The TRDs each bind to different specific sequences in the DNA. For example, S.EcoKI-TRD1 and S.StySPI-TRD1 recognize AAC/GTT, S.EcoKI-TRD2 recognizes GCAC/GTGC, and S.StySPI-TRD2 recognizes GYAC/GTRC. RM systems protect a bacterial cell against invasion of foreign DNA by endonucleolytic cleavage of DNA that lacks a site specific modification. The host genome is protected from cleavage by methylation of specific nucleotides in the target sites. In type I systems, both restriction and modification activities are present in one enzyme complex composed of one DNA specificity (S) subunit (this family), two modification (M) subunits and two restriction (R) subunits. This model contains both TRD1-CR1 and TRD2-CR2. It also includes TRD-CR-like sequence-recognition domains of various type II restriction enzymes and methyltransferases such as Treponema pedis T A4 putative Type IIG restriction enzyme/N6-adenine DNA methyltransferase RM.TpeTA4ORF2695P. It may also include type I DNA methyltransferases.	2.51446e-45

>LR214999.1|VEU66756.1|99231_100482_-|ATPase
MVIKRDIYLEKLKEMIDIPLIKIISGLRRSGKSFLLFNLFKEYLINELKVDQNHIIEINLENQENHSYCDPNNFLEFIKSKIKDRKKYFLLIDEVQLLKDFVPVLNQLNNNQQLNVFVTGSNSKFLINDVVTEFRGRSISLHVFPLSFYEIASHKEFKNLDELWKSYLIYGGLPLIQNMKEANIKTNYLVNEFKRTYLIDIVEKNKIEDIDNLDDIINILASNIGSYTNPYKLSLTFKSIKKTNISDATIRKYIENLKNAFIINEVKKYDIKGKKYINASYKYYFEDIGLRNAKINFAQNEENHLMENIIYNELLLRGYNVNVGIVEIRPNANQKVQLEVDFIAQKGNQKVYIQSCLNMYDQNKEIQEKRPFKNINDNFKKIIITKDDPIFDTDTNGYKIYGIKQFLLDLDILNKN
>LR214999.1|VEU66755.1|97362_99195_+|ABC-type-multidrug/protein/lipid-transport-system-ATPase-component
MPRFSNLRFRQKGEKKISFKIFFKFLSNFQISKSVWIFTVLFGLLVASLTNIASWLMGFITDKFLDPKTFNLANFKMKDYIVFVVMLALVYVFIKIFEISQRVIVSKLSARLGRNLRLQCYQKIQQMEMSFYEEEQTGDLMSALTNDIQNITEAIWDILISVISIIFEFSFITIMMFIYVPLLAAIILAIVPINASVIFLIIRSNQKFYIQQQERLGEFNGYLEEIMDAFPLVNLHQQKENVAKEFDKYSRALIKPDASATTRMNIVFPWFHFSKTINLIIVIAASAAFVYYKVPTGGIKPLSAGVVMSFTLYLFRISDNISLLLEVINGIQHGLGSIVRINKILALVPQFDEVKLNELDYKTGKIEFKNVSFAYASKPDKLVLKNISFTIEKGKSLALVGHTGCGKTTIAKLLSKFYVPTSGDILIDGQSILKTKSKSWRNYIDTILQETYIFNDTVKNNLTVVNPNISDKDFNDIVEKTSVAEFINLMPEKFDTVLKSNGANLSEGQKQLIAISRSLIASKPISILDEATSNIDTITELKVQHAMKYLMKDRSMLIIAHRLSTIKNVDEILVINEGEIIERGNHDQLMKQNGHYKKIYSLGLNDTKID
>LR214999.1|VEU66754.1|96889_97363_+|ABC-transporter-ATP-binding-protein-C-terminal-domain-protein
MIISGSIKENITFSNHELSEQEIEKAINISCANFIKELDDKYEARVDQRGKNFSGGQRQRVAIAQALIKKPQILILDDSTSALDNETDLRVRQNIKENLKDSTLIVISQRINSIKDSNQIFVLDKGQIVASGKHSQLLNTSSIYKDIWQSQEQKVGE
>LR214999.1|VEU66753.1|95545_96715_+|Putative-multidrug-export-ATP-binding/permease-protein-SAV1866
MLKIFKYMPARIKFFAFLSAFFAILQPFLSMLNPTITKQLITLIAKVQNGTSMNEVSLLFWNITTSGTSQSMIYLIIMAIGFAFLLMIVAFLSAFFAARTCIYGTYYLRKNLFEHLLTLSRSNLEKYSVGSLITRFSNDLNKIKDGIFVVVRGLVVSPFFVVWGLVFTTTTNVYLSIAIYIIIPFLVGAAVFAIFKLFPYYRKENWILDQLNELSKEDINAIALIKSYNLEEPRYEKYFNKNQEWFTIYRKNVVFGSFAWPIINGFVLFGNVAIFALVAYLIGSKGDDNVAKLIGDVSQFTANLSMISMGVFNTLFTINRLFRSSVSAKRYIELMNSKSEIPFVVSDKKVTSGAIEFKNVNFAYPIYKKGKLVDTKEALKNINLKIEAG
>LR214999.1|VEU66752.1|95237_95336_-|Uncharacterised-protein
MNKMPWESEEVEYKKSTCELKRIDYFFNRNAQ
>LR214999.1|VEU66751.1|94051_95248_-|Divergent-AAA-domain
MLNKRGTGTIYFSLKDDHTIVDLDICNKSMRDISQAISNNVKPEIMPRISIEFIDNQNVIKVEAEGEQKPYSAYDKYYIRIGEEDKKLNRDKLVDFVQKSVFKINICEIENKDQDLTFNSFLLYANIKNLTVNKDTFEKNFDLKTKNNKYNLMSYLLSNNNDISIKVNTFKDNDKSVLLKRNEYGNKCLFYAIESILNYVGSINDTYVDLSTATRSKQKLFDFECFREAWLNACIHNHWDEKYPPQVNIFKDYIQIESNGGISRNMTKEEFFKGVSRPVNEKLQKIFMQLDLVEQTGYGVPLIVKKYDEEAFEIDENTIWVKIPFNRKEFKRINKNENKKDLNDNQIKVIKTIEKESNITINQLSSALSLSEGYIKKIINQLKNKNLIERNCSRKNGN
>LR214999.1|VEU66750.1|92597_93941_-|Uncharacterised-protein
MKNLSEINTKYILISLILSLILSLIIIITRYILTIIFTLKKDSKIHINYNLFFKIYIFLLLVSNLLIFSVLIWNVFIYLNDIFLRTIAILILSVLLILNLVFWIIKFSFLKQDNQLYLESKNNLENNELTIKIADNKNNCNWKIWKTLKSAYTSFQKKNFFIFKEFPRIILDISIVKKILVENKNNLFIIFQWKNEHFNIKLQNKFKIIDFIRNSCEDIEFFSFFDAYCEKNDESNIDLHEILGAKYNKKIWFWTKINNIEKTKLKLTFYYLDSFWNFALFLLPIILALFLNNEIPVLKTFNKWVILFWITFVYLTVSFVRIFFKKDLYLNERKKEKLKIDPFYEKNHFDANSYLIEKLSNFKNNFIYTISIVIKENSEENQLYIKNIKKQIDEINKKLFDSEKTYFKFFYLKTIFVKAKKHFKLFTKKITNKRNLKLKKLNIVNEK
>LR214999.1|VEU66749.1|92020_92323_-|Uncharacterised-protein
MAIIDRDLATCAERIQKRRELLLKLYNENQAELANPALIEDEKPITGECQEFMCLVNKHEKEDPRVRKQKIILKVLGASLSVLIILLCTLLAVLISRVYA
>LR214999.1|VEU66748.1|91429_92011_-|membrane-protein
MCLESKIGFYVIVALLVTLILISIMPLIVNAIKNKMARSHFQKLGQSSQIRLINQLREAVEYLSKNKIGALITIENNDNIDNLRTDGVILNANISSSLLISIFNKYSPLHDGAVIIRDNKIYYASTFYKITRKSIDNQYGARHRAAMGISELCDATTIIVSEETGDVKFVKNGTFYNIRLEQFQEQLVKYLKD
>LR214999.1|VEU66747.1|89985_91428_-|Magnesium-transporter-mgtE
MSESQEISLQNELHEIIKTKNVTKAREFIDNNPMADVANLLNELQLEEQLTFLPLLKTSEAAELFSYLDEEVQANLAQSFTEDWGMKLLQELQSDELADVLEELPSNVTSKILAYTPQEKRAELNKLLSYEDDEVGSIMSIDISSIGNSYTCEQALHKIRRDYHKKNAELVHYYYVVNETNKLIGALTLEEIVFADPNAKIDDIYNPVTYVSAHDKTEVAAQVFSEHDMSVLPVVNHEKRLVGMITSDDVIDVIKEEATEDLYKMAGISSHEVNESEYLKTPWYKIIKSRILWLILLLLFATVTQIIVYFGTWTIAKKIKDVAEISLATISFAALIPVINNATSNSGIQANISVNRALALKEIEPGEYGKVIWKETLIGFVTGLILAVINFARLGIYFAATRDLMSTNKMIYWAIIIGSSIALWLALTISKLLGAAFPIIWAKIKKDPSSISASLINTFTDIISSLLIFGFAFAFLMVLI
>LR214999.1|VEU66757.1|100804_101725_-|COF-family-HAD-hydrolase-protein
MNIFYQYIYKTALLVNDWKLGNYRYIFFVSYIKSLYIIKIMKKEIQAYFIDLDGTLLDLPEGEETLSSANVKAVVKLNKTKPVIISTGRSNSEFVLSLVKLLKCPYAICQNGALIVDKKNKVLARYEMEQNQVDEIVKLLKEEEMFFIFNGENKIYCNYESSAYMRPWTAKLEKLKYSDLGQKTNVTKILTFGKDEIATKNFKNFLAKKYPSLAFHIVSKGYSIEITHKNATKGKGAAFVCDLLKIDPKNAAHIGDSGNDLNALPEIGTFIAMENAMDEVKEVAHYIGPSFENSGIAKLFKDLKEI
>LR214999.1|VEU66758.1|101779_102454_-|Uncharacterised-protein
MYSFVKNKSLIKNIESFGSTLIKDLIKRINKQKYIRVQKELFGSGSEELIVQNDKGVIIIDYNLIVYAFFEGNSLYDCKKIREFVKKNFDESLTQLGCEISKDHSLSLTAENLTIDDYKDTPFIINLNIVFEFGPEYWIQLAHFKKSDAKKERWFWYNVPNTNSLMKRVEECKECDLWKDVQNIYLEKMNDFSKIFNRNADWFYCYAAAITEVENKNSDYDGED
>LR214999.1|VEU66759.1|102496_103654_-|Uncharacterised-protein
MKLDITITQMQFNEYLYDYSQDQEKKIRLDDWTAFDEYYYELLKKYIKEKVTNTNEKIRIYFLPRYDNKYYAFRLKYESEKEAEKELGKEEWFRNLMWLEDNQFSFWIWHVDYYLFFAKGLNNATNLEAFKIWFNNANKYEKNKNSKDNNEDSEAIDYLIKHSFYKFIQSLQDSIAKALNDKLNKVDILVFKNKYVDYQDTENYNFETVSNNSFQKLAKEKYNEFLAKFQDLKINKIFVKDLQPFYSSNDSETIKLLEFYIYLYKALYCTLSNFISLAYSKEDALNKCINIKDYCHEYWNEQFVPCFIFNNPKFELFSDIYTSITKVLPYLNKTKEISDSKTSDLVNSFKVESYYVLGLTIALLSYLKFLTICQVNKVIKKEKEI
>LR214999.1|VEU66760.1|103833_104178_-|Uncharacterised-protein
MNNEFTNFIFKEKIITNLYDNDNKLTKELKNKNIWDILNYKMFKNVNIDFLPYYIVDGQGYKSLIRKYQVITSSKNAKFEIVYGYLLLVASINLILLDYLNQNSINNSAFEYEV
>LR214999.1|VEU66761.1|104550_105186_-|T5orf172-domain
MPEKGYVYVLTNPSFRDDWVKIGKSSRMPEVRGRELYNTAVPLPYEIYATLQTEKYNEVEKMIHKSIDRISKLRINKNREFFNIPPEKAYDILLDIKELLGNEAKLELMGDNVEVHTKEKTKRGEPFDFYSRGLKDGDVVSFIENSNIKAIVESNKTVYFENQSWSLSGLTREIYTRKGKVNSSGAYQGPKYFQFNGKRLTELPIIEECQS
>LR214999.1|VEU66762.1|105669_106704_+|EcoKI-restriction-modification-system-protein-HsdS
MQKTLKCAIINNELNGSLFSTGFYGFKSIYNKIKYLKLFIESPYYQILKDSFCSGVTQKSINDEKLLNILIAIPPINEQEKIINKLISLDKFMKKYLEKENQLFKLDSEIKDKLQKSILQYAIQGKLVKQDPNDEPASKLLEAIQIEKNKLIKEGKIKKDKHESFIFQGEDKNYYEKIGSKVINITNEIPFEIPKNWVIVKISNISFRIDKKNIIIKTKQILSTGKYPIITQGQKFIEGYTNNVNNIFKVKEPIIIFGDHTKTTKFVDFNFVPGGDGTVFLKPLKINPLFFYYLVNYLSKKIRNRGYARHYILLKKEIIPIPNINEQNQIVSKIKKVFYFINCL
>LR214999.1|VEU66763.1|106914_107427_-|type-i-restriction-modification-system,-s-subunit
MLNLVKIISGISYDKNDILTKMDKNYIRIIRSGNIQNSRLILFDDDIFLPVFYKNNIKMLHYNDIVIMASTGSKNLIGKPAFVEEQLDNVYIGAFLRIIRPNINNIFDYLKLIFMSEYYRSEIRKNVNGTNINNVNSNILLNMLIPIPSIKNERKISKKIYQVLNILTLM
>LR214999.1|VEU66764.1|107557_108319_-|Tyrosine-recombinase-XerC
MTKNTINAYKSAIKLFNLKYEEINKKNLLLFKTYLIENYKPNSVNLKIQALNRYLEFIKKDTLKLKFIKVQQKTFIDNVISDADYVFLKRKLKKESLDWYFVVRFLAATGARVSELIKIKVEHVKLGYIDIYSKGGKARRIYIPLKLKKEAIIWLENKCLNSGYIFLNRFGKAITTRGISQQLKKYALKFGINPKVVYPHSFRHRFAKNFLEKYNDISFLADLMGHESIETTRIYLRKTSNEQQEIVDKIITW
>LR214999.1|VEU66765.1|108474_109908_+|type-i-restriction-modification-system,-s-subunit,-putative
MPFEIPENWAWVRHNNIFEIIGGSQPPKSKFIEHEKQGYIRLYQIRDYGENPNPVYIPSKFAFKQSEKNDILLARYGASIGKVFFAENGAYNVALAKVKKMFINDWINKEFMFIFYKSSIYQTLVKNNSRSAQAGFNKDDLKNLFMPIPSLNESSRIVSKWNDLNKLINEYENKENQLFKLDSKIKDKLQKSILQYAIQGKLVKQDPNDEPASKLLEAIQIEKNELIKEGKIKKDKQESFIFQGEDKNYYEKIGSKVINITNEIPFEIPINWAWTRFKNIANLVLGKSPETNNINYWKNGVINWFTIADMKDKQIIEDSKKKISLQAKKEIFNNQMSKKGTLLLSFKLTIGKTSIINQDSVHNEAIVSINFYKDNNITKMFLLIFLGLLINNCEKINAIKGKTLNKEKLQKMLIPIPPIKNQNNILLITNKIIDLFKFKMISFCSFMFGIAKSKLLKMSIFKCGIAAPFLFFLNNSL
>LR214999.1|VEU66766.1|110114_110501_-|Uncharacterised-protein
MLYKKTENQLFKLDSEIKDKLQKSILQYAIQGKLVKQDPNDEPASKLLEAIQIEKNKLIKEGKIKKDKQESLIFQGEDKNYYEKIGSKVINITNEIPFEIPKKWAWVRQKNILKLTKNEASKNGNYLI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
LR214999_1	1.1\|100527\|56\|LR214999\|CRISPRCasFinder	100527-100582	56	NZ_LR214999	Mycoplasma conjunctivae strain NCTC10147 plasmid 3	100527-100582	0	1.0
LR214999_1	1.1\|100527\|56\|LR214999\|CRISPRCasFinder	100527-100582	56	LR214965	Mycoplasma fermentans strain NCTC10117 genome assembly, plasmid: 11	90119-90174	0	1.0

1. spacer 1.1|100527|56|LR214999|CRISPRCasFinder matches to NZ_LR214999 (Mycoplasma conjunctivae strain NCTC10147 plasmid 3) position: , mismatch: 0, identity: 1.0

ttcctacatatattttacattattatgtaacaaaaaagaagattataaaattaatt	CRISPR spacer
ttcctacatatattttacattattatgtaacaaaaaagaagattataaaattaatt	Protospacer
********************************************************

2. spacer 1.1|100527|56|LR214999|CRISPRCasFinder matches to LR214965 (Mycoplasma fermentans strain NCTC10117 genome assembly, plasmid: 11) position: , mismatch: 0, identity: 1.0

ttcctacatatattttacattattatgtaacaaaaaagaagattataaaattaatt	CRISPR spacer
ttcctacatatattttacattattatgtaacaaaaaagaagattataaaattaatt	Protospacer
********************************************************

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. LR215003

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

18001 : 69535

unidentified_phage(25.0%)

protease,tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
VEU66865.1\|18001_19318_-\|tRNA	tRNA (uracil-5-)-methyltransferase related enzyme	A0A2K5B251	Erysipelothrix_phage	5.7e-62	34.2
VEU66866.1\|19391_20441_-	Xaa-Pro aminopeptidase	NA	NA	NA	NA
VEU66867.1\|20473_21343_-	GTP-binding protein	NA	NA	NA	NA
VEU66868.1\|21342_21735_-	cytidine deaminase	NA	NA	NA	NA
VEU66869.1\|21738_22194_-\|protease	conserved hypothetical metalloprotease	NA	NA	NA	NA
VEU66870.1\|22214_22601_-	Uncharacterised protein	NA	NA	NA	NA
VEU66871.1\|22575_24639_-	ABC transporter ATP-binding protein	A0A1V0SGN0	Hokovirus	7.7e-05	25.8
VEU66872.1\|24771_25218_+	ribose-5-phosphate isomerase	NA	NA	NA	NA
VEU66873.1\|25284_25659_+	proline dipeptidase pepQ	A0A1X9I5T8	Streptococcus_phage	2.7e-17	45.9
VEU66874.1\|25660_26233_+	putative dephospho-CoA kinase	NA	NA	NA	NA
VEU66875.1\|26282_27245_+	DnaD domain-containing protein	NA	NA	NA	NA
VEU66876.1\|27258_28152_+	Chromosomal replication initiator protein dnaA	NA	NA	NA	NA
VEU66877.1\|28290_29328_+\|transposase	transposase	H7BW61	unidentified_phage	3.3e-12	28.0
VEU66878.1\|29606_30122_-	adenine phosphoribosyltransferase (APRT)	NA	NA	NA	NA
VEU66879.1\|30151_31957_-	translation initiation factor if-2	E3T4N3	Cafeteria_roenbergensis_virus	6.9e-26	25.5
VEU66880.1\|31935_32250_-	putative transcription termination factor	NA	NA	NA	NA
VEU66881.1\|32230_33847_-	N utilization substance protein A	NA	NA	NA	NA
VEU66882.1\|33856_34291_-	Uncharacterised BCR, YhbC family COG0779	NA	NA	NA	NA
VEU66883.1\|34415_35411_-	Bifunctional oligoribonuclease and PAP phosphatase nrnA	NA	NA	NA	NA
VEU66884.1\|35410_36379_-	Bifunctional oligoribonuclease and PAP phosphatase nrnA	NA	NA	NA	NA
VEU66885.1\|36701_38555_+	glucose inhibited division protein A	NA	NA	NA	NA
VEU66886.1\|38547_38994_+	ribosomal RNA large subunit methyltransferase h	NA	NA	NA	NA
VEU66887.1\|39028_39469_+	Uncharacterised protein	NA	NA	NA	NA
VEU66888.1\|39586_39943_-	50S ribosomal protein L19	NA	NA	NA	NA
VEU66889.1\|39932_40634_-\|tRNA	tRNA (guanine-N(1)-)-methyltransferase	NA	NA	NA	NA
VEU66890.1\|40647_41094_-	30S ribosomal protein S16	NA	NA	NA	NA
VEU66891.1\|41333_42200_+	Als operon repressor	NA	NA	NA	NA
VEU66892.1\|42210_43188_+	Ribosome-binding factor A	NA	NA	NA	NA
VEU66893.1\|43239_44589_-	Uncharacterised protein	NA	NA	NA	NA
VEU66894.1\|44712_44943_-	Sigma-70, region 4	NA	NA	NA	NA
VEU66895.1\|44935_46003_-	signal recognition particle-docking protein FtsY	D6PHS7	uncultured_phage	4.6e-09	26.8
VEU66896.1\|46089_48399_-	Uncharacterised protein	NA	NA	NA	NA
VEU66897.1\|48388_51379_-	Uncharacterised protein	NA	NA	NA	NA
VEU66898.1\|51424_51712_-	Uncharacterised protein	NA	NA	NA	NA
VEU66899.1\|51748_53446_-	Uncharacterised protein	NA	NA	NA	NA
VEU66900.1\|53438_54140_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.1e-23	34.9
VEU66901.1\|54353_54722_+	Uncharacterised protein	NA	NA	NA	NA
VEU66902.1\|54739_55453_+\|transposase	transposase	H7BW47	unidentified_phage	1.1e-22	39.3
VEU66903.1\|55655_56354_-	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	NA	NA	NA	NA
VEU66904.1\|56366_57389_-	Uncharacterised protein family UPF0052	NA	NA	NA	NA
VEU66905.1\|57420_58707_-	putative glucosyl-3-phosphoglycerate synthase	NA	NA	NA	NA
VEU66906.1\|59112_59520_-\|transposase	transposase	H7BWC8	unidentified_phage	4.4e-05	29.9
VEU66907.1\|59474_60401_-\|transposase	transposase	NA	NA	NA	NA
VEU66908.1\|60439_61432_-	UDP-glucose 4-epimerase	A0A2K9L5H6	Tupanvirus	2.5e-49	38.0
VEU66909.1\|61444_62452_-	Chondroitin polymerase	NA	NA	NA	NA
VEU66910.1\|62601_63483_-	esterase/lipase	NA	NA	NA	NA
VEU66911.1\|63492_64476_-	Lipoate-protein ligase A	A0A2H4UVX5	Bodo_saltans_virus	1.0e-18	30.3
VEU66912.1\|65159_67760_+	PTS system, glucose/glucosamine/beta-glucoside-specific, IICBA component	NA	NA	NA	NA
VEU66913.1\|67852_68578_+	bacterial surface protein 26-residue repeat	NA	NA	NA	NA
VEU66914.1\|68698_69535_-\|transposase	transposase, IS861	A0A1B1P773	Bacillus_phage	3.6e-46	43.0

DBSCAN-SWA_2

233796 : 253677

Mycoplasma_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
VEU67056.1\|233796_235170_+	multiple sugar ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	2.4e-119	100.0
VEU67057.1\|235153_235972_+	polyamine (spermidine/putrescine) ABC transporter permease	Q6GZ02	Mycoplasma_phage	1.1e-140	100.0
VEU67058.1\|235986_236841_+	spermidine/putrescine ABC transporter membrane protein	Q6GZ01	Mycoplasma_phage	5.4e-154	99.6
VEU67059.1\|236806_238348_+	Uncharacterised protein	Q6GZ00	Mycoplasma_phage	2.1e-302	99.4
VEU67060.1\|238477_238918_+	Uncharacterised protein	NA	NA	NA	NA
VEU67061.1\|239403_240258_+	repb	O80239	Mycoplasma_phage	3.6e-33	35.4
VEU67062.1\|240420_240582_+	Uncharacterised protein	A4D0G2	Mycoplasma_phage	1.5e-17	98.1
VEU67063.1\|240585_241386_+	Uncharacterised protein	O80242	Mycoplasma_phage	1.2e-46	43.1
VEU67064.1\|241517_241832_+	Uncharacterised protein	Q5QGL9	Mycoplasma_phage	1.6e-55	99.0
VEU67065.1\|241819_243502_+	Uncharacterised protein	Q5QGL8	Mycoplasma_phage	0.0e+00	100.0
VEU67066.1\|243482_244640_+	Uncharacterised protein	Q5QGL7	Mycoplasma_phage	1.8e-221	100.0
VEU67067.1\|244641_246489_+	Uncharacterised protein	Q5QGL6	Mycoplasma_phage	0.0e+00	100.0
VEU67068.1\|246530_247061_+	Uncharacterised protein	Q5QGL5	Mycoplasma_phage	1.5e-74	100.0
VEU67069.1\|247196_248066_+	Uncharacterised protein	Q5QGL4	Mycoplasma_phage	7.2e-162	99.7
VEU67070.1\|248068_249484_+	Uncharacterised protein	Q5QGL3	Mycoplasma_phage	1.1e-271	100.0
VEU67071.1\|249500_250886_+	Uncharacterised protein	Q5QGL2	Mycoplasma_phage	5.7e-262	100.0
VEU67072.1\|251179_251827_+	mem	Q5QGL0	Mycoplasma_phage	1.2e-68	100.0
VEU67073.1\|251886_252978_-	Site-specific recombinase XerD	NA	NA	NA	NA
VEU67074.1\|253029_253197_-	Uncharacterised protein	NA	NA	NA	NA
VEU67075.1\|253215_253677_-	Uncharacterised protein	Q5QGK8	Mycoplasma_phage	5.6e-81	97.4

DBSCAN-SWA_3

583999 : 594527

Mycoplasma_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
VEU67389.1\|583999_584461_+	Uncharacterised protein	Q5QGK8	Mycoplasma_phage	5.4e-84	100.0
VEU67390.1\|584697_585789_+	Site-specific recombinase XerD	NA	NA	NA	NA
VEU67391.1\|585848_586496_-	mem	Q5QGL0	Mycoplasma_phage	1.2e-68	100.0
VEU67392.1\|586789_588175_-	Uncharacterised protein	Q5QGL2	Mycoplasma_phage	5.7e-262	100.0
VEU67393.1\|588191_589607_-	Uncharacterised protein	Q5QGL3	Mycoplasma_phage	1.1e-271	100.0
VEU67394.1\|589609_590602_-	Uncharacterised protein	Q5QGL4	Mycoplasma_phage	5.3e-185	100.0
VEU67395.1\|590614_590998_-	Uncharacterised protein	Q5QGL5	Mycoplasma_phage	1.0e-48	99.2
VEU67396.1\|591185_591311_-	Uncharacterised protein	Q5QGL6	Mycoplasma_phage	4.6e-14	97.4
VEU67397.1\|591289_591901_-	Uncharacterised protein	Q5QGL6	Mycoplasma_phage	3.6e-112	100.0
VEU67398.1\|591908_592178_-	Uncharacterised protein	Q5QGL6	Mycoplasma_phage	5.3e-31	97.0
VEU67399.1\|592599_593031_-	Uncharacterised protein	Q5QGL6	Mycoplasma_phage	7.1e-70	100.0
VEU67400.1\|593032_593299_-	Uncharacterised protein	Q5QGL7	Mycoplasma_phage	1.3e-42	100.0
VEU67401.1\|593303_593477_-	Uncharacterised protein	Q5QGL7	Mycoplasma_phage	1.1e-13	95.1
VEU67402.1\|593485_594193_-	Uncharacterised protein	Q5QGL7	Mycoplasma_phage	3.0e-126	97.4
VEU67403.1\|594173_594527_-	Uncharacterised protein	Q5QGL8	Mycoplasma_phage	4.9e-61	100.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. LR214997

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: LR214997_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

LR214997_3

411206-411314

Orphan

Consensus_repeat	Method
TAAAAAGGTGGAAATCCACTTAAATTTTTCAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of LR214997_3

>merge|LR214997|3|411206-411314|CRISPRCasFinder
TAAAAAGGTGGAAATCCACTTAAATTTTTCAAACTATTACTAAAGATGAGTTTTTTTATGCTAAAATTATTTTGAAATAAAAAGGTGGAAATCCACCTAAATTTTTCAA

>LR214997|3|3|411206-411314|CRISPRCasFinder
TAAAAAGGTGGAAATCCACTTAAATTTTTCAA	ACTATTACTAAAGATGAGTTTTTTTATGCTAAAATTATTTTGAAA
TAAAAAGGTGGAAATCCACCTAAATTTTTCAA

Protein	Signature genes	Signature genes Name	Protein_function
LR214997.1\|VEU66250.1\|412813_413044_+\|Uncharacterised-protein	unknown	unknown	unknown
LR214997.1\|VEU66244.1\|403118_404099_+\|site-specific-tyrosine-recombinase	unknown	unknown	gnl\|CDD\|274042
LR214997.1\|VEU66252.1\|414298_417925_+\|Uncharacterised-protein	unknown	unknown	gnl\|CDD\|223039
LR214997.1\|VEU66245.1\|404103_404643_+\|Type-I-restriction-modification-DNA-specificity-domain	unknown	unknown	gnl\|CDD\|341197
LR214997.1\|VEU66258.1\|424415_425597_+\|TRANSPOSASE-FOR-INSERTION-SEQUENCE-ELEMENT-IS1	unknown	unknown	gnl\|CDD\|222853
LR214997.1\|VEU66241.1\|400370_401162_+\|Transposase	unknown	unknown	gnl\|CDD\|376573
LR214997.1\|VEU66255.1\|422799_423234_+\|ribose-5-phosphate-isomerase-B	unknown	unknown	gnl\|CDD\|235509
LR214997.1\|VEU66243.1\|402364_402955_-\|Uncharacterised-protein	unknown	unknown	gnl\|CDD\|341167
LR214997.1\|VEU66254.1\|421009_422737_+\|Phosphoenolpyruvate-protein-phosphotransferase	unknown	unknown	gnl\|CDD\|224006
LR214997.1\|VEU66248.1\|407788_410908_-\|Type-I-restriction-enzyme-EcoR124II-R-protein	unknown	unknown	gnl\|CDD\|223683
LR214997.1\|VEU66240.1\|399480_400365_+\|Transposase	unknown	unknown	gnl\|CDD\|227708
LR214997.1\|VEU66247.1\|406418_407765_-\|Type-I-restriction-enzyme-EcoKI-M-protein	unknown	unknown	gnl\|CDD\|223363
LR214997.1\|VEU66253.1\|417951_420795_+\|Uncharacterised-protein	unknown	unknown	unknown
LR214997.1\|VEU66249.1\|411327_412623_+\|putative-ATPase,-AAA+-superfamily	unknown	unknown	gnl\|CDD\|224292
LR214997.1\|VEU66246.1\|404639_405839_-\|Uncharacterised-protein	unknown	unknown	gnl\|CDD\|341132
LR214997.1\|VEU66251.1\|413707_414268_+\|Uncharacterised-protein	unknown	unknown	unknown
LR214997.1\|VEU66242.1\|401675_401849_-\|Uncharacterised-protein	unknown	unknown	gnl\|CDD\|372614
LR214997.1\|VEU66239.1\|398937_399408_-\|Type-I-restriction-modification-system-methyltransferase-subunit	unknown	unknown	gnl\|CDD\|341139
LR214997.1\|VEU66257.1\|424023_424317_+\|Uncharacterised-protein	unknown	unknown	unknown
LR214997.1\|VEU66256.1\|423233_424049_+\|DNA-formamidopyrimidine-glycosylase	unknown	unknown	gnl\|CDD\|234899

Protein	Function_ID	Function_description	E-value
LR214997.1\|VEU66244.1\|403118_404099_+\|site-specific-tyrosine-recombinase	gnl\|CDD\|274042	TIGR02224, Tyrosine_recombinase_XerC, tyrosine recombinase XerC. The phage integrase family describes a number of recombinases with tyrosine active sites that transiently bind covalently to DNA. Many are associated with mobile DNA elements, including phage, transposons, and phase variation loci. This model represents XerC, one of two closely related chromosomal proteins along with XerD (TIGR02225). XerC and XerD are site-specific recombinases which help resolve chromosome dimers to monomers for cell division after DNA replication. In species with a large chromosome and homologs of XerC on other replicons, the chomosomal copy was preferred for building this model. This model does not detect all XerC, as some apparent XerC examples score in the gray zone between trusted (450) and noise (410) cutoffs, along with some XerD examples. XerC and XerD interact with cell division protein FtsK. [DNA metabolism, DNA replication, recombination, and repair].	1.59253e-43
LR214997.1\|VEU66252.1\|414298_417925_+\|Uncharacterised-protein	gnl\|CDD\|223039	PHA03307, PHA03307, transcriptional regulator ICP4; Provisional.	8.98794e-18
LR214997.1\|VEU66245.1\|404103_404643_+\|Type-I-restriction-modification-DNA-specificity-domain	gnl\|CDD\|341197	cd17516, RMtype1_S_HinAWORF1578P-TRD2-CR2_like, Type I restriction-modification system specificity (S) subunit Target Recognition Domain-ConseRved domain (TRD-CR), similar to S.HinAWORF1578P TRD2-CR2. Haemophilus influenzae RdAW S subunit (S.HinAWORF1578P) recognizes 5'... CTANNNNNGTTY ... 3'. The restriction-modification (RM) system S subunit consists of two variable target recognition domains (TRD1 and 2) and two conserved regions (CR1 and CR2) which separate the TRDs. The TRDs each bind to different specific sequences in the DNA. RM systems protect a bacterial cell against invasion of foreign DNA by endonucleolytic cleavage of DNA that lacks a site specific modification. The host genome is protected from cleavage by methylation of specific nucleotides in the target sites. In type I systems, both restriction and modification activities are present in one enzyme complex composed of one DNA specificity (S) subunit (this family), two modification (M) subunits and two restriction (R) subunits. This model contains both TRD1-CR1 and TRD2-CR2. It may also include TRD-CR-like sequence-recognition domains of various type II restriction enzymes and methyltransferases and type I DNA methyltransferases.	1.01399e-81
LR214997.1\|VEU66258.1\|424415_425597_+\|TRANSPOSASE-FOR-INSERTION-SEQUENCE-ELEMENT-IS1	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	3.24844e-25
LR214997.1\|VEU66241.1\|400370_401162_+\|Transposase	gnl\|CDD\|376573	pfam01609, DDE_Tnp_1, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction. This family contains transposases for IS4, IS421, IS5377, IS427, IS402, IS1355, IS5, which was original isolated in bacteriophage lambda.	0.000119574
LR214997.1\|VEU66255.1\|422799_423234_+\|ribose-5-phosphate-isomerase-B	gnl\|CDD\|235509	PRK05571, PRK05571, ribose-5-phosphate isomerase B; Provisional.	2.40642e-65
LR214997.1\|VEU66243.1\|402364_402955_-\|Uncharacterised-protein	gnl\|CDD\|341167	cd17278, RMtype1_S_LdeBORF1052P-TRD2-CR2, Type I restriction-modification system specificity (S) subunit Target Recognition Domain-ConseRved domain (TRD-CR), similar to Lactobacillus delbrueckii subsp. bulgaricus S subunit (S2.LdeBORF1052P) TRD2-CR2. The recognition sequence of Lactobacillus delbrueckii subsp. bulgaricus S subunit (S2.LdeBORF1052P) is undetermined. The restriction-modification (RM) system S subunit consists of two variable target recognition domains (TRD1 and 2) and two conserved regions (CR1 and CR2) which separate the TRDs. The TRDs each bind to different specific sequences in the DNA. RM systems protect a bacterial cell against invasion of foreign DNA by endonucleolytic cleavage of DNA that lacks a site specific modification. The host genome is protected from cleavage by methylation of specific nucleotides in the target sites. In type I systems, both restriction and modification activities are present in one heteromeric enzyme complex composed of one DNA specificity (S) subunit (this family), two modification (M) subunits and two restriction (R) subunits. This model contains both TRD1-CR1 and TRD2-CR2. It may also include TRD-CR-like sequence-recognition domains of various type II restriction enzymes and methyltransferases and type I DNA methyltransferases.	2.08047e-07
LR214997.1\|VEU66254.1\|421009_422737_+\|Phosphoenolpyruvate-protein-phosphotransferase	gnl\|CDD\|224006	COG1080, PtsA, Phosphoenolpyruvate-protein kinase (PTS system EI component in bacteria) [Carbohydrate transport and metabolism].	0
LR214997.1\|VEU66248.1\|407788_410908_-\|Type-I-restriction-enzyme-EcoR124II-R-protein	gnl\|CDD\|223683	COG0610, COG0610, Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms].	1.2765e-75
LR214997.1\|VEU66240.1\|399480_400365_+\|Transposase	gnl\|CDD\|227708	COG5421, COG5421, Transposase [DNA replication, recombination, and repair].	9.09406e-13
LR214997.1\|VEU66247.1\|406418_407765_-\|Type-I-restriction-enzyme-EcoKI-M-protein	gnl\|CDD\|223363	COG0286, HsdM, Type I restriction-modification system methyltransferase subunit [Defense mechanisms].	6.34016e-57
LR214997.1\|VEU66249.1\|411327_412623_+\|putative-ATPase,-AAA+-superfamily	gnl\|CDD\|224292	COG1373, COG1373, Predicted ATPase (AAA+ superfamily) [General function prediction only].	1.37054e-55
LR214997.1\|VEU66246.1\|404639_405839_-\|Uncharacterised-protein	gnl\|CDD\|341132	cd17243, RMtype1_S_AchA6I-TRD2-CR2_like, Type I restriction-modification system specificity (S) subunit Target Recognition Domain-ConseRved domain (TRD-CR), similar to Arthrobacter chlorophenolicus A6 S subunit (S.AchA6I) TRD2-CR2. The S.AchA6I S subunit recognizes 5'... TGAANNNNNTCG ... 3'. The restriction-modification (RM) system S subunit consists of two variable target recognition domains (TRD1 and 2) and two conserved regions (CR1 and CR2) which separate the TRDs. The TRDs each bind to different specific sequences in the DNA. For example, S.AchA6I-TRD1 recognizes TGAA/TTCA, and TRD2 recognizes CGA/TCG. RM systems protect a bacterial cell against invasion of foreign DNA by endonucleolytic cleavage of DNA that lacks a site specific modification. The host genome is protected from cleavage by methylation of specific nucleotides in the target sites. In type I systems, both restriction and modification activities are present in one enzyme complex composed of one DNA specificity (S) subunit (this family), two modification (M) subunits and two restriction (R) subunits. This model contains both TRD1-CR1 and TRD2-CR2. It may also include TRD-CR-like sequence-recognition domains of various type II restriction enzymes and methyltransferases and type I DNA methyltransferases.	5.62124e-11
LR214997.1\|VEU66242.1\|401675_401849_-\|Uncharacterised-protein	gnl\|CDD\|372614	pfam13475, DUF4116, Domain of unknown function (DUF4116).	2.06977e-08
LR214997.1\|VEU66239.1\|398937_399408_-\|Type-I-restriction-modification-system-methyltransferase-subunit	gnl\|CDD\|341139	cd17250, RMtype1_S_Eco4255II_TRD2-CR2_like, Type I restriction-modification system specificity (S) subunit Target Recognition Domain-ConseRved domain (TRD-CR), similar to Escherichia coli O118:H16 07-4255 S subunit (S.Eco4255II) TRD2-CR2 and Shewanella oneidensis MR-1 S subunit (S.SonIV) TRD1-CR1. Escherichia coli O118:H16 07-4255 S subunit (S.Eco4255II) recognizes 5'... TACNNNNNNNRTRTC ... 3 while Shewanella oneidensis MR-1 S subunit (S.SonIV) recognizes 5'... TACNNNNNNGTNGT ... 3'. The restriction-modification (RM) system S subunit consists of two variable target recognition domains (TRD1 and 2) and two conserved regions (CR1 and CR2) which separate the TRDs. The TRDs each bind to different specific sequences in the DNA. For example, S.SonIV-TRD1 recognizes TAC/GTA and S.SonIV-TRD2 recognizes ACNAC/GTNGT. RM systems protect a bacterial cell against invasion of foreign DNA by endonucleolytic cleavage of DNA that lacks a site specific modification. The host genome is protected from cleavage by methylation of specific nucleotides in the target sites. In type I systems, both restriction and modification activities are present in one enzyme complex composed of one DNA specificity (S) subunit (this family), two modification (M) subunits and two restriction (R) subunits. This model contains both TRD1-CR1 and TRD2-CR2. It may also include TRD-CR-like sequence-recognition domains of various type II restriction enzymes and methyltransferases and type I DNA methyltransferases.	1.1599e-20
LR214997.1\|VEU66256.1\|423233_424049_+\|DNA-formamidopyrimidine-glycosylase	gnl\|CDD\|234899	PRK01103, PRK01103, bifunctional DNA-formamidopyrimidine glycosylase/DNA-(apurinic or apyrimidinic site) lyase.	3.72996e-127

>LR214997.1|VEU66248.1|407788_410908_-|Type-I-restriction-enzyme-EcoR124II-R-protein
MAEFNEKTRVQIPALVHLLRLGYIYLGRNSDSKKSFEYDATTNIAIEIFKEKFFQLNPTFKGDFNEVLREIKHDLNNDDLGMSFYNRLISDNQKLIDFDNINNNSFHFTGEFSYRNEGEELRPDITLFINGLPLVFIEVKTPNNPGGVVAEAERMNNKRLPNRKFKRYININQLMIFSNNMEYDNVDGIAPVEGAFYSTAAKQKAFFNCFREDSDKFINDYPYGPIDKDIEKQIIGDFNAHTLLWAPEYKTNLYFDTPTNRIITSLCSPERLLFIIKYGIAYLNYNKELDGNIEQFNLKHIMRYQQLLATLAVRDTLNEGKKSGIIWHTQGSGKTALSYYLIRYLNDYFSSQNKVAKFYFIVDRLDLLEQAKQEFEYRGLSVKTPRNKEELMAQFQTTHATEGIDGKMEITVVNIQRFDEKDEINIPDYSVNLQRIFIIDEAHRSYKKGGSFLANLFNADTNSIKIALTGTPLLRKDKESWSIFGNYIHTYYYDKSIKDGYTLKIIREDVETSCKFKLEKIYDSLQELAQKKDVKMSNIIEHDSYVEELTKFIIRDFKQFQISRESNSLGGMVICETSNQAKKIYNFFNKIQSNAEDNEFEKTNLKAALILHDTDDKATRIKYINDFKKGNNIDILIVYNMLLTGFDAPRLKKIYFGRKLTDHTLLQAITRVNRPYEQNTYGYIIDFADIKKNFDDTNKAYLHELQKISEPSEIESYDVLNSIIEDKDKLIENVKNASNKLFKYTINNLEIFNSEISEIDDKKHLIDLRNVLFSARDSFNLVRTWGDEVLKEKFNEIKIENLPILINLLTKRINIVNQKLALKDNESFQSSMNKIMNNIEFIFKKTLVNDELKIVSTDILNEKWVQISREFEANIDTKDPEYSSLLSIIRDKFAKRGFIIKNMDEFYESSTFLDKTLSNIKKINKDNNNLLAKYDNDQKFVRIHKRILDLNKKHADEKSELILSNNNHEIMNVLKMIKNNIDNEIYKKRSILNNQGFFKKTISSTIYNIFEEEKIEMNNEDIKFIINNIEEGYISQIKQ
>LR214997.1|VEU66247.1|406418_407765_-|Type-I-restriction-enzyme-EcoKI-M-protein
MNLKEKTISLIDALKATCQHYGIGNDGNEYKVITQVFLYKFINDKFGYEIKKVSPELNVADKWDESYANMSEEKRKSLLNRLKADVPLLEPQHLISGLWNQQKKGNFAQIFDSTMEEIAAKNEAIFATETVHKTRIPIFEKLTIYVTDDIKRSDFARALVDKLVNFSFEEALGEHYDFFADMFEYLLKDYNTNGGGKYAEYYTPQSIAKIMAKLLIGEQKEFNSIEIYDPSAGTGTLVMALSHSIGIDRCTIYTQDISQKSNKMLKFNLILNGLVSSLQNAIQGDTLTSPYHRSDDNKSLRQFDFVVSNPPFKLDFSETREKLSTMPERFWGGVPKVPPTKKDSMAIYTLFIQHVINSLKNETGKGAIVIPTGFITSKSGVESKILKRIVDEKIVYGCVSMPSNVFANTGTNVTVLFFDNARNHDKVILIDASKLGEDYKDGKNKKED
>LR214997.1|VEU66246.1|404639_405839_-|Uncharacterised-protein
MKKLMNYAIYSNEKLSIDGLDVFYVGVENILPNKKGIKPSSFVPKTGKYTKFEKYDILLGNIGPYLKKIWLADKTGLASPDVLVIKPLESRFGKYIYAHLLNDVFFKYAMLGVKGSILPRCDKNHIMNYSIPDVKNKEKIGDFIYFINKKIEINNKINDNLEKQTKLLYDYWFTQFDFPDENGNPYKSSGGEMVFNEELKRYIPKGWSIETLANNTISRIIKPGVNIFKEKTYFATADINNKEISSGNKVLYQNRESRANMQPIKSSVWFAKMKNSVKHLFITDNMDFMINEGILSTGFCGLECEKNSFEYISSFINSSYFEMAKDILSHGATQESVNNNDLNFINILIPDRRTLLNFHKITKPIYEQITENICSNRKITELRDYLLPLLLNGQVTIED
>LR214997.1|VEU66245.1|404103_404643_+|Type-I-restriction-modification-DNA-specificity-domain
MNEWKKVKISEIGKVVTGKTPKTSNSSFYGGKTPFFTPSDDWSTKYIKNTNKYLTEDGKNSVKGSIIPKNAICVSCIGSIGKVAMTSSETVTNQQINSIIVNETKYDIDFIYYAMLELGKVLNLHSGSSTVVPIISKNTFSEYKLACPKLDEQKKISNVLSIIDKKIEINRQINDNLFV
>LR214997.1|VEU66244.1|403118_404099_+|site-specific-tyrosine-recombinase
MNDKYIKNILQKMQHCLNNKQMNELKNVLKQELILAQNNSNNNDDVSNEKIVELFIGSKTLEGCSDKTIKYYISTIDSMVKSINKQINEIETNDLRNYLSNYQYKNNSSKVTIDNIRRILSSFFSWLEDENYIVKSPVRRIKKVKAPITVKETYSDEELEIMRDNVNNYRDLALIDILASTGMRVGELVKLNIEDVDFNERECIVVGKGNKQRIVYFDARTKIHLKKYLDSRVDKNKSLFVSLKLPYGRISINGIESRLRKIGKDLNIKKVHPHKFRRTLATIAIDKGMPIEQVQRLLGHEKVDTTLKYAMVKQSNVKKAHQKYIG
>LR214997.1|VEU66243.1|402364_402955_-|Uncharacterised-protein
MVFNEELKRYIPNGWSVKKMSDIILKKSNPFEFKSTEPTIDLSVMPQNSISLTTANTSSNFSTNLFTMIEGDILFGSIRPYLRKAGIAPFNGVVAGTIYSFIPKFQYDYNFALITISSDSFFEYAINQSQGTKMPIVSSQSILSYKFPYNKEISKKFNTFNIKNIIAKNSQQIIYLTTLRDYLLPLLLNGQVTIED
>LR214997.1|VEU66242.1|401675_401849_-|Uncharacterised-protein
MQNTPKELTNDKEFLLQIIDTRPEVLEYVSDKLKNDNEIHFQAIKKNIKVLNSLQKY
>LR214997.1|VEU66241.1|400370_401162_+|Transposase
MNWGYIISYRMKASNNSFKEYVLDENEYITNGSLKYKTREIASFFNKKRPNGHVRNQVVTSSTKRALKDKNDREILIENFTKKMNKNGLVSYENLAGSKKYKFFKPVNKGAFYQLDEEKIIEDSKFDGFYVYETNRRDLSVPEIIEIYSKQWQIESNFKTFKGTLLLRPVYLSTWNHIIGYICLCFISLVFLNYLIYILNNTLGLAGKSKITEYKLINVIRDIKELEIYIDKQKVQSIEIYNDELSESWEIYKLLLDIFIKKT
>LR214997.1|VEU66240.1|399480_400365_+|Transposase
MFNIEMKKSKKDAKRQWRTSISRIVKGEYLSIGIPRPDNKGFKIRFGYGYISELQNFHPDPVTAIKTIISNFPLSLTKEEAKTKLDSIYKGKKPIKQEAIEKFKGYEIIEKLFTHFDIFKDCRVTKSTTLKDVVSQLIYQRIKRPLSVYSTYKSMKKENLETFSKNSFYRSLDYIAENKNTILRNINQKIKDKINRNINVLWFDSTTSYFETFKRDGYKKPGFSKDGKFKEDQIVIGMATDENGIPLHYKVYPGNTADSKTFIPFMLEIAKIYNVNNVTIVADKGMSANSNIRF
>LR214997.1|VEU66239.1|398937_399408_-|Type-I-restriction-modification-system-methyltransferase-subunit
MSTGKRGNSKDKINISFKDKFKMFEKGSILFPKSGQSIYKNYRCILGEDAFVTSHIAVITISKKDKIKNRYLYELLKQVDSRNLKVSSGCASLNISDIENIKVPVPPIEIQEKIIKECEELEQQYQTTRMKIEEYQAQIQKIFEDLEVIKSEGGIN
>LR214997.1|VEU66249.1|411327_412623_+|putative-ATPase,-AAA+-superfamily
MIIKRDFYLNQIIDKKENGRIKIITGIRRCGKSYLLFNLYRDYLLSSGIKENQIITIALDQIDNIEYRNPFRLNEYIKQKTKNINKMYYIFIDEIQLSENVSNPYIESSEKNITFVDVLLSLMKHSNLDIYITGSNSKMLSSNLLTQFRDRGDQVHVHPLSFAEVYELFDDKSEAFEHYFVYGGMPHIYKLQNDEQKSHYLKQLFKQTYIKDILERNQIYNEQQILEILLDFTSSNIGSLTNPSKLAKRFLSEKQIHISSNTIFKYLKFFEESYIIQCAYRYDVKGSKYFSTPLKYYFSDIGLRNARLNFRQIENTHIMENIIYNDLLRRGYNIDIGVVEHEFKNGSTRKKIQLEIDFVINKGHKRYYIQSALNIDNLEKKEQEITSLKKINDSFKKIVIVRNKIIPKHDENGILYIGLEDFLLNESIIDL
>LR214997.1|VEU66250.1|412813_413044_+|Uncharacterised-protein
MHEPKDVVKNWLRVRDTIEFLGLWETINNPNSKGVEFDSFRKKAGSNAFTLSPQRWIKNTNSIGIISKSGREYGSS
>LR214997.1|VEU66251.1|413707_414268_+|Uncharacterised-protein
MENKKLIIGLGAAAAGVALFAIPVGIASTTKYDGDPLKNVEEKANSISNIVFKDESIGVNTTYASLKSKLVENGHKKSDVTAFGFFDFFTTKNNQPTLITDSEWNCCEIVIKDIIADDQDQSFKVYYYVQSKLDNNDVAKSNLRVKTLSFGFLPEFSLASFAHKGQQLFKSIRPRTYGEFIATLKG
>LR214997.1|VEU66252.1|414298_417925_+|Uncharacterised-protein
MTSSNDFAKDVNKAQSSDEAQQIVNKYFDLQSVIDRIASDTNNVFDNNGVTISKYKVSLIKNPNTNNEYALPLVDNKDEVVLFLQTEFSDQFKKTITNFDGKDFKHIDILRLNLKDLLTSTKLEDKISITPFSVQDFYSRKDKTNPFTIATKEKQNFANILNEFVKKNIAKADFNKPGTTRVRRSPLISKSAITQSYEDTSVPQTSSAGATGAGATTTPKTTADATLNDPTLAASDISALANQVRTAKFDFRLVDPIEFIQFINGSLFTNKEDRDQFLTFVVQQGLNQDLAKYIRFETGLENLPLGSVDNFLNFDITLDSSQLDLVLYDGRPVVKVGGTIVAKSNAGTIIFTKEFSTILGAFKNSLFTISKEKYASLPDNIRLSLNKIRQGLQNNNYTRDASSINEYAYLDLASGKEIDQLIKNSKFDQLQKLLSDRSRYGYQFNNQQILKALTQKFVLPSVEDFATKSKRSNLEQETNYKILNFNNDYFTNDFDVARFYTKLAHQGAETVANYFIELLKANNLIDSSVEISNPKQLFQQLRQISFKDGAKFQYFSFNRNYQRYSNLGFISTLSLPQGLRDNAVEEILDLAIVDGTTQVSQPGKTQAVIPTYSTAKIASAVDTNEIINFIRDYAQNNADPDELSDQLNSSAGVEIANLGDLLVAFYYKIFSQQFTDTLLPISSSLTYNTHFSQITVDELEAEKKAAEAAAEKIIDAIKKRTNTSSTGIDSEFVDIDGSKNALIIQEVLKEKDFVKKHVRLLQYNYSLGFKDEKTNTVNNTFISDNYNLLIFVKESDGKQFNTSGQLDQVVIGIPTIYKNVYLSEEEYNKLDTTVKEIEDKANKTGITDVKDIESIVGTSLVDYLKAINPNYNLVAKRIVLKDGELQPGDNGLEGATSILVDSTSPFTNKNQKILSLYLTDSPKFDKSKIDNQLFLNTNYSSIPLKIIIHKAEKEFKLPVNETLAQEQTDQNTQSSPNTQGGTPSGNNGNTSTNGQSAGTSGSQQSGSQQPGSTNGQTSGQGTNSTQPTQPQTSPQSSGSTTNSSITNSSTTQTNSPAPSQPGTAQGGGSSNGGGSSTPSFNVGSGGSTTTQPGQGSGGGGSSSSSAGSSSSAGSSSSSSSSSSSSSSSSSSSSSSSSSSSSPTPGATTPSAPAPATPGPSAPATPVPPATPPQPQPQQPSQQPSQPQSQQQGQKGNPFGGIFVPELVR
>LR214997.1|VEU66253.1|417951_420795_+|Uncharacterised-protein
MKKPNFKTSLIIGLSAVAALTIVVAPIVAVRAKANDYQRKLNASSQEIAKAVAFKSNFDFTRDDFIQLASSLTVNEAYKNRISAQSALDLHNDKTYSFELIDIVDLSPLKAKAPNMQFELRTISATEDANNVTKAEGGEIKGAILIGIDEKNKLYYSSSANILGFASPSTNAFANFIIDQNTSKIQLSSASILKYQSPSTLAIAFQKTFEKELAANNNQNALAFAKTVAAFGGLSLFDQTQKPTILPANYSLAAKVDEQNRLSFAKVDSSTGELSIILELINSNNNEKQEVILNFSKISGLSQNLTSQLASTFSKYYKIKDNLANLLATNKLSLAQVLYSSTIPSVLAQSDEFKDKSLADIQKFDFWFEQRDQQQSLQFDTEKNGIQASDFSIDFPKTNGNESQFSAPDASVVANLINNGEIMVTLKFNSNVNKSDKVPNGVDLIDGKDELSQKIDVVVDARGDVYKTVVANYFKNTNKIEVDPKSNINIAISQDDLDAALSPFLGKKLSSQLLEKSGQQLFSILDRTGVEIPSDSGDDQKTPAGQYLKSILENLLTQNHLPENTFIELQSSYFNNYALEIILSDAQKVITRFSLPIANVVKSNLAYNAATAYNADIFVDFSNASSSSEQKYKTNSLINNKFQWEADQSDIEVQKDGIQIKSEKSLTLSNTEAIKTTYNKDASQLTNVKDGLIYLAFKPSQLPTSGKLYLLKSDSKNPNGQVNIFIQKAPDFQTTPNFEKFKDSYLIGLEYQGIKSSNSVTEIPTLIALLTKSKSFDVLPGTESATNVSPNTDNKILSIIDKSEKTAKENILKKFDNLKFFSFFNGGTVDQDFAIGKDQSVLLEIRVQENRLKFVLRSSIAKDPLGDAIESEFNLKDSTSLDDSLAALLKRGLDFSQIGGKDKAETAGDITFQALAVFNKNATGDIDSVSARQAIAKKFIEQYFNKK
>LR214997.1|VEU66254.1|421009_422737_+|Phosphoenolpyruvate-protein-phosphotransferase
MKSIKIKGIGASSGVAVAKVFKLEEIKIDVNDAKISDIDAEIKLFEDAVKKSVFQIEQIKQKATKLKPEELEILEAHALLASDPDIAEDVKNMIRQQYNAVYSLKTVAKQRIQFMLDTQDEYWIARIADIKDVVSRISKNILNINILDLSSISEDVIIVADDLTPSDTAQLNSFVKGFATNVGSRTSHSAIMARSLEIPAILGLTNIVEQVKNGDVLAINGDSGQGVINPNEEELADFAQQYAHYVEGKKKLDEFLYKPAISADGRKVVLAANIGSVEDAEGAQKANADEIGLFRSEFLYMDASNWPTEDEQFNSYKKVLQTMAGKKVVVRTLDIGGDKTLKYYNFNKELNPFLGNRAIRLSLDKQEILATQLRALIRASEFGPIAIMFPMIATLNEFFAAKKVFNEVYEQLRFIYPKIAKKEEIKLGIMIEIPIAAVMANQFAHHVDFFSIGTNDLIQYSLAADRMNEKVSYLYQPLNPGILKLIKMTIDAGHRHNKWVGMCGEMAGDVNVVPILLGLGLDEFSMSASSITKVKQLISTLEYKKMHEIAQKVVNFETEHQVIKYLESLDLISPK
>LR214997.1|VEU66255.1|422799_423234_+|ribose-5-phosphate-isomerase-B
MYKRIAFASDHAGFQRKQELIDYYQKQGYEIIDLGPSDETSTSYATYGKKLATHLLENPDELAIGICGTGLGMSYALNRFKNVRAARITSENDAYLAKLHNDANALALSARFNSKEDSISFVNKFLDTRYEGGRHQDRIDELDK
>LR214997.1|VEU66256.1|423233_424049_+|DNA-formamidopyrimidine-glycosylase
MPELPEVVTVVRALSQKIIGKKITQIKIRSDNFIKEISPKNFIAEVKNATIIDIKNHAKHILIFLDNNKVIISHLRMNGKYFTYKSAKWFAHDYLQFIFSDQSVLNYNDSRKFGTFHLRRLESLYSLAPLKNVASEPFDIDVEQFFAKLQKINKTIKAVLLDQKLIGGIGNIYADEICFATKISPLTIAKTLNFQEVKLLIENAKRILAASIKLGGSSINSYTSLNAKQGSFQNFLQVHTKVGKPCPVCQQTIVKLKVAGRGTYVCNQCQK
>LR214997.1|VEU66257.1|424023_424317_+|Uncharacterised-protein
MFATNVKNKKPNEDHYRSSLFDDEIISSHSAFAQQELASQPLHKNNYFTSCPLEFDFHGFDRQELAAKLPTCLSSFLSSNCQSAIFITGKVNQDKKN
>LR214997.1|VEU66258.1|424415_425597_+|TRANSPOSASE-FOR-INSERTION-SEQUENCE-ELEMENT-IS1
MSRHFIKDEFDMIYKIYNEFGLKQTINYVNEISPDTNFITREQLVRRIKKIIIYYNNGMQDQLLDKKGANRKPGSGKPKKSIEPDWNEFTKEELIEIAKRYYEINKNKSKSGKLSEAKKLNISFSKSAKIFNVCRQAVAKSKTRVTKVREHKNDAIIKKSFLDNKGRYGRLRLSAYISMKYNIYINPRSLGRDLKRLNLVCKIRKQRRKSEIKNTKFTLPDIVKRDYNDKLNRNIFATDVSYIKAPKDVKDSHVFLSVIIEHKTKKIRDFKLSLNNDLDLVMDNIKTFSSIDKDFVIHSDHGFQYTSKIYIDKINKMGGTVSLSRVGNSLDNREAEYWFSIIKSECLNELDYSKITLEDLKKIIADYIFWYNNYRIQSILNWKTPQQYAMMLK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

731342 : 741009

Mycoplasma_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
VEU66508.1\|731342_733931_-	bifunctional preprotein translocase subunit SecD/SecF	A0A1B1IVP7	uncultured_Mediterranean_phage	1.2e-07	23.8
VEU66509.1\|734118_734937_+	Uncharacterised protein	NA	NA	NA	NA
VEU66510.1\|734952_736212_+	serine hydroxymethyltransferase	A0A240F3L3	Aeromonas_phage	2.4e-97	48.6
VEU66511.1\|736316_738026_-	Uncharacterised protein	Q6GZ00	Mycoplasma_phage	2.6e-46	30.2
VEU66512.1\|738010_738835_-	spermidine/putrescine ABC transporter membrane protein	Q6GZ01	Mycoplasma_phage	1.8e-61	47.4
VEU66513.1\|738827_739685_-	polyamine (spermidine/putrescine) ABC transporter permease	Q6GZ02	Mycoplasma_phage	1.0e-64	51.1
VEU66514.1\|739671_741009_-	maltodextrin ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	2.0e-54	55.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. LR215005

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. LR214999

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. LR215003

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. LR214997

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection