CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NC_013793	Bacillus pseudofirmus OF4 plasmid pBpOF4-02, complete sequence	0 crisprs	csa3	0	0
NC_013792	Bacillus pseudofirmus OF4 plasmid pBpOF4-01, complete sequence	1 crisprs	cas14j,csa3,RT,cas14k	1	0
NC_013791	Bacillus pseudofirmus OF4, complete sequence	2 crisprs	csa3,WYL,cas3,DinG,DEDDh	0	2

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_013791_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_013791_1

3142858-3142953

Orphan

Consensus_repeat	Method
GCTGCAGGTACTCGCTTTCCGCGGGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_013791_1

>merge|NC_013791|1|3142858-3142953|CRISPRCasFinder
GCTGCAGGTACTCGCTTTCCGCGGGCCGCGCACTTGATAAAACATCTCCCTACAGTAGTTGTTGATTTCCGCTGCAGGCACTCGCTTTCCGCGGGC

>NC_013791|1|1|3142858-3142953|CRISPRCasFinder
GCTGCAGGTACTCGCTTTCCGCGGGC	CGCGCACTTGATAAAACATCTCCCTACAGTAGTTGTTGATTTCC
GCTGCAGGCACTCGCTTTCCGCGGGC

Protein	Signature genes	Signature genes Name	Protein_function
NC_013791.2\|WP_012960194.1\|3139669_3139810_-\|hypothetical-protein	unknown	unknown	unknown
NC_013791.2\|WP_012960193.1\|3138119_3139601_-\|flavin-monoamine-oxidase-family-protein	unknown	unknown	gnl\|CDD\|224152
NC_013791.2\|WP_012960203.1\|3148890_3149685_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224054
NC_013791.2\|WP_012960197.1\|3142457_3142811_+\|glyoxalase/bleomycin-resistance/dioxygenase-family-protein	unknown	unknown	unknown
NC_013791.2\|WP_049779898.1\|3141957_3142461_+\|S-adenosylmethionine:tRNA-ribosyltransferase-isomerase	unknown	unknown	gnl\|CDD\|376813
NC_013791.2\|WP_012960199.1\|3143770_3144907_-\|GAF-domain-containing-sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|226951
NC_013791.2\|WP_012960200.1\|3145022_3145637_+\|restriction-endonuclease	unknown	unknown	gnl\|CDD\|377369
NC_013791.2\|WP_012960198.1\|3143135_3143771_-\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|225107
NC_013791.2\|WP_012960190.1\|3135806_3136460_+\|deoxynucleoside-kinase	unknown	unknown	gnl\|CDD\|224345
NC_013791.2\|WP_012960192.1\|3137239_3138094_+\|protein-glutamine-gamma-glutamyltransferase	unknown	unknown	gnl\|CDD\|235109
NC_013791.2\|WP_041822500.1\|3149809_3151408_-\|Na/Pi-cotransporter-family-protein	unknown	unknown	gnl\|CDD\|224202
NC_013791.2\|WP_012960191.1\|3136443_3137115_+\|deoxynucleoside-kinase	unknown	unknown	gnl\|CDD\|224345
NC_013791.2\|WP_148229598.1\|3139873_3140485_-\|restriction-endonuclease	unknown	unknown	gnl\|CDD\|377369
NC_013791.2\|WP_012960207.1\|3153474_3154284_-\|carbohydrate-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223472
NC_013791.2\|WP_012960205.1\|3151404_3152073_-\|phosphate-uptake-regulator-PhoU	unknown	unknown	gnl\|CDD\|223776
NC_013791.2\|WP_012960201.1\|3145831_3147097_+\|OFA-family-MFS-transporter	unknown	unknown	gnl\|CDD\|340911
NC_013791.2\|WP_049779897.1\|3141429_3141942_+\|S-adenosylmethionine:tRNA-ribosyltransferase-isomerase	unknown	unknown	gnl\|CDD\|223879
NC_013791.2\|WP_012960202.1\|3147182_3148880_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|374899
NC_013791.2\|WP_012960206.1\|3152150_3153452_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270451
NC_013791.2\|WP_012960196.1\|3140708_3141440_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|212491

Protein	Function_ID	Function_description	E-value
NC_013791.2\|WP_012960193.1\|3138119_3139601_-\|flavin-monoamine-oxidase-family-protein	gnl\|CDD\|224152	COG1231, COG1231, Monoamine oxidase [Amino acid transport and metabolism].	1.0276e-94
NC_013791.2\|WP_012960203.1\|3148890_3149685_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224054	COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms].	7.7986e-99
NC_013791.2\|WP_049779898.1\|3141957_3142461_+\|S-adenosylmethionine:tRNA-ribosyltransferase-isomerase	gnl\|CDD\|376813	pfam02547, Queuosine_synth, Queuosine biosynthesis protein. Queuosine (Q) biosynthesis protein, or S-adenosylmethionine:tRNA -ribosyltransferase-isomerase, is required for the synthesis of the queuosine precursor (oQ). It catalyzes the transfer and isomerisation of the ribose moiety from AdoMet to the 7-aminomethyl group of 7-deazaguanine (preQ1-tRNA) to form epoxyqueuosine (oQ-tRNA). Q is a hypermodified nucleoside usually found at the first position of the anticodon of asparagine, aspartate, histidine, and tyrosine tRNAs. In Streptococcus gordonii, QueA has been shown to play a role in the regulation of arginine deiminase genes.	2.6968e-59
NC_013791.2\|WP_012960199.1\|3143770_3144907_-\|GAF-domain-containing-sensor-histidine-kinase	gnl\|CDD\|226951	COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms].	1.35211e-43
NC_013791.2\|WP_012960200.1\|3145022_3145637_+\|restriction-endonuclease	gnl\|CDD\|377369	pfam04471, Mrr_cat, Restriction endonuclease. Prokaryotic family found in type II restriction enzymes containing the hallmark (D/E)-(D/E)XK active site. Presence of catalytic residues implicates this region in the enzymatic cleavage of DNA.	4.99929e-24
NC_013791.2\|WP_012960198.1\|3143135_3143771_-\|response-regulator-transcription-factor	gnl\|CDD\|225107	COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription].	5.09391e-81
NC_013791.2\|WP_012960190.1\|3135806_3136460_+\|deoxynucleoside-kinase	gnl\|CDD\|224345	COG1428, COG1428, Deoxynucleoside kinases [Nucleotide transport and metabolism].	1.22324e-66
NC_013791.2\|WP_012960192.1\|3137239_3138094_+\|protein-glutamine-gamma-glutamyltransferase	gnl\|CDD\|235109	PRK03187, tgl, transglutaminase; Provisional.	1.51581e-154
NC_013791.2\|WP_041822500.1\|3149809_3151408_-\|Na/Pi-cotransporter-family-protein	gnl\|CDD\|224202	COG1283, NptA, Na+/phosphate symporter [Inorganic ion transport and metabolism].	1.29701e-96
NC_013791.2\|WP_012960191.1\|3136443_3137115_+\|deoxynucleoside-kinase	gnl\|CDD\|224345	COG1428, COG1428, Deoxynucleoside kinases [Nucleotide transport and metabolism].	5.06288e-85
NC_013791.2\|WP_148229598.1\|3139873_3140485_-\|restriction-endonuclease	gnl\|CDD\|377369	pfam04471, Mrr_cat, Restriction endonuclease. Prokaryotic family found in type II restriction enzymes containing the hallmark (D/E)-(D/E)XK active site. Presence of catalytic residues implicates this region in the enzymatic cleavage of DNA.	2.4295e-24
NC_013791.2\|WP_012960207.1\|3153474_3154284_-\|carbohydrate-ABC-transporter-permease	gnl\|CDD\|223472	COG0395, UgpE, ABC-type sugar transport system, permease component [Carbohydrate transport and metabolism].	1.05935e-76
NC_013791.2\|WP_012960205.1\|3151404_3152073_-\|phosphate-uptake-regulator-PhoU	gnl\|CDD\|223776	COG0704, PhoU, Phosphate uptake regulator [Inorganic ion transport and metabolism].	1.45679e-17
NC_013791.2\|WP_012960201.1\|3145831_3147097_+\|OFA-family-MFS-transporter	gnl\|CDD\|340911	cd17353, MFS_OFA_like, Oxalate:formate antiporter (OFA) and similar proteins of the Major Facilitator Superfamily of transporters. This subfamily is composed of Oxalobacter formigenes oxalate:formate antiporter (OFA or OxlT) and similar proteins. O. formigenes, a commensal found in the gut of animals and humans, plays an important role in clearing dietary oxalate from the intestinal tract, which is carried out by OFA/OxlT, an anion transporter that facilitates the exchange of divalent oxalate with monovalent formate, the product of oxalate decarboxylation. This exchange generates an electrochemical proton gradient and is the source of energy for ATP synthesis in this cell. The OFA-like subfamily belongs to the Monocarboxylate transporter -like (MCT-like) family of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	2.19381e-115
NC_013791.2\|WP_049779897.1\|3141429_3141942_+\|S-adenosylmethionine:tRNA-ribosyltransferase-isomerase	gnl\|CDD\|223879	COG0809, QueA, S-adenosylmethionine:tRNA-ribosyltransferase-isomerase (queuine synthetase) [Translation, ribosomal structure and biogenesis].	1.05801e-33
NC_013791.2\|WP_012960202.1\|3147182_3148880_-\|hypothetical-protein	gnl\|CDD\|374899	pfam16949, ABC_tran_2, Putative ATP-binding cassette. This is a family of putative two component ABC exporters. This is the membrane protein of approximately 573 residues and twelve transmembrane domains. It is encoded adjacent to an ATPase.	3.71073e-17
NC_013791.2\|WP_012960206.1\|3152150_3153452_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|270451	cd14748, PBP2_UgpB, The periplasmic-binding component of ABC transport system specific for sn-glycerol-3-phosphate; possesses type 2 periplasmic binding fold. This group includes the periplasmic component of an ABC transport system specific for sn-glycerol-3-phosphate (G3P) and closely related proteins from archaea and bacteria. Under phophate starvation conditions, Escherichia coli can utilize G3P as phosphate source when exclusively imported by an ATP-binding cassette (ABC) transporter composed of the periplasmic binding protein, UgpB, the transmembrane subunits, UgpA and UgpE, and a homodimer of the nucleotide binding subunit, UgpC. Members of this group belong to the type 2 periplasmic-binding fold superfamily. PBP2 proteins are comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. The majority of PBP2 proteins function in the uptake of small soluble substrates in eubacteria and archaea. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	3.18225e-117
NC_013791.2\|WP_012960196.1\|3140708_3141440_+\|SDR-family-oxidoreductase	gnl\|CDD\|212491	cd05233, SDR_c, classical (c) SDRs. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human prostaglandin dehydrogenase (PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, PGDH numbering) and/or an Asn (Asn-107, PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	3.66961e-60

>NC_013791.2|WP_012960197.1|3142457_3142811_+|glyoxalase/bleomycin-resistance/dioxygenase-family-protein
MKLHHLGIDVVDLNKSTEYVQSTYQARFLFEITFGEETIRFFQLNEFMLELIYHPAKEQLSCHVAWQVDSIDRILNHISSEDEKKIEGPYQFENGLTSIFLEVDEELYVEWLEETPL
>NC_013791.2|WP_049779898.1|3141957_3142461_+|S-adenosylmethionine:tRNA-ribosyltransferase-isomerase
MNSAGRAFSHKMLKQLKDKGVQIAYVCLHTGLSYYENNRWPDPLRHFEWFSVGADTVEHIYKTKKGGHRVVAVGTTVVRALESAYDPKAGLQPQEGLTNVYIEKDTTLKVVDGLITGFHEPEASHLDMLCAFVQEKKLIEAYQAAINEQYLWHEFGDLNLIWKRTYA
>NC_013791.2|WP_049779897.1|3141429_3141942_+|S-adenosylmethionine:tRNA-ribosyltransferase-isomerase
MMINSTIHSFKLPPNLHATTPAEVTRNQRSDVRLMTLHGDSGAWDHHTFEDIIDLLQPNDLLILNTSRTIPSSLRTVDGAEVRLSRKIDEQVWEVLILEERLNESTTLYFDDGISASIVGPGMAPELTLIEFSIGGEELMHFFYNHGQPITYEYIDSPWQLSHYQTVYSH
>NC_013791.2|WP_012960196.1|3140708_3141440_+|SDR-family-oxidoreductase
MQKQKVIMITGASKGLGKALALHLAAKDHKLAICARNEKELKQVENEIHRRGAKVVAAVADVSNKKDVERFVSITENTFGKIDVLINNASVFGPGPTYLADYPDEAFEDVILSNITNPFYMTKRVLPGMLARQRGTIISITSEVGITGYAEWGAYSVSKYALEGLAAVWADELKGTGVQIVLVDPGEMDTIMHKIAVPDCNYSLSSPEQIARTLESVVLDETMSLNGKRFEAQDLIEEGPHDD
>NC_013791.2|WP_148229598.1|3139873_3140485_-|restriction-endonuclease
MSSSLVIWIAVALVVLLLIGWIKWIVGRRRKFDLAKITMRDIDKMDGHEFEDYLYVLISALEYEQVYQTKKSRDYGADLFYEQQDGTKCVVQAKRYREKLGLSAVQEVYAAKAFYGAERALIITTADKLSDSCLKLAAATDVHIVDRLDLDVVIKAFKKGRYAEAWEVLDVPLEPVAFSSTNSLEKPPEVRGAIQAGEYFYKQ
>NC_013791.2|WP_012960194.1|3139669_3139810_-|hypothetical-protein
MLKGIDLQMVAFVGASLLLEYVPFFHIPKLYYFTSKTDKEDDDRAA
>NC_013791.2|WP_012960193.1|3138119_3139601_-|flavin-monoamine-oxidase-family-protein
MRRIDPLPSYTEKSEEYLKIIEEGLPDIGAPQKDILILGAGMAGLVTAYLLKQAGHKVTIIEGNDRIGGRVHTIREPFSEGNYFEAGAMRIPSHHVLTLSWINKWSLSINPFITSTPNDLLYVNGQLVRRYQYEEDPAILKFPLLENEKGKTAEQLLQEAVTSFVDLYRKSNEQQRELLRRNFDQYSMTTFFRNNPIGRTLSTQAIHKIQTLLGIEGFPSLSFLDTLLNIVNTIFMEDVSFYEIEGGNDRLPYSFYPDLEEDIYLNHVVKKIIQHDKGVEVNTEGPQSIHSFQADYVISTIPFSVFQFIEVEPYHSIRYEKWKAIRTLPYVSSVKVGLEFSERFWEEDGMLGGKLITDLPTQFMYYPNQGIGKPGPGVLLGSYSWGENARLWEAMSDEERVEYALTFITRIHGEKAEQTFLAGTSYNWGQNRFSGGCFSLYGPYQATTYPEIITMQEQRIHFAGEHTSFMHAWIEGAVESGIRAALEVHQLTE
>NC_013791.2|WP_012960192.1|3137239_3138094_+|protein-glutamine-gamma-glutamyltransferase
MIEISGVPFHSSTSWPAGSLERSIVDQMMNSSATFSYRSMNEQQFEVELRRSIIRSSRMLNQSNAAFEVFETSRSNPMYWYTTRYGGFQLRPGARPSVAIDDIYRNSHMYGFECATAMVIVYYHAVLNVIGPAKFDQLFPDLYLYSWNFDPDLALQTGFSAQFVPGDVVYFNNPQYHPQTPEWRGVNAVLLEDGTYYGHGMGIMRADQMIASLNESRAPWATQPAYLTNMVTRPGFAYLASVAQMRSQRPEKVKYPVIEHNECSISFDRYVYYLNNTHLNGPTP
>NC_013791.2|WP_012960191.1|3136443_3137115_+|deoxynucleoside-kinase
MNLRDKYNIPKDAIITIAGTVGVGKSTMTKSIAKALGFQTSFENVDHNPYLDKFYADFERWSFHLQIYFLAERFKEQKRMFEQGGGFVQDRSIYEDTGIFAKMHADKGTMNPVDYETYTSLFDAMVMTPFFPHPHVLIYLEGSLDDIIDRIQKRGREMEQQTPVSYWEEMHKRYETWIDSFTSCPVLRLNISDYDLLRNENDIEPIIAKIGDVIESNQTAAQL
>NC_013791.2|WP_012960190.1|3135806_3136460_+|deoxynucleoside-kinase
MSHTPFIAVEGPIGVGKTSLAKAISLHYQYHLLKEIVHENPFLSKFYENIEEWSFQTEMFFLCNRYKQLEDIQRKFLASNVPVVADYHIYKNIIFAQRTLRSDQYEKYTAIYDIMTQDMPKPNFIIYLDASLPTLLKRIEMRGREMELKMDPAYLRQLREDYETAMAKWAVEYPDIPIIRINGDELDFVQHEQDLQKIFTLIDDARKEGAFCLESTR
>NC_013791.2|WP_012960198.1|3143135_3143771_-|response-regulator-transcription-factor
MIKVIIVDDHQMVRRGLRFFLDTQSDIEIVGEATNGEEAVKLVQTVKPDVVLMDIVMPVMGGIEATKQLIKVNPELKILVLTSFSDQDYVIPALKAGASGYQLKDIDPEELAETIRALHAGESKVHSKVMKYVLTRISHKEDEEEAKVKRLTKREKEVLIELAKGRSNKELADVLHIKEKTVKTHISNILSKLELSDRTQAALFAMRMGIN
>NC_013791.2|WP_012960199.1|3143770_3144907_-|GAF-domain-containing-sensor-histidine-kinase
MNVVHTLKVIARTLNVGEDLSTMLQSVLERLLEVTNHDTGWIFLIEGHRHQMVAHHGLPSGLEHRSKLMCEGGCWCKDKYMNGQLKKAANIMECRRIERASELGRPTKGLTHHATVPIFAGDRTYGLINIASVDKNHFSNEELEVLETVALQIGAAIYRLKQEEKKRELARMDERNKLARDLHDSVNQLLFSVSLTAKGIKGKGEDTNVNEAIDLIGEVSSEALLKLKQIIWQTSTEELEDGIVAAIHRYAALIGIKVNVKGDGNVQLPSRVERNVWRIIQESINNCSKHSGEKSVDLHFDRDESNWMVSITDFGCGFSPQDHSIFSGDGFLNMRTRAQEIGATFNMKSAPDQGTVISISIPLASNEQNIFRTKKERE
>NC_013791.2|WP_012960200.1|3145022_3145637_+|restriction-endonuclease
MQEKKTTMMGKKKRYPFLPTLLFVITFYMVQLFQYNVTVFFIVLGLLGSIPLSWYGWKQLKIAEQRLSSAREIDGMTHHQFTLFLKPLFQKQGYSVTKVKHSNEHGVHLIVRKRGIKAIVHAKLSQNEVQAKALRDINYVKEQYKANQVIIVTNHLFTKEAGQYATANKIILMDHNTLDAMIQVFMKKRKNHRFIDRVRSAWLD
>NC_013791.2|WP_012960201.1|3145831_3147097_+|OFA-family-MFS-transporter
MNTTKNRWLIALSAIAIHLSIGGAYAYSVYTYPISEQMGWSPTEITIAFTIMMALAGTSAAFFGKFVERSGPRKSAIVAAVLFGLGQAGSGVAIALGSLPLFLLTYGLASGLGLGIGYISPVSTLVKWFPDRRGLATGMAVLGFGSGALITAPIAANLMSTIGISATFYVLGACYFALMLVGASYIAPPKEGWMPASMKRNIASGKKVIKKDLQQLTSNEAVKTKRFWMLWTMMLINTTAGIMMISVASPMAQEVVGLSAAAAATLVGIMGIFNGGGRLGWAAISDYIGRSNVFLIFFVIQTIAFLTLPMITNVIIFQLLILLVVSCYGGGFSNLPAFVGDLFGTKQLGAIHGYLLTTWSLGGILGPMIVSQIRERTDSYIPVFYVFSALILLALLVSIMMKLDIKKSEQETKQRQEQVVS
>NC_013791.2|WP_012960202.1|3147182_3148880_-|hypothetical-protein
MTWNLIRWFWRMNLNSFKESSDKAKTTLIISGVAIGFAVLFFSGIVFSVARTLPGELLSDILSLSFLSLFAFLILFAVPQVFTKLYGDDDLTLLFTLPLKSTHIYWAKFTQVFLGIPGLILAASLVLLTMFGLGAGANIFYYPFAYFTAILVVLMGLGIAYLLNLLLIQMIPAHRAKELMTVITAFAGILGYVAFQIPTMMSRGGGGESSMLIPELPQWLPLYWAGESVSHLLLGDVTGETILFSGLLAGLTLAVLYLSSMLVDKGFRTGWIQMNESRSNRKKKKASSAVFKVRTPIIEVGLKEWRTIKRDMREWTMLIPMTFFMFFPIFSIMIRDGNMEFLQTVPALSWISLQAIALGLFSFMTSTFTSGSVAREGSSIDLLRVLPLKGIEVAVGKLWIHWLILFGFIGILQIICAIIFGWSPFHTVAGWLLIGLTGLGSSAIGLYFGAIGAKFNHKNPQNRLETGTSFILLFVAMGYVLIQVIPFGLTLLPASELVFLLGDESSGFFMMIVQWIIGLKSSMPIIVTLVGLALNLFITAITVWGALTFTAKEIDRGITINFVKE
>NC_013791.2|WP_012960203.1|3148890_3149685_-|ABC-transporter-ATP-binding-protein
MNEVRIKLNQLSKEYGENHAVKPFDLEVKKGELFCFLGPNGSGKTTTIKMMTGLLEPTNGTVHISGVNMWKEALEAKKQIAYVPDQPKLYPKLTGSEFLQFTASVFRLKEEEFEERAERYVRMFQLEHRLDELIETYSHGMKQKLSLCAALLHEPKVLFLDEPTVGLDPKGARTMKNLLQELCRGGMTVFMSTHILEIAEQMCDRVAIIKNGDLLTVGTVDELRQEKGSEDSSLEDLFLELTGDRETQSYVQEMEDYPSKGIRE
>NC_013791.2|WP_041822500.1|3149809_3151408_-|Na/Pi-cotransporter-family-protein
MMITQSLLSFIGGLGIFLYGMNRLSKGLQKAAINKLRHQMGVLVKNRLQALIVGLFFTFFLQSSTVMSIIAVGLVSHSIITFVQALGVILGSAIGTTLTVQVLAFNISQLSPVFIFLGVIFLVFISTDRVKPAGEVLLGLGLVLFGISYLSQAVSPLANDPFITEWMLRLTSQPIWLFLLSVGVTAALHSSVAMIIIGISFYSAGAMGYEEVIWLVLGANVGSTVPVLIASFSVSREGKRVAFAYLVMKLSIVVVVGMMLLIFPVISMFIPGEAERQIANFHTAFNIFLALCWLPFLALLAKLMTRFLPPSEPRQVVHISEQYLAIPDEALIQTEKEVLKLSRYIQTEIIAPIPAIIDGNIDHHVIVRKEEYIDQAYLIIQQYLLKLAQQDLSKEQSDQEVKLLYMLNDLEQIGDIVLQISANIEKLRNQHFELVAEDAERLKEFIPTIEDILQHAITACEEKNNKQVRKVIREQGALSEKERDFRFDHFNTLLQQNEYNPAISAIYLDLVNQLMRLQHASMNISRTVLGII
>NC_013791.2|WP_012960205.1|3151404_3152073_-|phosphate-uptake-regulator-PhoU
MLTRTNFLDREINELKERLLLMVELSYQMLQLSSESIEKDSTFDKESILQAEKDMNAINKVIQKKVLELLSYEQLAIKQVKGLFLFSKMAKDLERVGDHVINIIVVAPIDSVPHLVIQSFSQFMKNIGQMLESLKEGIKEEDCSRLKAIYEKEDEVVNRLNKKSFKRITDSLSLEQLPADSGGKLILMSRFFERMADHVSNAARDYRQYLLDCHSSISRNSP
>NC_013791.2|WP_012960206.1|3152150_3153452_-|ABC-transporter-substrate-binding-protein
MKSRKVWLGVVACLMLFVVAACGGNDSATEEGKKKITFWHAMGGGPGQAIDEMVADFNAQSDTVEVEAVYQGSYEELLNQLRAVGGSTEAPSLVQVYEVGTKYMSDSGFITPMQEFVDADGFDVNQLEENILGYYELDGDLYSMPFNTSNAIMFYNKDMFKEAGLDPENPPRTFEEVKEAAQTLTDQTDANGFAILIYGWFFEQLLANQGAHYLDQDNGRGGEPAEALINGEAGQNIFNWLNEMDEAGTLGNFGRQWDDIRAAFRAGQVAMYLDSTAATRDNVNDSPFEVGTAFLPHVDGEEANGVIVGGGSLWITNQVSAEEQQAAWEFVKYTADPEVQAKWAAATGYFPITPAAYEVEELAAVYEEFPQFTTAVEQLQNTQLTPATQGALMNVFPEARNIIENAIEELYEQNDPDASLNKAKELIDEALNH
>NC_013791.2|WP_012960207.1|3153474_3154284_-|carbohydrate-ABC-transporter-permease
MMKKIILYILLIASALAIFFPILYAFSASLMSTREIFSGALIPASPSVESYGQAFNRVPLLQFLTNSFIVSFVVMIGQLIVCSLAAYAFVFIPFKGRGIIFALFISTMLIPWEATVIPNYFTILNLGWVNTYQGLTVPFFALAFGIFLLRQHFLTIPKEIFESAQMDGCSRFRFYWNFVLPLSKSTLSALGIYGFLTTWNMYLWPLLVTSNNDVRTVQIGLKMMIAQESSTSWNMVMAAVVMILLPTLLLLFFGLKHIRKGLMAGAIKG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_013791_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_013791_2

3593513-3593629

Orphan

Consensus_repeat	Method
CTTGAACTGCCCAACCCCTAACCACCTA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_013791_2

>merge|NC_013791|2|3593513-3593629|CRISPRCasFinder
CTTGAACTGCCCAACCCCTAACCACCTAAAATGCTTTTGGGGTGACCGGCTACTAGGTGACTTGGTGGCTAGCAAGACTTTAAAAGCCCTTGAACTTGCCCAACCCCTAACCACCTA

>NC_013791|2|2|3593513-3593629|CRISPRCasFinder
CTTGAACTGCCCAACCCCTAACCACCTA	AAATGCTTTTGGGGTGACCGGCTACTAGGTGACTTGGTGGCTAGCAAGACTTTAAAAGCCC
TTGAACTTGCCCAACCCCTAACCACCTA

Protein	Signature genes	Signature genes Name	Protein_function
NC_013791.2\|WP_012960648.1\|3590678_3591035_-\|four-helix-bundle-protein	unknown	unknown	gnl\|CDD\|319869
NC_013791.2\|WP_012960641.1\|3582903_3584001_-\|glycosyltransferase	unknown	unknown	gnl\|CDD\|340848
NC_013791.2\|WP_012960656.1\|3597450_3597921_+\|STAS-domain-containing-protein	unknown	unknown	gnl\|CDD\|132912
NC_013791.2\|WP_012960652.1\|3593081_3593438_-\|four-helix-bundle-protein	unknown	unknown	gnl\|CDD\|319869
NC_013791.2\|WP_012960659.1\|3599607_3601254_-\|gamma-glutamyltransferase-family-protein	unknown	unknown	gnl\|CDD\|223482
NC_013791.2\|WP_041823079.1\|3588898_3590014_-\|aminotransferase-class-I/II-fold-pyridoxal-phosphate-dependent-enzyme	unknown	unknown	gnl\|CDD\|275034
NC_013791.2\|WP_012960654.1\|3594183_3596004_-\|polysaccharide-biosynthesis-protein	unknown	unknown	gnl\|CDD\|224011
NC_013791.2\|WP_012960662.1\|3604038_3604488_-\|poly-gamma-glutamate-biosynthesis-protein-PgsC	unknown	unknown	gnl\|CDD\|274916
NC_013791.2\|WP_012960660.1\|3601376_3602825_+\|C40-family-peptidase	unknown	unknown	gnl\|CDD\|223862
NC_013791.2\|WP_012960643.1\|3585144_3586365_-\|nucleotide-sugar-dehydrogenase	unknown	unknown	gnl\|CDD\|274399
NC_013791.2\|WP_012960658.1\|3598743_3599574_-\|SGNH/GDSL-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|379207
NC_013791.2\|WP_180316891.1\|3588254_3588878_-\|sugar-transferase	unknown	unknown	gnl\|CDD\|376775
NC_013791.2\|WP_012960649.1\|3591585_3592473_-\|UTP--glucose-1-phosphate-uridylyltransferase-GalU	unknown	unknown	gnl\|CDD\|224131
NC_013791.2\|WP_012960664.1\|3606482_3609158_-\|glycoside-hydrolase-family-13-protein	unknown	unknown	gnl\|CDD\|200477
NC_013791.2\|WP_012960655.1\|3596292_3597057_-\|tyrosine-protein-phosphatase	unknown	unknown	gnl\|CDD\|226870
NC_013791.2\|WP_012960645.1\|3587640_3588258_-\|acetyltransferase	unknown	unknown	gnl\|CDD\|274656
NC_013791.2\|WP_012960663.1\|3604504_3605695_-\|poly-gamma-glutamate-synthase-PgsB	unknown	unknown	gnl\|CDD\|188527
NC_013791.2\|WP_012960661.1\|3602865_3604026_-\|CapA-family-protein	unknown	unknown	gnl\|CDD\|214858
NC_013791.2\|WP_041822520.1\|3584030_3585137_-\|UDP-N-acetylglucosamine-2-epimerase-(non-hydrolyzing)	unknown	unknown	gnl\|CDD\|223458
NC_013791.2\|WP_012960644.1\|3586377_3587637_-\|glycosyltransferase-family-4-protein	unknown	unknown	gnl\|CDD\|340825

Protein	Function_ID	Function_description	E-value
NC_013791.2\|WP_012960648.1\|3590678_3591035_-\|four-helix-bundle-protein	gnl\|CDD\|319869	cd16377, 23S_rRNA_IVP_like, 23S rRNA-intervening sequence protein and similar proteins. A family of functionally uncharacterized bacterial proteins, some of which are encoded by an atypically large intervening sequence present within some 23S rRNA genes. The distantly related bAvd protein, which also forms a homopentamer of four-helix bundles, has been suggested to interact with nucleic acids and a reverse transcriptase.	3.8638e-59
NC_013791.2\|WP_012960641.1\|3582903_3584001_-\|glycosyltransferase	gnl\|CDD\|340848	cd03821, GT4_Bme6-like, Brucella melitensis Bme6 and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. Bme6 in Brucella melitensis has been shown to be involved in the biosynthesis of a polysaccharide.	6.77814e-35
NC_013791.2\|WP_012960656.1\|3597450_3597921_+\|STAS-domain-containing-protein	gnl\|CDD\|132912	cd07041, STAS_RsbR_RsbS_like, Sulphate Transporter and Anti-Sigma factor antagonist domain of the "stressosome" complex proteins RsbS and RsbR, regulators of the bacterial stress activated alternative sigma factor sigma-B by phosphorylation. The STAS (Sulphate Transporter and Anti-Sigma factor antagonist) domain of proteins related to RsbS and RsbR which are part of the "stressosome" complex that plays an important role in the regulation of the bacterial stress activated alternative sigma factor sigma-B. During stress conditions RsbS and RsbR are phosphorylated which leads to the release of RsbT, an activator of of the RsbU phosphatase, which in turn activates RsbV which leads to the release and activation of sigma factor B. RsbS is a single domain protein (STAS domain), while RsbR-like proteins have a well-conserved C-terminal STATS domain and a variable N-terminal domain. The STAS domain is also found in the C- terminal region of sulphate transporters and anti-anti-sigma factors.	4.09239e-21
NC_013791.2\|WP_012960652.1\|3593081_3593438_-\|four-helix-bundle-protein	gnl\|CDD\|319869	cd16377, 23S_rRNA_IVP_like, 23S rRNA-intervening sequence protein and similar proteins. A family of functionally uncharacterized bacterial proteins, some of which are encoded by an atypically large intervening sequence present within some 23S rRNA genes. The distantly related bAvd protein, which also forms a homopentamer of four-helix bundles, has been suggested to interact with nucleic acids and a reverse transcriptase.	1.07684e-58
NC_013791.2\|WP_012960659.1\|3599607_3601254_-\|gamma-glutamyltransferase-family-protein	gnl\|CDD\|223482	COG0405, Ggt, Gamma-glutamyltransferase [Amino acid transport and metabolism].	9.16391e-145
NC_013791.2\|WP_041823079.1\|3588898_3590014_-\|aminotransferase-class-I/II-fold-pyridoxal-phosphate-dependent-enzyme	gnl\|CDD\|275034	TIGR04181, DegT/DnrJ/EryC1/StrS_aminotransferase, aminotransferase, LLPSF_NHT_00031 family. This clade of aminotransferases is a member of the pfam01041 (DegT/DnrJ/EryC1/StrS) superfamily. The family is named after the instance in Leptospira interrogans serovar Lai, str. 56601, where it is the 31st gene in the 91-gene lipopolysaccharide biosynthesis locus. Members of this family are generally found within a subcluster of seven or more genes including an epimerase/dehydratase, four genes homologous to the elements of the neuraminic (sialic) acid biosynthesis cluster (NeuABCD) and a nucleotidyl transferase. Together it is very likely that these enzymes direct the biosynthesis of a nine-carbon sugar analogous to CMP-neuraminic acid. These seven genes form the core of the cassette, although they are often accompanied by additional genes that may further modify the product sugar.	2.97477e-154
NC_013791.2\|WP_012960654.1\|3594183_3596004_-\|polysaccharide-biosynthesis-protein	gnl\|CDD\|224011	COG1086, COG1086, Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism].	0
NC_013791.2\|WP_012960662.1\|3604038_3604488_-\|poly-gamma-glutamate-biosynthesis-protein-PgsC	gnl\|CDD\|274916	TIGR04011, poly_gGlu_PgsC, poly-gamma-glutamate biosynthesis protein PgsC/CapC. Of four genes commonly found to be involved in biosynthesis and export of poly-gamma-glutamate, pgsB(capB) and pgsC(capC) are found to be involved in the synthesis per se. Members of this family are designated PgsC, covering both cases in which the poly-gamma-glutamate is secreted and those in which it is retained to form capsular material. PgsC binds tightly to PgsB, which has been shown to have poly-gamma-glutamate activity. [Cell envelope, Other].	2.16152e-37
NC_013791.2\|WP_012960660.1\|3601376_3602825_+\|C40-family-peptidase	gnl\|CDD\|223862	COG0791, Spr, Cell wall-associated hydrolases (invasion-associated proteins) [Cell envelope biogenesis, outer membrane].	7.58598e-24
NC_013791.2\|WP_012960643.1\|3585144_3586365_-\|nucleotide-sugar-dehydrogenase	gnl\|CDD\|274399	TIGR03026, NDP-sugDHase, nucleotide sugar dehydrogenase. Enzymes in this family catalyze the NAD-dependent alcohol-to-acid oxidation of nucleotide-linked sugars. Examples include UDP-glucose 6-dehydrogenase (1.1.1.22), GDP-mannose 6-dehydrogenase (1.1.1.132), UDP-N-acetylglucosamine 6-dehydrogenase (1.1.1.136), UDP-N-acetyl-D-galactosaminuronic acid dehydrogenase, and UDP-N-acetyl-D-mannosaminuronic acid dehydrogenase. These enzymes are most often involved in the biosynthesis of polysaccharides and are often found in operons devoted to that purpose. All of these enzymes contain three Pfam domains, pfam03721, pfam00984, and pfam03720 for the N-terminal, central, and C-terminal regions respectively.	1.60985e-144
NC_013791.2\|WP_012960658.1\|3598743_3599574_-\|SGNH/GDSL-hydrolase-family-protein	gnl\|CDD\|379207	pfam13472, Lipase_GDSL_2, GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.	2.3023e-07
NC_013791.2\|WP_180316891.1\|3588254_3588878_-\|sugar-transferase	gnl\|CDD\|376775	pfam02397, Bac_transf, Bacterial sugar transferase. This Pfam family represents a conserved region from a number of different bacterial sugar transferases, involved in diverse biosynthesis pathways.	3.21848e-87
NC_013791.2\|WP_012960649.1\|3591585_3592473_-\|UTP--glucose-1-phosphate-uridylyltransferase-GalU	gnl\|CDD\|224131	COG1210, GalU, UDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane].	1.43778e-180
NC_013791.2\|WP_012960664.1\|3606482_3609158_-\|glycoside-hydrolase-family-13-protein	gnl\|CDD\|200477	cd11338, AmyAc_CMD, Alpha amylase catalytic domain found in cyclomaltodextrinases and related proteins. Cyclomaltodextrinase (CDase; EC3.2.1.54), neopullulanase (NPase; EC 3.2.1.135), and maltogenic amylase (MA; EC 3.2.1.133) catalyze the hydrolysis of alpha-(1,4) glycosidic linkages on a number of substrates including cyclomaltodextrins (CDs), pullulan, and starch. These enzymes hydrolyze CDs and starch to maltose and pullulan to panose by cleavage of alpha-1,4 glycosidic bonds whereas alpha-amylases essentially lack activity on CDs and pullulan. They also catalyze transglycosylation of oligosaccharides to the C3-, C4- or C6-hydroxyl groups of various acceptor sugar molecules. Since these proteins are nearly indistinguishable from each other, they are referred to as cyclomaltodextrinases (CMDs). The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.	2.19626e-129
NC_013791.2\|WP_012960655.1\|3596292_3597057_-\|tyrosine-protein-phosphatase	gnl\|CDD\|226870	COG4464, CapC, Capsular polysaccharide biosynthesis protein [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane].	2.03106e-97
NC_013791.2\|WP_012960645.1\|3587640_3588258_-\|acetyltransferase	gnl\|CDD\|274656	TIGR03570, NeuD_NnaD, sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family. This family of proteins includes the characterized NeuD sialic acid O-acetyltransferase enzymes from E. coli and Streptococcus agalactiae (group B strep). These two are quite closely related to one another, so extension of this annotation to other members of the family in unsupported without additional independent evidence. The neuD gene is often observed in close proximity to the neuABC genes for the biosynthesis of CMP-N-acetylneuraminic acid (CMP-sialic acid), and NeuD sequences from these organisms were used to construct the seed for this model. Nevertheless, there are numerous instances of sequences identified by this model which are observed in a different genomic context (although almost universally in exopolysaccharide biosynthesis-related loci), as well as in genomes for which the biosynthesis of sialic acid (SA) is undemonstrated. Even in the cases where the association with SA biosynthesis is strong, it is unclear in the literature whether the biological substrate is SA iteself, CMP-SA, or a polymer containing SA. Similarly, it is unclear to what extent the enzyme has a preference for acetylation at the 7, 8 or 9 positions. In the absence of evidence of association with SA, members of this family may be involved with the acetylation of differring sugar substrates, or possibly the delivery of alternative acyl groups. The closest related sequences to this family (and those used to root the phylogenetic tree constructed to create this model) are believed to be succinyltransferases involved in lysine biosynthesis. These proteins contain repeats of the bacterial transferase hexapeptide (pfam00132), although often these do not register above the trusted cutoff.	1.21229e-69
NC_013791.2\|WP_012960663.1\|3604504_3605695_-\|poly-gamma-glutamate-synthase-PgsB	gnl\|CDD\|188527	TIGR04012, poly_gGlu_PgsB, poly-gamma-glutamate synthase PgsB/CapB. Of four genes commonly found to be involved in biosynthesis and export of poly-gamma-glutamate, pgsB(capB) and pgsC(capC) are found to be involved in the synthesis per se. Members of this family are designated PgsB, a nomeclature that covers both cases in which the poly-gamma-glutamate is secreted and those in which it is retained to form capsular material.PgsB has been shown to have poly-gamma-glutamate activity by itself but is bound tightly by PgsC (TIGR04011). [Cell envelope, Other].	0
NC_013791.2\|WP_012960661.1\|3602865_3604026_-\|CapA-family-protein	gnl\|CDD\|214858	smart00854, PGA_cap, Bacterial capsule synthesis protein PGA_cap. This protein is a putative poly-gamma-glutamate capsule biosynthesis protein found in bacteria. Poly-gamma-glutamate is a natural polymer that may be involved in virulence and may help bacteria survive in high salt concentrations. It is a surface-associated protein.	1.75194e-69
NC_013791.2\|WP_041822520.1\|3584030_3585137_-\|UDP-N-acetylglucosamine-2-epimerase-(non-hydrolyzing)	gnl\|CDD\|223458	COG0381, WecB, UDP-N-acetylglucosamine 2-epimerase [Cell envelope biogenesis, outer membrane].	0
NC_013791.2\|WP_012960644.1\|3586377_3587637_-\|glycosyltransferase-family-4-protein	gnl\|CDD\|340825	cd03794, GT4_WbuB-like, Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.	1.71776e-74

>NC_013791.2|WP_012960652.1|3593081_3593438_-|four-helix-bundle-protein
MYEDINKLVVFQKAHVLVLEIYKITRHFPREEQYGLMSQMKRAAVSIPSNIAEGRARGSTKEYKRFLLIARGSLEELKYQIYLSKDLKFINQAQYEELITKVDQVGRMLNGLVRKIEG
>NC_013791.2|WP_012960649.1|3591585_3592473_-|UTP--glucose-1-phosphate-uridylyltransferase-GalU
MHKVKKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAVQSGIEDIIIVTGKGKRAIEDHFDHAFELEQNLFHKGKTELLEKVQYSSNMVDIHYIRQKEPKGLGHAVWCARKFIGDEPFAVLLGDDIVRADKPCLKQLIEQYEETMSSVVGVQTVPDSETHRYGIVDPVSNSGRRYQVNEFVEKPAQGTAPSNLAIMGRYILTPYIFKFLDEQQTGAGGEIQLTDAIQKLNEIQRVFAYDFEGKRYDVGEKMGFVKTTLEFAMENEELRAELLEYMESVVERERVGNN
>NC_013791.2|WP_012960648.1|3590678_3591035_-|four-helix-bundle-protein
MYEDINKLVVFQKAHILVLEIYKITRHFPREEQYGLMSQMKRAAVSIPSNIAEGRARGSTKEYKRFLLIARGSLEELKYQIYLSKDLEFINQAQYEELITKIDQVGRMLNGLVKKLGG
>NC_013791.2|WP_041823079.1|3588898_3590014_-|aminotransferase-class-I/II-fold-pyridoxal-phosphate-dependent-enzyme
MNERIFLSSPHMSDEGYEMEYVKEAFDTNWIAPLGENVNGFERELAEKVGSKAAAALSSGTAAIHLALRAAGVGEGDIVFCPTLTFSATANPIIYQNATPAFIDSNYETWNMCPKALEEAFQKYPEVKAVIVVHLYGLSADMDRIVELCKKHNVVLIEDAAESLGTYYKGKHTGTFGDYGIFSFNGNKIITTSGGGMLVSNNEEGIAKARFWATQSRDQARHYQHSELGFNYRMSNVVAGIGRGQLKVLDQRVEKKNYIYEFYKRELGELEGVQFMPSNDWDAPNYWLSSMTLTGKVRPIDIFKTLEAENIESRPVWKPMHMQPFFEKYDYVGTDVSEKLFENGVCLPSDTKMTEADLEKIVETIKKLWCE
>NC_013791.2|WP_180316891.1|3588254_3588878_-|sugar-transferase
MYKRFIKRPMDFILSLAAIVALSPVLLIVAILVRTKLGSPVLFKQKRPGLNEKVFIMYKFRTMTDEKDENGELLPDRVRLTNFGKFLRSTSLDELPGLFNILKGDMSIIGPRPLLVQYLPLYNDHQKRRHEVRPGLSGLAQISGRNAISWEDKFNLDVEYVDNVSFIGDWKIIFQTIKKVFVREGINSETAATMEPFKGTKKERMGS
>NC_013791.2|WP_012960645.1|3587640_3588258_-|acetyltransferase
MKNKLLIIGASGHGKVVADIARKMDRWQTIAFLDDNDDVKLPMGIAIIGKSNEAIEHINDCDIFVGIGKNATRKQIHEHLEAKGATIPTLIHPNSVIGEQVEIASGTVIMAGVVINCCTRIGKGCIINTSASVDHDNVIEDFVHISPGAHLAGTVKVGQGTWLGIGSVVSNNVNLTSECKVGAGAVVVCDINETGTYVGIPARRV
>NC_013791.2|WP_012960644.1|3586377_3587637_-|glycosyltransferase-family-4-protein
MKKNIWIWNHYATDMYKNRGGRHYWFAENLIKQGYNVTVFCANTFHNKLESIDTGKKKYSTDIVDDIPFVFVKTSTALGNGIDRVKNMSFFYFNLFSVAKEYARLNGKPDVILASSVHPLTMVAGIQVAKKLGVPCICEIRDLWPEAIFSFNKAKENSLLGRGLTAGEQWIYKKADALIFTKEGDTDYIKEKKWDIEQGGEINLDKCHYINNGVDIESFELLASNNKVDDEDLSSAKFNVVYVGAIRPVNNVGNLLDAASLLKDKEDIQFLIYGDGNQKEMLEKRVVEENLTNVKLKGFVNKRLIPYILSKSSVNILNYSQTQYNWTRGNSSNKLFEYMASGKPIISTVKMGYSILDKYQCGIELEKSTPEELANAIIEIRNFSEEQYNAISKNAKKGVKDFDFKLLTGKLIDVIKKVK
>NC_013791.2|WP_012960643.1|3585144_3586365_-|nucleotide-sugar-dehydrogenase
MINIIGLGYIGLPTALMFAKSGVKVVGTDYNTELVDSLSNGKLTFEEVGLVDLFHEALSNGIEFTTEYQKTHTYILAVPTPYIKESKKLDPKYVISAVNSVLDVCENGAVIIIESTISPGTVDKYIRPEIEKRGYVIGDNIHLMHAPERIIPGNMIYELEHNSRTIGADNLELGEKVKGLYENFCKAEIIVTDIRSAEMSKVVENTYRDINIAFANELAKICRTDNMDVYEIIRIANMHPRVNILQPGPGVGGHCISVDPWFLVGDYPDLTNLILTARKINDSMPRHVLGRIRDIMREHGIKDISKVGLYGLAYKENVDDTRESPTLQLLERMDEHLAFGVKVFDPFVKERIVDHQFMNFEDFLNEIKILVVMVGHEHIRNNMDLIKDKLVLDTKNICIFEGSYKL
>NC_013791.2|WP_041822520.1|3584030_3585137_-|UDP-N-acetylglucosamine-2-epimerase-(non-hydrolyzing)
MVCKLGKKIMVVFGTRPEAIKMCPLVKELKTRENLETIVCVTGQHREMLDQVLDAFKVVPDIDLSIMKANQTLFDVTINILEKMKSVLEEFKPDVVLVHGDTSTTFVTTLACFYLQIPVGHVEAGLRTYNISSPYPEEFNRQAVGIVAKYNFAPTDVSKENLVKEGKDPSTIYVTGNTAIDALKTTVRDDYTHEHLDWAADSRLIMITAHRRENLGEPMRNMFRAIKRIVDEQSDIKAIYPIHMNPVVRDAANEILGNCERVRIIEPLEVLDFHNFLSRSHLILTDSGGIQEEAPSLGKPILVMRDTTERPEGVAAGTLKLVGTDEDVIYKTFKTLLEEKEEYENMSQASNPYGDGFASKRIADILNN
>NC_013791.2|WP_012960641.1|3582903_3584001_-|glycosyltransferase
MNILYVSNLKGNKWTGPNQSVPRQIRAQSKIDNVFWFNINNTENPEWNMLTKYHSTNDFQKISLDSLPTPFNKPDLIIFQGLYCFPFCKIIFEAWYKTIPYIIVTRGALPKQAQKNKRLKKFFANLVFFKRFVNKAKAIHYLTDQEYLDSGEKWNKNYFIIPNGIEIPQEYNYVLPQNGIKAVYIGRTDIYQKGLDLLLEACNQIKPLLLSNRVTIDLYGPDMDGAKSRLYDLIESFDLGDIISLNEGVFDAEKQQVLTNSDLFIMTSRFEGHPMGLIEALSYGLPSLVTKGTNMSKEVLAQDAGWVADDNVESIKDAFIKMLEEREKLKLKSKNALSLATNYDWDTIAQITHQKYLELQNNYNK
>NC_013791.2|WP_012960654.1|3594183_3596004_-|polysaccharide-biosynthesis-protein
MTYKKRIASLILVDSLIVIISIFISNFILLPTGSPFTTVLIISSVVLLLSHHAFAHIYKLYKRVWQYASMNELYGIFMVVNFSIALTAVAQLIMIQDVYYRTLAITWMMHILLIGGSRFSWRMYRDTYLKPKLGGKRTLIVGAGNAGTMVARQLRNSEDTELDPIGFVDDDNYKQHLEIMNLPVLGEIKNIPTLVEELHVEHIIIAIPSLNRQELNEIFAVCTQTKVKTQILPKMEDLITGNVEVNQFRDVEVEDLLGRDPVELDIEGIADYITNKTVLVTGAGGSIGSEICRQIARFSPEELVLLGHGENSIYAIEMELRRNLPDLNIKTEIADIQDREKIFSIMAARTPHVVFHAAAHKHVPLMERNPEEAVKNNVLGTKNVAEAASAAHVNTFVMISTDKAVNPTSVMGSTKRIAEMIVQHMDMISDTRFVAVRFGNVLGSRGSVIPLFKDQIKNGGPVTVTDPEMVRYFMTIPEASRLVLQAGSLAKGGEVFVLDMGEPVKIVDLARNLIRLSGYTEEEIPIVFTGMRPGEKMFEELLSKDEVHDEQVYPKIYRGKTPVVDINVTYELAKTYDEYTKEQLRERLLDIANFRVRQLKVLSEAK
>NC_013791.2|WP_012960655.1|3596292_3597057_-|tyrosine-protein-phosphatase
MIDIHSHILPGLDDGPESMTSAVEMARKAVEQGITGMIATPHHQNGTYENHYEDILAAVHRFEDELRAHKIDLHIAPGQEVRLYGNIVADAAHSQLITLNQTNHLLIELPSDHVPSYTARYLYELQLQGIKPVIAHPERNREIAADSSKLYELIKNGALAQVTASSVAGRFGRNVKKLSMQLIEHELVHFVASDTHNNTNRPNELAKSFDVIEKEFGMGAVYTLKENAEILVSGGSVYAGPPSRIKKKKILGLF
>NC_013791.2|WP_012960656.1|3597450_3597921_+|STAS-domain-containing-protein
MTHQEEIQLLKDSIREKEELIKELSAPIIPSIIPKTILVPLTGALTHERFATIQEKIVNRIPLEKADSVIIDFTAISYREVGDLGMEQLGDRISKLRDSLRLMGVETIFTGFSSTFVQEIIRSGIDTSQIVVHSTFRTGLQYLMKKKGLEFVESGK
>NC_013791.2|WP_012960658.1|3598743_3599574_-|SGNH/GDSL-hydrolase-family-protein
MLNFLKSIVPLAAVGVLLVALYMFKHDDMLTEVEAGAIDYFYTELEQQEMMAESLGEALDHPKYAEKKDQIIAKYQNNQTISIAVIGSDAHAQGEIFENGQSIQIPSWPDLAEEELNELYGEETFDIQYLSGYKDLTTSEFYAGEALQQIEAMNPDIIVFEPFLLNDHSTVPLDKTMMNLSSIVSAIDAQIGSYVILQPSHPLYKPEFYQEQVDALERFAQEEDLPYLDHWDVWPLTNDQEIGQYLVELPDGKFRPNKQGHTVWSEKIVDYFAGNE
>NC_013791.2|WP_012960659.1|3599607_3601254_-|gamma-glutamyltransferase-family-protein
MKIKWTTLFILLLLIIVIFLIVGDRGGEQETGDLSLPDEEVEQVKHKEGYGVSSSNPVAVEVGMRVLEQGGNAVDAAVAVSFALGVAEPYGSGLGGGGTMLVLPKPDVEPVVYDYRETAPREGRKNSTGVPGLVKGMHEVHHDYGVKSLYDLLEPSIDIAEGGFVVDTYLSQRIHGARHRIDQDAASHFFPDDEAIKGGETLRQEDLAETLKRLQEYGLNDFYEGDIAEDIANNYSDVSKRDLEEYEVVKTKAAKGSFYGYDVYTAGPPTAGITLIQMLQMAEAYKLDRIDKTSADYIHLLGEMAKQAYNDRLSNISDPKFTEVNTEKLASEKYSSKMASEISTVELSASFDVNDTPADENNHNNTTHFVVMDQDGMVVSATNTLSNFFGSGNMVEGFFLNNQLANFSSNDKSPNAYEPQKSPRSFITPTIVRSEDGDDVMGIGTPGGRRIPQILTQVMISAMFDDISIQEALDQPRFIVEDDEIFIEEDMPDSIVSDLRNKGYLVKVNNSDMFYGGVQVLSKFGEDREVTGAADKRRSGVWKARSTE
>NC_013791.2|WP_012960660.1|3601376_3602825_+|C40-family-peptidase
MRVLLIIFFLFLSIFIPVSTQAKAIERVDLADVKAGDTLYFTHTKGTYIGNGRFLSKKGLVDIDLTDSYWIDSYVGLKRRSQSGSTMSQSQSMGSTLASRAISLIGTPYNQRGETPHDGFSTGSFVHYVYKDVTGSLLSKIPLRQKEAGTPVKRSELAPGDLVFFQGSSSVISGIYVGNQEFVIATSNGVAKRHLDRDSYYANSYVGAVRYSRDELRLSHPKTYENHEHPAVREAMRYIHTPYVLTGNTLAGFDCSYLIQMAFADGLDVHLPRITYNQWEVGLTVLDGKIDFKRQSLDDLIRPGDAIYFSNTWQPGISHVGIYLGQNYMVHASGDEGETTISYIASYWQERMTGAKRFDDLTLRLDHPVVQKASVLLGTPYVLGADEPETGFDTGSLVQYIYKESVGLDLPRFGSQQILTGVEVTEPETGDLLFFQGSSVIPAVYVGNGQMVVMTQLQGATIIDYKNSDYWAPRYIGARRVL
>NC_013791.2|WP_012960661.1|3602865_3604026_-|CapA-family-protein
MSQKRKLTFPEKVLMSTKKHKVHAKKHSIIAFIICFIILASTSFIRQADVPTVAKEDDSVFTASLVGDIMFGRHVEKVAERHGYDHMFAYTKPYFEAADYVTGNLTSPVLDEESSKPLSEEEISSLVADKEAIKTLEDADFSVVNLANNHSFEIDSPQTKETLEAIDESDVEAVGVATDYNAAQGVSYTKHNGLEVATVGVTDVVAPSNAAAVLTTDPNEALPLIREARSQADLVVVHVHAGQDYDSSPTTRQETLMKAFADAGADIVIGHYPHVLQSVDVYNDTLILYSIGNFVLDQGWTRTRDTAIAQYNLKKDGTAEVELVPFRIYEAQPKPVEGALSFYHRGKIFRQLTKDTENTESIKQQDDRLIFEVDHSHVLNRMNDAR
>NC_013791.2|WP_012960662.1|3604038_3604488_-|poly-gamma-glutamate-biosynthesis-protein-PgsC
MFGTDLYVALVIGVVLSLVYAEKTGIMPAGLIVPGYLALVFDQPVFLLVIFSISFLTYLIVVYGISKITILYGRRKFAAMLTTGIVLKLVFDFFYPVMPFEIHEFRGLGVIVPGLIANTIQKQGVTPTVLSTLALSGITFAIISLFYLL
>NC_013791.2|WP_012960663.1|3604504_3605695_-|poly-gamma-glutamate-synthase-PgsB
MAFIPISIFVIFILVLGIREKIIHKRNIDSIPVRVNINGIRGKSTVTRLVTGVITETGKRTIGKTTGTSARMIYWNKKEEKPIKRRLEGPNIREQRIVVKEAADLDAEVLVSECMAVNPDYQITFQEEMVQANIGVIVNVLEDHMDVMGPTLDEVAQAFVATIPYNGHLIITESPYTDYYKEIAEKRNTKVIVADNSRISEAFLKQFEYMVFPENASLALAVAEALGIDEETAFRGMLNAHPDPGAMRIIPMDDHSNQTSYFVNGFAANDAASTLNIWKRVEVLGYPTKQPVIIMNCREDRVERTEQFARDVLPHIEMDKLVVIGESVSPIVDAFEDGFIPANEIVNFEGASTDEIADYLYDVMASTTIYGVGNIHGAAEPLIEKLNQYKVKRLAS
>NC_013791.2|WP_012960664.1|3606482_3609158_-|glycoside-hydrolase-family-13-protein
MKKSVVLIMVLSLLLSLFVQPFAQTNTAEAAGDQVYDKVVLRGESPLRWDGENHPLTFDESEGLWKSEPVTLSGGIQFEYKFVMDNEWLAGDNLRFQVPQTGDYEFYFDPSDQRKVDVRPATEYDGSITLQLTVPEETPDWAVPTVATSNNSFNYSVTPLEREGETFTVTLNGQAGEELEYRYGLGDSKYREVIEANRTATFTEEGTVVEDTVTEWTGLPVAKNVSHNFNHNPFIPSPNDDVEITVEVEHYGPIDEGGIYFTTDGSTPAGARGEASSGEFSPLEVVETKTENNLQRSTLKGVIPKQADSTPVKYLVDVWAADGEGSQYADTNSLTSEEATEFAYYVENYSSPEWAKDAVIYHIFVDRFFDGNPENNFGVDPSLPLEEALKDWMGGDLEGVHAKLDYIEELGVDTIWLSPVFEGPYSHGYHPTDFMSVDQNFGTLKVLKELIDEAHDRDMKVIYDFVPNHTSSEHPFFQDALENGEDSPYYDWYTFYEDGTYETFYGIEELPQFNNDHPEARDYMLNEVVPFWLEELEFDGLRLDYAKGPSYSFWVDFRDKVKSIDPDMYVFGEVWDSREKISSYAGKLDGSLDFGFHDTFKGTFAFDGSMQSVVNYVEENEAVYHPEYIMTTFLDNHDLPRFLYEAGSNTDKLKLASFTQFMLPGSPVIYYGTEVGLSQSANHNEFNDWKDRWYREFMIWDEEEQDQELLTHYQEIIELRQNHSALRTGDFHAHSATRDALVFERSNEDERLIVAVNKGAEAVLAIDEELELENLVTGERMTGDELTVGANSFAVYQVVEEEKDIEHVALRGVHAQDIALSYDEAAGVWRSEGIHLKNKQKVTFEYVINGAETTSELTFTPDRGGKFEFVFNPVEPEQVTVLHPSDKRGQK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

350241 : 360045

Cyanophage(25.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012957352.1\|350241_351543_+	adenylosuccinate lyase	A0A1B3B081	Gordonia_phage	6.5e-18	33.2
WP_012957353.1\|351616_352339_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A127KMU1	Cyanophage	2.3e-49	44.5
WP_012957354.1\|352326_352578_+	phosphoribosylformylglycinamidine synthase subunit PurS	A0A1D7SRI3	Cyanophage	4.6e-05	34.6
WP_012957355.1\|352574_353258_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_012957356.1\|353241_355467_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	4.5e-160	40.0
WP_012957357.1\|355442_356855_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	4.0e-53	34.9
WP_012957358.1\|356891_357926_+	phosphoribosylformylglycinamidine cyclo-ligase	R9TMC7	Synechococcus_phage	3.2e-60	42.2
WP_012957359.1\|357925_358519_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	4.6e-27	37.4
WP_012957360.1\|358515_360045_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	6.2e-76	51.3

DBSCAN-SWA_2

1395667 : 1401850

Staphylococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012958396.1\|1395667_1396750_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	3.3e-63	39.1
WP_012958397.1\|1396751_1397423_+	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	1.1e-40	44.2
WP_012958398.1\|1397462_1398656_+	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	8.7e-118	53.0
WP_012958399.1\|1398739_1399207_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	9.8e-41	57.0
WP_041822316.1\|1399375_1399726_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_012958401.1\|1399753_1400281_-	DUF309 domain-containing protein	NA	NA	NA	NA
WP_041822700.1\|1400510_1401272_+	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	1.5e-09	29.6
WP_012958403.1\|1401271_1401850_+	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	1.8e-15	32.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NC_013792

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_013792_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_013792_1

175709-175800

TypeV

Consensus_repeat	Method
TACCCCTGTTAGACGGAGTACAATACCCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_013792_1

>merge|NC_013792|1|175709-175800|CRISPRCasFinder
TACCCCTGTTAGACGGAGTACAATACCCCTTTACGGAGTGCAGTACCCCTTTACGGAGTACAGTACCCCTGTTAGACGGAGTACAGTACCCC

>NC_013792|1|1|175709-175800|CRISPRCasFinder
TACCCCTGTTAGACGGAGTACAATACCCC	TTTACGGAGTGCAGTACCCCTTTACGGAGTACAG
TACCCCTGTTAGACGGAGTACAGTACCCC

Protein	Signature genes	Signature genes Name	Protein_function
NC_013792.1\|WP_012961078.1\|172125_173178_-\|DNA-primase	unknown	unknown	gnl\|CDD\|273595
NC_013792.1\|WP_012961081.1\|177152_177320_-\|ribbon-helix-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|289422
NC_013792.1\|WP_012961080.1\|175902_176997_-\|hypothetical-protein	unknown	unknown	unknown
NC_013792.1\|WP_012961073.1\|167535_167682_-\|hypothetical-protein	unknown	unknown	unknown
NC_013792.1\|WP_012961087.1\|183651_184464_-\|hypothetical-protein	unknown	unknown	unknown
NC_013792.1\|WP_012961085.1\|180349_182173_-\|nitric-oxide-reductase-activation-protein	unknown	unknown	gnl\|CDD\|238731
NC_013792.1\|WP_012961088.1\|184460_185036_-\|NYN-domain-containing-protein	unknown	unknown	gnl\|CDD\|350235
NC_013792.1\|WP_012961076.1\|169016_169304_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|372412
NC_013792.1\|WP_012961082.1\|177458_178145_+\|hypothetical-protein	unknown	unknown	unknown
NC_013792.1\|WP_012961075.1\|168515_168971_-\|single-stranded-DNA-binding-protein	unknown	unknown	gnl\|CDD\|168659
NC_013792.1\|WP_049779884.1\|178866_180222_-\|IS1182-like-element-ISBspe1-family-transposase	unknown	unknown	gnl\|CDD\|372705
NC_013792.1\|WP_012961072.1\|166240_167413_-\|hypothetical-protein	unknown	unknown	unknown
NC_013792.1\|WP_012961086.1\|182175_183576_-\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|223786
NC_013792.1\|WP_012961079.1\|173855_175295_-\|hypothetical-protein	unknown	unknown	unknown
NC_013792.1\|WP_012961084.1\|178541_178715_+\|hypothetical-protein	unknown	unknown	unknown
NC_013792.1\|WP_012961083.1\|178226_178439_+\|hypothetical-protein	unknown	unknown	unknown
NC_013792.1\|WP_012961077.1\|169516_171391_-\|group-II-intron-reverse-transcriptase/maturase	RT	pfam00078_RT_CAS-I:CAS-III	gnl\|CDD\|275209
NC_013792.1\|WP_012961071.1\|165851_166136_+\|hypothetical-protein	unknown	unknown	unknown
NC_013792.1\|WP_049779960.1\|167792_168416_-\|JAB-domain-containing-protein	unknown	unknown	gnl\|CDD\|377189
NC_013792.1\|WP_012961070.1\|165474_165807_+\|DUF4257-domain-containing-protein	unknown	unknown	gnl\|CDD\|372902

Protein	Function_ID	Function_description	E-value
NC_013792.1\|WP_012961078.1\|172125_173178_-\|DNA-primase	gnl\|CDD\|273595	TIGR01391, DNA_primase, DNA primase, catalytic core. Members of this family are DNA primase, a ubiquitous bacteria protein. Most members of this family contain nearly two hundred additional residues C-terminal to the region represented here, but conservation between species is poor and the C-terminal region was not included in the seed alignment. This protein contains a CHC2 zinc finger (pfam01807) and a Toprim domain (pfam01751). [DNA metabolism, DNA replication, recombination, and repair].	1.77032e-16
NC_013792.1\|WP_012961081.1\|177152_177320_-\|ribbon-helix-helix-domain-containing-protein	gnl\|CDD\|289422	pfam12651, RHH_3, Ribbon-helix-helix domain. This short bacterial protein contains a ribbon-helix-helix domain that is likely to be DNA-binding.	1.02714e-08
NC_013792.1\|WP_012961086.1\|182175_183576_-\|AAA-family-ATPase	gnl\|CDD\|223786	COG0714, COG0714, MoxR-like ATPases [General function prediction only].	1.94659e-13
NC_013792.1\|WP_012961085.1\|180349_182173_-\|nitric-oxide-reductase-activation-protein	gnl\|CDD\|238731	cd01454, vWA_norD_type, norD type: Denitrifying bacteria contain both membrane bound and periplasmic nitrate reductases. Denitrification plays a major role in completing the nitrogen cycle by converting nitrate or nitrite to nitrogen gas. The pathway for microbial denitrification has been established as NO3- ------> NO2- ------> NO -------> N2O ---------> N2. This reaction generally occurs under oxygen limiting conditions. Genetic and biochemical studies have shown that the first srep of the biochemical pathway is catalyzed by periplasmic nitrate reductases. This family is widely present in proteobacteria and firmicutes. This version of the domain is also present in some archaeal members. The function of the vWA domain in this sub-group is not known. Members of this subgroup have a conserved MIDAS motif.	9.82783e-22
NC_013792.1\|WP_012961088.1\|184460_185036_-\|NYN-domain-containing-protein	gnl\|CDD\|350235	cd10911, PIN_LabA, PIN domain of Synechococcus elongatus LabA (low-amplitude and bright) and related proteins. This subfamily contains Synechococcus elongatus PCC 7942 LabA which participates in cyanobacterial circadian timing, it is required for negative feedback regulation of the autokinase/autophosphatase KaiC, a central component of the circadian clock system, and appears to be necessary for KaiC-dependent repression of gene expression. This subfamily belongs to the LabA-like domain family which includes the N-terminal domain of limkain b1, a human autoantigen localized to a subset of ABCD3 and PXF marked peroxisomes. Also included in the LabA-like domain family are human ZNF451, uncharacterized Bacillus subtilis YqxD, uncharacterized Escherichia coli YaiI, and the N-terminal domain of a well-conserved group of mainly bacterial proteins with no defined function, which contain a C-terminal LabA_like_C domain. Curiously Pseudomonas putida S16 NicB , which is described as a putative NADH-dependent hydroxylase involved in the microbial degradation of nicotine also falls into the LabA-like family. The PIN (PilT N terminus) domain belongs to a large nuclease superfamily. The structural properties of the PIN domain indicate its active center, consisting of three highly conserved catalytic residues which coordinate metal ions; in some members, additional metal coordinating residues can be found while some others lack several of these key catalytic residues. The PIN active site is geometrically similar in the active center of structure-specific 5' nucleases, PIN-domain ribonucleases of eukaryotic rRNA editing proteins, and bacterial toxins of toxin-antitoxin (TA) operons.	2.4603e-13
NC_013792.1\|WP_012961076.1\|169016_169304_-\|hypothetical-protein	gnl\|CDD\|372412	pfam12965, DUF3854, Domain of unknown function (DUF3854). A family of uncharacterized proteins found by clustering human gut metagenomic sequences. This domain is likely to be related to the Toprim domain.	0.00804531
NC_013792.1\|WP_012961077.1\|169516_171391_-\|group-II-intron-reverse-transcriptase/maturase	gnl\|CDD\|275209	TIGR04416, hypothetical_protein, group II intron reverse transcriptase/maturase. Members of this protein family are multifunctional proteins encoded in most examples of bacterial group II introns. These group II introns are mobile selfish genetic elements, often with multiple highly identical copies per genome. Member proteins have an N-terminal reverse transcriptase (RNA-directed DNA polymerase) domain (pfam00078) followed by an RNA-binding maturase domain (pfam08388). Some members of this family may have an additional C-terminal DNA endonuclease domain that this model does not cover. A region of the group II intron ribozyme structure should be detectable nearby on the genome by Rfam model RF00029. [Mobile and extrachromosomal element functions, Other].	4.67781e-98
NC_013792.1\|WP_012961070.1\|165474_165807_+\|DUF4257-domain-containing-protein	gnl\|CDD\|372902	pfam14074, DUF4257, Protein of unknown function (DUF4257). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 120 amino acids in length.	2.59025e-29
NC_013792.1\|WP_049779960.1\|167792_168416_-\|JAB-domain-containing-protein	gnl\|CDD\|377189	pfam04002, RadC, RadC-like JAB domain. A family of proteins present widely across the bacteria. This family was named initially with reference to the E. coli radC102 mutation which suggested that RadC was involved in repair of DNA lesions. However the relevant mutation has subsequently been shown to be in recG, where radC is in fact an allele of recG. In addition, a personal communication from Claverys, J-P, et al, indicates a total failure of all attempts to characterize a radiation-related function for RadC in Streptococcus pneumoniae, suggesting that it is not involved in repair of DNA lesions, in recombination during transformation, in gene conversion, nor in mismatch repair. Computational analysis, however, provides a possible function. The RadC-like family belong to the JAB superfamily of metalloproteins. The domain shows fusions to an N-terminal Helix-hairpin-Helix (HhH) domain in most instances. Other domain combinations include fusions to the anti-restriction module ArdC, the DinG/RAD3-like superfamily II helicases and the DNAG-like primase. In some bacteria, closely related DinG/Rad3- like superfamily II helicases are fused to a 3'-5' exonuclease in the same position as the RadC-like JAB domain. These conserved domain associations lead to the hypothesis that the RadC-like JAB domains might function as a nuclease.	4.08527e-44
NC_013792.1\|WP_049779884.1\|178866_180222_-\|IS1182-like-element-ISBspe1-family-transposase	gnl\|CDD\|372705	pfam13751, DDE_Tnp_1_6, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis.	7.49522e-32
NC_013792.1\|WP_012961075.1\|168515_168971_-\|single-stranded-DNA-binding-protein	gnl\|CDD\|168659	PRK06751, PRK06751, single-stranded DNA-binding protein; Provisional.	1.52489e-56

>NC_013792.1|WP_012961079.1|173855_175295_-|hypothetical-protein
MSQSKVADQTNQAMTSLQTPIRISFPFFQHAFGLHLEDMEAIGRVTPTEIDLMIILHKICNTNGVIRYTNRNQIYTRYKAYFTNPSSASQFYDAFQRFIEKGLVKESYCEDRDLYSYTLQHFLKEDGKPERFATIHQLVFGQAFQKLTLSARKLFFLVAMRQENKQQIIHMTLKGKKGLYTRLRKSLPVQIQSSMDELIEAGFFTYGYIQKEKGVYHQAVCCVHEDYHCKMTGAHLRDPLEPTIRYPRKVGFIKRLLDAKGIGELAGEIGAFIHLFKRIGNRVIRNMIRELAHYIKTTGQYPSIPDFIKKQTRRESERNIIDLAYEYDFDQYVTEDNDPIKREEAFHHFAVNLSRVINLKDMRKAFSKARKALKDYGTRIDEVYIDDYITYGPLGKEKEMGVIVQRAYQERIKPNSFKALVRKAEFFYAQGEFSLKECYDWLLAVIKTAKEEDKMQPRYQLSYHADEFIVKIWESPSFS
>NC_013792.1|WP_012961078.1|172125_173178_-|DNA-primase
MTAETKKPFKRISQETIQEVLDVSILDISEQLGHSPRRSGKQYAIFCPSPNHGSERTPDTYIEPYKNIFKCFGGGGCGCGGNSSIAYYSWTENGEYDPKKHFLSSVKGVAALMGISLKYTDGSSEKATIAPVKRTKVYKPKETEPRDDGECDRLYRSFLSLCPIRAHHYEEWKSRGYSNEEIKLFGLRSVPNKEELQDILQSLHQQGFDLKHIPGFSQRASKSAEGLVWEWSINATDGYFIPVRNEIGQWYRMRIRRDAGKPKYIWFSSYDNSDDTSCEVYLLRRYGASSGAPLNITVPTNVVQNWHVGDSIQDYFSTDTVISTEGEHKSQLSANILQTLVDGVPGVGNV
>NC_013792.1|WP_012961077.1|169516_171391_-|group-II-intron-reverse-transcriptase/maturase
MVQKLDIPKTESELNKLLDKLYLISKEYKDSKKHPCFKGLLEIIQSDEVILTAIHKIKANKGSNTKGTDGETIDDILQDGYESVISRVRKCFLAYNPKLLRRVHIDKQVSKDKRPLGIPAIIDRIIQECIRMIIEPILEAQFFSHSYGFRPYRSAEHALSKVTNTAYDTNYCWVVEGDIKKFFDNVNHTILIKKLYSMGIRDRRVLMIIKAMLQCGVLGEAEQTTVGTPQGGIISPLLANAYLDSLDHWITREWENKETKHEYSRLDGKYRALKNASNLKPAHFVRYADDWVLITNSKANAIKWKQRIAKHLKEQLKLELSEEKTLITNIKKKAIKFVGFHFKQVKNGKGKNGWVTRTEPDPKRLEIKIQTIRKNLKAIKRTHTDGKREITHSINKVNSQIRGVIQYYEIASRISKSLEKYANNLRKTGMYTLSRFGATWTPANETNNLMSVHEKYKLTIPTIEIDEVKIGLTDLYFSNFKQPQIKSQKETPYTPEGRMLYFKRLNKRKPMDRMDGFFSERLSEAIGTGRKQGTFYNFEYYMNRPYTYNRDKGKCKICGDSVSLFELEVHHINPKLPLNEVNKVRNLASLHMKCHKKVTARTSDISYLSDKIQKKIIKFRKALG
>NC_013792.1|WP_012961076.1|169016_169304_-|hypothetical-protein
MLVRFGTKKHIIAYDTDALSKEDSVDGKNQQVFDHVIDFAKQSKAAGIPTYLWTWNANDGKGLDDLLKNRKLPIEVNLLTKQRRAVTLENINQVW
>NC_013792.1|WP_012961075.1|168515_168971_-|single-stranded-DNA-binding-protein
MLNRVILVGRLTKDPELRYTPSGVAVANFTLAVNRTFSNQNGERDADFINCVVWRKPAENVANYLKKGSLAGVDGRIQTRSYDDNEGKKQFVTEVVAESVQFLEPRGNNNNNTANPGSKREQSRGNQSKQFNDDPFSQYGSNDNPSDDLPF
>NC_013792.1|WP_049779960.1|167792_168416_-|JAB-domain-containing-protein
MLARNHSLFADRIEQLSFHEILRILVKDYPLVTKKINQYRVRELVNFSKLDFLSLGCNEYIAEQLFWTMQLCKKTNEKEADQPFTITSPNDIYECFKELRYLQEERFCVAFLNVKNHVILKKTISIGGLDSTLVDTRIILREALRVSAAKIVAVHNHPSGIALFSTNDLVVTKKLKSACDAVDIEFFDHVIIGDGTFSSLINEGTFN
>NC_013792.1|WP_012961073.1|167535_167682_-|hypothetical-protein
MGNIDYLKLRQFKQSVFLGFCEKKGYLYKLENKIYALKSGKSRIIAEI
>NC_013792.1|WP_012961072.1|166240_167413_-|hypothetical-protein
MTHTFKQSDFERMTYTLLHPLSTKPPQSFEDSFEFGWLRGVAFQGESLLIGRWSKWLSIIDRGELLESDIIPSISFGEGIIKPVQKMLDECLEIIYQDGRRMEQLLDWIGYSLGIGWFEKPSLSNKAWRRLYETFNINLFWEYPCDVLSQFTQMNGVGGVLDYFPTPMTVTKAMNLMISPKRTDSVYEPCLGAAAMLLPTNSLNLTGTELNLTLIKASCIQAFLYLPWLLYCPVPIMNLHANKEEQRMEKFFVFNSDTRIFCGDSLMGEFVAPEKIFQKSEERVDVFIRPYDLRKNEAIQYQDQLENWSNLDRETRFKIVAAQSKEFGFDVTLSNPPFSVKLGKEYKDRIIKLDKSNEEFLKTFQVKQPQIEDILQETLSKKQYVQTSLF
>NC_013792.1|WP_012961071.1|165851_166136_+|hypothetical-protein
MTHNNKPTLRDIMTSEEKDHLHKLRSKLNEADTIREANQIKKEIDNFLNQIRENYYKNQSGQELSATREREFVIYGRRMKPDFTLRINGKKYSV
>NC_013792.1|WP_012961070.1|165474_165807_+|DUF4257-domain-containing-protein
MNIIYAGLIGAFLGLIFHMIRNNKEIKKPKNKQNSFYLGFIFDMVTGMFGAILMITVIAPIHYTELDVFLLRTLVGAIIGEGILTHLELKKKDLVSKHQNTIDDKLDDEL
>NC_013792.1|WP_012961080.1|175902_176997_-|hypothetical-protein
MALNIDNPLKEDQMAETIKKSIATILARASASFKDDLTPTAKYGIIQQYIPSLRRQTTANLQHTLFLLSRKETSSVNEFQIQLVEEALKARKKINKRLPMERNYAEAPIFSVTNRSARALVKLQNKNGEIVESRKGYRKIEYYGKNDLTTMDFKVFAGLQKLWDVKGHNKKFSLKFAELCEVLDLALEGGNYKLVGDSIFKLSTTSIVMEDYNDPLLKKSITTRVHNLIQSAEINRDLNSADIVFNDYLQSGLELGNRIDLDALIFNDLGSLTTKLLYPLLSSLLTETKTLDLDKIIQSLNIQNKERKAVLKQLRESFDDLKNKDLIEEYTFIKVNRSYKMVEVIPTKELINALDQGITLSKES
>NC_013792.1|WP_012961081.1|177152_177320_-|ribbon-helix-helix-domain-containing-protein
MSEKNKRGLTTRKPLSNAIDKELYDRLDQLHKETKVPKSKLLDEAIELLLEKRKG
>NC_013792.1|WP_012961082.1|177458_178145_+|hypothetical-protein
MEPMNQIMMKLEQLQKQMNELQITTEKVDAFISPNTPSREVKIYKSANKKSTLDVTSMLSGSKMYNKNKHEEFTYKGKIIIGITEHGKDYEKAYLSKGRAKVILSEMLNHTFSKRYGVGFSRDNGVHIHGGSVKDGKVRGRILSIFYTDRNQYVFQIEEGPAEKTETGAFKLKKKERKVQKFLSLDEALEMAHEVKDYIGHEEMVNHLRGAPLYDILPTEYPRAVANT
>NC_013792.1|WP_012961083.1|178226_178439_+|hypothetical-protein
MRFVNEYAVYKGDEFLVLGTAEECAKQLNVSADYIKWLTMPTAKRRVEKSKNPEKCMVAIRLEDEEEEVS
>NC_013792.1|WP_012961084.1|178541_178715_+|hypothetical-protein
MYGMTWKDLVNKYFPNATSNECESILWSETSFPIGSVSCIEKQLKDFHMKSMEKIKT
>NC_013792.1|WP_049779884.1|178866_180222_-|IS1182-like-element-ISBspe1-family-transposase
MTLLRPIREKQIELEMVSIDQLVPEDHLLRKIDATIDFNFIYDRVKSFYSEDNGRPPIDPVMLFKMMLVGYLFGIRSERQLEKEIQTNVAYRWFLGLNLTDSVPHHSTISFNRHKRFKGTKIFQDIFDEVVLLAMEHRMVGGRLLFTDSTHLKANANKRKFVKETVQVDTREYIEELNQAIEDDRKAHGKKPLPKKEKEVEEKEIKVSTTDKDSGYMFRDGKPEGFFYLDHRTTDHKYNIITDVYVTPGNVHDSRPYLERLDRQCTRFDFKLEAVGLDAGYLTMPICHGLDQRGIMGVIAHRRFSTVKGLLPKWKFTFDHETDTYICPQSQVLTYATTNREGYRQYHSNPEICKDCPSLSQCTKSKNHKKVITRHVWEDKKEKVRENRLSPEGKTIYKMRKETIERSFADSKQLHGLRYCRLRSLEGASEQALMTATAQNIKKIANHLTRG
>NC_013792.1|WP_012961085.1|180349_182173_-|nitric-oxide-reductase-activation-protein
MSIQLIQQERERKRLYRFLRFNFNHQFEMFWSNKGTSYTDGKDIYIQFEMQQPARRPFTEAECKLLRKGHSIHEVGHLAFDQLQDYFKWLKDLTSQKNEDWMQNKGYPHDWVVFFGNMALDGRMENLCILKDPSYAPYIDFNNYEWRFGIRGEQAGECRIKDFREAYGSRVLGLEDIPNWHIETMEVIEDIQPLLELARFSPTTQSCLDYIKEIMEKVWPTILSWYNENGKKPDQESDDSFFTVSHEEPTYQSDDGDQHAQEVLEANGLLTSDGDIDLSNASKRSLNNTKQIVKDLLSKEEKQLTKEQQEDPQFKTERNQLDIPTPEGQQSCDIIVRPLKDSNINHYHYHLQKVKRQIIPFSKTLQKLLEGKKDQVRRNQRSGKFDPSKAWKASKLEQDDVFVKNKKGSPSKGAAIQVIWDQSGSTDMFYGKEMIIDQMKQAAILLAEACQRINLPLSMHGFSTDFLEEACTYVDEIYPLVSFESGLKDYNRSLIGGVHPRRTNHDPAALAWGYEQLKKRKEDIRLLIMISDGLPCFEGNEDTSTMSTLVKQAEKEGIETLCLFIGDHSPVIIDQVREMYPSRSIIAKSGLIKETERHVKRIIRNRL
>NC_013792.1|WP_012961086.1|182175_183576_-|AAA-family-ATPase
MKTINFTMPANYPLQSYRDRFHTVVDQVEVATHKDKMIYRITYSKLLLPGYFVVEDENGSNVGSFIHHCEANQEGKSCVHLGAAVILAEDLGVPLKKITVKTLSSHIEKHPYQDLEYTTIETTIKAVEPPSSVKIPRSKGKSASQNWKEGWKEIEQYLTSQNFTRGMIGAVQEKRKHVCDKVSLQPICTPPIKPVFPYEGEILARAVRHVISGRDLLLVGGKGTGKDTLCSTLAWIFGLPLLLVTGNVDETRESVVGGAGFKDNQTTFEKSPFTQCLEQGGITHYAELNMMSGDVTSIFHSVLDDNKVLPTPNGVIKRHPHHLFIGSINLGEGYAGVKTLNDALKDRLAVIHLPYAKNFRGMIERKTGVTSASILSLLEKVRSAIKRLISEENQGDSADTIRGYIAAAEHLQKFGTTEDIKAEALEDFIVNRVEDLDERMAVRQAVRLAWAEFPVNDEEEHYEGGY
>NC_013792.1|WP_012961087.1|183651_184464_-|hypothetical-protein
MTRYTEKAMQLSESTQKRREQAFNVIPEAYHSFIVMMAEQECIGAANELSKDEIDVGIMLQDGKAYCSISKPYMMVDGRVKWARDEHKQNEKKLFIHPPAISEDGTFLTVHVESEWLGSSSGSSTIPVGNQGFAATSAIEMAQTSALGRALGFLGYGLIGGGFITAEEKQSKDQSTSMINKKTNDSTEDDLDLVKFRVEENPQINADSTCFVKGMLQDRTFVDVLFPKALLSDARKLTINDVICILGYRHDAVIRVQRFATTEDQQIQTA
>NC_013792.1|WP_012961088.1|184460_185036_-|NYN-domain-containing-protein
MKAAILVDEQNAMSTMHLMDVKGLTRWKTFFDAIHHVVKRDYPTLQMDYCMYGAVVPKKVNYSLHEKRRRFFHSLSKDQIKVSLGYCLLNAQGVMTEKGVDVELALDIYQKALEGYELLIVFSGDSDLVPAIERAKALGTKVVAVLGDNQPATHMSKVCDATIPFTAIVHLLPKSSIVFFKETHLKGAVLT

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_013792_1	1.1\|175738\|34\|NC_013792\|CRISPRCasFinder	175738-175771	34	NC_013792	Bacillus pseudofirmus OF4 plasmid pBpOF4-01, complete sequence	175738-175771	0	1.0
NC_013792_1	1.1\|175738\|34\|NC_013792\|CRISPRCasFinder	175738-175771	34	NC_013792	Bacillus pseudofirmus OF4 plasmid pBpOF4-01, complete sequence	175824-175857	4	0.882

1. spacer 1.1|175738|34|NC_013792|CRISPRCasFinder matches to NC_013792 (Bacillus pseudofirmus OF4 plasmid pBpOF4-01, complete sequence) position: , mismatch: 0, identity: 1.0

tttacggagtgcagtacccctttacggagtacag	CRISPR spacer
tttacggagtgcagtacccctttacggagtacag	Protospacer
**********************************

2. spacer 1.1|175738|34|NC_013792|CRISPRCasFinder matches to NC_013792 (Bacillus pseudofirmus OF4 plasmid pBpOF4-01, complete sequence) position: , mismatch: 4, identity: 0.882

tttacggagtgcagtacccctttacggagtacag	CRISPR spacer
tagacggagtgcagtaccccctttcggagtacag	Protospacer
*  *****************.** **********

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_013791

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NC_013792

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection