CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
LR215038	Mycoplasma maculosum strain NCTC10168 genome assembly, plasmid: 2	0 crisprs	NA	0	0	0	0
LR215037	Mycoplasma maculosum strain NCTC10168 genome assembly, chromosome: 1	1 crisprs	cas2,cas1,cas9,DEDDh	2	15	3	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: LR215037_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

LR215037_2

554013-555107

TypeII

Consensus_repeat	Method
GTTTTATCTTACACAAGAATTGTACTAACTTAAAAT	PILER-CR
GTTTTATCTTACACAAGAATTGTACTAACTTAAAAT	CRISPRCasFinder
GTTTTATCTTACACAAGAATTGTACTAACTTAAAAT	CRT

16 spacers

csn2,cas2,cas1,cas9

The CRISPR arrays of LR215037_2

>merge|LR215037|2|554013-555107|PILER-CR,CRISPRCasFinder,CRT
GTTTTATCTTACACAAGAATTGTACTAACTTAAAATTGTTTGGAATTTCTGTTTTAGTTGCTAATCGTTTTATCTTACACAAGAATTGTACTAACTTAAAATGTGACCGTCATAATCATCTATTAAATTAAAGTTTTATCTTACACAAGAATTGTACTAACTTGAAATCAATTTATAAAAAAGGTATAGACTATCTTGGTTTTATCTTACACAAGAATTGTACTAACTTAAAATATGTAAGTTTATTTTGTTTTTGTTCTAATAGTTTTATCTTACACAAGAATTGTACTAACTTAAAATAAGGAAGATGATATTACGAATGTGCAGTTAGTTTTATCTTACACAAGAATTGTACTAACTTAAAATTTGCTCCTGTCCCTTTAATATCAGAAAAAGGTTTTATCTTACACAAGAATTGTACTAACTTAAAATCTAATCAAAATGTAGATCCGGTCACCATTAGTTTTATCTTACACAAGAATTGTACTAACTTAAAATTATGGTATTTGCCGTCAAAGCTTAAATATTGTTTTATCTTACACAAGAATTGTACTAACTTAAAATCTTTATTTAAAAATGGAAAAATAGCAATTTTGTTTTATCTTACACAAGAATTGTACTAACTTAAAATTAGTGTAAATTTTGTATACTTTTAGCTATAGTTTTATCTTACACAAGAATTGTACTAACTTAAAATCGTCGTCTTTACTTCATTTTTGTAAAACTTGTTTTATCTTACACAAGAATTGTACTAACTTAAAATCCTTTTCCTTCATCCTCTAAATTAAAATAAGTTTTATCTTACACAAGAATTGTACTAACTTAAAATGTCCTCTTATAGTTAAATTTGACGACTCACGTTTTATCTTACACAAGAATTGTACTAACTTAAAATTTCTATTAATTGAAGCGTTTATAAGCTCTAAGTTTTATCTTACACAAGAATTGTACTAACTTAAAATTCATTCTCCCAAAACTTTTACTTACTCCTTTGTTTTATCTTACACAAGAATTGTACTAACTTAAAATTTAGATTTTTAGATAAGGTTTCACTTGATTGTTTTATCTTACACAAGAATTGTACTAACTTAAAAT

>LR215037|2|2|554013-555107|PILER-CR
GTTTTATCTTACACAAGAATTGTACTAACTTAAAAT	TGTTTGGAATTTCTGTTTTAGTTGCTAATC
GTTTTATCTTACACAAGAATTGTACTAACTTAAAAT	GTGACCGTCATAATCATCTATTAAATTAAA
GTTTTATCTTACACAAGAATTGTACTAACTTGAAAT	CAATTTATAAAAAAGGTATAGACTATCTTG
GTTTTATCTTACACAAGAATTGTACTAACTTAAAAT	ATGTAAGTTTATTTTGTTTTTGTTCTAATA
GTTTTATCTTACACAAGAATTGTACTAACTTAAAAT	AAGGAAGATGATATTACGAATGTGCAGTTA
GTTTTATCTTACACAAGAATTGTACTAACTTAAAAT	TTGCTCCTGTCCCTTTAATATCAGAAAAAG
GTTTTATCTTACACAAGAATTGTACTAACTTAAAAT	CTAATCAAAATGTAGATCCGGTCACCATTA
GTTTTATCTTACACAAGAATTGTACTAACTTAAAAT	TATGGTATTTGCCGTCAAAGCTTAAATATT
GTTTTATCTTACACAAGAATTGTACTAACTTAAAAT	CTTTATTTAAAAATGGAAAAATAGCAATTTT
GTTTTATCTTACACAAGAATTGTACTAACTTAAAAT	TAGTGTAAATTTTGTATACTTTTAGCTATA
GTTTTATCTTACACAAGAATTGTACTAACTTAAAAT	CGTCGTCTTTACTTCATTTTTGTAAAACTT
GTTTTATCTTACACAAGAATTGTACTAACTTAAAAT	CCTTTTCCTTCATCCTCTAAATTAAAATAA
GTTTTATCTTACACAAGAATTGTACTAACTTAAAAT	GTCCTCTTATAGTTAAATTTGACGACTCAC
GTTTTATCTTACACAAGAATTGTACTAACTTAAAAT	TTCTATTAATTGAAGCGTTTATAAGCTCTAA
GTTTTATCTTACACAAGAATTGTACTAACTTAAAAT	TCATTCTCCCAAAACTTTTACTTACTCCTTT
GTTTTATCTTACACAAGAATTGTACTAACTTAAAAT	TTAGATTTTTAGATAAGGTTTCACTTGATT
GTTTTATCTTACACAAGAATTGTACTAACTTAAAAT

>LR215037|2|1|554013-555107|CRISPRCasFinder
GTTTTATCTTACACAAGAATTGTACTAACTTAAAAT	TGTTTGGAATTTCTGTTTTAGTTGCTAATC
GTTTTATCTTACACAAGAATTGTACTAACTTAAAAT	GTGACCGTCATAATCATCTATTAAATTAAA
GTTTTATCTTACACAAGAATTGTACTAACTTGAAAT	CAATTTATAAAAAAGGTATAGACTATCTTG
GTTTTATCTTACACAAGAATTGTACTAACTTAAAAT	ATGTAAGTTTATTTTGTTTTTGTTCTAATA
GTTTTATCTTACACAAGAATTGTACTAACTTAAAAT	AAGGAAGATGATATTACGAATGTGCAGTTA
GTTTTATCTTACACAAGAATTGTACTAACTTAAAAT	TTGCTCCTGTCCCTTTAATATCAGAAAAAG
GTTTTATCTTACACAAGAATTGTACTAACTTAAAAT	CTAATCAAAATGTAGATCCGGTCACCATTA
GTTTTATCTTACACAAGAATTGTACTAACTTAAAAT	TATGGTATTTGCCGTCAAAGCTTAAATATT
GTTTTATCTTACACAAGAATTGTACTAACTTAAAAT	CTTTATTTAAAAATGGAAAAATAGCAATTTT
GTTTTATCTTACACAAGAATTGTACTAACTTAAAAT	TAGTGTAAATTTTGTATACTTTTAGCTATA
GTTTTATCTTACACAAGAATTGTACTAACTTAAAAT	CGTCGTCTTTACTTCATTTTTGTAAAACTT
GTTTTATCTTACACAAGAATTGTACTAACTTAAAAT	CCTTTTCCTTCATCCTCTAAATTAAAATAA
GTTTTATCTTACACAAGAATTGTACTAACTTAAAAT	GTCCTCTTATAGTTAAATTTGACGACTCAC
GTTTTATCTTACACAAGAATTGTACTAACTTAAAAT	TTCTATTAATTGAAGCGTTTATAAGCTCTAA
GTTTTATCTTACACAAGAATTGTACTAACTTAAAAT	TCATTCTCCCAAAACTTTTACTTACTCCTTT
GTTTTATCTTACACAAGAATTGTACTAACTTAAAAT	TTAGATTTTTAGATAAGGTTTCACTTGATT
GTTTTATCTTACACAAGAATTGTACTAACTTAAAAT

>LR215037|2|1|554013-555107|CRT
GTTTTATCTTACACAAGAATTGTACTAACTTAAAAT	TGTTTGGAATTTCTGTTTTAGTTGCTAATC
GTTTTATCTTACACAAGAATTGTACTAACTTAAAAT	GTGACCGTCATAATCATCTATTAAATTAAA
GTTTTATCTTACACAAGAATTGTACTAACTTGAAAT	CAATTTATAAAAAAGGTATAGACTATCTTG
GTTTTATCTTACACAAGAATTGTACTAACTTAAAAT	ATGTAAGTTTATTTTGTTTTTGTTCTAATA
GTTTTATCTTACACAAGAATTGTACTAACTTAAAAT	AAGGAAGATGATATTACGAATGTGCAGTTA
GTTTTATCTTACACAAGAATTGTACTAACTTAAAAT	TTGCTCCTGTCCCTTTAATATCAGAAAAAG
GTTTTATCTTACACAAGAATTGTACTAACTTAAAAT	CTAATCAAAATGTAGATCCGGTCACCATTA
GTTTTATCTTACACAAGAATTGTACTAACTTAAAAT	TATGGTATTTGCCGTCAAAGCTTAAATATT
GTTTTATCTTACACAAGAATTGTACTAACTTAAAAT	CTTTATTTAAAAATGGAAAAATAGCAATTTT
GTTTTATCTTACACAAGAATTGTACTAACTTAAAAT	TAGTGTAAATTTTGTATACTTTTAGCTATA
GTTTTATCTTACACAAGAATTGTACTAACTTAAAAT	CGTCGTCTTTACTTCATTTTTGTAAAACTT
GTTTTATCTTACACAAGAATTGTACTAACTTAAAAT	CCTTTTCCTTCATCCTCTAAATTAAAATAA
GTTTTATCTTACACAAGAATTGTACTAACTTAAAAT	GTCCTCTTATAGTTAAATTTGACGACTCAC
GTTTTATCTTACACAAGAATTGTACTAACTTAAAAT	TTCTATTAATTGAAGCGTTTATAAGCTCTAA
GTTTTATCTTACACAAGAATTGTACTAACTTAAAAT	TCATTCTCCCAAAACTTTTACTTACTCCTTT
GTTTTATCTTACACAAGAATTGTACTAACTTAAAAT	TTAGATTTTTAGATAAGGTTTCACTTGATT
GTTTTATCTTACACAAGAATTGTACTAACTTAAAAT

Protein	Signature genes	Signature genes Name	Protein_function
LR215037.1\|VEU75556.1\|555855_556164_-\|CRISPR-associated-protein-Cas2	cas2	COG3512_cas2_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|226043
LR215037.1\|VEU75551.1\|550553_551465_-\|ribosomal-large-subunit-pseudouridine-synthaseD	unknown	unknown	gnl\|CDD\|223638
LR215037.1\|VEU75550.1\|549575_550541_-\|Uncharacterised-protein	unknown	unknown	unknown
LR215037.1\|VEU75555.1\|555112_555856_-\|Uncharacterised-protein	csn2	cls000024_csn2_CAS-II-A	unknown
LR215037.1\|VEU75557.1\|556168_557053_-\|CRISPR-associated-endonuclease-Cas1,-subtype-II/NMENI	cas1	cd09720_cas1_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|187851
LR215037.1\|VEU75560.1\|562906_565282_+\|Xylulose-5-phosphate-phosphoketolase	unknown	unknown	gnl\|CDD\|235379
LR215037.1\|VEU75563.1\|567557_568463_+\|Uncharacterised-protein	unknown	unknown	unknown
LR215037.1\|VEU75545.1\|543811_544984_+\|Uncharacterised-protein	unknown	unknown	unknown
LR215037.1\|VEU75552.1\|551508_552174_-\|Chromate-transporter	unknown	unknown	gnl\|CDD\|224970
LR215037.1\|VEU75558.1\|557180_560669_-\|Uncharacterized-protein-conserved-in-bacteria	cas9	cd09643_cas9_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|273840
LR215037.1\|VEU75549.1\|548912_549533_-\|ribonuclease-H-II	unknown	unknown	gnl\|CDD\|260003
LR215037.1\|VEU75564.1\|568572_569304_+\|UPF0082-protein-MCRO_0552	unknown	unknown	gnl\|CDD\|234640
LR215037.1\|VEU75559.1\|560795_562613_-\|Uncharacterized-protein-involved-in-cytokinesis,-contains-TGc-(transglutaminase/protease-like)-domain	unknown	unknown	gnl\|CDD\|376628
LR215037.1\|VEU75553.1\|552173_552776_-\|chromate-transporter	unknown	unknown	gnl\|CDD\|224970
LR215037.1\|VEU75554.1\|552821_553592_-\|Uncharacterised-protein	unknown	unknown	gnl\|CDD\|376437
LR215037.1\|VEU75561.1\|565422_565932_+\|Uncharacterised-protein	unknown	unknown	unknown
LR215037.1\|VEU75547.1\|546423_548202_+\|Uncharacterised-protein	unknown	unknown	unknown
LR215037.1\|VEU75562.1\|566214_567534_+\|Aminopeptidase-C	unknown	unknown	gnl\|CDD\|238328
LR215037.1\|VEU75546.1\|545039_546170_-\|chaperone-protein	unknown	unknown	gnl\|CDD\|274090
LR215037.1\|VEU75548.1\|548229_548898_+\|LemA-family	unknown	unknown	gnl\|CDD\|224618

Protein	Function_ID	Function_description	E-value
LR215037.1\|VEU75556.1\|555855_556164_-\|CRISPR-associated-protein-Cas2	gnl\|CDD\|226043	COG3512, COG3512, CRISPR-associated protein, Cas2 homolog [Defense mechanisms].	1.06321e-19
LR215037.1\|VEU75552.1\|551508_552174_-\|Chromate-transporter	gnl\|CDD\|224970	COG2059, ChrA, Chromate transport protein ChrA [Inorganic ion transport and metabolism].	1.77043e-11
LR215037.1\|VEU75564.1\|568572_569304_+\|UPF0082-protein-MCRO_0552	gnl\|CDD\|234640	PRK00110, PRK00110, YebC/PmpR family DNA-binding transcriptional regulator.	2.17558e-114
LR215037.1\|VEU75557.1\|556168_557053_-\|CRISPR-associated-endonuclease-Cas1,-subtype-II/NMENI	gnl\|CDD\|187851	cd09720, Cas1_II, CRISPR/Cas system-associated protein Cas1. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas1 is the most universal CRISPR system protein thought to be involved in spacer intergration. Cas1 is metal-dependent deoxyribonuclease, also binds RNA; Shown to possess a unique fold consisting of a N-terminal beta-strand domain and a C-terminal alpha-helical domain.	1.92047e-96
LR215037.1\|VEU75560.1\|562906_565282_+\|Xylulose-5-phosphate-phosphoketolase	gnl\|CDD\|235379	PRK05261, PRK05261, phosphoketolase.	0
LR215037.1\|VEU75549.1\|548912_549533_-\|ribonuclease-H-II	gnl\|CDD\|260003	cd07182, RNase_HII_bacteria_HII_like, Bacterial Ribonuclease HII-like. This family includes mostly bacterial type 2 RNases H, with some eukaryotic members. Bacterial RNase HII has a role in primer removal based on its involvement in ribonucleotide-specific catalytic activity in the presence of RNA/DNA hybrid substrates. Several bacteria, such as Bacillus subtilis, have two different type II RNases H, RNases HII and HIII; double deletion of these leads to cellular lethality. It appears that type I and type II RNases H also have overlapping functions in cells, as over-expression of Escherichia coli RNase HII can complement an RNase HI deletion phenotype. In Leishmania mitochondria, of the four distinct RNase H genes (H1, HIIA, HIIB, HIIC), HIIC is essential for the survival of the parasite and thus can be a potential target for anti-leishmanial chemotherapy. Ribonuclease H (RNase H) is classified into two families, type I (prokaryotic RNase HI, eukaryotic RNase H1 and viral RNase H) and type II (prokaryotic RNase HII and HIII, and eukaryotic RNase H2). RNase H endonucleolytically hydrolyzes an RNA strand when it is annealed to a complementary DNA strand in the presence of divalent cations, in DNA replication and repair.	6.72123e-95
LR215037.1\|VEU75546.1\|545039_546170_-\|chaperone-protein	gnl\|CDD\|274090	TIGR02349, Chaperone_protein_DnaJ, chaperone protein DnaJ. This model represents bacterial forms of DnaJ, part of the DnaK-DnaJ-GrpE chaperone system. The three components typically are encoded by consecutive genes. DnaJ homologs occur in many genomes, typically not near DnaK and GrpE-like genes; most such genes are not included by this family. Eukaryotic (mitochondrial and chloroplast) forms are not included in the scope of this family.	1.72445e-136
LR215037.1\|VEU75558.1\|557180_560669_-\|Uncharacterized-protein-conserved-in-bacteria	gnl\|CDD\|273840	TIGR01865, conserved_hypothetical_protein, CRISPR subtype II/NMENI RNA-guided endonuclease Cas9/Csn1. CRISPR loci appear to be mobile elements with a wide host range. This model represents a protein found only in CRISPR-containing species, near other CRISPR-associated proteins (cas), as part of the NMENI subtype of CRISPR/Cas locus. The species range so far for this protein is animal pathogens and commensals only.	9.14395e-71
LR215037.1\|VEU75559.1\|560795_562613_-\|Uncharacterized-protein-involved-in-cytokinesis,-contains-TGc-(transglutaminase/protease-like)-domain	gnl\|CDD\|376628	pfam01841, Transglut_core, Transglutaminase-like superfamily. This family includes animal transglutaminases and other bacterial proteins of unknown function. Sequence conservation in this superfamily primarily involves three motifs that centre around conserved cysteine, histidine, and aspartate residues that form the catalytic triad in the structurally characterized transglutaminase, the human blood clotting factor XIIIa'. On the basis of the experimentally demonstrated activity of the Methanobacterium phage pseudomurein endoisopeptidase, it is proposed that many, if not all, microbial homologs of the transglutaminases are proteases and that the eukaryotic transglutaminases have evolved from an ancestral protease.	1.25608e-11
LR215037.1\|VEU75562.1\|566214_567534_+\|Aminopeptidase-C	gnl\|CDD\|238328	cd00585, Peptidase_C1B, Peptidase C1B subfamily (MEROPS database nomenclature); composed of eukaryotic bleomycin hydrolases (BH) and bacterial aminopeptidases C (pepC). The proteins of this subfamily contain a large insert relative to the C1A peptidase (papain) subfamily. BH is a cysteine peptidase that detoxifies bleomycin by hydrolysis of an amide group. It acts as a carboxypeptidase on its C-terminus to convert itself into an aminopeptidase and peptide ligase. BH is found in all tissues in mammals as well as in many other eukaryotes. Bleomycin, a glycopeptide derived from the fungus Streptomyces verticullus, is an effective anticancer drug due to its ability to induce DNA strand breaks. Human BH is the major cause of tumor cell resistance to bleomycin chemotherapy, and is also genetically linked to Alzheimer's disease. In addition to its peptidase activity, the yeast BH (Gal6) binds DNA and acts as a repressor in the Gal4 regulatory system. BH forms a hexameric ring barrel structure with the active sites imbedded in the central channel. The bacterial homolog of BH, called pepC, is a cysteine aminopeptidase possessing broad specificity. Although its crystal structure has not been solved, biochemical analysis shows that pepC also forms a hexamer. .	0
LR215037.1\|VEU75553.1\|552173_552776_-\|chromate-transporter	gnl\|CDD\|224970	COG2059, ChrA, Chromate transport protein ChrA [Inorganic ion transport and metabolism].	8.95923e-23
LR215037.1\|VEU75554.1\|552821_553592_-\|Uncharacterised-protein	gnl\|CDD\|376437	pfam01027, Bax1-I, Inhibitor of apoptosis-promoting Bax1. Programmed cell-death involves a set of Bcl-2 family proteins, some of which inhibit apoptosis (Bcl-2 and Bcl-XL) and some of which promote it (Bax and Bak). Human Bax inhibitor, BI-1, is an evolutionarily conserved integral membrane protein containing multiple membrane-spanning segments predominantly localized to intracellular membranes. It has 6-7 membrane-spanning domains. The C termini of the mammalian BI-1 proteins are comprised of basic amino acids resembling some nuclear targeting sequences, but otherwise the predicted proteins lack motifs that suggest a function. As plant BI-1 appears to localize predominantly to the ER, we hypothesized that plant BI-1 could also regulate cell death triggered by ER stress. BI-1 appears to exert its effect through an interaction with calmodulin. The budding yeast member of this family has been found unexpectedly to encode a BH3 domain-containing protein (Ybh3p) that regulates the mitochondrial pathway of apoptosis in a phylogenetically conserved manner. Examination of the crystal structure of a bacterial member of this family shows that these proteins mediate a calcium leak across the membrane that is pH-dependent. Calcium homoeostasis balances passive calcium leak with active calcium uptake. The structure exists in a pore-closed and pore-open conformation, at pHs of 8 and 6 respectively, and the pore can be opened by intracrystalline transition; together these findings suggest that pH controls the conformational transition.	0.0046065
LR215037.1\|VEU75551.1\|550553_551465_-\|ribosomal-large-subunit-pseudouridine-synthaseD	gnl\|CDD\|223638	COG0564, RluA, Pseudouridylate synthases, 23S RNA-specific [Translation, ribosomal structure and biogenesis].	9.0304e-99
LR215037.1\|VEU75548.1\|548229_548898_+\|LemA-family	gnl\|CDD\|224618	COG1704, LemA, Uncharacterized conserved protein [Function unknown].	1.36647e-35

>LR215037.1|VEU75554.1|552821_553592_-|Uncharacterised-protein
MITQNNNEKLSFWKPKTYTEEQKVSKNKLLASAFIWFGYSMFIAFLTGIITTYAISWKTDTIGTAGIAVMLTFGILGVISLFIELFFGWRMNFYVQLVFVTFGMMFLGFAVVSLIILFTVANKTVEYLLYSISIPMLLFILFGFLSYYNKIKIKPVYILLIIMAIVMLISTIVGFFVFSRWFEMFYVTLSVFIYSLILLIDIYMISNANRYFNEQMNTKNTNKEIMKLSIYFGFKIAYDCIYLIYYLFRIFIELKN
>LR215037.1|VEU75553.1|552173_552776_-|chromate-transporter
MSEIRVRKDVSFWKVFWFIILSTFIGFGGGNALFPILKRYSVDKYKWLSEKEFEENVLITNMLPGPSVIEALSYISFKMLGFWKGLIVVIFAVIPHVLLAFLLIYFSQYIEKKYLYVIEVGVMITIIGSLIIFVLNYYKKGIKGIKISLWFILFLTTFLFTLFIPAPYNMPVGIMILVIIIFSLIYFAKKCLNKEKEVKK
>LR215037.1|VEU75552.1|551508_552174_-|Chromate-transporter
MTLFLLLLFTIGLTIVISLSVFGGGQIFMPIYRQFWSLLNTLFNTNISENDISNIFTLSNSTPGVFSTKLAFVTGYYVANGEWWGFIFMFITYLSFILVPILIMYFAMKLSQKSKNSVYGKKLLAIMNPIISAIMAALVIQLLIGIIAPYFVFNKSINDYFKIDENNSKALFFSGFRKIALFIFVPTGIISSAILYKFKFPLLAILFINVISSFIIFAPWA
>LR215037.1|VEU75551.1|550553_551465_-|ribosomal-large-subunit-pseudouridine-synthaseD
MLKIEVTYKERIDKYISDNSEISRNDAKALIEQEAVYIDDEKYVRKPNYIVREGMVITILKLLEKEIDIEPKDMPLDIRYEDNDLIVLNKPSDLVVHPAPGHYNDTLVNGLLHHFNQLSNNNGLLRPGIVHRIDKDTSGLLIIAKNNDSHNKLADMLKEHKIKRSYIAIVEGILENKITKINLPIARSTQDRKTMTVHRDGKDSITIVHLLKTFYIDKKPYSLVRCELETGRTHQIRVHLSYIKHPVYGDPIYGKFVDDFNQRLHAYKLEFEHPFTNNLVKVYAEIPKEFEIADYNFDELLNN
>LR215037.1|VEU75550.1|549575_550541_-|Uncharacterised-protein
MFDKSFFNERSYEGLWTHYKKTFLPIFIATIFSFAFILFFELISIGLQIAHVSKLGLAELTNSGPYAKWSVNDGFKQGLTLLYLFTLPSFVIVIFTLSIVYISISIAKGKKEKDFSNLAGWPVIAYLVTFINSIIFVITLVFTRFENIDAISIIRITIQVISAITTIVFYLLFIRRYMWVKSSYIVVKQYLESIRIQNELKNDPNFQNIFSFINRYSENNNNFEEESKNNNNNSSELSEKEAKRKENFDKLMELPNEKLFDAAKGLFISGYETMSKEKLVNILLDIFEKQEQDKQNYSSNEKEEIKIEETDAVESDNLEEK
>LR215037.1|VEU75549.1|548912_549533_-|ribonuclease-H-II
MLLFEKNNFGDKTLVAGFDEAGRGCCAGPLVVASVIMPRDYNNDLINDSKKLNEKTRNALYEEIINNAIDYSIVFLDAQYVDENNPKQSSKNGMKLCLEKLSKKPEILITDFENIPETSIKQLNLVKGDSISFNVACASILAKVSRDRYMIDISSKYPEYFFDKHKGYGTKLHQEMIEKYGTCKEHRLSYKNVKLALEKHNKKISN
>LR215037.1|VEU75548.1|548229_548898_+|LemA-family
MANELDELTGPVNSEGKDINVIQKQIPVKVGAGSLIFEIFLWILIIPGLIFLFVKIKSRNYLRQLQQKINHNASTVDNFLEQRVQILQNAASIMNKAIEFDKSVMTEIAALRSGATASNDFTRSEINTKLNSAFDGIKVQIERYPELQAHDSLKRAMQENSYLQKEITAAREIYNDTVLQWNQEIFNWPSKQIVAAKAGYTTRIPFSVSFETKEKARSNFFE
>LR215037.1|VEU75547.1|546423_548202_+|Uncharacterised-protein
MKENFNAIDEIDYDPIEAYNKNFKTKHKELSKKYINDIIEQSGIDVSTNKEESKKYRKYSEINDKLKRKGSIFKGILISISILTIVALLIASFLYVSLKWFGTPITLFVVFPIIFIASLSLFLTLIIKNNKIRKNNKEILIKHYEKAKELIAPVFPLIKHGIREKLLTEACSIIKFDKYLRDETLFEYKINFGFEDPYDSKNSSCVFLQSGYVLNNPFVIKKNLTMTMGTKNYYGSITISWTEYSTDANGTRRAVLRTQTLTAHVTKSYPYYNTQNVLYYLNNAAPNLKFTREFSHIEKLSEKEYKKHINKMNKVFTKMDQEAIKEGRTFKSMSGNLEFESIFNAKDRNNELEYRLLFTPLAQKSMKKVLLDKNNYGDDFSFIKFNKINALISEHLNEFPLATNEKLFYETYDVDILIDNFLKYQENYFKNIYHSFAPIFAIPLYLNTPYERNIYEEDKQMFMSEYDLEYYINLINPKLIAHENSKTQNINKIIGRYKNIESGYDEIDVISSGFDSFERVDYISVRGGDGKLHSVPVTWYEYVPVSAKSRLHVKALNKYECENDETNQNYENDSSIINMNKNSTIINFIRKM
>LR215037.1|VEU75546.1|545039_546170_-|chaperone-protein
MDNNKDYYAILGVSKNATEKEIKMAYRKLAMQYHPDKVKDGSSDEKMQKINEAYDILSDPKKREHYDRYGADGPQAGGFSGASGFDFGSFNMDFGDIFGDIFSNFGFGGGSRSRSKQANQKMKGEDILSQISISFTDAILGKKISEKLKKFELCETCKGHGALEKDIKTCSKCQGSGRMRVRQRTPFGITEVLTTCDLCNGKGKEIANKCLTCNGEGYNEKLKNVAFYIPAGADNKTQIKLDGYGKKGINGGPSGDMYVNVIVNEHKFYKRSNLDLFIEVSVSFLDIIRENTIKVPTPYGPEELKLKRNYQNGKVITLKNKGIKTNKDSRVGDLHVKLNLQMPNFDEKVYKKMVSDLETYLDTTNADFISQVEKEK
>LR215037.1|VEU75545.1|543811_544984_+|Uncharacterised-protein
MKIIKIIFNIFSKTNSKQKFLADLICYFNEDALLVKYKLNIKEGTLFDFYTTPSWFKNKNTNFVLRDKITNLLWPENKNKRQAPRPDENSKMLYKFNKEELELLNNFLNSNYEGTLKGLISLFKGNNPSGSYKNPNNSEIKSNNERFKNNLIMLLDILKINKKNSIVDINSDKYEIIELKEDQFNFFLSKTKIWQIIFSFIYEIENIKSKDLKNPAEKNKINLLEKEMKKMKNDFVNYSLEVLKDIRSKRNIARNIVDKLYLFSIEKYLSFEIAHIYPVSEIKNEIYSFIEKNKINNTLKDIFKMQEYKKILNKICDKNNLLKLEPNLHTEYDKYKFYWDSETGEVKYLTDDISNEVKNKLKSMNINLNKFPNIKNYLKNYEKFLFEKKY
>LR215037.1|VEU75555.1|555112_555856_-|Uncharacterised-protein
MLKIFDEIIDENYNGIRIIDIENTNLFLKKCFEFEKGNDKSFIKINGEYINSENYLLIDNLTKVSDLLNFTSKNILFKSIQNYFSKDLSIFNIEKLNNIIKNINKKFDENIISLSLDNNKLIKNIFSLDEDIYLNLLVFENYLKNYDSKEKLTFIINDVEWISIKFMLKYINKFNFIVLTNNSQKYLSSINEIILLSFYSKNNFVNITFLEQIESILNEIKIEKNMKKIDIISNKKLFFELKSTFFL
>LR215037.1|VEU75556.1|555855_556164_-|CRISPR-associated-protein-Cas2
MRIIIMYDISMDNEEKVKKYNTFRKELFRLGYTMIQYSIYSKRLEAHTFYKKEKEKIISVIPRESNVRIMMLTEKQYQNIELLNGEKSLNEKYNNRERFIEI
>LR215037.1|VEU75557.1|556168_557053_-|CRISPR-associated-endonuclease-Cas1,-subtype-II/NMENI
MKKIIDVTETSYIHLFLNNLIFTKNGVKIMIPTKDIETLIIENTHLTISIALINKLVDNGVNIIICDEKHLPNALLIPYHKYYSVKNLQNQITWNLDFKTKAWQLIVKTKIFNSLKILKTLKLLNKENEDKIINYSNSIVGLDFSNAEAHVAKLYFKLLFGEKFKRSDEENFINRYLNYGYSILLSYIVRSLCNKGFDVRLGLFHKSYSNNFALATDIIEPFRCLIDLHLYKYIKSNELLSFKDYKKVIFDIFEEFIFFKNENVKVSKYIDLFVEEILVKNNFEKELYFERIKG
>LR215037.1|VEU75558.1|557180_560669_-|Uncharacterized-protein-conserved-in-bacteria
MSKKDISISFDIGVGSVGWAVIDEKTNDILKWGVRLFEQVNKEQAGERRIKRSLRRRIRRMQYRNRKFYRLIVRTKDLFNKNNVDEVKQTIKYLSTKYSNILDLKVKALSEQITSDELIFVLHSYLKHRGYFYVDKDDNNKNRNNEEINKLSEQNNKFPSIIIKEMYDKYKFSRSELYEGKKISNPKWVEEIEHLFNIQKITNEDFKNTYINNLFKAVREFSKGPGSENSPTQYGLYRKNKDGIVEKIGENLWDITTKKCEIFPEEKADLSHSIRYEIFSLLENINNLRFNHIKDWKIDNESKIELLNLIFSKMWESKIKYPTISLELNKNKVLNKSINLYLDKNNLQIMDGGKFNYESIYNLENLFTLIKYIKETMPNISNFISFESLDLFINELDNIISCLYNEQNIEKRIIILKSILKESKIFGQYFNDDFINILANSKKLMLSKVGSYSKKALKMFIDNMLKTSDNSIKIKFDKIRDKTIALKNSFKQTKYINEKSINNFALPSDVKNPMIEAIKVFNKIKKLYSNEWEIKNIYVEMARENNSKSYKDYVNSMLENFTNDKEKWLLKLLEDKNIKEEIYKNNTLEKLILWEQQDHIDIYDGEELDVYQIINNPSYTEIDHIIPYSQSLNNSRSNKVITKSKNNSLKSNELAYTFVKRNSEWFNKYIQKCKDIFNEKRLTKNTFPFTSKKELKDKLDNLLLEDLSSTKQKEFISRNLNDTRYVTKLFINYLKDYSLANNNCFNVSAINGQITSYIRKNAKKLLKNKSYYDWYIKDRNIYSHHAIDASIIGLYLNNSKSSLKNLKIDSLHYELFDDNGETSLVDRLTGEILKFDDFKNSKEAVKLAKINEIVNICDEKITNKYNEIAFSRKPVTNNNKELFNQKLYGLLSLENINYKIAKFNLIKKDERAKNSAKETQPFKNFFGIDPNKKSDLLIYKHSIKEYNKLNEIFLNFKEKKSPFEEYMKDLKEKKIFNGDFIDKLLQAKKVLLIHNNEKTSYSVVKNLKYIDSKVETIFLNKKQNNKSFNENMNWISVLVYKNNKNKYSIIRVNPEIYKFKKEKVNFINEDKLIKEKLNKIKIKNNISLDSKPVMILKKGSIFQRKNDETIWYVTGSNAQRIELNRIDKNKENSNYRNMPSVNVLIDNYIPLEIDILGNIYKK
>LR215037.1|VEU75559.1|560795_562613_-|Uncharacterized-protein-involved-in-cytokinesis,-contains-TGc-(transglutaminase/protease-like)-domain
MKKKHLIFKNLLASSILLTTPLMWVSCSINEKENVNNEIKTNNENEEPKTTNLPKENDNKEKVIISNPIENKKPDVIDLKQKFLELKNETENFINNELNDISYTYYKDILVNFKNELELDQINKITYDENELEQKINSLELLYKNAKENYLKLPRIQMSEEDLKPIFDDKNSNSEIETNNDYENNLKTNLEANLFMNLVDSTLVKDYSSKNYTANNKKEIIDFTKELTKDAKTENEVVRTIFTWIVRNVKYAHDLSRMPALEPQDVLHEKFAVCGGYSNLYKAMLDAVGIKNSIVIGWSKYGHHQWNLVYNSQTKQYYHSDATFNYFNLSEEKFAKDHRTFKIIDVEHKIDDFKYEYNYGVSVLSSISNKDKPKDIINDELKVVSISEELLKKSDTVYVGKNIEKINYAGGLHKVKWFEVDPENKYYSSKDGILYNKNFTKLILVPENYENNEFTLPRTVRIIEDKKGSLKAKKLSSIKVEPGNFWFSSFDGILYNKSLSDIINIPFNKNKIILSKNTVLKEYDITDSPNFEYINITNGIDNIPAWTFNNLKNLKELIISKSISKIENNAFNNTNIKNVVVKVSDKTSKEVIDQLNKIGFRKIIK
>LR215037.1|VEU75560.1|562906_565282_+|Xylulose-5-phosphate-phosphoketolase
MNSSFDSKDYLKKVDAWWRAANYLSVGQMYLRNNPLLLQPLKSEDVKVYPIGHWGTVPGQNFIYAHLNRIINKYDVKHMLYIEGPGHGGQVISSNAYLDGSYTELFPNVTQDIKGMTHLFKYFSFPGGTASHAAPETPGSIHEGGELGYSLSHAAGAVLDNPNVIAATVVGDGEAETGPLAAGWFLNAFINPVKDGVVLPIVHVNGGKISNPTLFSRRTNEELTQYFAGMGWKALIVEGSEYMPMHEKMAKALDEAMEMIIKIKFDAAKVGAEKASRPVWPMIVLKSPKGWTGPATWKGEAIEGSFRAHQVPIPAKAEAMEYAGDLEKWLRSYKPEELFDNTGKLLPEIAEIAPKGDSRMGINPVGNGGVNPKPMELMDWKQFALDIKKPGETINQDMVTLGTYFGELTLTNKDNFRVFGPDETKSNRLYNMFKYTNRQWLDKIHPEYDEFLSPVGRIIDSQLSEHQAEGMLEGYVLTGRHGVFVSYESFLRVVDSMLTQHMKWLRKASELSWRKDYPSLNLIATSNAFQQDHNGYTHQDPGLIGHLADKRPEFIRIYLPADTNTLLATMDKAFKEREVINLIISSKQPREQFFNKEEAQELVDKGLKVFDWASTVSMNETPDLVVAASGTESTIEALATINILLENNPSLKVRFVNVLDLLKLRHPSIDPRGISDEEFDAIFTKDKPVLFAFHGYEAVLREIFFKRNNRNLIAHGYRENGDITTSFDIRLLSDMDRFHMTIDAAKAIYGEKSKELVAKMEEMIKYHKEYIKEYGTDIPEVKNWKFTPVKK
>LR215037.1|VEU75561.1|565422_565932_+|Uncharacterised-protein
MKKIHKMINSASIITLSSFSIVTISSTTNEENNNQNLDQIKNKYIEDLDSIDFDNNLKIDYKEKINSSTTEKDLNDNYNTGLRLYRDKLIKSAEISGLTEAKINELIDKANNSTTFKEINNGFILFHKYISDLGTPKSFIITTSITFSLLMVLLIIGTSVWLFKKYRKR
>LR215037.1|VEU75562.1|566214_567534_+|Aminopeptidase-C
MILNNKEIKKFYEKYISDKNNKVIENAITKNGIFNSTINNDIYRKHNHEFNVQVKKGGMTNQKSSGRCWIFSSTNMLKTKILEKLNVESFEFSENYLFFYDKLEKANTFLELVIETADKPYDNRLLQNIMSFRVSDGGYWEWAQGLIKKYGLVPKSIMDDTYDAQNSNGLNQVLDFHLLSAAHKIREAFKNNENIEELRKIKHDALEIVFQINAKSLGLPPIEFTFEYRDKDKNFHKIENITPLDFLKEYIGFEFLDKINLIHDPRDIYPKNRVYHSKYYKSVIEEKCVQSLNTNINEIKEAIVKSLQAGIPVWFDCDVSLFIEPKAGIFDTDIYNFEDSLKIWNSISKKDRVNFKFSTPNHAMTFVGVDLDKDGKPIKWEVENSWGEDRRHKGYFSMSDKWFDEFCFGAIVDPKFVNKEVLKGLNEPAIELEPWDPLA
>LR215037.1|VEU75563.1|567557_568463_+|Uncharacterised-protein
MEYQEFEQTLRQVLLDNNSKKMIYKLIDAPYRFNSLMHPFEFKVKFEQAFIRSQENKYYNFIKDYALLLFNKYGYKTMENIIKINKVDKNDPQLFIVQNLRFSHVFLDEQNKNLYLVLQKKRDTYSLNESAKLLSKLKEMANDVSDLYKEFNIKAFIWFTEVDHRKNEEFYNTNTFINENEKVTCLARYSSELFAELNHSEDWDQFEIYLSKFKNYNYQDFLKLPDLDTDKEALETLVNLSNSAWDKLNSLEPIYINIRKSIFNERSENSNLFKAKKEREIIQNSSDEDILKNELIKEGLR
>LR215037.1|VEU75564.1|568572_569304_+|UPF0082-protein-MCRO_0552
MAGHSHAANIMHRKGAQDAARGKVFQKLSKEIFVAAKSGGDPEMNPYLKLAIAKAKAKNMPKDNIERAIAKALGNSKDGSSYTETLYNATISGGATFLVVTLSDNINRTTGNVQAYFNRQNAKLGKTGTVPFQFDHKGVLEISNSLIDEETITLFAIENGAEDIQVTDESFIITTTPENFNNCKNAIESNLNITDFLQCEVTYIPNSMVLFEGEKADKIKEFIAKLEDDDDIQEVFHNIEFNE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
LR215037_1	1.2\|309969\|14\|LR215037\|PILER-CR	309969-309982	14	LR215038.1	2834-2847	1	0.929
LR215037_1	1.2\|309969\|14\|LR215037\|PILER-CR	309969-309982	14	LR215038.1	5186-5199	1	0.929
LR215037_1	1.1\|309894\|14\|LR215037\|PILER-CR	309894-309907	14	LR215038.1	2834-2847	2	0.857
LR215037_1	1.1\|309894\|14\|LR215037\|PILER-CR	309894-309907	14	LR215038.1	5186-5199	2	0.857
LR215037_1	1.2\|309969\|14\|LR215037\|PILER-CR	309969-309982	14	LR215038.1	885-898	2	0.857

1. spacer 1.2|309969|14|LR215037|PILER-CR matches to position: 2834-2847, mismatch: 1, identity: 0.929

ttttaaatcatttg	CRISPR spacer
ttttaaatcatatg	Protospacer
*********** **

2. spacer 1.2|309969|14|LR215037|PILER-CR matches to position: 5186-5199, mismatch: 1, identity: 0.929

ttttaaatcatttg	CRISPR spacer
ttttatatcatttg	Protospacer
***** ********

3. spacer 1.1|309894|14|LR215037|PILER-CR matches to position: 2834-2847, mismatch: 2, identity: 0.857

ttgtaaatcatttg	CRISPR spacer
ttttaaatcatatg	Protospacer
** ******** **

4. spacer 1.1|309894|14|LR215037|PILER-CR matches to position: 5186-5199, mismatch: 2, identity: 0.857

ttgtaaatcatttg	CRISPR spacer
ttttatatcatttg	Protospacer
** ** ********

5. spacer 1.2|309969|14|LR215037|PILER-CR matches to position: 885-898, mismatch: 2, identity: 0.857

ttttaaatcatttg	CRISPR spacer
ttttaaattttttg	Protospacer
********. ****

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
LR215037_2	2.4\|554247\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554247-554276	30	KM359505	Prochlorococcus phage P-TIM68, complete genome	164703-164732	5	0.833
LR215037_2	2.4\|554247\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554247-554276	30	MN693411	Marine virus AFVG_25M210, complete genome	12642-12671	5	0.833
LR215037_2	2.1\|554049\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554049-554078	30	AP014212	Uncultured Mediterranean phage uvMED isolate uvMED-GF-C86-MedDCM-OCT-S32-C46, * SEQUENCING IN PROGRESS *	26770-26799	6	0.8
LR215037_2	2.1\|554049\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554049-554078	30	NZ_LR214939	Mycoplasma salivarium strain NCTC10113 plasmid 2	688109-688138	6	0.8
LR215037_2	2.2\|554115\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554115-554144	30	AY855346	Clostridium difficile bacteriophage phi CD119, complete genome	27247-27276	6	0.8
LR215037_2	2.2\|554115\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554115-554144	30	NC_007917	Clostridium phage phi CD119, complete genome	27247-27276	6	0.8
LR215037_2	2.4\|554247\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554247-554276	30	NC_010282	Bacillus thuringiensis plasmid pFR12.5, complete sequence	109-138	6	0.8
LR215037_2	2.4\|554247\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554247-554276	30	NZ_AP018256	Calothrix sp. NIES-4071 plasmid plasmid1 DNA, complete genome	62197-62226	6	0.8
LR215037_2	2.6\|554379\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554379-554408	30	AP014010	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C97-MedDCM-OCT-S27-C11, * SEQUENCING IN PROGRESS *	31081-31110	6	0.8
LR215037_2	2.8\|554511\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554511-554540	30	NZ_CP033890	Lactobacillus plantarum strain LMT1-48 plasmid p_2, complete sequence	3290-3319	6	0.8
LR215037_2	2.8\|554511\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554511-554540	30	NZ_CP046657	Lactobacillus plantarum strain 123-17 plasmid p123-18.1, complete sequence	27035-27064	6	0.8
LR215037_2	2.8\|554511\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554511-554540	30	NC_021516	Lactobacillus plantarum 16 plasmid Lp16C, complete sequence	9379-9408	6	0.8
LR215037_2	2.9\|554577\|31\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554577-554607	31	MN694445	Marine virus AFVG_250M317, complete genome	25196-25226	6	0.806
LR215037_2	2.9\|554577\|31\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554577-554607	31	MN694780	Marine virus AFVG_250M331, complete genome	14150-14180	6	0.806
LR215037_2	2.10\|554644\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554644-554673	30	MT457553	Shewanella phage Thanatos-2, complete genome	141399-141428	6	0.8
LR215037_2	2.12\|554776\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554776-554805	30	MK250023	Prevotella phage Lak-B4, complete genome	226255-226284	6	0.8
LR215037_2	2.12\|554776\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554776-554805	30	MH552526	Siphoviridae sp. isolate ctfj46, complete genome	87382-87411	6	0.8
LR215037_2	2.13\|554842\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554842-554871	30	MN694705	Marine virus AFVG_250M45, complete genome	39505-39534	6	0.8
LR215037_2	2.1\|554049\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554049-554078	30	AP014374	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S42-C54, * SEQUENCING IN PROGRESS *	21413-21442	7	0.767
LR215037_2	2.1\|554049\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554049-554078	30	NZ_CP017431	Staphylococcus simulans strain MR4 plasmid unnamed4, complete sequence	38158-38187	7	0.767
LR215037_2	2.1\|554049\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554049-554078	30	NC_013944	Staphylococcus simulans bv. staphylolyticus strain NRRL B-2628 plasmid pACK1, complete sequence	41716-41745	7	0.767
LR215037_2	2.1\|554049\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554049-554078	30	NZ_CP015643	Staphylococcus simulans strain MR1 plasmid unnamed1, complete sequence	47587-47616	7	0.767
LR215037_2	2.1\|554049\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554049-554078	30	NZ_CP017429	Staphylococcus simulans strain MR3 plasmid unnamed5, complete sequence	109553-109582	7	0.767
LR215037_2	2.1\|554049\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554049-554078	30	NZ_CP016158	Staphylococcus simulans strain MR2 plasmid unnamed1	108698-108727	7	0.767
LR215037_2	2.2\|554115\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554115-554144	30	GU943034	Uncultured phage MedDCM-OCT-S08-C232 genomic sequence	3013-3042	7	0.767
LR215037_2	2.2\|554115\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554115-554144	30	NC_017296	Clostridium acetobutylicum EA 2018 plasmid pEA2018, complete sequence	81901-81930	7	0.767
LR215037_2	2.2\|554115\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554115-554144	30	NC_015686	Clostridium acetobutylicum DSM 1731 plasmid pSMBa, complete sequence	81901-81930	7	0.767
LR215037_2	2.2\|554115\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554115-554144	30	NC_001988	Clostridium acetobutylicum ATCC 824 plasmid pSOL1, complete sequence	81901-81930	7	0.767
LR215037_2	2.4\|554247\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554247-554276	30	AP014395	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S45-C86, * SEQUENCING IN PROGRESS *	16151-16180	7	0.767
LR215037_2	2.4\|554247\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554247-554276	30	NC_011259	Borrelia duttonii Ly plasmid pl23b, complete sequence	3152-3181	7	0.767
LR215037_2	2.4\|554247\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554247-554276	30	NZ_CP031070	Bacillus sp. JAS24-2 plasmid pl278, complete sequence	88454-88483	7	0.767
LR215037_2	2.4\|554247\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554247-554276	30	NZ_CP032612	Bacillus thuringiensis strain QZL38 plasmid p.4, complete sequence	50180-50209	7	0.767
LR215037_2	2.4\|554247\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554247-554276	30	NZ_CP014285	Bacillus thuringiensis strain Bt185 plasmid pBT1850055, complete sequence	11630-11659	7	0.767
LR215037_2	2.4\|554247\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554247-554276	30	AP014236	Uncultured Mediterranean phage uvMED isolate uvMED-GF-C95A-MedDCM-OCT-S25-C36, * SEQUENCING IN PROGRESS *	3866-3895	7	0.767
LR215037_2	2.5\|554313\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554313-554342	30	NC_010821	Pseudomonas phage 201phi2-1, complete genome	283378-283407	7	0.767
LR215037_2	2.9\|554577\|31\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554577-554607	31	NZ_CP021661	Candidatus Fukatsuia symbiotica strain 5D plasmid p5D_Fsymbiotica-2	75862-75892	7	0.774
LR215037_2	2.9\|554577\|31\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554577-554607	31	NZ_CP021661	Candidatus Fukatsuia symbiotica strain 5D plasmid p5D_Fsymbiotica-2	86842-86872	7	0.774
LR215037_2	2.9\|554577\|31\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554577-554607	31	MT074137	Bacteroides phage DAC16, complete genome	167837-167867	7	0.774
LR215037_2	2.11\|554710\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554710-554739	30	MN940411	Staphylococcus phage f2b1, partial genome	64832-64861	7	0.767
LR215037_2	2.12\|554776\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554776-554805	30	NZ_CP018745	Borreliella garinii strain CIP 103362 isolate 20047 plasmid p_lp54_linear	31164-31193	7	0.767
LR215037_2	2.12\|554776\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554776-554805	30	NC_006129	Borreliella bavariensis PBi plasmid lp54, complete sequence	29132-29161	7	0.767
LR215037_2	2.12\|554776\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554776-554805	30	MK504445	Lactobacillus phage ATCCB, complete genome	29038-29067	7	0.767
LR215037_2	2.12\|554776\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554776-554805	30	NZ_CP028862	Borreliella garinii strain 20047 plasmid lp54, complete sequence	26295-26324	7	0.767
LR215037_2	2.12\|554776\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554776-554805	30	NC_017804	Borreliella garinii BgVir plasmid lp54, complete sequence	26493-26522	7	0.767
LR215037_2	2.12\|554776\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554776-554805	30	KU878088	Bacillus phage AR9, complete genome	242418-242447	7	0.767
LR215037_2	2.12\|554776\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554776-554805	30	MF360957	Bacillus virus PBS1, complete genome	151936-151965	7	0.767
LR215037_2	2.1\|554049\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554049-554078	30	LT699705	Staphylococcus aureus strain NZ15MR0322 genome assembly, plasmid: 2	9978-10007	8	0.733
LR215037_2	2.1\|554049\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554049-554078	30	AP014198	Uncultured Mediterranean phage uvMED isolate uvMED-GF-C73-MedDCM-OCT-S33-C13, * SEQUENCING IN PROGRESS *	34263-34292	8	0.733
LR215037_2	2.1\|554049\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554049-554078	30	MG945422	UNVERIFIED: Microviridae sp. isolate 4310-1711, complete genome	1674-1703	8	0.733
LR215037_2	2.1\|554049\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554049-554078	30	NZ_LT992457	Staphylococcus aureus isolate 1_1439 plasmid II	6070-6099	8	0.733
LR215037_2	2.1\|554049\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554049-554078	30	NZ_LT992457	Staphylococcus aureus isolate 1_1439 plasmid II	33254-33283	8	0.733
LR215037_2	2.2\|554115\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554115-554144	30	NZ_LR134403	Listeria monocytogenes strain NCTC7974 plasmid 6, complete sequence	169224-169253	8	0.733
LR215037_2	2.3\|554181\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554181-554210	30	NZ_CP053971	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed3, complete sequence	23439-23468	8	0.733
LR215037_2	2.3\|554181\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554181-554210	30	NZ_CP013278	Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-3-235K, complete sequence	52007-52036	8	0.733
LR215037_2	2.3\|554181\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554181-554210	30	NC_018509	Bacillus thuringiensis HD-789 plasmid pBTHD789-2, complete sequence	45891-45920	8	0.733
LR215037_2	2.3\|554181\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554181-554210	30	NZ_CP039724	Bacillus thuringiensis strain BT-59 plasmid p3, complete sequence	81298-81327	8	0.733
LR215037_2	2.3\|554181\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554181-554210	30	NZ_CP051859	Bacillus thuringiensis serovar israelensis strain BGSC 4Q7rifR plasmid pBtic235, complete sequence	158535-158564	8	0.733
LR215037_2	2.3\|554181\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554181-554210	30	NZ_CP009347	Bacillus thuringiensis HD1002 plasmid 3, complete sequence	197291-197320	8	0.733
LR215037_2	2.3\|554181\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554181-554210	30	NZ_CP045025	Bacillus thuringiensis strain JW-1 plasmid p3, complete sequence	52007-52036	8	0.733
LR215037_2	2.4\|554247\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554247-554276	30	MK448665	Streptococcus phage Javan1, complete genome	2005-2034	8	0.733
LR215037_2	2.4\|554247\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554247-554276	30	NZ_CP021437	Bacillus thuringiensis strain C15 plasmid pBMB240, complete sequence	15609-15638	8	0.733
LR215037_2	2.4\|554247\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554247-554276	30	NZ_CP021437	Bacillus thuringiensis strain C15 plasmid pBMB240, complete sequence	82190-82219	8	0.733
LR215037_2	2.4\|554247\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554247-554276	30	NZ_CP030080	Enterobacter hormaechei strain 20710 plasmid pIMP-20710, complete sequence	252918-252947	8	0.733
LR215037_2	2.4\|554247\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554247-554276	30	MN694783	Marine virus AFVG_250M759, complete genome	27708-27737	8	0.733
LR215037_2	2.6\|554379\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554379-554408	30	NZ_CP039706	Clostridium butyricum strain 4-1 plasmid p-butyl_plas_4-1, complete sequence	264581-264610	8	0.733
LR215037_2	2.6\|554379\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554379-554408	30	NZ_CP033246	Clostridium butyricum strain CFSA3987 plasmid pCFSA3987, complete sequence	847045-847074	8	0.733
LR215037_2	2.6\|554379\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554379-554408	30	NZ_CP033248	Clostridium butyricum strain CFSA3989 plasmid pCFSA3989, complete sequence	847060-847089	8	0.733
LR215037_2	2.6\|554379\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554379-554408	30	NZ_AP019717	Clostridium butyricum strain NBRC 13949 plasmid pCBU1, complete sequence	300185-300214	8	0.733
LR215037_2	2.6\|554379\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554379-554408	30	NZ_CP039703	Clostridium butyricum strain 29-1 plasmid p-butyl_plas_29-1, complete sequence	414363-414392	8	0.733
LR215037_2	2.6\|554379\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554379-554408	30	NZ_CP013238	Clostridium butyricum strain CDC_51208 plasmid pNPD4_2, complete sequence	531377-531406	8	0.733
LR215037_2	2.9\|554577\|31\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554577-554607	31	NZ_CP026601	Clostridiaceae bacterium 14S0207 plasmid unnamed1, complete sequence	122146-122176	8	0.742
LR215037_2	2.9\|554577\|31\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554577-554607	31	MN693433	Marine virus AFVG_25M397, complete genome	22830-22860	8	0.742
LR215037_2	2.12\|554776\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554776-554805	30	NC_047887	Pectobacterium phage DU_PP_V, complete genome	27084-27113	8	0.733
LR215037_2	2.13\|554842\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554842-554871	30	NC_030925	Bacillus phage Shbh1, complete genome	81807-81836	8	0.733
LR215037_2	2.15\|554975\|31\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554975-555005	31	MN445185	Escherichia phage vB_EcoM_EC001, complete genome	118793-118823	8	0.742
LR215037_2	2.15\|554975\|31\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554975-555005	31	KU726251	Enterobacteria phage SEGD1, complete genome	115299-115329	8	0.742
LR215037_2	2.15\|554975\|31\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554975-555005	31	MT679221	Proteus phage 7, complete genome	117410-117440	8	0.742
LR215037_2	2.15\|554975\|31\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554975-555005	31	NC_027402	Salmonella phage SPN3US, complete genome	116542-116572	8	0.742
LR215037_2	2.15\|554975\|31\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554975-555005	31	MT799840	Salmonella phage JN03, complete genome	119031-119061	8	0.742
LR215037_2	2.15\|554975\|31\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554975-555005	31	LR535912	XXX	124027-124057	8	0.742
LR215037_2	2.16\|555042\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	555042-555071	30	NC_009137	Lactococcus lactis subsp. lactis bv. diacetylactis plasmid pDBORO, complete sequence	8820-8849	8	0.733
LR215037_2	2.3\|554181\|30\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554181-554210	30	NC_048797	Bacillus phage vB_BmeM-Goe8, complete genome	145833-145862	9	0.7
LR215037_2	2.9\|554577\|31\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554577-554607	31	AP014122	Uncultured Mediterranean phage uvMED isolate uvMED-GF-C4-MedDCM-OCT-S43-C68, * SEQUENCING IN PROGRESS *	11834-11864	9	0.71
LR215037_2	2.9\|554577\|31\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554577-554607	31	AP014140	Uncultured Mediterranean phage uvMED isolate uvMED-GF-C4A-MedDCM-OCT-S37-C62, * SEQUENCING IN PROGRESS *	21771-21801	9	0.71
LR215037_2	2.9\|554577\|31\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554577-554607	31	MK448873	Streptococcus phage Javan202, complete genome	11284-11314	9	0.71
LR215037_2	2.9\|554577\|31\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554577-554607	31	AP014141	Uncultured Mediterranean phage uvMED isolate uvMED-GF-C4A-MedDCM-OCT-S46-C72, * SEQUENCING IN PROGRESS *	11832-11862	9	0.71
LR215037_2	2.14\|554908\|31\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554908-554938	31	MN693047	Marine virus AFVG_25M111, complete genome	6582-6612	9	0.71
LR215037_2	2.14\|554908\|31\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554908-554938	31	MN693506	Marine virus AFVG_25M112, complete genome	6581-6611	9	0.71
LR215037_2	2.15\|554975\|31\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554975-555005	31	NZ_CP013278	Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-3-235K, complete sequence	51640-51670	9	0.71
LR215037_2	2.15\|554975\|31\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554975-555005	31	NC_018509	Bacillus thuringiensis HD-789 plasmid pBTHD789-2, complete sequence	45524-45554	9	0.71
LR215037_2	2.15\|554975\|31\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554975-555005	31	NZ_CP051859	Bacillus thuringiensis serovar israelensis strain BGSC 4Q7rifR plasmid pBtic235, complete sequence	158168-158198	9	0.71
LR215037_2	2.15\|554975\|31\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554975-555005	31	NZ_CP009347	Bacillus thuringiensis HD1002 plasmid 3, complete sequence	196924-196954	9	0.71
LR215037_2	2.15\|554975\|31\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554975-555005	31	NZ_CP045025	Bacillus thuringiensis strain JW-1 plasmid p3, complete sequence	51640-51670	9	0.71
LR215037_2	2.15\|554975\|31\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554975-555005	31	NZ_CP053971	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed3, complete sequence	23805-23835	9	0.71
LR215037_2	2.15\|554975\|31\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554975-555005	31	NZ_CP039724	Bacillus thuringiensis strain BT-59 plasmid p3, complete sequence	81664-81694	9	0.71
LR215037_2	2.9\|554577\|31\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554577-554607	31	NZ_CP031281	Staphylococcus pasteuri strain 3C plasmid unnamed1, complete sequence	20773-20803	10	0.677
LR215037_2	2.9\|554577\|31\|LR215037\|PILER-CR,CRISPRCasFinder,CRT	554577-554607	31	MT773554	Myoviridae sp. isolate BML_2 genomic sequence	53902-53932	10	0.677

1. spacer 2.4|554247|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to KM359505 (Prochlorococcus phage P-TIM68, complete genome) position: , mismatch: 5, identity: 0.833

atgtaagtttattttgtttttgttctaata	CRISPR spacer
aattatctttattttgtttttgatctaata	Protospacer
*  **  *************** *******

2. spacer 2.4|554247|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to MN693411 (Marine virus AFVG_25M210, complete genome) position: , mismatch: 5, identity: 0.833

atgtaagtttattttgtttttgttc-taata	CRISPR spacer
tagtaagtttatttttttcttgttcataat-	Protospacer
  ************* **.****** ****

3. spacer 2.1|554049|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to AP014212 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-C86-MedDCM-OCT-S32-C46, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.8

tgtttggaatttctgttttagttgctaatc	CRISPR spacer
gatttgcaatttcttttttagttgcttttc	Protospacer
 .**** ******* ***********  **

4. spacer 2.1|554049|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to NZ_LR214939 (Mycoplasma salivarium strain NCTC10113 plasmid 2) position: , mismatch: 6, identity: 0.8

tgtttggaatttctgttttagttgctaatc	CRISPR spacer
tatctccactttcttttttagttgctaatc	Protospacer
*.*.*  * ***** ***************

5. spacer 2.2|554115|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to AY855346 (Clostridium difficile bacteriophage phi CD119, complete genome) position: , mismatch: 6, identity: 0.8

gtgaccgtcataatcatctattaaattaaa	CRISPR spacer
atcatcttcataatcctctattgaattaaa	Protospacer
.* *.* ******** ******.*******

6. spacer 2.2|554115|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to NC_007917 (Clostridium phage phi CD119, complete genome) position: , mismatch: 6, identity: 0.8

gtgaccgtcataatcatctattaaattaaa	CRISPR spacer
atcatcttcataatcctctattgaattaaa	Protospacer
.* *.* ******** ******.*******

7. spacer 2.4|554247|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to NC_010282 (Bacillus thuringiensis plasmid pFR12.5, complete sequence) position: , mismatch: 6, identity: 0.8

atgtaagtttattttgtttttgttctaata	CRISPR spacer
tttgtagtttattttgtttttcttttaata	Protospacer
 *   **************** **.*****

8. spacer 2.4|554247|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to NZ_AP018256 (Calothrix sp. NIES-4071 plasmid plasmid1 DNA, complete genome) position: , mismatch: 6, identity: 0.8

---atgtaagtttattttgtttttgttctaata	CRISPR spacer
cacattt---tttaatttgtttttgttcttata	Protospacer
   ** *   **** ************** ***

9. spacer 2.6|554379|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to AP014010 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C97-MedDCM-OCT-S27-C11, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.8

ttgctcctgtccctttaatatcagaaaaag	CRISPR spacer
ttgctactgtacctttaatatcatcaataa	Protospacer
***** **** ************  ** *.

10. spacer 2.8|554511|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP033890 (Lactobacillus plantarum strain LMT1-48 plasmid p_2, complete sequence) position: , mismatch: 6, identity: 0.8

tatggtatttgccgtcaaagcttaaatatt	CRISPR spacer
agcgttatttgccgtcaaagattaaagatt	Protospacer
 ..* *************** ***** ***

11. spacer 2.8|554511|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP046657 (Lactobacillus plantarum strain 123-17 plasmid p123-18.1, complete sequence) position: , mismatch: 6, identity: 0.8

tatggtatttgccgtcaaagcttaaatatt	CRISPR spacer
agcgttatttgccgtcaaagattaaagatt	Protospacer
 ..* *************** ***** ***

12. spacer 2.8|554511|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to NC_021516 (Lactobacillus plantarum 16 plasmid Lp16C, complete sequence) position: , mismatch: 6, identity: 0.8

tatggtatttgccgtcaaagcttaaatatt	CRISPR spacer
agcgttatttgccgtcaaagattaaagatt	Protospacer
 ..* *************** ***** ***

13. spacer 2.9|554577|31|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to MN694445 (Marine virus AFVG_250M317, complete genome) position: , mismatch: 6, identity: 0.806

ctttatttaaaaatggaaaaatagcaatttt	CRISPR spacer
atgaatttaaaaatggaaaaaaagcaatagt	Protospacer
 *  ***************** ******  *

14. spacer 2.9|554577|31|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to MN694780 (Marine virus AFVG_250M331, complete genome) position: , mismatch: 6, identity: 0.806

ctttatttaaaaatggaaaaatagcaatttt	CRISPR spacer
atgaatttaaaaatggaaaaaaagcaatagt	Protospacer
 *  ***************** ******  *

15. spacer 2.10|554644|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to MT457553 (Shewanella phage Thanatos-2, complete genome) position: , mismatch: 6, identity: 0.8

tagtgtaaattttgtatacttttagctata	CRISPR spacer
ttcggtaaattttgtaaatttttagctaca	Protospacer
*   ************ *.*********.*

16. spacer 2.12|554776|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to MK250023 (Prevotella phage Lak-B4, complete genome) position: , mismatch: 6, identity: 0.8

ccttttccttcatcctctaaattaaaataa	CRISPR spacer
gaattaacttcatcctctacattaaaataa	Protospacer
   **  ************ **********

17. spacer 2.12|554776|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to MH552526 (Siphoviridae sp. isolate ctfj46, complete genome) position: , mismatch: 6, identity: 0.8

ccttttccttcatcctctaaattaaaataa	CRISPR spacer
cttatatcttcatcgtctaaatcaaaataa	Protospacer
*.* * .******* *******.*******

18. spacer 2.13|554842|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to MN694705 (Marine virus AFVG_250M45, complete genome) position: , mismatch: 6, identity: 0.8

gtcctcttatagttaaatttgacgactcac	CRISPR spacer
atcctcttttagttaaatttgataaatctc	Protospacer
.******* *************..* ** *

19. spacer 2.1|554049|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to AP014374 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S42-C54, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 7, identity: 0.767

tgtttggaatttctgttttagttgctaatc	CRISPR spacer
cttttggaatttctgttttaggtggttcac	Protospacer
. ******************* ** *   *

20. spacer 2.1|554049|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP017431 (Staphylococcus simulans strain MR4 plasmid unnamed4, complete sequence) position: , mismatch: 7, identity: 0.767

tgtttggaatttctgttttagttgctaatc	CRISPR spacer
gattactattttctgttttagttgctattc	Protospacer
 .**   * ****************** **

21. spacer 2.1|554049|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to NC_013944 (Staphylococcus simulans bv. staphylolyticus strain NRRL B-2628 plasmid pACK1, complete sequence) position: , mismatch: 7, identity: 0.767

tgtttggaatttctgttttagttgctaatc	CRISPR spacer
gattactattttctgttttagttgctattc	Protospacer
 .**   * ****************** **

22. spacer 2.1|554049|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP015643 (Staphylococcus simulans strain MR1 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

tgtttggaatttctgttttagttgctaatc	CRISPR spacer
gattactattttctgttttagttgctattc	Protospacer
 .**   * ****************** **

23. spacer 2.1|554049|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP017429 (Staphylococcus simulans strain MR3 plasmid unnamed5, complete sequence) position: , mismatch: 7, identity: 0.767

tgtttggaatttctgttttagttgctaatc	CRISPR spacer
gattactattttctgttttagttgctattc	Protospacer
 .**   * ****************** **

24. spacer 2.1|554049|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP016158 (Staphylococcus simulans strain MR2 plasmid unnamed1) position: , mismatch: 7, identity: 0.767

tgtttggaatttctgttttagttgctaatc	CRISPR spacer
gattactattttctgttttagttgctattc	Protospacer
 .**   * ****************** **

25. spacer 2.2|554115|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to GU943034 (Uncultured phage MedDCM-OCT-S08-C232 genomic sequence) position: , mismatch: 7, identity: 0.767

gtgaccgtcataatcatctattaaattaaa	CRISPR spacer
ttgaccatcataatcatctactaaatactt	Protospacer
 *****.*************.*****

26. spacer 2.2|554115|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to NC_017296 (Clostridium acetobutylicum EA 2018 plasmid pEA2018, complete sequence) position: , mismatch: 7, identity: 0.767

gtgaccgtcataatcatctattaaattaaa	CRISPR spacer
cttatcagcatattcatctattaaattaat	Protospacer
 * *.*. **** ****************

27. spacer 2.2|554115|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to NC_015686 (Clostridium acetobutylicum DSM 1731 plasmid pSMBa, complete sequence) position: , mismatch: 7, identity: 0.767

gtgaccgtcataatcatctattaaattaaa	CRISPR spacer
cttatcagcatattcatctattaaattaat	Protospacer
 * *.*. **** ****************

28. spacer 2.2|554115|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to NC_001988 (Clostridium acetobutylicum ATCC 824 plasmid pSOL1, complete sequence) position: , mismatch: 7, identity: 0.767

gtgaccgtcataatcatctattaaattaaa	CRISPR spacer
cttatcagcatattcatctattaaattaat	Protospacer
 * *.*. **** ****************

29. spacer 2.4|554247|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to AP014395 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S45-C86, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 7, identity: 0.767

atgtaagtttattttgtttttgttctaata	CRISPR spacer
ccatttgtttattttctttttcttctaata	Protospacer
 ..*  ********* ***** ********

30. spacer 2.4|554247|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to NC_011259 (Borrelia duttonii Ly plasmid pl23b, complete sequence) position: , mismatch: 7, identity: 0.767

atgtaagtttattttgtttttgttctaata	CRISPR spacer
ttaaatttttattttgtctttgttttaata	Protospacer
 *. *  **********.******.*****

31. spacer 2.4|554247|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP031070 (Bacillus sp. JAS24-2 plasmid pl278, complete sequence) position: , mismatch: 7, identity: 0.767

atgtaagtttattttgtttttgttctaata	CRISPR spacer
acgaaagttcattttgtttttgttcgtaag	Protospacer
*.* *****.***************  * .

32. spacer 2.4|554247|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032612 (Bacillus thuringiensis strain QZL38 plasmid p.4, complete sequence) position: , mismatch: 7, identity: 0.767

atgtaagtttattttgtttttgttctaata	CRISPR spacer
ctatttttttattttgtttttgttcaagta	Protospacer
 *.*   ****************** *.**

33. spacer 2.4|554247|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP014285 (Bacillus thuringiensis strain Bt185 plasmid pBT1850055, complete sequence) position: , mismatch: 7, identity: 0.767

atgtaagtttattttgtttttgttctaata	CRISPR spacer
ctatttttttattttgtttttgttcaagta	Protospacer
 *.*   ****************** *.**

34. spacer 2.4|554247|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to AP014236 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-C95A-MedDCM-OCT-S25-C36, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 7, identity: 0.767

atgtaagtttattttgtttttgttctaata	CRISPR spacer
ttgtaagtttttttggtttttgtttttttg	Protospacer
 ********* *** *********.*  *.

35. spacer 2.5|554313|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to NC_010821 (Pseudomonas phage 201phi2-1, complete genome) position: , mismatch: 7, identity: 0.767

aaggaagatgatattacgaatgtgcagtta	CRISPR spacer
aaggaagatgttattacgaatcgagggttc	Protospacer
********** **********  . .***

36. spacer 2.9|554577|31|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP021661 (Candidatus Fukatsuia symbiotica strain 5D plasmid p5D_Fsymbiotica-2) position: , mismatch: 7, identity: 0.774

ctttatttaaaaatggaaaaatagcaatttt	CRISPR spacer
atcgtgttaaaaatggaaatatagaaatttt	Protospacer
 *.   ************* **** ******

37. spacer 2.9|554577|31|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP021661 (Candidatus Fukatsuia symbiotica strain 5D plasmid p5D_Fsymbiotica-2) position: , mismatch: 7, identity: 0.774

ctttatttaaaaatggaaaaatagcaatttt	CRISPR spacer
atcgtgttaaaaatggaaatatagaaatttt	Protospacer
 *.   ************* **** ******

38. spacer 2.9|554577|31|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to MT074137 (Bacteroides phage DAC16, complete genome) position: , mismatch: 7, identity: 0.774

ctttatttaaaaatggaaaaatagcaatttt	CRISPR spacer
ctttatttaaataaggaaaaatattaagata	Protospacer
*********** * ********* .**  *

39. spacer 2.11|554710|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to MN940411 (Staphylococcus phage f2b1, partial genome) position: , mismatch: 7, identity: 0.767

cgtcgtctttacttcatttttgtaaaactt	CRISPR spacer
taatttctttacttcatcttcgtaaaactt	Protospacer
.. . ************.**.*********

40. spacer 2.12|554776|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP018745 (Borreliella garinii strain CIP 103362 isolate 20047 plasmid p_lp54_linear) position: , mismatch: 7, identity: 0.767

ccttttccttcatcctctaaattaaaataa	CRISPR spacer
acttttctttcatcttctaaattaatcttt	Protospacer
 ******.******.**********  *

41. spacer 2.12|554776|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to NC_006129 (Borreliella bavariensis PBi plasmid lp54, complete sequence) position: , mismatch: 7, identity: 0.767

ccttttccttcatcctctaaattaaaataa	CRISPR spacer
acttttctttcatcttctaaattaatcttt	Protospacer
 ******.******.**********  *

42. spacer 2.12|554776|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to MK504445 (Lactobacillus phage ATCCB, complete genome) position: , mismatch: 7, identity: 0.767

ccttttccttcatcctctaaattaaaataa	CRISPR spacer
ggaattacttcatcatctaaattaaaatta	Protospacer
    ** ******* ************* *

43. spacer 2.12|554776|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP028862 (Borreliella garinii strain 20047 plasmid lp54, complete sequence) position: , mismatch: 7, identity: 0.767

ccttttccttcatcctctaaattaaaataa	CRISPR spacer
acttttctttcatcttctaaattaatcttt	Protospacer
 ******.******.**********  *

44. spacer 2.12|554776|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to NC_017804 (Borreliella garinii BgVir plasmid lp54, complete sequence) position: , mismatch: 7, identity: 0.767

ccttttccttcatcctctaaattaaaataa	CRISPR spacer
acttttctttcatcttctaaattaatcttt	Protospacer
 ******.******.**********  *

45. spacer 2.12|554776|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to KU878088 (Bacillus phage AR9, complete genome) position: , mismatch: 7, identity: 0.767

ccttttccttcatcctctaaattaaaataa	CRISPR spacer
tcttttcctgcaccctctaaattaccttca	Protospacer
.******** **.***********   * *

46. spacer 2.12|554776|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to MF360957 (Bacillus virus PBS1, complete genome) position: , mismatch: 7, identity: 0.767

ccttttccttcatcctctaaattaaaataa	CRISPR spacer
tcttttcctgcaccctctaaattaccttca	Protospacer
.******** **.***********   * *

47. spacer 2.1|554049|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to LT699705 (Staphylococcus aureus strain NZ15MR0322 genome assembly, plasmid: 2) position: , mismatch: 8, identity: 0.733

tgtttggaatttctgttttagttgctaatc	CRISPR spacer
tgtttggaatatctgctttagttttttggg	Protospacer
********** ****.******* .* .

48. spacer 2.1|554049|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to AP014198 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-C73-MedDCM-OCT-S33-C13, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 8, identity: 0.733

tgtttggaatttctgttttagttgctaatc	CRISPR spacer
caatattaatttcttttttagtttctaatc	Protospacer
.. *   ******* ******** ******

49. spacer 2.1|554049|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to MG945422 (UNVERIFIED: Microviridae sp. isolate 4310-1711, complete genome) position: , mismatch: 8, identity: 0.733

tgtttggaatttctgttttagttgctaatc	CRISPR spacer
ctgttggagtttctgttttagtttctgttg	Protospacer
.  *****.************** **. *

50. spacer 2.1|554049|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to NZ_LT992457 (Staphylococcus aureus isolate 1_1439 plasmid II) position: , mismatch: 8, identity: 0.733

tgtttggaatttctgttttagttgctaatc	CRISPR spacer
tgtttggaatatctgctttagttttttggg	Protospacer
********** ****.******* .* .

51. spacer 2.1|554049|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to NZ_LT992457 (Staphylococcus aureus isolate 1_1439 plasmid II) position: , mismatch: 8, identity: 0.733

tgtttggaatttctgttttagttgctaatc	CRISPR spacer
tgtttggaatatctgctttagttttttggg	Protospacer
********** ****.******* .* .

52. spacer 2.2|554115|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to NZ_LR134403 (Listeria monocytogenes strain NCTC7974 plasmid 6, complete sequence) position: , mismatch: 8, identity: 0.733

gtgaccgtcataatcatctattaaattaaa	CRISPR spacer
gccattttcataatcatctagtaaattatt	Protospacer
*. *.. ************* *******

53. spacer 2.3|554181|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP053971 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.733

caatttataaaaaaggtatagactatcttg	CRISPR spacer
gatgggttgaaaaaggtatagactttcttg	Protospacer
 *     *.*************** *****

54. spacer 2.3|554181|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013278 (Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-3-235K, complete sequence) position: , mismatch: 8, identity: 0.733

caatttataaaaaaggtatagactatcttg	CRISPR spacer
gatgggttgaaaaaggtatagactttcttg	Protospacer
 *     *.*************** *****

55. spacer 2.3|554181|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to NC_018509 (Bacillus thuringiensis HD-789 plasmid pBTHD789-2, complete sequence) position: , mismatch: 8, identity: 0.733

caatttataaaaaaggtatagactatcttg	CRISPR spacer
gatgggttgaaaaaggtatagactttcttg	Protospacer
 *     *.*************** *****

56. spacer 2.3|554181|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP039724 (Bacillus thuringiensis strain BT-59 plasmid p3, complete sequence) position: , mismatch: 8, identity: 0.733

caatttataaaaaaggtatagactatcttg	CRISPR spacer
gatgggttgaaaaaggtatagactttcttg	Protospacer
 *     *.*************** *****

57. spacer 2.3|554181|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP051859 (Bacillus thuringiensis serovar israelensis strain BGSC 4Q7rifR plasmid pBtic235, complete sequence) position: , mismatch: 8, identity: 0.733

caatttataaaaaaggtatagactatcttg	CRISPR spacer
gatgggttgaaaaaggtatagactttcttg	Protospacer
 *     *.*************** *****

58. spacer 2.3|554181|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP009347 (Bacillus thuringiensis HD1002 plasmid 3, complete sequence) position: , mismatch: 8, identity: 0.733

caatttataaaaaaggtatagactatcttg	CRISPR spacer
gatgggttgaaaaaggtatagactttcttg	Protospacer
 *     *.*************** *****

59. spacer 2.3|554181|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP045025 (Bacillus thuringiensis strain JW-1 plasmid p3, complete sequence) position: , mismatch: 8, identity: 0.733

caatttataaaaaaggtatagactatcttg	CRISPR spacer
gatgggttgaaaaaggtatagactttcttg	Protospacer
 *     *.*************** *****

60. spacer 2.4|554247|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to MK448665 (Streptococcus phage Javan1, complete genome) position: , mismatch: 8, identity: 0.733

atgtaagtttattttgtttttgttctaata	CRISPR spacer
cttctagtttattttgttttttttctacat	Protospacer
 * . **************** *****

61. spacer 2.4|554247|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP021437 (Bacillus thuringiensis strain C15 plasmid pBMB240, complete sequence) position: , mismatch: 8, identity: 0.733

atgtaagtttattttgtttttgttctaata	CRISPR spacer
aaaacttttcattttgttcttgttctaata	Protospacer
* .    **.********.***********

62. spacer 2.4|554247|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP021437 (Bacillus thuringiensis strain C15 plasmid pBMB240, complete sequence) position: , mismatch: 8, identity: 0.733

atgtaagtttattttgtttttgttctaata	CRISPR spacer
aaaacttttcattttgttcttgttctaata	Protospacer
* .    **.********.***********

63. spacer 2.4|554247|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP030080 (Enterobacter hormaechei strain 20710 plasmid pIMP-20710, complete sequence) position: , mismatch: 8, identity: 0.733

atgtaagtttattttgtttttgttctaata	CRISPR spacer
taataagtttattttgtttttttttggatc	Protospacer
  .****************** **. .**

64. spacer 2.4|554247|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to MN694783 (Marine virus AFVG_250M759, complete genome) position: , mismatch: 8, identity: 0.733

atgtaagtttattttgtttttgttctaata	CRISPR spacer
catcaagtttattttgtatttgtcctattc	Protospacer
   .************* *****.*** *

65. spacer 2.6|554379|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP039706 (Clostridium butyricum strain 4-1 plasmid p-butyl_plas_4-1, complete sequence) position: , mismatch: 8, identity: 0.733

ttgctcctgtccctttaatatcagaaaaag	CRISPR spacer
ccaatcctgtctctttaatataagaaacaa	Protospacer
... *******.********* ***** *.

66. spacer 2.6|554379|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP033246 (Clostridium butyricum strain CFSA3987 plasmid pCFSA3987, complete sequence) position: , mismatch: 8, identity: 0.733

ttgctcctgtccctttaatatcagaaaaag	CRISPR spacer
ccaatcctgtctctttaatataagaaacaa	Protospacer
... *******.********* ***** *.

67. spacer 2.6|554379|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP033248 (Clostridium butyricum strain CFSA3989 plasmid pCFSA3989, complete sequence) position: , mismatch: 8, identity: 0.733

ttgctcctgtccctttaatatcagaaaaag	CRISPR spacer
ccaatcctgtctctttaatataagaaacaa	Protospacer
... *******.********* ***** *.

68. spacer 2.6|554379|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to NZ_AP019717 (Clostridium butyricum strain NBRC 13949 plasmid pCBU1, complete sequence) position: , mismatch: 8, identity: 0.733

ttgctcctgtccctttaatatcagaaaaag	CRISPR spacer
ccaatcctgtctctttaatataagaaacaa	Protospacer
... *******.********* ***** *.

69. spacer 2.6|554379|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP039703 (Clostridium butyricum strain 29-1 plasmid p-butyl_plas_29-1, complete sequence) position: , mismatch: 8, identity: 0.733

ttgctcctgtccctttaatatcagaaaaag	CRISPR spacer
ccaatcctgtctctttaatataagaaacaa	Protospacer
... *******.********* ***** *.

70. spacer 2.6|554379|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013238 (Clostridium butyricum strain CDC_51208 plasmid pNPD4_2, complete sequence) position: , mismatch: 8, identity: 0.733

ttgctcctgtccctttaatatcagaaaaag	CRISPR spacer
ccaatcctgtctctttaatataagaaacaa	Protospacer
... *******.********* ***** *.

71. spacer 2.9|554577|31|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP026601 (Clostridiaceae bacterium 14S0207 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

ctttatttaaaaatggaaaaatagcaatttt	CRISPR spacer
ctttatttgaaaatggaaaaataattgaata	Protospacer
********.**************.. .  *

72. spacer 2.9|554577|31|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to MN693433 (Marine virus AFVG_25M397, complete genome) position: , mismatch: 8, identity: 0.742

ctttatttaaaaatggaaaaatagcaatttt	CRISPR spacer
ctttatttaaaaatggaactatagtttctgg	Protospacer
******************  ****.  .*

73. spacer 2.12|554776|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to NC_047887 (Pectobacterium phage DU_PP_V, complete genome) position: , mismatch: 8, identity: 0.733

ccttttccttcatcctctaaattaaaataa	CRISPR spacer
cgagtaccttcatcctctaaactaaaaatt	Protospacer
*   * ***************.*****

74. spacer 2.13|554842|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to NC_030925 (Bacillus phage Shbh1, complete genome) position: , mismatch: 8, identity: 0.733

gtcctcttatagttaaatttgacgactcac	CRISPR spacer
ttatacttatagttaactttgacaactcta	Protospacer
 * . *********** ******.****

75. spacer 2.15|554975|31|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to MN445185 (Escherichia phage vB_EcoM_EC001, complete genome) position: , mismatch: 8, identity: 0.742

tcattctcccaaaacttttacttactccttt	CRISPR spacer
gctttctcccaaatcttttactgactggtca	Protospacer
 * ********** ******** ***  *.

76. spacer 2.15|554975|31|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to KU726251 (Enterobacteria phage SEGD1, complete genome) position: , mismatch: 8, identity: 0.742

tcattctcccaaaacttttacttactccttt	CRISPR spacer
gctttctcccaaatcttttactgactggtca	Protospacer
 * ********** ******** ***  *.

77. spacer 2.15|554975|31|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to MT679221 (Proteus phage 7, complete genome) position: , mismatch: 8, identity: 0.742

tcattctcccaaaacttttacttactccttt	CRISPR spacer
gctttctcccaaatcttttactgactggtca	Protospacer
 * ********** ******** ***  *.

78. spacer 2.15|554975|31|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to NC_027402 (Salmonella phage SPN3US, complete genome) position: , mismatch: 8, identity: 0.742

tcattctcccaaaacttttacttactccttt	CRISPR spacer
gctttctcccaaatcttttactgactggtca	Protospacer
 * ********** ******** ***  *.

79. spacer 2.15|554975|31|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to MT799840 (Salmonella phage JN03, complete genome) position: , mismatch: 8, identity: 0.742

tcattctcccaaaacttttacttactccttt	CRISPR spacer
gctttctcccaaatcttttactgactggtca	Protospacer
 * ********** ******** ***  *.

80. spacer 2.15|554975|31|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to LR535912 (XXX) position: , mismatch: 8, identity: 0.742

tcattctcccaaaacttttacttactccttt	CRISPR spacer
gctttctcccaaatcttttactgactggtca	Protospacer
 * ********** ******** ***  *.

81. spacer 2.16|555042|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to NC_009137 (Lactococcus lactis subsp. lactis bv. diacetylactis plasmid pDBORO, complete sequence) position: , mismatch: 8, identity: 0.733

ttagatttttagataaggtttcacttgatt	CRISPR spacer
tgtgatttttagatagggtttctcttagaa	Protospacer
*  ************.****** ***..

82. spacer 2.3|554181|30|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to NC_048797 (Bacillus phage vB_BmeM-Goe8, complete genome) position: , mismatch: 9, identity: 0.7

caatttataaaaaaggtatagactatcttg	CRISPR spacer
aaatttataaaaaaagtattgacttataaa	Protospacer
 *************.**** ****  .  .

83. spacer 2.9|554577|31|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to AP014122 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-C4-MedDCM-OCT-S43-C68, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 9, identity: 0.71

ctttatttaaaaatggaaaaatagcaatttt	CRISPR spacer
atggtcttaaaaatggaaaattagcatttaa	Protospacer
 *   .************** ***** **

84. spacer 2.9|554577|31|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to AP014140 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-C4A-MedDCM-OCT-S37-C62, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 9, identity: 0.71

ctttatttaaaaatggaaaaatagcaatttt	CRISPR spacer
atggtcttaaaaatggaaaattagcatttaa	Protospacer
 *   .************** ***** **

85. spacer 2.9|554577|31|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to MK448873 (Streptococcus phage Javan202, complete genome) position: , mismatch: 9, identity: 0.71

ctttatttaaaaatggaaaaatagcaatttt	CRISPR spacer
acacgatgaaaaatagaaaaatagcagtttt	Protospacer
 . .. * ******.***********.****

86. spacer 2.9|554577|31|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to AP014141 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-C4A-MedDCM-OCT-S46-C72, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 9, identity: 0.71

ctttatttaaaaatggaaaaatagcaatttt	CRISPR spacer
atggtcttaaaaatggaaaattagcatttaa	Protospacer
 *   .************** ***** **

87. spacer 2.14|554908|31|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to MN693047 (Marine virus AFVG_25M111, complete genome) position: , mismatch: 9, identity: 0.71

ttctattaattgaagcgtttataagctctaa	CRISPR spacer
agttgacgattgaagcttttattagctctaa	Protospacer
  .*. ..******** ***** ********

88. spacer 2.14|554908|31|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to MN693506 (Marine virus AFVG_25M112, complete genome) position: , mismatch: 9, identity: 0.71

ttctattaattgaagcgtttataagctctaa	CRISPR spacer
agttgacgattgaagcttttattagctctaa	Protospacer
  .*. ..******** ***** ********

89. spacer 2.15|554975|31|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013278 (Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-3-235K, complete sequence) position: , mismatch: 9, identity: 0.71

tcattctcccaaaacttttacttactccttt	CRISPR spacer
atattatcccaaaacttgtacttaccaaagt	Protospacer
 .*** *********** *******.    *

90. spacer 2.15|554975|31|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to NC_018509 (Bacillus thuringiensis HD-789 plasmid pBTHD789-2, complete sequence) position: , mismatch: 9, identity: 0.71

tcattctcccaaaacttttacttactccttt	CRISPR spacer
atattatcccaaaacttgtacttaccaaagt	Protospacer
 .*** *********** *******.    *

91. spacer 2.15|554975|31|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP051859 (Bacillus thuringiensis serovar israelensis strain BGSC 4Q7rifR plasmid pBtic235, complete sequence) position: , mismatch: 9, identity: 0.71

tcattctcccaaaacttttacttactccttt	CRISPR spacer
atattatcccaaaacttgtacttaccaaagt	Protospacer
 .*** *********** *******.    *

92. spacer 2.15|554975|31|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP009347 (Bacillus thuringiensis HD1002 plasmid 3, complete sequence) position: , mismatch: 9, identity: 0.71

tcattctcccaaaacttttacttactccttt	CRISPR spacer
atattatcccaaaacttgtacttaccaaagt	Protospacer
 .*** *********** *******.    *

93. spacer 2.15|554975|31|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP045025 (Bacillus thuringiensis strain JW-1 plasmid p3, complete sequence) position: , mismatch: 9, identity: 0.71

tcattctcccaaaacttttacttactccttt	CRISPR spacer
atattatcccaaaacttgtacttaccaaagt	Protospacer
 .*** *********** *******.    *

94. spacer 2.15|554975|31|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP053971 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.71

tcattctcccaaaacttttacttactccttt	CRISPR spacer
atattatcccaaaacttgtacttaccaaagt	Protospacer
 .*** *********** *******.    *

95. spacer 2.15|554975|31|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP039724 (Bacillus thuringiensis strain BT-59 plasmid p3, complete sequence) position: , mismatch: 9, identity: 0.71

tcattctcccaaaacttttacttactccttt	CRISPR spacer
atattatcccaaaacttgtacttaccaaagt	Protospacer
 .*** *********** *******.    *

96. spacer 2.9|554577|31|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP031281 (Staphylococcus pasteuri strain 3C plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.677

ctttatttaaaaatggaaaaatagcaatttt	CRISPR spacer
atttattgaaagatggaaaaataggggagaa	Protospacer
 ****** ***.************ ..

97. spacer 2.9|554577|31|LR215037|PILER-CR,CRISPRCasFinder,CRT matches to MT773554 (Myoviridae sp. isolate BML_2 genomic sequence) position: , mismatch: 10, identity: 0.677

ctttatttaaaaatggaaaaatagcaatttt	CRISPR spacer
agaaattaaaaaatgcaaaaatagcaaacaa	Protospacer
    *** ******* *********** .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

428368 : 439124

Mycoplasma_phage(57.14%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
VEU75440.1\|428368_430213_-	ABC-type multidrug/protein/lipid transport system ATPase component	W8CYL7	Bacillus_phage	2.1e-25	26.5
VEU75441.1\|430226_432053_-	ABC-type multidrug/protein/lipid transport system ATPase component	W8CYL7	Bacillus_phage	1.7e-32	27.0
VEU75442.1\|432127_433960_-	Oligoendopeptidase F, plasmid	A0A1X9I5X5	Streptococcus_phage	1.8e-21	21.7
VEU75443.1\|434035_434188_+	Uncharacterised protein	NA	NA	NA	NA
VEU75444.1\|434294_435683_+	ABC-type maltose/maltodextrin transporter ATP-binding protein MalK	Q6GZ03	Mycoplasma_phage	7.6e-89	74.4
VEU75445.1\|435666_436506_+	polyamine (spermidine/putrescine) ABC transporter permease	Q6GZ02	Mycoplasma_phage	9.2e-90	66.4
VEU75446.1\|436498_437389_+	spermidine/putrescine ABC transporter membrane protein	Q6GZ01	Mycoplasma_phage	5.9e-95	62.9
VEU75447.1\|437381_439124_+	Uncharacterised protein	Q6GZ00	Mycoplasma_phage	4.1e-76	34.6

DBSCAN-SWA_2

446936 : 455120

Aeromonas_phage(16.67%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
VEU75455.1\|446936_448202_-	Serine hydroxymethyltransferase	A0A219YB23	Aeromonas_phage	2.7e-93	49.3
VEU75456.1\|448216_450397_-\|tRNA	Phenylalanine--tRNA ligase beta subunit	A0A1L3IZU3	BeAn_58058_virus	9.6e-14	38.9
VEU75457.1\|450398_451073_-	uracil-DNA glycosylase	A0A172DS90	Canid_alphaherpesvirus	1.6e-31	39.1
VEU75458.1\|451062_452028_-\|tRNA	phenylalanyl-tRNA synthetase subunit alpha	A0A2H4UW22	Bodo_saltans_virus	4.8e-26	38.1
VEU75459.1\|452029_453238_-	recombination factor protein RarA	A0A127AWE7	Bacillus_phage	1.4e-62	37.7
VEU75460.1\|453332_455120_-	chaperone protein DnaK	A0A167RF67	Powai_lake_megavirus	8.4e-125	43.5

DBSCAN-SWA_3

606253 : 615988

Mycoplasma_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
VEU75596.1\|606253_608164_-	Uncharacterised protein	Q5QGL2	Mycoplasma_phage	2.9e-22	25.7
VEU75597.1\|608163_609606_-	Uncharacterised protein	Q5QGL3	Mycoplasma_phage	1.8e-40	30.9
VEU75598.1\|609608_610487_-	Uncharacterised protein	O80247	Mycoplasma_phage	4.4e-18	26.1
VEU75599.1\|610504_611029_-	Uncharacterised protein	NA	NA	NA	NA
VEU75600.1\|611075_613169_-	Uncharacterised protein	Q5QGL6	Mycoplasma_phage	1.7e-15	22.5
VEU75601.1\|613173_614334_-	Uncharacterised protein	Q5QGL7	Mycoplasma_phage	4.7e-68	42.5
VEU75602.1\|614323_615988_-	Uncharacterised protein	O80243	Mycoplasma_phage	6.4e-143	47.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. LR215038

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. LR215037

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection