CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NC_002662	Lactococcus lactis subsp. lactis Il1403, complete sequence	2 crisprs	cas3,DEDDh,csa3,DinG	0	1	14	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_002662_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_002662_1

1417891-1417982

Orphan

Consensus_repeat	Method
TCCAAATCCGTTTGATTAGCTTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_002662_1

>merge|NC_002662|1|1417891-1417982|CRISPRCasFinder
TCCAAATCCGTTTGATTAGCTTTTGTTGAAACAGTCGCCGATTGATTATTAACAGTATGCCGTAAACTTTCTAAATCCGTTTGATTAGCTTT

>NC_002662|1|1|1417891-1417982|CRISPRCasFinder
TCCAAATCCGTTTGATTAGCTTT	TGTTGAAACAGTCGCCGATTGATTATTAACAGTATGCCGTAAACTT
TCTAAATCCGTTTGATTAGCTTT

Protein	Signature genes	Signature genes Name	Protein_function
NC_002662.1\|WP_003132438.1\|1407666_1408482_-\|hypothetical-protein	unknown	unknown	unknown
NC_002662.1\|WP_010905913.1\|1414111_1414642_-\|hypothetical-protein	unknown	unknown	unknown
NC_002662.1\|WP_010905929.1\|1432349_1432745_-\|DUF806-family-protein	unknown	unknown	gnl\|CDD\|368546
NC_002662.1\|WP_010905924.1\|1422689_1424477_-\|phage-tail-protein	unknown	unknown	gnl\|CDD\|377677
NC_002662.1\|WP_003130485.1\|1410554_1410908_-\|DUF1304-domain-containing-protein	unknown	unknown	gnl\|CDD\|377753
NC_002662.1\|WP_010905920.1\|1418725_1418950_-\|hemolysin-XhlA-family-protein	unknown	unknown	gnl\|CDD\|371241
NC_002662.1\|WP_010905922.1\|1421379_1421553_-\|hypothetical-protein	unknown	unknown	unknown
NC_002662.1\|WP_010905925.1\|1424476_1426012_-\|phage-tail-family-protein	unknown	unknown	gnl\|CDD\|368574
NC_002662.1\|WP_010905910.1\|1406956_1407526_-\|hypothetical-protein	unknown	unknown	unknown
NC_002662.1\|WP_010905917.1\|1416047_1416827_-\|C40-family-peptidase	unknown	unknown	gnl\|CDD\|283125
NC_002662.1\|WP_010905923.1\|1421552_1422674_-\|hypothetical-protein	unknown	unknown	unknown
NC_002662.1\|WP_003130484.1\|1411004_1411433_-\|universal-stress-protein	unknown	unknown	gnl\|CDD\|366180
NC_002662.1\|WP_010905927.1\|1431161_1431581_-\|phage-tail-assembly-chaperone	unknown	unknown	gnl\|CDD\|311073
NC_002662.1\|WP_010905926.1\|1426014_1430937_-\|phage-tail-tape-measure-protein	unknown	unknown	gnl\|CDD\|227608
NC_002662.1\|WP_003130483.1\|1411552_1411714_-\|hypothetical-protein	unknown	unknown	unknown
NC_002662.1\|WP_010905921.1\|1418969_1421402_-\|hypothetical-protein	unknown	unknown	unknown
NC_002662.1\|WP_010905928.1\|1431725_1432319_-\|phage-tail-protein	unknown	unknown	gnl\|CDD\|309671
NC_002662.1\|WP_003130487.1\|1409730_1410489_+\|pilus-protein	unknown	unknown	gnl\|CDD\|368639
NC_002662.1\|WP_010905918.1\|1416826_1417126_-\|phage-holin	unknown	unknown	gnl\|CDD\|377400
NC_002662.1\|WP_003130481.1\|1411743_1412145_-\|arsenate-reductase-(thioredoxin)	unknown	unknown	gnl\|CDD\|131738

Protein	Function_ID	Function_description	E-value
NC_002662.1\|WP_010905929.1\|1432349_1432745_-\|DUF806-family-protein	gnl\|CDD\|368546	pfam05657, DUF806, Protein of unknown function (DUF806). This family consists of several Siphovirus and Lactococcus proteins of unknown function. The viral sequences are thought to be tail component proteins.	1.46113e-53
NC_002662.1\|WP_010905920.1\|1418725_1418950_-\|hemolysin-XhlA-family-protein	gnl\|CDD\|371241	pfam10779, XhlA, Haemolysin XhlA. XhlA is a cell-surface associated haemolysin that lyses the two most prevalent types of insect immune cells (granulocytes and plasmatocytes) as well as rabbit and horse erythrocytes. This family has had DUF1267, pfam06895, merged into it.	1.29318e-11
NC_002662.1\|WP_003130485.1\|1410554_1410908_-\|DUF1304-domain-containing-protein	gnl\|CDD\|377753	pfam06993, DUF1304, Protein of unknown function (DUF1304). This family consists of several hypothetical bacterial proteins of around 120 residues in length. The function of this family is unknown.	2.19612e-15
NC_002662.1\|WP_010905927.1\|1431161_1431581_-\|phage-tail-assembly-chaperone	gnl\|CDD\|311073	pfam06896, Phage_TAC_3, Phage tail assembly chaperone proteins, TAC. This is a family of phage tail tube assembly chaperone proteins from some Siphoviridae viruses.	3.38795e-33
NC_002662.1\|WP_010905925.1\|1424476_1426012_-\|phage-tail-family-protein	gnl\|CDD\|368574	pfam05709, Sipho_tail, Phage tail protein. This family consists of several Siphovirus and other phage tail component proteins as well as some bacterial proteins of unknown function.	1.19416e-27
NC_002662.1\|WP_010905926.1\|1426014_1430937_-\|phage-tail-tape-measure-protein	gnl\|CDD\|227608	COG5283, COG5283, Phage-related tail protein [Function unknown].	0
NC_002662.1\|WP_010905917.1\|1416047_1416827_-\|C40-family-peptidase	gnl\|CDD\|283125	pfam05382, Amidase_5, Bacteriophage peptidoglycan hydrolase. At least one of the members of this family, the Pal protein from the pneumococcal bacteriophage Dp-1 has been shown to be a N-acetylmuramoyl-L-alanine amidase. According to the known modular structure of this and other peptidoglycan hydrolases from the pneumococcal system, the active site should reside at the N-terminal domain whereas the C-terminal domain binds to the choline residues of the cell wall teichoic acids. This family appears to be related to pfam00877.	7.65332e-75
NC_002662.1\|WP_010905924.1\|1422689_1424477_-\|phage-tail-protein	gnl\|CDD\|377677	pfam06605, Prophage_tail, Prophage endopeptidase tail. This family is of prophage tail proteins that are probably acting as endopeptidases.	1.14071e-07
NC_002662.1\|WP_003130484.1\|1411004_1411433_-\|universal-stress-protein	gnl\|CDD\|366180	pfam00582, Usp, Universal stress protein family. The universal stress protein UspA is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. UspA enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae UspA reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, though UspA lacks ATP-binding activity.	9.6067e-36
NC_002662.1\|WP_003130487.1\|1409730_1410489_+\|pilus-protein	gnl\|CDD\|368639	pfam05857, TraX, TraX protein. This family consists of several bacterial TraX proteins. TraX is responsible for the amino-terminal acetylation of F-pilin subunits.	5.14129e-16
NC_002662.1\|WP_010905928.1\|1431725_1432319_-\|phage-tail-protein	gnl\|CDD\|309671	pfam04630, Phage_TTP_1, Phage tail tube protein. This is a family of phage tail tube proteins from Myoviridae.	2.51719e-85
NC_002662.1\|WP_010905918.1\|1416826_1417126_-\|phage-holin	gnl\|CDD\|377400	pfam04688, Holin_SPP1, SPP1 phage holin. This family constitutes holin proteins from the dsDNA Siphidoviridae group bacteriophages with two transmembrane segments. Most bacteriophages require an endolysin and a holin for host lysis. During late gene expression, holins accumulate and oligomerize in the host cell membrane. They then suddenly trigger to permeablise the membrane, which causes lysis by allowing endolysin to attach the peptidoglycan. There are thought to be at least 35 different families of holin genes.	6.56958e-30
NC_002662.1\|WP_003130481.1\|1411743_1412145_-\|arsenate-reductase-(thioredoxin)	gnl\|CDD\|131738	TIGR02691, Protein_ArsC, arsenate reductase (thioredoxin). This family describes the well-studied thioredoxin-dependent arsenate reductase of Staphylococcus aureaus plasmid pI258 and other mechanistically similar arsenate reductases. The mechanism involves an intramolecular disulfide bond cascade, and aligned members of this family have four absolutely conserved Cys residues. This group of arsenate reductases belongs to the low-molecular weight protein-tyrosine phosphatase family (pfam01451), as does a group of glutathione/glutaredoxin type arsenate reductases (TIGR02689). At least two other, non-homologous groups of arsenate reductases involved in arsenical resistance are also known. This enzyme reduces arsenate to arsenite, which may be more toxic but which is more easily exported. [Cellular processes, Detoxification].	1.35635e-82

>NC_002662.1|WP_010905918.1|1416826_1417126_-|phage-holin
MKTIDKGTLTRTILLVLALANQLLTASGHSVIPIDDATVTNIISTGFTVATALASWWKNNDFTHAAKKGTELTKSLKNGDSVQVVKASDSDHEFTEGGE
>NC_002662.1|WP_010905917.1|1416047_1416827_-|C40-family-peptidase
MSSIENMIAWMQARKGKVTYSMTLRMGPRSYDCSSSVFFAMIAGGFLSAGSMGNTETLFGMSGTKLKEISRGEVQRGDIFISGTPGGSAGSDGHTGIFLSNGSFIHCSYTHNGIAVDTNDAYMSTRLPHHFYRIVGSGSANADSKPQMVTLNVDGQFGNATAKRLQEYFDTAGKDGVISHQYKQTFNQNIYAAQFDSSLTGSNVVKALQRFLGIGQDGLFGQGTIKALQKHLGTTQDGTISPVSDSVRELQRRLNANKL
>NC_002662.1|WP_010905913.1|1414111_1414642_-|hypothetical-protein
MKKIGLVILAAMAFIMGGVINAHQVSADTDPLHERLYRVYNPNSGEHLLTPAGWEVLTLEKAGWKSEGVAFYIPLTEPPYSGYPVVQRLYNPNAGDHHYTTSDFEAASLLSIGWNNDGTAFRFPVAKANTGVPVYRLYNPNAKVGSHHFTMSSFERDSLIKAGWKNEGIAFNAYTK
>NC_002662.1|WP_003130481.1|1411743_1412145_-|arsenate-reductase-(thioredoxin)
MKKVYFLCTGNSCRSQIAEGYGHKNLEGWEVRSAEIETHGLNPRAVKVMAEEGIDISSQKSELIDLDYFNECDLIITLCGDALDKCPMIPKGVNHEHWDLQDPACAIGSETEILAEFRKTRDLIKEKVKMIEK
>NC_002662.1|WP_003130483.1|1411552_1411714_-|hypothetical-protein
MKYKIGQLVNLPETRYKGIIGTVIAENKAGILVRFNGSQQLYFKEEELKAYKK
>NC_002662.1|WP_003130484.1|1411004_1411433_-|universal-stress-protein
MAKQYKKILVPVDGSDQAYNAVREGVMLAQWSEAELIVLTVKDLVRYYGIANYGIVETPGLDKLANDILLKVGSIIPAESKFKTQILSGSPKREIVQYAKENDIDLIVMGATGAGAFDRLLAGSTTNYVVNHAPCGVTIVQG
>NC_002662.1|WP_003130485.1|1410554_1410908_-|DUF1304-domain-containing-protein
MISLILIIIVGIEHLLFGFIEMFGGIKLQADAFGFDESELKNKTLQVALSNQGIYNLGFGLMIIVLAIMNATTIVFIIAMLFVILIGIYGALTVTKKILFVQALPALVTLIVLLLSL
>NC_002662.1|WP_003130487.1|1409730_1410489_+|pilus-protein
MKQRFGLSGYQLKIIAIIFMLLDHIYLEVLLGLPGIPDFSILDMASRFVSPLFFFLMIEGFFYTRSRKKYLTRLLVAGAVMALGNLVIHYLMNVSISFFTILNPNIFLSLACGFGAVWLLDTIIEKKKILLIFPLIFVSALSIFTEASLVALILPYLMYASRKSGKDWILYIGTLLLSILFLLQAFSFDTSMSLWQSISLNPEFLIITVLPFIYLYNGKKGGRSSTFEKYFFYGFYPIHIWILFIIGHLLNH
>NC_002662.1|WP_003132438.1|1407666_1408482_-|hypothetical-protein
MILGGVSDEKLTKRQFTAIGAVAVLIIGGVKTNTSSLKSSSKKEMTSKTSEIKESQKSSSSQSSSSSQEETTQSQLSVDTKNLTENQFEQWVPITQSNQMQDTHPLRITVSKSDNNLYQAKIDYTATQIDSVNSYKVNSSGELEAIDFEHYPGMKVVSQSFPEIKQNQLTTNQINMWAVAVQDVLFEQKGLKPGIDVIYDLETATDDSIANVKAFKIDYTPSANGGADNANRTLINEFRINSDGNLEIKDVNSETGYRIISKVYMDTSMVQ
>NC_002662.1|WP_010905910.1|1406956_1407526_-|hypothetical-protein
MLKIGSYILLFYLAFRLSKHSFEFEKVSRLELIILPLYSTLMFFITMTWSEENIMVAIILLFLSFLVGWLQASKVEFKDEGKEDKYQHPIILMKKNWSYIIGWGILFLLIIGAHFYSNSHMEVEEVVTEFWKEIVKEISIFARFNAKDGWETWLITGVSSLTFTAFIKSKNKKLEKSLARRRKNSSFSE
>NC_002662.1|WP_010905920.1|1418725_1418950_-|hemolysin-XhlA-family-protein
MEEQAWREVLERLARIETKLDNYETVRDKAERALLIAQSNAKLIEKMEANNKWAWGFMLTLAVTVIGYIITKIL
>NC_002662.1|WP_010905921.1|1418969_1421402_-|hypothetical-protein
MTIVASNSLTISNVNDGTITHTAYAYSADGTDRFTTVYPNLNLLEGSKDFSGDWWLVERSENDGTYKGLTVKKSEGPGITKQFIAPKDGIYTFSAYVKGSGDSADIHRSVTLNSVTGKIVPDKSMGNNFAWLRDSFQVTLKAGDKIYAQYNVAGSGVLWNAGHKWEEGSAATDDLTANYPNLNLLEGSTKYTKDNPKTLSSNSTDGWFFVDDVFVKNLKAGTYTMSGKADAPWTVHDTSGAKKGKVGLWLVSTTPGLNVNISLGDTVPKTIEVPKDGDYCVRINTYSNGKDIETHKFWDFKLEPGSTATPCMPSKNELQEQLTPWMPSLSEVTTSDWPKYRGEYSDMSSEQSTYPYDYTWSLIRGNDGKDGADGHDGRAGKDGVGIKTTVITYAISTSGTTAPNTGWTNSVPSLVKGQYLWTKTVWTYSDTTSETGYSVTYIAKDGNDGNDGIAGKDGTGIKTTTITYAGSTSGTIAPSSGWATTVPTVAAGSYLWTKTVWAYTDNTSETGYSVAKMGNNGATGPQGPPGSNGDPGKIVSNTEPTTRFKGLTWKYIGMSDLTASDGTVIKPNTEYYYNGTHWVINYFSVNNFAAESITSDKIDAKNLIITDGEFVSTTTNGPVTTSTEIKDNHIAISKTDGTVNTKNDLAVDTEQGFAMKFTNNTTGLTREASVNFQGVSTSDSNGNYAQLTPQGTKLSTDVPWTNITRSSGVGTSGTLRARINNGVFYAQSKDVTIPSIAPNSIITIGTMSSKFSGVSGFDTLGLLYSIGQLSVASVTVGNDGKINIGNPNPTTMSGKVIQFSINIPLG
>NC_002662.1|WP_010905922.1|1421379_1421553_-|hypothetical-protein
MKSTFYANIELGGEITQVSFEAASASDVIEQIWRTYGISTPIIEIWAEVTNDDSSKQ
>NC_002662.1|WP_010905923.1|1421552_1422674_-|hypothetical-protein
MSIVSSGQITITDLSDGMQLNAFITASGVTTQTYDATAQTWSPSYATTPQVLTLNLTKAGSTTSVIGGISGNITWTRADGTTTTTITSTTNTDTQYMSGSANSVLTTKVNVPIANSASRFTASGLWVDPNTGLNVPFSAVLDLTVVQLAKSAVLANVYAGNGGAFYNSMPASLTVNADLYKGGQLSAGNKQIFFGYADSTVTTTGSTGYNSNLGLGWHLCTSSTTGQTPNVAAGTNTTSQGILTVLPTAITNSQTFKAVIIDQARGTAGTAVSGICTLLDYTDPLTCTIDSTAGSIFKNGSGTTTLTCRVFQSGAEIDTAGTTYTYKWSQRNQNGVLNANFGGTGNQYKTGKTISVAATDINVKAQYTCEVNQ
>NC_002662.1|WP_010905924.1|1422689_1424477_-|phage-tail-protein
MEIVVHDNTLKTVAVINNDIPILPSFFNDNWHRYKDQGAETFIFTVNKFINGQLQDYCRFLNEQAYISFTYDGIDHLFGVENVQESDYQITLTCSSLNLELRNEQANALVNTSSHNIQWYFDQMGLIANAQITIGTNEVSSLTRTINYDGQESKLARLISVIGNFDAEFEFITHLNDDGTLDSIILNIYRANDGVNIQGVGTNRNDVSLNFGKNISGITRTGDTTNLFNATTVTGSDNLNWNSSSFSYKNEDGVEEFYKRAGSDTAYAPLSLNLFKSQIKSNNGDKWIRKDFQTEYTNVNDMWGYCVSQFKQFAYPTVTYEVLANSSLVLESVGNDRPLSIGDTINIQDDNFMDSDGNVGLLLSARVSEMEISFSNPTLNKITFSNFKKQQSEASADIQAIVNQLVDAATPYRAELTTTNGTQFKNGTGSTTLAAHIFKGSATTETIADSYEWSKDGTIVANAQTITVDASGVTDKAVYSFKATVAGKVVASQSVTITNVDDGTSPINLVIDSSNGYQFKNNIINTTFTAILYQNNKEIDKDGTKFAYIWTKTNSDGTVDTAWNLAHQTSQKSITITNRDIWQRATFDCTAEPLN
>NC_002662.1|WP_010905925.1|1424476_1426012_-|phage-tail-family-protein
MAFSVKFNDVDLSTIVDGFTAITRNIGAGWTNTVQPNPIIGADFTQNSINSKSITVNFIANVKLDRFTSVRKALASALNVKQPAALIFDDDPNQVWWAVPDGTPTLDESSFYQAVGSITFLVPSGVSESVETNVLNASNSGGQLGTITNNSDGSVDIEINNTGNLETFPTIEITNVHENGYIAIAGQNGAIEIGNRQEANGATHALSEYLYNSNSDLSFSKFKDATGTANPQNSGLGTNGTISFQSDGLRFATQGTMSGSQFAGGGMKVMTLPADSNGHVGAVNFYSHFNLFAWAGAMGQTGILQILFTDINDKLVAGYGITKSDMSGNSAKCSFWVGGNTPKEYTSFGFETNNAEKNQKYPNNMFNSSTGDADFLKEGANLGFYWYGSRKTTYVPELADVEVSKVYLYLGQFKGSNKFINNLSIRQVNLTKNNVSVWKDVPNRYAANSKITVNMNGKDTVVINGMPAIQEKIRGTEPFSIPPGRSTLKILQSTWNTTPPIVQISYKERNL
>NC_002662.1|WP_010905926.1|1426014_1430937_-|phage-tail-tape-measure-protein
MADIMVDSVTTGIDLNETKAVEAINRLKSAVKDSTREWQINEAQAKSAGDAVSASKYRYEGLSEAMEKQKAYIANLSEGMKTINRNTDAGEKAYQKYNAQLTTAERSLASMTGQLNRAKSAYEYQQTGIEDLNKSLSANDKLMQSQIDLYEKTRNKMGAAKAEVSGLSTSYAKQTEIYRAQVTELKRLEAAEGTSSETLVKQKTRVNEAASSLMNYRNKLLEANLAVTKMQPFNSESLIGKGLNTVYQTTEKATDVMAAGYQKVKSAAYQSAFGIAAIGAAAVKGAQMASELQNQYKTTFNLLVTGGEQAKEAQENVNKMQEQGSELSVKYGKTQKEIADGYQELIKRGYTSSQALAALPTMLQASVASGDDFTDVVHNSTAALESFGMRSNDVAGMTKNTKEAVNQMAYAADMTATDFQNMGVAMEYVGASAHQSKLSLSETASAIGILSNNGLEADKAGTGLRKVIVSLQSPSKDAAEALSGIGLSTKDFVDQNGNMKSMTEIFGLLNQHTEKLSSFQKGQIFHALFGTTGQQAGAILSENVKQLGELDDKVKKSADGQGYVVNLANKNMQSTQNELKQFKAAGEAVLIMIGQRFLPVLSDAATSMAKAFNSKEGKQGLEEIAKWIAEIFQKLVDTVKFIGTHKDEVVTFGKIFAGIWATKKIGDVIVWLKKLKKSLLEIQAIDALSGGLGTGGIKASVGKGVATEAGTVASTVTKGGVAAEGEALVASGSLSKATSLIPRLLGIIGSVGGSTVLSGGINAGAELLSKDSTAQKTGGVAGSLGGAAAGAAIGSLIAPGIGTAIGAAIGGMGGKNLGKKLGDLINNGLKESSLKSEKLPVVKFDPKAPTKDMKEFSKDYQGFLDKINKASNVDIVDEKSLEKAKKATADAYAQMSKDIDKFYQNQEKDSKKQIDILVKNGVITQAQADKMYKGQKDSDDKQKVAQKKNLDEMKKNTDKYYSDVAKSQKSYDTQSQKDASNHANLMKKIKSGNTSELLKIEKTYGKNSPEYQQEMNKEIAKENSDFNKAQQAAKKKHNEAMNKLEKDYAKTQTKAEEQMNNQINTATKIAQNKQLDLLDDLKNKKGKLNQKQLIDTLEKADDEYKGVKDKAQKQKDEAVKAANEKYKKTVAAADKERAENGSMSKAQYDEIVKNAQKQRDDTISAAKKQQTEVTDKAQKTHDKTVELANSKADKNVKAAAKEQGETVEQYTKGFKDSRNLINSFIDGINGVLNFLHKGWGNIGHVSLKGFATGTRGLAQDETALVGEEGFELAHHPSRGIFAVGQQGPEIRNLKAGTSILPHSMSKEFLSLTANLPAHADGVSGFLSDALGWVKSTYKDVTSVISKGPKGVVDAIYNGLGLDDLENDFPPVVTRIAKGSAQTAQDNFIKFLQSFFKKAESDAGGSQGSPSGSGVQRWAGQVKQALAANGLSTSQDMIDRVLRQISSESSGNEKAVQGNIGDINNITGDLAKGLMQTISSTFNANKFPGHGDIFNGYDNLLAALNYAKKTYGPSLSFLGNGHGYENGGIINAHGFYEIAEGNRPEMVIPLDPQKKSRATQLLNQASQTINNNQGYSNNVTDFSPVLALLSNIFNSIEDVKKNPLIAYALLDGRNVSQGLAPYMNQALTDYVNQQDRLWGKN
>NC_002662.1|WP_010905927.1|1431161_1431581_-|phage-tail-assembly-chaperone
MKLSLPEIREESFEVKTSIKNIKKMHAYQLGLAEHQEKLASAQDGTLDELTKAIALDDQFVINTAEKFISEVLGLNKKEIDKFEEEIERDQLMKLQSKLVLLLQGYNDDQIDTMFTEEVDSAEKKVQALKNEKSTTTTN
>NC_002662.1|WP_010905928.1|1431725_1432319_-|phage-tail-protein
MATKGLKMVTLALLDDKGVIVKGETGLSTNGVFPITDEMLGTKTANITNLSSAPTMIYGNDGQVDADIAKGTPSVAFAFNGLPVDIKNKLLGRVNDTKGGYTQGSIPKVAVLIQTTTIGTAKPQYVAFAAGKMNETAMNLQTNTNAVVRVDDALTFTAFSVSRWGGEAVKFFDGGDSKFTEDVMMKDVFNGYAGVGV
>NC_002662.1|WP_010905929.1|1432349_1432745_-|DUF806-family-protein
MKRPVEIVQDIIAASDFPHDEIFLDSIPSEKLDSSNETQVLLTESDNGPSDYGNSDFISLMYGVYIQIFYSNAEDSGINIVQSEINLMKSFINNDWLIAQSKSHYIDPDTGQIIKNLTVQRIMTLSEIANS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_002662_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_002662_2

1847570-1847664

Orphan

Consensus_repeat	Method
TTTATTACTGACAGACTTGTCAGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_002662_2

>merge|NC_002662|2|1847570-1847664|CRISPRCasFinder
TTTATTACTGACAGACTTGTCAGCTTTGCTGACAAATCCTTCATCCATTGATAAAAAGCTCAATTCAATCGCTTTTTACTGACAGACTTGTCAGC

>NC_002662|2|2|1847570-1847664|CRISPRCasFinder
TTTATTACTGACAGACTTGTCAGC	TTTGCTGACAAATCCTTCATCCATTGATAAAAAGCTCAATTCAATCG
CTTTTTACTGACAGACTTGTCAGC

Protein	Signature genes	Signature genes Name	Protein_function
NC_002662.1\|WP_004255158.1\|1855295_1855982_-\|amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223836
NC_002662.1\|WP_004255189.1\|1848840_1850058_-\|cysteine-desulfurase	unknown	unknown	gnl\|CDD\|131034
NC_002662.1\|WP_003130548.1\|1856129_1857038_-\|diacylglycerol-kinase-family-lipid-kinase	unknown	unknown	gnl\|CDD\|224513
NC_002662.1\|WP_004255224.1\|1840676_1841246_-\|biotin-transporter-BioY	unknown	unknown	gnl\|CDD\|224187
NC_002662.1\|WP_010906135.1\|1842621_1843770_+\|acetyl-CoA-C-acyltransferase	unknown	unknown	gnl\|CDD\|273881
NC_002662.1\|WP_004255217.1\|1843766_1844117_+\|hypothetical-protein	unknown	unknown	unknown
NC_002662.1\|WP_004255173.1\|1853730_1854432_-\|adaptor-protein-MecA	unknown	unknown	gnl\|CDD\|227199
NC_002662.1\|WP_010906134.1\|1839377_1839683_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226801
NC_002662.1\|WP_004255171.1\|1854561_1855296_-\|amino-acid-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224051
NC_002662.1\|WP_004255197.1\|1847782_1848241_-\|SUF-system-NifU-family-Fe-S-cluster-assembly-protein	unknown	unknown	gnl\|CDD\|273918
NC_002662.1\|WP_010906141.1\|1852396_1853728_-\|undecaprenyl/decaprenyl-phosphate-alpha-N-acetylglucosaminyl-1-phosphate-transferase	unknown	unknown	gnl\|CDD\|133463
NC_002662.1\|WP_004255215.1\|1844091_1844385_+\|hypothetical-protein	unknown	unknown	unknown
NC_002662.1\|WP_004255181.1\|1851451_1852222_-\|Fe-S-cluster-assembly-ATPase-SufC	unknown	unknown	gnl\|CDD\|223473
NC_002662.1\|WP_010906138.1\|1845150_1845996_+\|nitronate-monooxygenase	unknown	unknown	gnl\|CDD\|132195
NC_002662.1\|WP_004255213.1\|1844372_1845128_+\|SDR-family-NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|187594
NC_002662.1\|WP_004255227.1\|1839699_1840671_-\|biotin--[acetyl-CoA-carboxylase]-ligase	unknown	unknown	gnl\|CDD\|237010
NC_002662.1\|WP_010906139.1\|1848356_1848839_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|223659
NC_002662.1\|WP_010906140.1\|1850057_1851314_-\|Fe-S-cluster-assembly-protein-SufD	unknown	unknown	gnl\|CDD\|223791
NC_002662.1\|WP_004255221.1\|1841390_1842632_+\|AMP-binding-protein	unknown	unknown	gnl\|CDD\|341288
NC_002662.1\|WP_004255207.1\|1846136_1847549_-\|Fe-S-cluster-assembly-protein-SufB	unknown	unknown	gnl\|CDD\|131035

Protein	Function_ID	Function_description	E-value
NC_002662.1\|WP_004255158.1\|1855295_1855982_-\|amino-acid-ABC-transporter-permease	gnl\|CDD\|223836	COG0765, HisM, ABC-type amino acid transport system, permease component [Amino acid transport and metabolism].	4.09368e-76
NC_002662.1\|WP_004255189.1\|1848840_1850058_-\|cysteine-desulfurase	gnl\|CDD\|131034	TIGR01979, Probable_cysteine_desulfurase, cysteine desulfurases, SufSfamily. This model represents a subfamily of NifS-related cysteine desulfurases involved in FeS cluster formation needed for nitrogen fixation among other vital functions. Many cysteine desulfurases are also active as selenocysteine lyase and/or cysteine sulfinate desulfinase. This subfamily is associated with the six-gene SUF system described in E. coli and Erwinia as an FeS cluster formation system during oxidative stress. The active site Cys is this subfamily resembles GHHC with one or both His conserved. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other].	0
NC_002662.1\|WP_004255224.1\|1840676_1841246_-\|biotin-transporter-BioY	gnl\|CDD\|224187	COG1268, BioY, Uncharacterized conserved protein [General function prediction only].	5.72661e-47
NC_002662.1\|WP_010906135.1\|1842621_1843770_+\|acetyl-CoA-C-acyltransferase	gnl\|CDD\|273881	TIGR01930, 3-ketoacyl-CoA_thiolase, acetyl-CoA acetyltransferases. This model represents a large family of enzymes which catalyze the thiolysis of a linear fatty acid CoA (or acetoacetyl-CoA) using a second CoA molecule to produce acetyl-CoA and a CoA-ester product two carbons shorter (or, alternatively, the condensation of two molecules of acetyl-CoA to produce acetoacetyl-CoA and CoA). This enzyme is also known as "thiolase", "3-ketoacyl-CoA thiolase", "beta-ketothiolase" and "Fatty oxidation complex beta subunit". When catalyzing the degradative reaction on fatty acids the corresponding EC number is 2.3.1.16. The condensation reaction corresponds to 2.3.1.9. Note that the enzymes which catalyze the condensation are generally not involved in fatty acid biosynthesis, which is carried out by a decarboxylating condensation of acetyl and malonyl esters of acyl carrier proteins. Rather, this activity may produce acetoacetyl-CoA for pathways such as IPP biosynthesis in the absence of sufficient fatty acid oxidation. [Fatty acid and phospholipid metabolism, Other].	4.30804e-158
NC_002662.1\|WP_004255173.1\|1853730_1854432_-\|adaptor-protein-MecA	gnl\|CDD\|227199	COG4862, MecA, Negative regulator of genetic competence, sporulation and motility [Posttranslational modification, protein turnover, chaperones / Signal transduction mechanisms / Cell motility and secretion].	3.81196e-86
NC_002662.1\|WP_004255197.1\|1847782_1848241_-\|SUF-system-NifU-family-Fe-S-cluster-assembly-protein	gnl\|CDD\|273918	TIGR01994, Iron-sulfur_cluster_assembly_scaffold_protein_IscU, SUF system FeS assembly protein, NifU family. Three iron-sulfur cluster assembly systems are known so far. ISC is broadly distributed while NIF tends to be associated with nitrogenase in nitrogen-fixing bacteria. The most recently described is SUF, believed to be important to maintain the function during aerobic stress of enzymes with labile Fe-S clusters. It is fairly widely distributed. This family represents one of two different proteins proposed to act as a scaffold on which the Fe-S cluster is built and from which it is transferred. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other].	9.34852e-67
NC_002662.1\|WP_004255171.1\|1854561_1855296_-\|amino-acid-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224051	COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism].	1.02808e-157
NC_002662.1\|WP_003130548.1\|1856129_1857038_-\|diacylglycerol-kinase-family-lipid-kinase	gnl\|CDD\|224513	COG1597, LCB5, Sphingosine kinase and enzymes related to eukaryotic diacylglycerol kinase [Lipid metabolism / General function prediction only].	2.39571e-70
NC_002662.1\|WP_010906141.1\|1852396_1853728_-\|undecaprenyl/decaprenyl-phosphate-alpha-N-acetylglucosaminyl-1-phosphate-transferase	gnl\|CDD\|133463	cd06853, GT_WecA_like, This subfamily contains Escherichia coli WecA, Bacillus subtilis TagO and related proteins. WecA is an UDP-N-acetylglucosamine (GlcNAc):undecaprenyl-phosphate (Und-P) GlcNAc-1-phosphate transferase that catalyzes the formation of a phosphodiester bond between a membrane-associated undecaprenyl-phosphate molecule and N-acetylglucosamine 1-phosphate, which is usually donated by a soluble UDP-N-acetylglucosamine precursor. WecA participates in the biosynthesis of O antigen LPS in many enteric bacteria and is also involved in the biosynthesis of enterobacterial common antigen. A conserved short sequence motif and a conserved arginine at a cytosolic loop of this integral membrane protein were shown to be critical in recognition of substrate UDP-N-acetylglucosamine.	4.68381e-85
NC_002662.1\|WP_010906134.1\|1839377_1839683_-\|hypothetical-protein	gnl\|CDD\|226801	COG4357, COG4357, Zinc finger domain containing protein (CHY type) [Function unknown].	1.12966e-28
NC_002662.1\|WP_004255181.1\|1851451_1852222_-\|Fe-S-cluster-assembly-ATPase-SufC	gnl\|CDD\|223473	COG0396, sufC, Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones].	2.57723e-148
NC_002662.1\|WP_010906138.1\|1845150_1845996_+\|nitronate-monooxygenase	gnl\|CDD\|132195	TIGR03151, enACPred_II, putative enoyl-[acyl-carrier-protein] reductase II. This oxidoreductase of the 2-nitropropane dioxygenase family (pfam03060) is commonly found in apparent operons with genes involved in fatty acid biosynthesis. Furthermore, this genomic context generally includes the fabG 3-oxoacyl-[ACP] reductase and lacks the fabI enoyl-[ACP] reductase.	3.58449e-84
NC_002662.1\|WP_004255213.1\|1844372_1845128_+\|SDR-family-NAD(P)-dependent-oxidoreductase	gnl\|CDD\|187594	cd05333, BKR_SDR_c, beta-Keto acyl carrier protein reductase (BKR), involved in Type II FAS, classical (c) SDRs. This subgroup includes the Escherichai coli K12 BKR, FabG. BKR catalyzes the NADPH-dependent reduction of ACP in the first reductive step of de novo fatty acid synthesis (FAS). FAS consists of four elongation steps, which are repeated to extend the fatty acid chain through the addition of two-carbo units from malonyl acyl-carrier protein (ACP): condensation, reduction, dehydration, and a final reduction. Type II FAS, typical of plants and many bacteria, maintains these activities on discrete polypeptides, while type I FAS utilizes one or two multifunctional polypeptides. BKR resembles enoyl reductase, which catalyzes the second reduction step in FAS. SDRs are a functionally diverse family of oxidoreductases that have a single domain with structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet) NAD(P)(H) binding region and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRS are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes have a 3-glycine N-terminal NAD(P)(H) binding pattern: TGxxxGxG in classical SDRs. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P) binding motif and an altered active site motif (YXXXN). Fungal type type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P) binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction. A critical catalytic Tyr residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering), is often found in a conserved YXXXK pattern. In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) or additional Ser, contributing to the active site. Substrates for these enzymes include sugars, steroids, alcohols, and aromatic compounds. The standard reaction mechanism is a proton relay involving the conserved Tyr-151 and Lys-155, and well as Asn-111 (or Ser). Some SDR family members, including 17 beta-hydroxysteroid dehydrogenase contain an additional helix-turn-helix motif that is not generally found among SDRs.	7.26065e-73
NC_002662.1\|WP_004255227.1\|1839699_1840671_-\|biotin--[acetyl-CoA-carboxylase]-ligase	gnl\|CDD\|237010	PRK11886, PRK11886, bifunctional biotin--[acetyl-CoA-carboxylase] ligase/biotin operon repressor BirA.	8.8094e-70
NC_002662.1\|WP_010906139.1\|1848356_1848839_-\|hypothetical-protein	gnl\|CDD\|223659	COG0586, DedA, Uncharacterized membrane-associated protein [Function unknown].	3.28577e-22
NC_002662.1\|WP_010906140.1\|1850057_1851314_-\|Fe-S-cluster-assembly-protein-SufD	gnl\|CDD\|223791	COG0719, SufB, Cysteine desulfurase activator SufB [Posttranslational modification, protein turnover, chaperones].	9.30838e-131
NC_002662.1\|WP_004255221.1\|1841390_1842632_+\|AMP-binding-protein	gnl\|CDD\|341288	cd17633, AFD_YhfT-like, fatty acid-CoA ligase VraA. This family of acyl-CoA ligases includes Bacillus subtilis YhfT, as well as long-chain fatty acid-CoA ligase VraA, all of which are as yet to be characterized. These proteins belong to the adenylate-forming enzymes which catalyze an ATP-dependent two-step reaction to first activate a carboxylate substrate as an adenylate and then transfer the carboxylate to the pantetheine group of either coenzyme A or an acyl-carrier protein. The active site of the domain is located at the interface of a large N-terminal subdomain and a smaller C-terminal subdomain	3.2301e-68
NC_002662.1\|WP_004255207.1\|1846136_1847549_-\|Fe-S-cluster-assembly-protein-SufB	gnl\|CDD\|131035	TIGR01980, UPF0051_protein_slr0074, FeS assembly protein SufB. This protein, SufB, forms a cytosolic complex SufBCD. This complex enhances the cysteine desulfurase of SufSE. The system, together with SufA, is believed to act in iron-sulfur cluster formation during oxidative stress. Note that SufC belongs to the family of ABC transporter ATP binding proteins, so this protein, encoded by an adjacent gene, has often been annotated as a transporter component. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other].	0

>NC_002662.1|WP_004255207.1|1846136_1847549_-|Fe-S-cluster-assembly-protein-SufB
MTENSTQEVVKDLEEYKFGFHDNAELEFTTGLGLTEEVIREISETKNEPEWMLEFRLKSFEAFKKLDMPKWGPDLSGIDFNDIVYYQKPSAKAARSWEDVPQEIKDTFEKIGIPEAERSYLAGASAQYESEVVYHNMKDEFEKLGIIFTDTDSGLRDYPEIFKKYFSKLVPPTDNKLAALNSAVWSGGSFVYVPKGVKCEIPIQAYFRINNEKSGQFERTLIIVEEGASIQYVEGCTAPTYSASSLHAAVVEIFVEEGGYMRYSTIQNWSDNVYNLVTKRAAAEKNATVEWIDGNLGSKVSMKYPAVHLNGPGARGTMLSIAFAGANQNQDTGAKMIHNAPNTSSSIISKSIAKNGGAVNYRGQVTFGKNSKKSASHIECDTILMDDLSKSDTVPFNEIHNSQVALEHEAKVSKISEEQLYYLMSRGLTEKEATDMIVMGFIEPFTKELPMEYAVELNRLISYSMEGSIG
>NC_002662.1|WP_010906138.1|1845150_1845996_+|nitronate-monooxygenase
MTWYHELGIKYPLFQGGMAWASNAELVAAVSNNGALGIIGSGGRTANELRRMIRKTKTLTSQPFGVNLMLLDKNIKQLLEVICEEKISVVTTGAGSPKEIIDTIIANNIKLFPVVPNKEIALKMLNLPISGIIVEGNEAGGHVGSQNLASLLKEIAPICPLPLIAAGGIYDHHTASLANILGANGVQVGTAFLLAKECQISPIYQELICKGEENGTSLISDKNGHLTRLLNISSEYPLNKSLKAAVEKGDLINGAFMAGSSSAYLEKIEPVENIIQRIMKK
>NC_002662.1|WP_004255213.1|1844372_1845128_+|SDR-family-NAD(P)-dependent-oxidoreductase
MEAMNKRTILITGATRGIGWAIAQKAAQANHKVILTGRDPLSLKSRAEELKKKFPKTEIQAIPLDVSNRSSVANAAKLIKDIDILINNAGITADSTFKKMSPEIWDEVISVNLTGVFNSTHALLDKINQGGQIITLTSKSALFGNFGQANYAASKAGIIAFTKTLAKELQKSMIRVNSVSPAAVTDMTLPVLKSLKETYGQNIPDEWKMGSSSDVANFIINDLIESEMTGKIFSINGSEIGYWQEPTFHKL
>NC_002662.1|WP_004255215.1|1844091_1844385_+|hypothetical-protein
MKLYKKINKADLIDYLQSVKDTNSLHYGKNPIIPGNFLLFILEEMYQEFYSMPLSYLKANFCSPAYLNERFCFIFNQNAFQITDRNQTLILKGEWKQ
>NC_002662.1|WP_004255217.1|1843766_1844117_+|hypothetical-protein
MILIAQKSLPRHFKLEGQKNFLSLLPQLWQELEGIPYSLKNGENWLLSEEIIRYPSSNYSFDKLKLYLLSEHITRHSKKYIINLSLEITSNTKLLAQINLSLLSEDSWNEIIQKNQ
>NC_002662.1|WP_010906135.1|1842621_1843770_+|acetyl-CoA-C-acyltransferase
MSFKNPVGIIAANRLPIGKINGFYKKISPETLYQNLIKQQFNKNLLLKKADIDYIILGNVTNQGGNLARRCALKAGFSSQVPAFTIDQQCGSGLTAMISSANYIISGEASVICTGGVESTSQANIVLDSESYQPINRFKMAPEPYEDFDMGTIADMTALKYNIPRSVQDLYALNSHKKATQAIEGKLLENEVFPYQDEGFTISSDQTVRPKSSMEALSKLTPAFTTNGTATAGNSCPINDGASSIILSSTNNPFDFQGYYLGQTTIALSPSDFLLGPIKATEKLLQKFNLKLNDIEAIELNEAFASQAILFQNYFKLDDIKLNAYGGSLAFGHPYGATGGILISRLLNRLNQVQKPCLGIATLCVAGGMGISVLIGNQWYQK
>NC_002662.1|WP_004255221.1|1841390_1842632_+|AMP-binding-protein
MEKNKFNFSKLAALFTDYPALKIGEISYSYQQINDLIQRKLTDYSHSSKTVITLINDSPLNFIIDFLAIIESGNYPLVVDKSFKKKSFKFGLIPEDTLFLASTSGTTGPPKIYYRNWESWKMGFEVCDDLFHLSNSQALATTSPLTTSLGLHTLMCALYLGKTFLTITNPSQFINITENYALFTVPTYLLNNLNELFALTSPEIIFLGGGTLSPEAINKVRKKLPQTQMIEFYGSSETSFISWQAVNEGKKTSSVGKLFPHVELTLGPKYRLTVKSPYLFSGYLNQPYPQSWTTDDLGTLKNNHLYLFGRRSDIIEHGANKIFPEEIERMAKDLCEDCIAFGVFDERYSQKIALLLLKPIEKEKLIKILAQRLPKYKLPQIYLETPTLNFTKNQKISRKELEKEYFRGVYHEL
>NC_002662.1|WP_004255224.1|1840676_1841246_-|biotin-transporter-BioY
MTKNQKVKTLTYSAFMTAFIIILGFLPGIPIGFIPVPIILQNMGIMMAGGLLGPKYGTISVGAFLTLALIGLPVLTGGNGGAASFLGPSGGYRMAWLFTPFLIGFFLKKLQITASKNWIGELIIVLVFGVIFVDLVGAIWLSIQSNIPLITSLISNLVFIPGDCIKAILTVLIVRRLRKEGGFEMYFRK
>NC_002662.1|WP_004255227.1|1839699_1840671_-|biotin--[acetyl-CoA-carboxylase]-ligase
MRTTKQFVLLKLLQQKGNWVSGDELAEELKLSRESIWKAINTLKRKGNQIESRKNLGYKYVGNESLDEDTINFYSGMKFEDKIFVFDEVTSTQELAKQYLSSHEVKQPFIFVANNQTEGHGRRGRNFYSPSDTGLYFSLILPNPSHDILKIGLLTTSTAVAVVKVLEQFYKDKNFQLKWVNDIYLGTYKVGGIITEAALDLESSSAGNFIMGIGLNLSTKDFPADLSEKAQGINPEFKIDRNQLLAEMAKEVINNFANYRQPDLIDEYRKRSLLFGKNVTLKLGTKAVNGKVEGISDDGSLILKAKSGELQTFKSGEVVKVDW
>NC_002662.1|WP_010906134.1|1839377_1839683_-|hypothetical-protein
MREKIWGKVIDEEGRCTHYHQENDIVALKCSDCEKYFSCYHCHDELENHLFRATDKEDFPVLCGHCGKKLNFNDYSRGECIKCSSAFNPNCHRHWQVYFNE
>NC_002662.1|WP_004255197.1|1847782_1848241_-|SUF-system-NifU-family-Fe-S-cluster-assembly-protein
MALSKLDNLYRAVILDHSSNPRHAGELQTGCMVDLNNPTCGDVIRLTVEFENDVISNIAFSGHGCTISTASASMMTVAVLGKTKEEAKELATIFSAMVTGETDERQEKLGDAQFLAGVSKFPARVKCSTLAWNALKKAIDVGEAQETVIHGE
>NC_002662.1|WP_010906139.1|1848356_1848839_-|hypothetical-protein
MLNWVASLPLWLATTFLFVVVFFRAQCTFWLGKLSYHGILKTKWGKKLEKNSETSAGILAIQKMGWPIIPLSFLTVGFQTAVQFGAGLTNWSWYKYTLAAIPGYLAWGFIYASGGLSLFRSLVQGSIGLLILFIIIILAVVIAANLVLRYIRKNGIKTDD
>NC_002662.1|WP_004255189.1|1848840_1850058_-|cysteine-desulfurase
MLEGIKKDFPVLNQIVNDEPLVYLDNAATTQKPLKVLAAIKDYYENDNANVHRGVHTLAERATEKYEAAREKVRQFINAKSTKEVLFTRGTTTSINWVAQFAGQILKTGDEIVISIMEHHSNIVPWQEVAKKTGAILKFVYLKDGQLDMDDLRKKITNQTKFVSIAHVSNVLGTINPVEEITKIAHEHGAYMAVDGAQSTPHMAIDLQKMDVDFFAFSGHKMMGPTGIGVLYGKEELLNQFEPVEFGGEMIDFVYESHSTWTELPWKFEAGTPNIAGAIALGAAIDYIQELGIDQIHQHEIELIDYLMPKLQEIEGLKIYGPKDNVKRGGLIAFNIEGLHPHDVATALDMEGVAVRAGHHCAQPLLNYLETPATARASFYLYNTKADCDKLVEALKKTKEFFNLD
>NC_002662.1|WP_010906140.1|1850057_1851314_-|Fe-S-cluster-assembly-protein-SufD
MNQEILNFSQMHAEPAWLSDLRQKAALEFENLELPNIERVKINRWGLDHLSISENEEIGSVPTFTEIPNHPLLVQVGSQTVMEQMTPNLAEQGVIFTDFNSALTEIPELLEENFGSVVPFNESRLTAANTVTFNSGLVLYVPDGVEVLEPIESILMQEGSSEVPFNKRILIIVGKNAKVDYLERLETSDEQSSKAKANIVVEVIAKAGAQVKFAAIDRLGENVTASVVRRGLIGDNATVDWSVGVMNDGNVVADFDSDLKGNGSHSQIKVVGISTGHQTQGIDTRVTNFGLNSVGHILQNGVILDKGTLTFNAIGHIIKGAKNADAQQSSHVLMLSDKGRGDANPILLIDENEVTAGHAASVGQVDEEDLFYLQSRGLDEETAKRLVIRGFLGSVVSEIPVKSVQAEFIETIERKLGM
>NC_002662.1|WP_004255181.1|1851451_1852222_-|Fe-S-cluster-assembly-ATPase-SufC
MATLEIKNLHVAIEDKEILKGVNLVINTNEIHAIMGPNGTGKSTLSAAIMGNPNYSVTQGEVLFDGQNVLEMSVDERARLGLFLAMQYPSEIPGITNAEFLRAAMNAKRAEDDKVSVMEFIKKLDKNMEVLSMKEEMAERYLNEGFSGGEKKRNEILQLLMLEPTFAILDEIDSGLDIDALKVVAKGVNSMRGEKFGALIITHYQRLLDYITPDVVHIMMDGRVVKTGGAELAKRLETEGYVNIAEELGLEYKEEV
>NC_002662.1|WP_010906141.1|1852396_1853728_-|undecaprenyl/decaprenyl-phosphate-alpha-N-acetylglucosaminyl-1-phosphate-transferase
MVDTLKEIPFALKFLIVIIITFGISVILTPIMTFVSKAIGAVDKPNERRVNKKPMPSAGGLVIFIAFAIATLFILPHIVHNQPPIHSQPPVHGASHQPIQLVSYFSYIWPFIVGAGIVVLTGLIDDIKEISPKMKLLGLTVAASFIWFFTNARFDNLKIPFGGPLLIFPAWLSFIFTVFWILAITNAINLIDGLDGLASGVSIISLTTMGIVSYFFLPSPNVFLPITIFIMVAAIMGFFPYNYHPAIIYLGDTGALFLGFIISVASLQGLKNATAVAVLTPLLILGVPITDTIMAMVRRKLNRQSIATADKRHLHHRLMALGFTHRGAVLVIYGIASIFAFISILLQFSSRIGGILLVIACLFGLEIFIELVGILGENRQPVLKALKFVGNSSYRDKVLHSDEDADIDENEEDIGNHSMIDEEIDEPTQEFPIQNYRRSRNKK
>NC_002662.1|WP_004255173.1|1853730_1854432_-|adaptor-protein-MecA
MKYEDINENTIKITLSFDDLTDYDIKLSDFFGNQEVIEQFFYELVDELGLENRFGNVGMLTFQIQPFPQGVHMIVHEEAMLGEGGEIPDDPEEFEELMTGFYNKLNEIGADMARERGITDFKPGLGLPGTKKDEAEQEPDFIYYSIRYEDIMSVLTGIKNVKFADEESEFYRYDGNFYLVVLDNQKEKGKMHVESTRSRMMEYGEATKMSREFLQEYGECLIATRALDVLRKI
>NC_002662.1|WP_004255171.1|1854561_1855296_-|amino-acid-ABC-transporter-ATP-binding-protein
MNEYLIEIKNLHKYFGKNEVLKGLDIQIKKGEVVVMIGPSGSGKSTFLRTMNLLEKPTDGQVYFEGVNIADKSVDVFKHREKMGMVFQQFNLFPNMTVLENLCLAPVKTGKMTKEEAKKTAEDLLQRVGLSDKAEAYPQALSGGQQQRVAIARALAMNPDVMLFDEPTSALDPEMVGEVLAVMQELAKEGMTMVVVTHEMGFAKTVADRVLFMADGTIVEQGKPAQVFDSPKEKRTQDFLAKVL
>NC_002662.1|WP_004255158.1|1855295_1855982_-|amino-acid-ABC-transporter-permease
MNFDFLPKYLPYFNDGMIVTILISAFVVLIGTLLGIVTALAKISKIAPLRWLANIYIEIFRGTPMLVQIMLGFGLMGSLSLPTFQVGILQQDLGRLIPGIIVISLNSGAYMAEIVRAGIEAVPLGQKEAAYSLGIRPRQAMATVILPQALRNILPAVGNEFVTIIKDSSLLYTIGVMEVFNGAQTVANLTYQTISPMLFVALYYFVVTFVVSRLLVLFEKKLGKGYAK
>NC_002662.1|WP_003130548.1|1856129_1857038_-|diacylglycerol-kinase-family-lipid-kinase
MTYYLLANPNSGAGKGARTLETLIPYLEKNNYEYRLFKTKAAGEEGALVRQILDLKNPDDHLVIIGGDGTISLVINELPEEEAFSYIPSGSGNDFARSLKLKLDPIESFEAARRGINHEIFIMNYQSKGLSGYALNNIGIGLDATIVKSANEGKLKQVLNKLKLGSFSYILTALHVLITKKPFPALIEVENQEISLENAFLMTFTKHPYFGGGVKISPEATNENADIHLVEYNKHHLLRTFSLIPSVLRGMHLKHPLFLHRVSPQFSVELAESQPVQIDGEIHELVAADRLSISTERRMIIY

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_002662_1	1.1\|1417914\|46\|NC_002662\|CRISPRCasFinder	1417914-1417959	46	AF323669	Bacteriophage bIL286, complete genome	39158-39203	0	1.0
NC_002662_1	1.1\|1417914\|46\|NC_002662\|CRISPRCasFinder	1417914-1417959	46	NC_002667	Lactococcus prophage bIL286, complete genome	39158-39203	0	1.0
NC_002662_1	1.1\|1417914\|46\|NC_002662\|CRISPRCasFinder	1417914-1417959	46	MF448566	Lactococcus phage 63302, complete genome	7597-7642	2	0.957

1. spacer 1.1|1417914|46|NC_002662|CRISPRCasFinder matches to AF323669 (Bacteriophage bIL286, complete genome) position: , mismatch: 0, identity: 1.0

tgttgaaacagtcgccgattgattattaacagtatgccgtaaactt	CRISPR spacer
tgttgaaacagtcgccgattgattattaacagtatgccgtaaactt	Protospacer
**********************************************

2. spacer 1.1|1417914|46|NC_002662|CRISPRCasFinder matches to NC_002667 (Lactococcus prophage bIL286, complete genome) position: , mismatch: 0, identity: 1.0

tgttgaaacagtcgccgattgattattaacagtatgccgtaaactt	CRISPR spacer
tgttgaaacagtcgccgattgattattaacagtatgccgtaaactt	Protospacer
**********************************************

3. spacer 1.1|1417914|46|NC_002662|CRISPRCasFinder matches to MF448566 (Lactococcus phage 63302, complete genome) position: , mismatch: 2, identity: 0.957

tgttgaaacagtcgccgattgattattaacagtatgccgtaaactt	CRISPR spacer
tgttgaaacagttgccgattgattattaacagtatgctgtaaactt	Protospacer
************.************************.********

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

13280 : 55047

Lactococcus_phage(82.76%)

tRNA,bacteriocin,terminase,integrase,transposase,protease

attL 34907:34934|attR 49836:49863

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010905029.1\|13280_15272_+\|bacteriocin	bacteriocin-associated integral membrane family protein	NA	NA	NA	NA
WP_010905030.1\|15273_15909_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.9e-24	36.0
WP_010905031.1\|16109_16580_+	AAA family ATPase	A0A097BYE2	Leuconostoc_phage	4.0e-10	30.1
WP_010905032.1\|16597_17164_+\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA
WP_010905033.1\|17164_20650_+	transcription-repair coupling factor	NA	NA	NA	NA
WP_003132169.1\|20809_21280_+	hypothetical protein	NA	NA	NA	NA
WP_003132170.1\|21398_21668_+	RNA-binding S4 domain-containing protein	NA	NA	NA	NA
WP_010905035.1\|21696_22071_+	septum formation initiator family protein	NA	NA	NA	NA
WP_003132172.1\|22070_22394_+	hypothetical protein	NA	NA	NA	NA
WP_010905036.1\|22531_23881_+	serine hydrolase	NA	NA	NA	NA
WP_010905037.1\|23877_25149_+\|tRNA	tRNA lysidine(34) synthetase TilS	NA	NA	NA	NA
WP_010905038.1\|25129_25681_+	hypoxanthine phosphoribosyltransferase	A0A1V0SEQ1	Hokovirus	1.8e-09	29.7
WP_003132177.1\|25886_27974_+\|protease	ATP-dependent zinc metalloprotease FtsH	G8DDJ2	Micromonas_pusilla_virus	5.4e-107	49.2
WP_010905039.1\|30921_32859_+	transcription antiterminator	NA	NA	NA	NA
WP_003132182.1\|32906_33338_+	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_010905040.1\|33475_34633_+	mannitol-1-phosphate 5-dehydrogenase	NA	NA	NA	NA
34907:34934	attL	NA	NA	NA	NA
WP_010905041.1\|35515_35839_-	sigma-70 family RNA polymerase sigma factor	Q9AZI1	Lactococcus_phage	3.8e-52	100.0
WP_010905042.1\|35863_36274_-	RinA family protein	Q9AZI2	Lactococcus_phage	8.0e-71	100.0
WP_010905043.1\|36270_36714_-\|terminase	terminase small subunit	Q9AZI3	Lactococcus_phage	7.3e-62	100.0
WP_010905044.1\|36846_37428_-	hypothetical protein	Q9AZI4	Lactococcus_phage	2.0e-99	100.0
WP_010905045.1\|37663_39292_-	DNA primase	Q9AZI5	Lactococcus_phage	0.0e+00	100.0
WP_010905046.1\|39302_40097_-	bifunctional DNA primase/polymerase	Q9AZI6	Lactococcus_phage	5.4e-156	100.0
WP_010905047.1\|40100_40430_-	hypothetical protein	Q9AZI7	Lactococcus_phage	5.2e-57	100.0
WP_010905048.1\|40416_40611_-	hypothetical protein	Q9AZI8	Lactococcus_phage	2.3e-28	100.0
WP_010905050.1\|40858_41098_-	hypothetical protein	Q9AZJ0	Lactococcus_phage	1.6e-39	100.0
WP_010905051.1\|41140_41422_-	hypothetical protein	Q9AZJ1	Lactococcus_phage	8.5e-48	100.0
WP_010905052.1\|41418_41670_-	helix-turn-helix transcriptional regulator	Q9AZJ2	Lactococcus_phage	1.7e-39	100.0
WP_010905053.1\|41666_42188_-	hypothetical protein	Q9AZJ3	Lactococcus_phage	1.5e-93	100.0
WP_010905054.1\|42191_42386_-	DUF1655 domain-containing protein	Q9AZJ4	Lactococcus_phage	7.9e-29	100.0
WP_010905055.1\|42461_43202_-	Rha family transcriptional regulator	Q9AZJ5	Lactococcus_phage	4.1e-134	100.0
WP_015966790.1\|43230_43428_-	hypothetical protein	Q9AZJ6	Lactococcus_phage	1.3e-26	100.0
WP_003132198.1\|43688_44075_+	helix-turn-helix transcriptional regulator	Q9AZJ7	Lactococcus_phage	7.3e-66	100.0
WP_003132200.1\|44084_44639_+	hypothetical protein	Q9AZJ8	Lactococcus_phage	8.1e-111	100.0
WP_003132204.1\|44749_44980_+	hypothetical protein	Q9AZK0	Lactococcus_phage	3.7e-17	100.0
WP_003132205.1\|45052_45247_+	hypothetical protein	Q9AZK1	Lactococcus_phage	6.0e-29	100.0
WP_010905057.1\|45398_45641_+	hypothetical protein	Q9AZK2	Lactococcus_phage	4.6e-34	100.0
WP_010905058.1\|45776_46001_+	hypothetical protein	Q9AZK3	Lactococcus_phage	4.5e-36	100.0
WP_010905061.1\|47701_47866_+\|bacteriocin	bacteriocin	Q9AZK6	Lactococcus_phage	7.9e-22	100.0
WP_010905062.1\|47987_48293_+\|bacteriocin	bacteriocin immunity protein	Q9AZK7	Lactococcus_phage	8.3e-49	100.0
WP_010905063.1\|48542_49727_+\|integrase	site-specific integrase	Q9AZK8	Lactococcus_phage	1.9e-226	100.0
WP_010905064.1\|50179_50629_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
49836:49863	attR	NA	NA	NA	NA
WP_010905065.1\|50705_50948_+	TM2 domain-containing protein	NA	NA	NA	NA
WP_120784960.1\|53899_55047_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	1.9e-45	40.6

DBSCAN-SWA_2

67263 : 111031

Bacillus_phage(44.44%)

transposase,tRNA,bacteriocin,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010905081.1\|67263_68289_-\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_010905082.1\|68790_69228_+	OsmC family protein	NA	NA	NA	NA
WP_010905083.1\|69388_70702_+	APC family permease	NA	NA	NA	NA
WP_010905084.1\|70761_71112_+	hypothetical protein	NA	NA	NA	NA
WP_010905085.1\|71170_72166_-	phosphate acyltransferase PlsX	NA	NA	NA	NA
WP_010905086.1\|72268_73081_-	HAD family hydrolase	NA	NA	NA	NA
WP_010905087.1\|73206_74844_-	ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	5.3e-49	25.9
WP_010905088.1\|75971_77252_-	O-acetylhomoserine aminocarboxypropyltransferase/cysteine synthase	A0A2I2L687	Orpheovirus	1.4e-09	26.9
WP_010905089.1\|77478_78312_-	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_010905090.1\|78712_79180_+	universal stress protein	NA	NA	NA	NA
WP_010905091.1\|79308_79506_+	DUF4649 domain-containing protein	NA	NA	NA	NA
WP_010905092.1\|79536_80157_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_010905093.1\|80207_81377_+	ring-cleaving dioxygenase	NA	NA	NA	NA
WP_003132255.1\|81387_81978_+	flavin reductase family protein	NA	NA	NA	NA
WP_010905094.1\|82575_84723_+	peptide cleavage/export ABC transporter	W8CYL7	Bacillus_phage	7.2e-38	26.5
WP_010905095.1\|84737_86159_+	HlyD family secretion protein	NA	NA	NA	NA
WP_021214955.1\|86252_86378_+\|bacteriocin	lactococcin family bacteriocin	NA	NA	NA	NA
WP_010905097.1\|87110_87767_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_010905098.1\|87869_88151_-	hypothetical protein	NA	NA	NA	NA
WP_010905099.1\|88160_88313_-	hypothetical protein	NA	NA	NA	NA
WP_165842628.1\|89009_89102_+	hypothetical protein	NA	NA	NA	NA
WP_010905101.1\|89116_89827_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_010905102.1\|90252_90705_+	transporter	NA	NA	NA	NA
WP_088792927.1\|91051_92163_-\|transposase	IS3-like element IS981 family transposase	A0A1P8CWQ3	Bacillus_phage	1.2e-49	41.4
WP_010905104.1\|92199_92805_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_165842620.1\|94318_94621_+	hypothetical protein	NA	NA	NA	NA
WP_003132256.1\|94840_95143_-	hypothetical protein	NA	NA	NA	NA
WP_003132257.1\|95144_95312_-\|bacteriocin	lactococcin family bacteriocin	NA	NA	NA	NA
WP_003132258.1\|95878_96028_-	50S ribosomal protein L33	NA	NA	NA	NA
WP_010905107.1\|96057_96231_-	50S ribosomal protein L32	NA	NA	NA	NA
WP_010905108.1\|96594_98376_+	cadmium-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	3.8e-61	29.1
WP_010905109.1\|98428_99214_-	ParB/RepB/Spo0J family partition protein	NA	NA	NA	NA
WP_010905110.1\|99268_100528_-	replication-associated recombination protein A	A0A127AWE7	Bacillus_phage	3.5e-93	45.4
WP_010905111.1\|100571_101060_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_010905112.1\|101211_101679_+	DUF3013 family protein	NA	NA	NA	NA
WP_010905113.1\|101708_103262_+	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L0W2	Tupanvirus	3.0e-46	28.1
WP_010905114.1\|103392_103677_+	hypothetical protein	NA	NA	NA	NA
WP_010905115.1\|103714_104203_+	YdeI/OmpD-associated family protein	NA	NA	NA	NA
WP_010905116.1\|104220_105174_+	50S ribosomal protein L11 methyltransferase	NA	NA	NA	NA
WP_010905117.1\|105273_106026_+	16S rRNA (uracil(1498)-N(3))-methyltransferase	NA	NA	NA	NA
WP_010905118.1\|106054_107011_+	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_010905119.1\|107211_109434_+	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	U5J9N6	Bacillus_phage	2.9e-13	28.3
WP_003132278.1\|109449_110385_-	glycosyltransferase family 2 protein	V9QJB1	Oenococcus_phage	1.3e-76	49.7
WP_010905120.1\|110575_111031_+\|tRNA	D-tyrosyl-tRNA(Tyr) deacylase	NA	NA	NA	NA

DBSCAN-SWA_3

135965 : 174031

Shigella_phage(40.0%)

transposase,tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010905144.1\|135965_136511_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_010905145.1\|136563_137244_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_095559415.1\|137412_138559_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	2.3e-46	41.0
WP_165842621.1\|138616_139988_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	2.3e-53	42.3
WP_095559415.1\|140044_141192_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	2.3e-46	41.0
WP_003131820.1\|141496_141763_+	IreB family regulatory phosphoprotein	NA	NA	NA	NA
WP_021214669.1\|141762_142194_+	Holliday junction resolvase RuvX	NA	NA	NA	NA
WP_003131822.1\|142346_142670_+	DUF1292 domain-containing protein	NA	NA	NA	NA
WP_003131824.1\|142700_143252_-	DUF1211 domain-containing protein	NA	NA	NA	NA
WP_010905150.1\|143346_144132_-	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_010905151.1\|144151_144397_-	DUF2316 family protein	NA	NA	NA	NA
WP_010905152.1\|144406_145192_-	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_010905153.1\|145303_145849_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_010905154.1\|148002_148323_-	hypothetical protein	NA	NA	NA	NA
WP_010905155.1\|148794_154746_+	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_003129711.1\|155374_156523_-\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	3.2e-85	42.9
WP_010905156.1\|156714_157407_+	DUF975 family protein	NA	NA	NA	NA
WP_010905157.1\|157467_158649_-	MFS transporter	NA	NA	NA	NA
WP_010905158.1\|158829_159267_-	CoA-binding protein	NA	NA	NA	NA
WP_010905159.1\|159401_160193_+	DNA/RNA non-specific endonuclease	NA	NA	NA	NA
WP_010905160.1\|160357_160567_+	hypothetical protein	NA	NA	NA	NA
WP_010905161.1\|160578_160818_+	hypothetical protein	NA	NA	NA	NA
WP_010905162.1\|161013_162597_+	APC family permease	NA	NA	NA	NA
WP_003129721.1\|162665_163880_+	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_003129722.1\|164032_164821_+	GTP-sensing pleiotropic transcriptional regulator CodY	NA	NA	NA	NA
WP_010905163.1\|165329_165635_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC	NA	NA	NA	NA
WP_010905164.1\|165634_167095_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA	NA	NA	NA	NA
WP_010905165.1\|167098_167701_+	NUDIX hydrolase	NA	NA	NA	NA
WP_010905166.1\|167740_169174_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB	NA	NA	NA	NA
WP_010905167.1\|169397_170897_+	amidase	NA	NA	NA	NA
WP_010905168.1\|170978_172319_-	MATE family efflux transporter	NA	NA	NA	NA
WP_003129735.1\|172500_172698_-	cold-shock protein	Q9AZD3	Lactococcus_phage	7.8e-24	81.5
WP_010905169.1\|172815_173349_+	5-formyltetrahydrofolate cyclo-ligase	NA	NA	NA	NA
WP_003129738.1\|173338_174031_+\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA

DBSCAN-SWA_4

395393 : 407524

Streptococcus_phage(40.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003131595.1\|395393_395711_+	thioredoxin family protein	A0A0K2FIM3	Achromobacter_phage	4.5e-05	30.4
WP_003131594.1\|395796_396423_+\|tRNA	DUF4479 and tRNA-binding domain-containing protein	NA	NA	NA	NA
WP_010905313.1\|396585_397926_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_010905314.1\|398015_398405_+	single-stranded DNA-binding protein	A0A0K0MWE1	Streptococcus_phage	1.4e-24	45.0
WP_003131589.1\|398524_398809_+	co-chaperone GroES	A0A221S386	uncultured_virus	3.1e-13	44.1
WP_003131585.1\|398896_400525_+	chaperonin GroEL	A0A219YK78	uncultured_virus	4.9e-156	56.8
WP_003131583.1\|400570_401383_-	MBL fold metallo-hydrolase	A0A0C5AJ83	Bacteriophage	3.1e-34	38.1
WP_010905315.1\|401553_402996_-	cell wall metabolism sensor histidine kinase WalK	W8CYF6	Bacillus_phage	1.4e-32	33.0
WP_003131580.1\|402988_403690_-	response regulator transcription factor	W8CYM9	Bacillus_phage	1.2e-42	39.7
WP_003131575.1\|403867_404503_+	dTMP kinase	M1PSC7	Streptococcus_phage	5.4e-74	65.0
WP_003131573.1\|404635_405496_+	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	5.0e-67	45.2
WP_010905316.1\|405547_406330_+	stage 0 sporulation family protein	NA	NA	NA	NA
WP_010905317.1\|406322_406649_+	DNA replication initiation control protein YabA	NA	NA	NA	NA
WP_010905318.1\|406648_407524_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	8.7e-99	65.4

DBSCAN-SWA_5

444553 : 520485

106

Lactococcus_phage(90.7%)

tRNA,holin,head,tail,terminase,portal,integrase,capsid,protease

attL 502595:502623|attR 517745:517773

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003131526.1\|444553_445000_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE	NA	NA	NA	NA
WP_003131525.1\|444996_445515_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_010905336.1\|445618_447004_+	LCP family protein	NA	NA	NA	NA
WP_010905337.1\|447235_448369_-\|integrase	site-specific integrase	Q9AZR0	Lactococcus_phage	2.8e-214	100.0
WP_010905338.1\|448491_449070_-	SHOCT domain-containing protein	Q9AZQ9	Lactococcus_phage	9.8e-99	100.0
WP_010905339.1\|449153_449990_-	helix-turn-helix domain-containing protein	Q9AZQ8	Lactococcus_phage	6.0e-158	100.0
WP_015966779.1\|450218_450389_+	putative transcriptional regulator	Q9AZQ7	Lactococcus_phage	1.0e-24	100.0
WP_010905341.1\|450420_450654_+	hypothetical protein	Q9AZQ6	Lactococcus_phage	5.0e-38	100.0
WP_010905342.1\|450762_450912_+	hypothetical protein	Q9AZQ5	Lactococcus_phage	9.1e-17	100.0
WP_015966780.1\|451171_451414_+	hypothetical protein	Q77JL3	Lactococcus_phage	5.2e-38	100.0
WP_010905344.1\|451425_452181_+	phage antirepressor KilAC domain-containing protein	Q9AZQ4	Lactococcus_phage	1.1e-139	100.0
WP_010905345.1\|452193_452523_+	DUF771 domain-containing protein	Q9AZQ3	Lactococcus_phage	8.1e-58	100.0
WP_010905346.1\|452523_452694_+	hypothetical protein	A0A1P8BME6	Lactococcus_phage	8.7e-24	100.0
WP_180947906.1\|452725_452911_+	putative transcriptional regulator	Q77NG6	Lactococcus_phage	1.0e-25	95.1
WP_010905348.1\|453009_453816_+	recombinase RecT	Q9AZQ0	Lactococcus_phage	6.2e-144	100.0
WP_010905349.1\|453815_454592_+	PD-(D/E)XK nuclease-like domain-containing protein	Q9AZP9	Lactococcus_phage	2.6e-147	100.0
WP_010905350.1\|454819_455596_+	phage replisome organiser protein	Q9AZP8	Lactococcus_phage	2.0e-131	100.0
WP_010905351.1\|455605_456490_+	ATP-binding protein	Q9AZP7	Lactococcus_phage	1.6e-164	100.0
WP_010905352.1\|456486_456651_+	hypothetical protein	Q9AZP6	Lactococcus_phage	2.5e-23	100.0
WP_015966782.1\|456640_457051_+	hypothetical protein	Q9AZP5	Lactococcus_phage	2.2e-76	100.0
WP_010905354.1\|457158_457323_+	hypothetical protein	Q9AZP4	Lactococcus_phage	4.9e-24	100.0
WP_010905355.1\|457297_457660_+	DUF658 family protein	Q9AZP3	Lactococcus_phage	1.5e-60	100.0
WP_153916742.1\|457666_457810_-	hypothetical protein	NA	NA	NA	NA
WP_010905356.1\|457853_458060_+	DUF1125 domain-containing protein	Q9MC26	Lactococcus_phage	2.6e-30	100.0
WP_010905357.1\|458052_458325_+	hypothetical protein	Q9AYV0	Lactococcus_phage	5.3e-47	100.0
WP_010905358.1\|458321_458876_+	DUF1642 domain-containing protein	Q9AYU5	Lactococcus_phage	1.6e-103	100.0
WP_010905359.1\|458872_459292_+	dUTP diphosphatase	Q9AZP1	Lactococcus_phage	3.0e-73	100.0
WP_010905360.1\|459291_459582_+	hypothetical protein	Q9AZP0	Lactococcus_phage	2.5e-47	100.0
WP_010905361.1\|459578_459743_+	hypothetical protein	Q9AZN9	Lactococcus_phage	4.9e-24	100.0
WP_010905362.1\|459791_459935_+	hypothetical protein	Q9AZN8	Lactococcus_phage	2.1e-18	100.0
WP_010905363.1\|459931_460114_+	DUF1660 domain-containing protein	Q9AZN7	Lactococcus_phage	1.8e-30	100.0
WP_010905365.1\|460295_460481_+	hypothetical protein	Q9AZN6	Lactococcus_phage	1.6e-26	100.0
WP_010905366.1\|460533_460743_-	hypothetical protein	NA	NA	NA	NA
WP_010905367.1\|460955_461249_+	DUF1359 domain-containing protein	Q9AZN4	Lactococcus_phage	9.7e-47	100.0
WP_010905368.1\|461359_461605_+	helix-turn-helix transcriptional regulator	Q9AZN3	Lactococcus_phage	4.5e-37	100.0
WP_010905369.1\|461649_462039_+	DUF1359 domain-containing protein	Q9AZN2	Lactococcus_phage	5.8e-63	100.0
WP_010905370.1\|462040_462439_+	hypothetical protein	Q9AZN1	Lactococcus_phage	2.4e-64	100.0
WP_010905372.1\|462764_463187_+	RinA family protein	Q9AZM9	Lactococcus_phage	8.5e-52	100.0
WP_010905373.1\|463424_463928_+	HNH endonuclease	Q9AZM8	Lactococcus_phage	3.1e-93	100.0
WP_010905374.1\|464044_464497_+\|terminase	phage terminase small subunit P27 family	Q9AZM7	Lactococcus_phage	1.3e-82	100.0
WP_010905375.1\|464496_466311_+\|terminase	terminase large subunit	Q9AZM6	Lactococcus_phage	0.0e+00	99.8
WP_010905376.1\|466319_466484_+	hypothetical protein	Q9AZM5	Lactococcus_phage	1.9e-20	100.0
WP_010905377.1\|466480_467560_+\|portal	phage portal protein	Q9AZM4	Lactococcus_phage	2.4e-199	100.0
WP_010905378.1\|467559_468147_+\|head,protease	HK97 family phage prohead protease	Q9AZM3	Lactococcus_phage	4.4e-107	100.0
WP_010905379.1\|468136_469450_+\|capsid	phage major capsid protein	Q9AZM2	Lactococcus_phage	2.0e-200	100.0
WP_010905380.1\|469460_469766_+	hypothetical protein	Q9AZM1	Lactococcus_phage	4.4e-50	100.0
WP_010905381.1\|469752_470088_+\|head	phage head closure protein	Q9AZM0	Lactococcus_phage	5.9e-56	100.0
WP_010905382.1\|470084_470570_+	HK97 gp10 family phage protein	Q9AZL9	Lactococcus_phage	8.8e-85	100.0
WP_010905383.1\|470566_470962_+	DUF806 family protein	Q9AZL8	Lactococcus_phage	1.4e-67	100.0
WP_010905384.1\|470963_471569_+\|tail	phage tail protein	Q9AZL7	Lactococcus_phage	4.9e-109	100.0
WP_010905385.1\|471628_471973_+\|tail	phage tail assembly chaperone	Q9AZL6	Lactococcus_phage	1.2e-27	100.0
WP_014573136.1\|472020_472161_+	hypothetical protein	NA	NA	NA	NA
WP_021214765.1\|472178_475982_+	tape measure protein	Q9AZL5	Lactococcus_phage	0.0e+00	100.0
WP_010905387.1\|475984_477520_+\|tail	phage tail family protein	Q9AZL3	Lactococcus_phage	4.8e-294	100.0
WP_010905388.1\|477519_481845_+	hypothetical protein	Q9AZL2	Lactococcus_phage	0.0e+00	100.0
WP_010905389.1\|481864_482191_+	hypothetical protein	Q9AZL1	Lactococcus_phage	3.9e-52	100.0
WP_010905390.1\|482177_482465_+\|holin	phage holin	Q9AZL0	Lactococcus_phage	5.6e-47	100.0
WP_010905391.1\|482464_483244_+	C40 family peptidase	Q9AZK9	Lactococcus_phage	2.1e-128	100.0
WP_166409921.1\|483521_483674_+\|holin	bacteriophage holin	A0A059NTA2	Lactococcus_phage	3.1e-20	95.9
WP_003131523.1\|484225_484987_+\|tRNA	tRNA pseudouridine(38-40) synthase TruA	NA	NA	NA	NA
WP_010905393.1\|485019_485808_+	bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase	NA	NA	NA	NA
WP_003131521.1\|485847_486348_+	ECF transporter S component	NA	NA	NA	NA
WP_010905395.1\|486328_486871_+	TIGR01440 family protein	NA	NA	NA	NA
WP_003131519.1\|486871_488008_+	alanine--glyoxylate aminotransferase family protein	NA	NA	NA	NA
WP_003131516.1\|488242_489850_+	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	1.0e-129	44.5
WP_003131512.1\|490933_491806_-	DUF1003 domain-containing protein	NA	NA	NA	NA
WP_003131510.1\|492153_492336_-	YjzD family protein	NA	NA	NA	NA
WP_010905396.1\|492451_492931_-	nucleoside 2-deoxyribosyltransferase	A0A1D3SPR3	Enterococcus_phage	6.5e-32	47.4
WP_010905397.1\|492914_493337_-	LOG family protein	A0A1D3SNB7	Enterococcus_phage	2.2e-15	41.4
WP_010905398.1\|493468_494122_-	deoxynucleoside kinase	C1KFI3	Lactobacillus_virus	6.6e-51	45.9
WP_003131504.1\|494601_497784_+	DNA polymerase III subunit alpha	A0A2L1IZ23	Streptomyces_phage	1.1e-122	29.2
WP_003131502.1\|497814_498468_-	hemolysin III family protein	NA	NA	NA	NA
WP_014570388.1\|498669_499506_+	DegV family protein	NA	NA	NA	NA
WP_003131499.1\|499498_500359_+	SGNH/GDSL hydrolase family protein	NA	NA	NA	NA
WP_010905400.1\|500355_501567_+	glycoside hydrolase family 3 protein	NA	NA	NA	NA
WP_010905401.1\|501576_502233_+	YpmS family protein	NA	NA	NA	NA
WP_010905402.1\|502337_502613_+	HU family DNA-binding protein	A7KV42	Bacillus_phage	1.6e-22	67.4
502595:502623	attL	NA	NA	NA	NA
WP_010905403.1\|502722_503871_-\|integrase	site-specific integrase	Q9AZF9	Lactococcus_phage	1.4e-210	100.0
WP_010905404.1\|503994_504486_-	hypothetical protein	Q9AZF8	Lactococcus_phage	3.7e-83	100.0
WP_003131491.1\|504539_504836_-	hypothetical protein	Q9AZF7	Lactococcus_phage	3.3e-50	100.0
WP_003131490.1\|504882_505470_-	hypothetical protein	Q9AZF6	Lactococcus_phage	3.6e-109	100.0
WP_003131489.1\|505481_505850_-	XRE family transcriptional regulator	Q9AZF5	Lactococcus_phage	1.8e-66	100.0
WP_003131488.1\|506143_506335_+	hypothetical protein	Q9AZF4	Lactococcus_phage	8.6e-28	100.0
WP_010905405.1\|506350_506611_+	excisionase	Q9AZF3	Lactococcus_phage	8.6e-47	100.0
WP_010905406.1\|506769_506964_+	DUF1655 domain-containing protein	Q9AZF2	Lactococcus_phage	1.0e-28	100.0
WP_010905407.1\|506968_507394_+	hypothetical protein	Q9AZF1	Lactococcus_phage	2.6e-77	100.0
WP_010905408.1\|507428_507668_+	hypothetical protein	Q9AZF0	Lactococcus_phage	3.6e-39	100.0
WP_010905409.1\|507664_507919_+	hypothetical protein	Q9AZE9	Lactococcus_phage	3.7e-42	100.0
WP_003131482.1\|507915_508110_+	hypothetical protein	Q9AZE8	Lactococcus_phage	2.3e-28	100.0
WP_010905410.1\|508096_508423_+	HTH domain-containing protein	Q9AZE7	Lactococcus_phage	1.1e-54	100.0
WP_010905411.1\|508430_509009_+	hypothetical protein	Q9AZE6	Lactococcus_phage	1.2e-91	100.0
WP_010905412.1\|509001_510444_+	hypothetical protein	Q9AZE5	Lactococcus_phage	1.6e-278	100.0
WP_010905413.1\|510595_511180_+	hypothetical protein	Q9AZE4	Lactococcus_phage	2.9e-106	100.0
WP_010905414.1\|511356_511542_+	hypothetical protein	Q9AZE3	Lactococcus_phage	7.0e-27	100.0
WP_010905415.1\|511568_512177_+	hypothetical protein	Q9AZE2	Lactococcus_phage	1.2e-102	100.0
WP_010905416.1\|512185_512776_+\|head,protease	HK97 family phage prohead protease	Q9AZE1	Lactococcus_phage	9.0e-108	100.0
WP_010905417.1\|512991_513321_+	hypothetical protein	Q9AZE0	Lactococcus_phage	9.3e-54	100.0
WP_010905418.1\|513421_513742_+	sigma-70 family RNA polymerase sigma factor	Q9AZD9	Lactococcus_phage	3.8e-52	100.0
WP_010905420.1\|514454_514676_+	hypothetical protein	Q9AZD7	Lactococcus_phage	3.0e-32	100.0
WP_010905421.1\|514844_515333_+	DUF4065 domain-containing protein	Q9AZD6	Lactococcus_phage	5.0e-88	100.0
WP_010905422.1\|515298_515865_+	hypothetical protein	Q9AZD5	Lactococcus_phage	4.6e-101	100.0
WP_010905424.1\|517113_517314_+	cold-shock protein	Q9AZD3	Lactococcus_phage	6.7e-31	100.0
WP_003131761.1\|517854_518352_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
517745:517773	attR	NA	NA	NA	NA
WP_010905425.1\|518498_519008_+	methylated-DNA--[protein]-cysteine S-methyltransferase	M1PFU9	Streptococcus_phage	4.3e-26	42.1
WP_003131759.1\|519021_519582_+	methylphosphotriester-DNA--protein-cysteine methyltransferase family protein	NA	NA	NA	NA
WP_010905426.1\|519675_520485_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	2.2e-19	36.7

DBSCAN-SWA_6

614998 : 672973

Bacillus_phage(25.0%)

tRNA,integrase,protease,transposase

attL 634322:634381|attR 651790:651901

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003129541.1\|614998_615883_+\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
WP_003129542.1\|615965_616634_+	hypothetical protein	NA	NA	NA	NA
WP_003129543.1\|616804_617701_+	SPFH domain-containing protein	A0A1V0SL90	Klosneuvirus	1.8e-35	34.8
WP_003129544.1\|618075_618336_+	membrane protein	NA	NA	NA	NA
WP_003129545.1\|618693_619617_+	ribonuclease Z	NA	NA	NA	NA
WP_010905467.1\|619609_620311_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_010905468.1\|620477_622706_+	single-stranded-DNA-specific exonuclease RecJ	A7KV88	Bacillus_phage	1.3e-79	30.4
WP_012897343.1\|622828_623341_+	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	9.1e-32	44.0
WP_003129551.1\|623556_624120_+	DNA-directed RNA polymerase subunit delta	NA	NA	NA	NA
WP_010905469.1\|624256_625909_+	endolytic transglycosylase MltG	NA	NA	NA	NA
WP_025016857.1\|625968_626442_+	transcription elongation factor GreA	NA	NA	NA	NA
WP_101928132.1\|626560_627708_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	2.3e-46	41.0
WP_120784970.1\|627781_629154_-\|transposase	IS3-like element ISLla3 family transposase	A0A1B1P773	Bacillus_phage	3.0e-53	43.1
WP_010905471.1\|629353_629809_+	CtsR family transcriptional regulator	NA	NA	NA	NA
WP_010905472.1\|629798_632249_+\|protease	ATP-dependent Clp protease ATP-binding subunit	A0A223W0B1	Agrobacterium_phage	5.7e-124	34.0
WP_003129564.1\|632383_632941_+	ribosome-associated translation inhibitor RaiA	NA	NA	NA	NA
WP_010905473.1\|633125_634427_+	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	4.0e-217	87.6
634322:634381	attL	NA	NA	NA	NA
WP_031297127.1\|634514_635450_+\|integrase	tyrosine-type recombinase/integrase	A0A142F1N9	Bacillus_phage	4.0e-25	27.5
WP_010905475.1\|635722_636490_+	hypothetical protein	NA	NA	NA	NA
WP_010905476.1\|637077_637218_+	hypothetical protein	NA	NA	NA	NA
WP_010905477.1\|637533_637716_+	hypothetical protein	NA	NA	NA	NA
WP_010905478.1\|637737_638907_+	hypothetical protein	V9VGE4	Lactococcus_phage	1.1e-37	40.4
WP_010905479.1\|640779_643767_+	type I restriction endonuclease subunit R	A0A220A398	Liberibacter_phage	5.5e-20	26.4
WP_010905480.1\|643806_645354_+	type I restriction-modification system subunit M	A0A2H4PQP4	Staphylococcus_phage	1.4e-99	39.1
WP_010905481.1\|645350_646574_+	restriction endonuclease subunit S	A0A2H4PQP5	Staphylococcus_phage	1.6e-34	30.7
WP_161940567.1\|646778_647777_+	hypothetical protein	NA	NA	NA	NA
WP_010905484.1\|647938_648208_+	hypothetical protein	NA	NA	NA	NA
WP_021211383.1\|648509_648710_+	hypothetical protein	NA	NA	NA	NA
WP_010905486.1\|648975_649746_+	hypothetical protein	NA	NA	NA	NA
WP_123174237.1\|650156_651268_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	4.2e-50	41.1
WP_010905491.1\|652009_652681_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.6e-28	36.0
651790:651901	attR	NA	NA	NA	NA
WP_003129569.1\|652683_653757_-	ABC transporter permease	NA	NA	NA	NA
WP_010905492.1\|653768_654338_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_010905493.1\|654525_656049_-	acyl-CoA synthetase	NA	NA	NA	NA
WP_010905494.1\|656293_657157_+	magnesium transporter CorA family protein	NA	NA	NA	NA
WP_003129579.1\|657417_659781_+	formate C-acetyltransferase	A0A2P0VNR5	Tetraselmis_virus	9.5e-108	32.0
WP_010905495.1\|659912_660572_+	dephospho-CoA kinase	NA	NA	NA	NA
WP_010905496.1\|660574_661792_+	multidrug efflux MFS transporter	NA	NA	NA	NA
WP_003129585.1\|661788_661935_+	50S ribosomal protein L33	NA	NA	NA	NA
WP_010905497.1\|662275_663538_+	FtsW/RodA/SpoVE family cell cycle protein	NA	NA	NA	NA
WP_010905498.1\|663643_667057_+	pyruvate carboxylase	NA	NA	NA	NA
WP_123174238.1\|667180_668506_+	citrate/2-methylcitrate synthase	NA	NA	NA	NA
WP_010905500.1\|668502_671049_+	aconitate hydratase AcnA	NA	NA	NA	NA
WP_010905501.1\|671069_672308_+	NADP-dependent isocitrate dehydrogenase	NA	NA	NA	NA
WP_003129593.1\|672373_672973_-\|protease	ATP-dependent Clp protease proteolytic subunit	A0A223W000	Agrobacterium_phage	2.1e-51	52.0

DBSCAN-SWA_7

999585 : 1013369

Enterococcus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003130964.1\|999585_1000278_+	cell division ATP-binding protein FtsE	G9BWD6	Planktothrix_phage	2.7e-31	34.4
WP_010905664.1\|1000270_1001206_+	ABC transporter permease	NA	NA	NA	NA
WP_003130966.1\|1001307_1002285_-	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A096XT60	Enterococcus_phage	2.4e-118	66.2
WP_003130967.1\|1002634_1004803_-	class 1b ribonucleoside-diphosphate reductase subunit alpha	A8E2R1	Enterococcus_phage	3.0e-257	61.1
WP_003130968.1\|1004938_1005361_-	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	A0A142F1R4	Bacillus_phage	2.3e-12	37.3
WP_012897612.1\|1005362_1005581_-	redoxin NrdH	C3U2K9	Lactococcus_phage	7.6e-12	47.6
WP_010905665.1\|1005754_1006396_-	glycerol-3-phosphate 1-O-acyltransferase PlsY	NA	NA	NA	NA
WP_010905666.1\|1006670_1008605_+	DNA topoisomerase IV subunit B	G3M9Z3	Bacillus_virus	1.6e-124	43.2
WP_003130976.1\|1009340_1010174_+	3'-5' exonuclease	A0A0K2SUJ2	Clostridium_phage	3.1e-21	39.4
WP_003130977.1\|1010170_1010620_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_003130980.1\|1010894_1013369_+	DNA topoisomerase IV subunit A	G3M9Z5	Bacillus_virus	4.2e-98	32.2

DBSCAN-SWA_8

1022027 : 1075411

Lactococcus_phage(85.07%)

holin,head,tail,terminase,integrase,portal,capsid,protease

attL 1027637:1027653|attR 1072824:1072840

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010905672.1\|1022027_1023116_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A1V0SE20	Indivirus	8.4e-51	38.8
WP_003130990.1\|1023115_1023766_+	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	1.2e-41	43.6
WP_010905673.1\|1023774_1024971_+	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	1.3e-110	51.0
WP_010905674.1\|1024998_1025463_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	5.3e-39	53.0
WP_003130994.1\|1025565_1026018_+	lipoprotein signal peptidase	NA	NA	NA	NA
WP_003130995.1\|1026078_1026984_+	RluA family pseudouridine synthase	A0A2H4UV25	Bodo_saltans_virus	5.4e-11	28.2
WP_003130996.1\|1027130_1027574_+	divergent PAP2 family protein	NA	NA	NA	NA
1027637:1027653	attL	NA	NA	NA	NA
WP_010905675.1\|1027713_1029315_+	glycosyltransferase family 39 protein	NA	NA	NA	NA
WP_010905676.1\|1029338_1030295_+	glycosyltransferase family 2 protein	I1TED8	Salmonella_phage	3.1e-49	37.5
WP_003131888.1\|1030420_1031107_+	response regulator transcription factor	W8CYM9	Bacillus_phage	5.5e-32	33.6
WP_003131889.1\|1031126_1031642_+	DUF2127 domain-containing protein	NA	NA	NA	NA
WP_003131891.1\|1031645_1032971_+	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	3.4e-22	27.5
WP_010905677.1\|1032977_1033634_+	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_010905678.1\|1033814_1035632_+	glutamine--fructose-6-phosphate transaminase (isomerizing)	M1HVL7	Paramecium_bursaria_Chlorella_virus	3.5e-94	37.0
WP_003131898.1\|1035762_1036443_+	DNA repair protein RadC	NA	NA	NA	NA
WP_010905679.1\|1036641_1037766_-\|integrase	site-specific integrase	Q9B016	Lactococcus_phage	1.0e-213	100.0
WP_010905680.1\|1037888_1038434_-	PH domain-containing protein	Q9B015	Lactococcus_phage	8.9e-94	100.0
WP_010905681.1\|1038490_1038928_-	ImmA/IrrE family metallo-endopeptidase	Q9B014	Lactococcus_phage	1.1e-81	100.0
WP_010905682.1\|1038924_1039467_-	helix-turn-helix domain-containing protein	Q9B013	Lactococcus_phage	3.1e-91	100.0
WP_010905683.1\|1039634_1039853_+	DUF739 family protein	O48504	Lactococcus_phage	2.9e-35	100.0
WP_010905684.1\|1039889_1040633_+	ORF6C domain-containing protein	Q9B012	Lactococcus_phage	2.1e-138	100.0
WP_003131910.1\|1040645_1040981_+	DUF771 domain-containing protein	Q38331	Lactococcus_phage	1.3e-58	100.0
WP_010905685.1\|1041118_1041313_+	hypothetical protein	Q77JL6	Lactococcus_phage	3.0e-28	100.0
WP_010905686.1\|1041309_1041585_-	hypothetical protein	Q9AYU7	Lactococcus_phage	1.6e-46	100.0
WP_010905687.1\|1041687_1041903_+	DUF1408 domain-containing protein	Q38272	Lactococcus_phage	2.4e-34	100.0
WP_010905688.1\|1042018_1042537_+	host-nuclease inhibitor Gam family protein	Q9XJE3	Lactococcus_phage	6.3e-89	100.0
WP_010905689.1\|1042545_1043169_+	DUF1071 domain-containing protein	Q9B009	Lactococcus_phage	1.9e-116	100.0
WP_010905690.1\|1043168_1043621_+	single-stranded DNA-binding protein	Q9B008	Lactococcus_phage	4.6e-80	100.0
WP_015966758.1\|1043745_1044528_+	phage replisome organiser protein	A5GYR3	Lactococcus_phage	3.7e-125	100.0
WP_010905692.1\|1044527_1045253_+	hypothetical protein	Q9XJE7	Lactococcus_phage	5.3e-134	99.6
WP_002819817.1\|1045249_1045639_+	RusA family crossover junction endodeoxyribonuclease	R9QLL1	Lactococcus_phage	3.2e-69	100.0
WP_010905693.1\|1045641_1045836_+	hypothetical protein	Q9B005	Lactococcus_phage	6.7e-28	100.0
WP_031297271.1\|1045828_1046068_+	DUF1031 family protein	Q9B004	Lactococcus_phage	1.1e-37	98.7
WP_010905695.1\|1046179_1046446_+	hypothetical protein	Q9B003	Lactococcus_phage	6.3e-45	100.0
WP_010905696.1\|1046467_1046647_+	DUF1497 domain-containing protein	Q9AYU3	Lactococcus_phage	9.2e-24	100.0
WP_010905697.1\|1046636_1047206_+	DUF658 family protein	Q9B002	Lactococcus_phage	2.8e-90	100.0
WP_153916742.1\|1047212_1047356_-	hypothetical protein	NA	NA	NA	NA
WP_010905356.1\|1047399_1047606_+	DUF1125 domain-containing protein	Q9MC26	Lactococcus_phage	2.6e-30	100.0
WP_010905357.1\|1047598_1047871_+	hypothetical protein	Q9AYV0	Lactococcus_phage	5.3e-47	100.0
WP_010905358.1\|1047867_1048422_+	DUF1642 domain-containing protein	Q9AYU5	Lactococcus_phage	1.6e-103	100.0
WP_010905698.1\|1048418_1048838_+	dUTP diphosphatase	Q9B001	Lactococcus_phage	5.1e-73	100.0
WP_010905699.1\|1048840_1049338_+	hypothetical protein	Q9B000	Lactococcus_phage	2.2e-91	100.0
WP_010905700.1\|1049327_1049675_+	hypothetical protein	Q9AZZ9	Lactococcus_phage	4.5e-59	100.0
WP_010905701.1\|1049696_1049861_+	hypothetical protein	Q9AZZ8	Lactococcus_phage	4.9e-24	100.0
WP_010905702.1\|1049907_1050093_+	hypothetical protein	Q9AZZ7	Lactococcus_phage	2.4e-27	100.0
WP_010905703.1\|1050134_1050308_+	DUF1660 domain-containing protein	Q9AZZ6	Lactococcus_phage	1.9e-29	100.0
WP_010905704.1\|1050308_1050608_+	hypothetical protein	Q9AZZ5	Lactococcus_phage	4.8e-49	100.0
WP_010905705.1\|1050604_1050787_+	hypothetical protein	Q9AZZ4	Lactococcus_phage	4.3e-29	100.0
WP_010905707.1\|1051150_1051444_+	DUF1359 domain-containing protein	Q9AZZ2	Lactococcus_phage	4.4e-47	100.0
WP_010905708.1\|1051521_1051923_+	RinA family protein	Q9AZZ1	Lactococcus_phage	5.6e-69	100.0
WP_010905709.1\|1052033_1052486_+	HNH endonuclease	Q9AZZ0	Lactococcus_phage	2.7e-88	100.0
WP_010905710.1\|1052577_1052946_+\|terminase	P27 family phage terminase small subunit	Q9AZY9	Lactococcus_phage	1.8e-61	100.0
WP_010905711.1\|1052929_1054708_+\|terminase	terminase large subunit	Q9AZY8	Lactococcus_phage	0.0e+00	100.0
WP_161908439.1\|1054802_1055927_+\|portal	phage portal protein	Q9AZY7	Lactococcus_phage	8.8e-213	100.0
WP_010905713.1\|1055941_1056538_+\|head,protease	HK97 family phage prohead protease	Q9AZY6	Lactococcus_phage	5.5e-105	100.0
WP_010905714.1\|1056509_1057703_+\|capsid	phage major capsid protein	Q9AZY5	Lactococcus_phage	3.6e-172	100.0
WP_010905715.1\|1057757_1058615_+	hypothetical protein	Q9AZY4	Lactococcus_phage	1.1e-167	100.0
WP_010905716.1\|1058607_1058889_+	hypothetical protein	Q9AZY3	Lactococcus_phage	6.7e-45	100.0
WP_010905717.1\|1058875_1059193_+\|head	phage head closure protein	Q9AZY2	Lactococcus_phage	4.6e-50	99.0
WP_010905718.1\|1059182_1059554_+	hypothetical protein	Q9AZY1	Lactococcus_phage	2.5e-63	100.0
WP_010905719.1\|1059550_1059868_+	hypothetical protein	Q9AZY0	Lactococcus_phage	7.5e-53	100.0
WP_010905720.1\|1059885_1060494_+\|tail	phage tail protein	Q9AZX9	Lactococcus_phage	3.3e-105	100.0
WP_010905721.1\|1060503_1060863_+	hypothetical protein	Q9AZX8	Lactococcus_phage	2.7e-62	100.0
WP_010905723.1\|1061079_1063341_+\|tail	phage tail tape measure protein	Q9AZX7	Lactococcus_phage	0.0e+00	100.0
WP_010905724.1\|1063341_1064091_+	hypothetical protein	Q9AZX6	Lactococcus_phage	1.5e-144	99.6
WP_010905725.1\|1064087_1066772_+	peptidoglycan DD-metalloendopeptidase family protein	Q9AZX5	Lactococcus_phage	0.0e+00	100.0
WP_010905726.1\|1066784_1068386_+	DUF2479 domain-containing protein	Q9AZX4	Lactococcus_phage	0.0e+00	100.0
WP_010905727.1\|1068378_1069209_+	hypothetical protein	Q9AZX3	Lactococcus_phage	3.1e-154	100.0
WP_010905729.1\|1069661_1070000_+	hypothetical protein	Q9AZX1	Lactococcus_phage	1.3e-55	100.0
WP_010905730.1\|1070001_1070229_+	hypothetical protein	Q9AZX0	Lactococcus_phage	1.6e-33	100.0
WP_010905731.1\|1070254_1070479_+	hemolysin XhlA family protein	Q9AZW9	Lactococcus_phage	1.0e-32	100.0
WP_010905732.1\|1070491_1070779_+\|holin	phage holin	Q9AZW8	Lactococcus_phage	9.5e-47	100.0
WP_010905733.1\|1070778_1071558_+	C40 family peptidase	Q9AZW7	Lactococcus_phage	5.5e-129	100.0
WP_003132739.1\|1072933_1073326_+	transcriptional regulator Spx	NA	NA	NA	NA
1072824:1072840	attR	NA	NA	NA	NA
WP_010905735.1\|1073503_1075411_+	ABC-F type ribosomal protection protein	A0A2K9L3Z8	Tupanvirus	1.6e-49	28.9

DBSCAN-SWA_9

1375966 : 1460426

Lactococcus_phage(89.06%)

plate,holin,head,tail,lysis,terminase,capsid,portal,integrase,transposase,protease

attL 1415289:1415348|attR 1457044:1457116

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010905895.1\|1375966_1376593_-\|lysis	5-bromo-4-chloroindolyl phosphate hydrolysis family protein	NA	NA	NA	NA
WP_003131086.1\|1376784_1377810_+	NAD(P)H-dependent glycerol-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_010905896.1\|1377853_1378795_+	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	4.8e-79	51.9
WP_003131088.1\|1378865_1379273_+	NusG domain II-containing protein	NA	NA	NA	NA
WP_003131089.1\|1379269_1379800_+	Gx transporter family protein	NA	NA	NA	NA
WP_003131090.1\|1379790_1380750_+	polyprenyl synthetase family protein	NA	NA	NA	NA
WP_003131091.1\|1380746_1381463_+	16S rRNA (guanine(527)-N(7))-methyltransferase RsmG	NA	NA	NA	NA
WP_003131093.1\|1381945_1382659_-	orotidine-5'-phosphate decarboxylase	NA	NA	NA	NA
WP_010905897.1\|1382808_1383744_-	dihydroorotate dehydrogenase	NA	NA	NA	NA
WP_003131096.1\|1383816_1384605_-	dihydroorotate dehydrogenase electron transfer subunit	NA	NA	NA	NA
WP_010905898.1\|1385071_1386436_-	MFS transporter	NA	NA	NA	NA
WP_003132414.1\|1386812_1388024_+	SPFH domain-containing protein	NA	NA	NA	NA
WP_003132415.1\|1388183_1389323_+	hypothetical protein	NA	NA	NA	NA
WP_003132416.1\|1389319_1390105_+	YgcG family protein	NA	NA	NA	NA
WP_031296465.1\|1390134_1390671_-	rRNA large subunit pseudouridine synthase E	NA	NA	NA	NA
WP_010905901.1\|1392251_1393064_-	WxL domain-containing protein	NA	NA	NA	NA
WP_003132422.1\|1393038_1393383_-	hypothetical protein	NA	NA	NA	NA
WP_003132423.1\|1393429_1394434_-	DUF916 domain-containing protein	NA	NA	NA	NA
WP_003130410.1\|1395696_1396644_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	3.4e-32	33.0
WP_010905904.1\|1397061_1397496_-	hypothetical protein	NA	NA	NA	NA
WP_010905905.1\|1397508_1398090_-	hypothetical protein	NA	NA	NA	NA
WP_010905906.1\|1398286_1401481_-	carbamoyl-phosphate synthase large subunit	NA	NA	NA	NA
WP_010905907.1\|1401792_1402266_-	glutathione peroxidase	NA	NA	NA	NA
WP_010905908.1\|1402448_1403078_+	glycoside hydrolase family 73 protein	A0A0K2CP65	Brevibacillus_phage	1.5e-28	46.3
WP_010905909.1\|1403119_1405756_-	cation-translocating P-type ATPase	A0A1J0FA34	Only_Syngen_Nebraska_virus	4.5e-90	30.8
WP_023189145.1\|1406013_1406736_-	epoxyqueuosine reductase QueH	NA	NA	NA	NA
WP_010905910.1\|1406956_1407526_-	hypothetical protein	NA	NA	NA	NA
WP_003132438.1\|1407666_1408482_-	hypothetical protein	NA	NA	NA	NA
WP_003130487.1\|1409730_1410489_+	pilus protein	NA	NA	NA	NA
WP_003130485.1\|1410554_1410908_-	DUF1304 domain-containing protein	NA	NA	NA	NA
WP_003130484.1\|1411004_1411433_-	universal stress protein	NA	NA	NA	NA
WP_003130483.1\|1411552_1411714_-	hypothetical protein	NA	NA	NA	NA
WP_003130481.1\|1411743_1412145_-	arsenate reductase (thioredoxin)	A0A2H4PQT9	Staphylococcus_phage	2.4e-27	48.8
WP_010905913.1\|1414111_1414642_-	hypothetical protein	NA	NA	NA	NA
1415289:1415348	attL	NA	NA	NA	NA
WP_010905917.1\|1416047_1416827_-	C40 family peptidase	Q9AZR1	Lactococcus_phage	6.1e-128	100.0
WP_010905918.1\|1416826_1417126_-\|holin	phage holin	Q9AZR2	Lactococcus_phage	1.3e-46	100.0
WP_010905919.1\|1417151_1418714_-\|plate	BppU family phage baseplate upper protein	Q9AZR3	Lactococcus_phage	4.0e-256	100.0
WP_010905920.1\|1418725_1418950_-	hemolysin XhlA family protein	Q9AZR4	Lactococcus_phage	6.1e-33	100.0
WP_010905921.1\|1418969_1421402_-	hypothetical protein	Q9AZR5	Lactococcus_phage	0.0e+00	100.0
WP_010905922.1\|1421379_1421553_-	hypothetical protein	Q9AZR6	Lactococcus_phage	8.0e-25	100.0
WP_010905923.1\|1421552_1422674_-	hypothetical protein	Q9AZR7	Lactococcus_phage	4.8e-195	100.0
WP_010905924.1\|1422689_1424477_-\|tail	phage tail protein	Q9AZR8	Lactococcus_phage	0.0e+00	100.0
WP_010905925.1\|1424476_1426012_-\|tail	phage tail family protein	Q9AZR9	Lactococcus_phage	2.1e-294	100.0
WP_010905926.1\|1426014_1430937_-\|tail	phage tail tape measure protein	Q9AZS0	Lactococcus_phage	0.0e+00	100.0
WP_010905927.1\|1431161_1431581_-\|tail	phage tail assembly chaperone	Q9AZS1	Lactococcus_phage	1.9e-67	100.0
WP_010905928.1\|1431725_1432319_-\|tail	phage tail protein	Q9AZS2	Lactococcus_phage	3.8e-106	100.0
WP_010905929.1\|1432349_1432745_-	DUF806 family protein	Q9AZS3	Lactococcus_phage	3.9e-67	100.0
WP_010905930.1\|1432741_1433248_-	HK97 gp10 family phage protein	Q9AZS4	Lactococcus_phage	3.6e-89	100.0
WP_010905931.1\|1433249_1433600_-\|head	phage head closure protein	Q9AZS5	Lactococcus_phage	2.5e-57	100.0
WP_010905932.1\|1433574_1433898_-\|head,tail	phage gp6-like head-tail connector protein	Q9AZS6	Lactococcus_phage	6.3e-55	100.0
WP_010905933.1\|1433913_1435140_-\|capsid	phage major capsid protein	Q9AZS7	Lactococcus_phage	4.6e-223	99.8
WP_010905934.1\|1435151_1435859_-\|protease	Clp protease ClpP	Q9AZS8	Lactococcus_phage	1.4e-120	100.0
WP_010905935.1\|1435901_1437080_-\|portal	phage portal protein	Q77P35	Lactococcus_phage	3.1e-224	100.0
WP_010905936.1\|1437076_1437286_-	DUF1056 family protein	Q9AZT0	Lactococcus_phage	3.8e-29	100.0
WP_164752717.1\|1437254_1439225_-\|terminase	terminase large subunit	Q9AZT1	Lactococcus_phage	0.0e+00	100.0
WP_010905938.1\|1439214_1439688_-\|terminase	phage terminase small subunit P27 family	Q9AZT2	Lactococcus_phage	5.9e-86	100.0
WP_010905939.1\|1439816_1440332_-	HNH endonuclease	Q9AZT3	Lactococcus_phage	2.3e-99	100.0
WP_015966776.1\|1440333_1440555_-	hypothetical protein	Q9AZT4	Lactococcus_phage	9.9e-36	100.0
WP_010905941.1\|1440786_1441209_-	RinA family protein	Q9AZT6	Lactococcus_phage	1.5e-51	100.0
WP_010905942.1\|1441286_1441646_-	hypothetical protein	Q9AZT7	Lactococcus_phage	1.3e-56	100.0
WP_010905945.1\|1442106_1442301_-	DUF1660 domain-containing protein	Q9AZT9	Lactococcus_phage	5.6e-35	100.0
WP_010905946.1\|1442297_1442441_-	hypothetical protein	A0A1P8BMD9	Lactococcus_phage	2.1e-18	100.0
WP_010905947.1\|1442459_1442795_-	DUF1140 family protein	Q9AZU1	Lactococcus_phage	5.9e-56	99.1
WP_010905948.1\|1442816_1443161_-	hypothetical protein	Q9AZU2	Lactococcus_phage	1.4e-60	99.1
WP_010905949.1\|1443164_1443584_-	dUTP diphosphatase	Q9AZU3	Lactococcus_phage	2.3e-73	100.0
WP_010905950.1\|1443580_1443868_-	hypothetical protein	Q9AZU4	Lactococcus_phage	2.9e-51	100.0
WP_015966771.1\|1443864_1444500_-	DUF1642 domain-containing protein	Q9AZU5	Lactococcus_phage	3.8e-120	100.0
WP_010905952.1\|1444492_1444852_-	hypothetical protein	Q9AZU6	Lactococcus_phage	8.2e-64	100.0
WP_010905953.1\|1444860_1445370_-	hypothetical protein	Q9AZU7	Lactococcus_phage	1.1e-26	100.0
WP_010905954.1\|1445384_1445957_-	DUF658 family protein	Q9AZU8	Lactococcus_phage	8.7e-92	100.0
WP_010905696.1\|1445946_1446126_-	DUF1497 domain-containing protein	Q9AYU3	Lactococcus_phage	9.2e-24	100.0
WP_010905955.1\|1446147_1446438_-	hypothetical protein	Q9AZU9	Lactococcus_phage	1.2e-49	100.0
WP_010905956.1\|1446549_1446789_-	DUF1031 family protein	Q9AZV0	Lactococcus_phage	2.3e-38	100.0
WP_010905957.1\|1446781_1447276_-	hypothetical protein	Q9AZV1	Lactococcus_phage	5.2e-93	100.0
WP_010905958.1\|1447272_1447647_-	DUF1064 domain-containing protein	Q9AZV2	Lactococcus_phage	9.5e-63	100.0
WP_010905959.1\|1447627_1447801_-	hypothetical protein	Q9AZV3	Lactococcus_phage	4.7e-25	100.0
WP_010905960.1\|1447797_1448682_-	ATP-binding protein	A0A059NT94	Lactococcus_phage	3.9e-163	99.3
WP_010905961.1\|1448691_1449531_-	phage replisome organiser protein	Q9AZV5	Lactococcus_phage	5.7e-132	100.0
WP_010905962.1\|1449658_1450084_-	single-stranded DNA-binding protein	Q9AZV6	Lactococcus_phage	7.2e-75	100.0
WP_010905963.1\|1450076_1450835_-	hypothetical protein	Q9AZV7	Lactococcus_phage	2.5e-147	100.0
WP_010905964.1\|1450843_1451239_-	hypothetical protein	Q9AZV8	Lactococcus_phage	8.5e-70	100.0
WP_010905687.1\|1451353_1451569_-	DUF1408 domain-containing protein	Q38272	Lactococcus_phage	2.4e-34	100.0
WP_010905686.1\|1451671_1451947_+	hypothetical protein	Q9AYU7	Lactococcus_phage	1.6e-46	100.0
WP_010905685.1\|1451943_1452138_-	hypothetical protein	Q77JL6	Lactococcus_phage	3.0e-28	100.0
WP_010905965.1\|1452280_1452571_-	hypothetical protein	Q9AZW0	Lactococcus_phage	9.3e-50	100.0
WP_010905966.1\|1452583_1453294_-	phage antirepressor Ant	Q9AZW1	Lactococcus_phage	3.8e-129	99.6
WP_003131906.1\|1453307_1453541_-	helix-turn-helix transcriptional regulator	Q9AZW2	Lactococcus_phage	2.1e-36	100.0
WP_010905968.1\|1453712_1454234_+	helix-turn-helix domain-containing protein	Q9AZW3	Lactococcus_phage	1.3e-86	99.4
WP_010905969.1\|1454243_1454831_+	hypothetical protein	Q9AZW4	Lactococcus_phage	6.8e-108	100.0
WP_010905970.1\|1454895_1455747_+	hypothetical protein	Q9AZW5	Lactococcus_phage	1.2e-89	100.0
WP_010905971.1\|1455869_1456949_+\|integrase	site-specific integrase	Q9AZW6	Lactococcus_phage	2.5e-204	100.0
WP_003130477.1\|1457653_1457989_-	putative DNA-binding protein	NA	NA	NA	NA
1457044:1457116	attR	NA	NA	NA	NA
WP_003130475.1\|1458172_1458883_+	response regulator transcription factor	A0A1V0SGR9	Hokovirus	3.5e-05	29.1
WP_010905972.1\|1458872_1460426_+	two-component sensor histidine kinase	W8CYF6	Bacillus_phage	2.5e-32	38.6

DBSCAN-SWA_10

1558960 : 1569261

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003130058.1\|1558960_1560517_-	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	2.3e-70	45.6
WP_003130055.1\|1560692_1561235_-	hypoxanthine phosphoribosyltransferase	A0A218MMB5	uncultured_virus	1.8e-09	29.9
WP_010906016.1\|1561371_1562409_-	NAD-dependent epimerase/dehydratase family protein	NA	NA	NA	NA
WP_003130052.1\|1562539_1563070_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_010906017.1\|1563120_1564710_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	3.0e-09	22.2
WP_003130044.1\|1564876_1565425_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	2.8e-18	31.1
WP_003130042.1\|1565452_1566475_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3FGG1	Synechococcus_phage	6.4e-61	40.4
WP_003130040.1\|1566657_1569261_-	ATP-dependent chaperone ClpB	K4FB40	Cronobacter_phage	9.4e-125	32.8

DBSCAN-SWA_11

1771128 : 1780987

Prochlorococcus_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010906105.1\|1771128_1771890_-	phosphate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.1e-17	30.5
WP_003130885.1\|1772055_1772865_-	phosphate ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	7.0e-10	26.5
WP_003130884.1\|1772898_1773792_-	phosphate ABC transporter permease PstA	NA	NA	NA	NA
WP_003130883.1\|1773791_1774715_-	phosphate ABC transporter permease subunit PstC	NA	NA	NA	NA
WP_003130881.1\|1774835_1775687_-	phosphate ABC transporter substrate-binding protein PstS family protein	E3SNT9	Prochlorococcus_phage	4.2e-05	27.3
WP_003130880.1\|1776033_1776930_-	phosphate ABC transporter substrate-binding protein	E3SM63	Prochlorococcus_phage	7.2e-08	32.4
WP_003130878.1\|1777207_1777675_-	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	2.7e-43	56.6
WP_031296345.1\|1777706_1778264_-	SGNH/GDSL hydrolase family protein	NA	NA	NA	NA
WP_003130876.1\|1778368_1780987_-\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	7.1e-64	33.7

DBSCAN-SWA_12

2011425 : 2028705

Lactococcus_phage(85.71%)

integrase,transposase

attL 2011247:2011267|attR 2025736:2025756

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2011247:2011267	attL	NA	NA	NA	NA
WP_003130410.1\|2011425_2012373_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	3.4e-32	33.0
WP_010906204.1\|2013684_2014605_-	DUF4065 domain-containing protein	Q9AZG0	Lactococcus_phage	1.6e-172	99.7
WP_010906205.1\|2014616_2014913_-	hypothetical protein	Q9AZG1	Lactococcus_phage	1.6e-49	100.0
WP_023349381.1\|2015101_2015323_-	hypothetical protein	Q9AZD7	Lactococcus_phage	2.5e-31	97.3
WP_010906207.1\|2015472_2015703_-	hypothetical protein	Q9AZG3	Lactococcus_phage	1.5e-39	100.0
WP_010906208.1\|2015845_2016352_-	GNAT family N-acetyltransferase	Q9AZG4	Lactococcus_phage	4.2e-90	100.0
WP_015966752.1\|2016510_2016681_-	hypothetical protein	Q9AZG5	Lactococcus_phage	8.2e-06	100.0
WP_003130410.1\|2016950_2017898_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	3.4e-32	33.0
WP_010906210.1\|2017985_2018348_-	hypothetical protein	Q9AZG6	Lactococcus_phage	3.4e-57	100.0
WP_010906211.1\|2018364_2018937_-	hypothetical protein	Q9AZG7	Lactococcus_phage	2.1e-98	100.0
WP_010906212.1\|2019098_2019305_-	hypothetical protein	Q9AZG9	Lactococcus_phage	1.6e-32	100.0
WP_010906213.1\|2019323_2019506_-	hypothetical protein	Q9AZH0	Lactococcus_phage	1.4e-27	100.0
WP_010906214.1\|2019874_2020189_-	hypothetical protein	Q9AZH1	Lactococcus_phage	3.4e-53	100.0
WP_010906215.1\|2020101_2021571_-	hypothetical protein	Q9AZH2	Lactococcus_phage	3.2e-279	100.0
WP_010906216.1\|2021581_2021851_-	hypothetical protein	Q9AZH3	Lactococcus_phage	1.3e-40	100.0
WP_010906217.1\|2021847_2022000_-	hypothetical protein	Q9AZH4	Lactococcus_phage	1.4e-20	100.0
WP_010906219.1\|2022253_2022424_-	DUF1655 domain-containing protein	Q9AZH6	Lactococcus_phage	4.6e-25	100.0
WP_010906221.1\|2022662_2023178_-	Rha family transcriptional regulator	Q9AZH8	Lactococcus_phage	4.2e-93	100.0
WP_010906222.1\|2023292_2023499_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_010906223.1\|2023647_2024355_+	helix-turn-helix transcriptional regulator	Q9AZH9	Lactococcus_phage	1.8e-123	100.0
WP_010906224.1\|2024435_2025635_+\|integrase	site-specific integrase	Q9AZI0	Lactococcus_phage	1.4e-224	100.0
WP_004254847.1\|2025838_2026378_+	PadR family transcriptional regulator	NA	NA	NA	NA
2025736:2025756	attR	NA	NA	NA	NA
WP_010906225.1\|2026544_2028023_+	chitinase	NA	NA	NA	NA
WP_010906226.1\|2028042_2028705_+	lytic polysaccharide monooxygenase	A0A0K1Y848	Apis_mellifera_filamentous_virus	1.2e-15	31.2

DBSCAN-SWA_13

2083062 : 2148220

unidentified_phage(20.0%)

tRNA,bacteriocin,protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010906258.1\|2083062_2084010_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	8.9e-33	33.0
WP_010906259.1\|2084030_2084240_-	hypothetical protein	NA	NA	NA	NA
WP_010906260.1\|2084275_2084794_-	peptide-methionine (S)-S-oxide reductase MsrA	NA	NA	NA	NA
WP_010906261.1\|2084968_2085826_-	S1 RNA-binding domain-containing protein	NA	NA	NA	NA
WP_010906262.1\|2085871_2086330_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_004254618.1\|2086422_2086980_-	ribosome recycling factor	NA	NA	NA	NA
WP_004254608.1\|2087191_2087908_-	UMP kinase	NA	NA	NA	NA
WP_010906263.1\|2087992_2088445_-	hypothetical protein	NA	NA	NA	NA
WP_010906264.1\|2088578_2089766_-	acetate kinase	NA	NA	NA	NA
WP_004254593.1\|2089922_2091110_-	acetate kinase	NA	NA	NA	NA
WP_004254589.1\|2091304_2092243_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_004254583.1\|2092330_2092582_-	DUF3165 family protein	NA	NA	NA	NA
WP_165842632.1\|2092678_2094511_-	translational GTPase TypA	A0A1S5SF82	Streptococcus_phage	9.2e-18	36.1
WP_010906266.1\|2094698_2095157_-	hypothetical protein	NA	NA	NA	NA
WP_004254570.1\|2095172_2095946_-	hypothetical protein	NA	NA	NA	NA
WP_010906267.1\|2096282_2096909_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.7e-19	34.5
WP_010906268.1\|2096909_2098892_-\|bacteriocin	bacteriocin-associated integral membrane family protein	NA	NA	NA	NA
WP_010906269.1\|2098895_2099222_-\|bacteriocin	lactococcin 972 family bacteriocin	NA	NA	NA	NA
WP_004254546.1\|2099521_2100250_-	LytTR family transcriptional regulator	NA	NA	NA	NA
WP_010906270.1\|2100442_2100664_+	YqgQ family protein	NA	NA	NA	NA
WP_004254542.1\|2100697_2101669_+	ROK family glucokinase	NA	NA	NA	NA
WP_010906271.1\|2101671_2102058_+	rhodanese-like domain-containing protein	NA	NA	NA	NA
WP_004254538.1\|2102140_2102587_-	DNA starvation/stationary phase protection protein	A0A2K9VCK5	Lactobacillus_phage	6.5e-18	34.2
WP_088792927.1\|2102724_2103836_-\|transposase	IS3-like element IS981 family transposase	A0A1P8CWQ3	Bacillus_phage	1.2e-49	41.4
WP_004254535.1\|2103980_2104646_+	prepilin peptidase	NA	NA	NA	NA
WP_010906272.1\|2104596_2105688_-	DNA polymerase IV	NA	NA	NA	NA
WP_010906273.1\|2105766_2106258_-\|tRNA	prolyl-tRNA synthetase associated domain-containing protein	NA	NA	NA	NA
WP_010906274.1\|2106336_2107830_-	amino acid permease	NA	NA	NA	NA
WP_010906275.1\|2108021_2109152_-	aminotransferase	NA	NA	NA	NA
WP_010906276.1\|2109415_2110360_-	carbamate kinase	NA	NA	NA	NA
WP_010906277.1\|2110391_2111336_-	carbamate kinase	NA	NA	NA	NA
WP_153936531.1\|2111352_2111490_-	hypothetical protein	NA	NA	NA	NA
WP_010906278.1\|2111455_2112928_-	amino acid permease	NA	NA	NA	NA
WP_004254507.1\|2113058_2114123_-	ornithine carbamoyltransferase	NA	NA	NA	NA
WP_004254504.1\|2114306_2115539_-	arginine deiminase	NA	NA	NA	NA
WP_010906279.1\|2115840_2117535_-\|tRNA	arginine--tRNA ligase	A0A2I2L3K1	Orpheovirus	2.1e-80	34.8
WP_004254487.1\|2117602_2118061_+	arginine repressor	NA	NA	NA	NA
WP_010906280.1\|2118243_2119575_-	UDP-N-acetylmuramate--L-alanine ligase	NA	NA	NA	NA
WP_010906281.1\|2119777_2120371_-	hypothetical protein	NA	NA	NA	NA
WP_010906282.1\|2120586_2123691_-	SNF2 helicase associated domain-containing protein	A0A2L1IWL4	Gordonia_phage	5.3e-42	30.1
WP_010906283.1\|2123944_2128297_-	VWA domain-containing protein	NA	NA	NA	NA
WP_010906284.1\|2128719_2130423_-	pyruvate oxidase	A0A0P0CDR3	Ostreococcus_lucimarinus_virus	1.9e-33	27.2
WP_004254459.1\|2130619_2131606_-	serine hydrolase	NA	NA	NA	NA
WP_010906285.1\|2131678_2132458_-	VOC family protein	NA	NA	NA	NA
WP_004254455.1\|2132811_2133597_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_010906286.1\|2133639_2134509_-	aquaporin family protein	NA	NA	NA	NA
WP_004254450.1\|2134680_2136972_+	Xaa-Pro dipeptidyl-peptidase	NA	NA	NA	NA
WP_004254447.1\|2136973_2137684_+	gamma-glutamyl-gamma-aminobutyrate hydrolase family protein	H9D1C6	Salinivibrio_phage	5.2e-09	31.8
WP_010906287.1\|2137833_2138676_+	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_010906290.1\|2140194_2141646_-\|tRNA	glutamate--tRNA ligase	NA	NA	NA	NA
WP_031296836.1\|2141809_2142304_-	cysteine hydrolase	NA	NA	NA	NA
WP_003129898.1\|2142438_2143362_-	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_003129897.1\|2143590_2144085_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_010906291.1\|2144176_2144500_-	DUF1048 domain-containing protein	NA	NA	NA	NA
WP_010906292.1\|2144486_2144834_-	DUF1048 domain-containing protein	NA	NA	NA	NA
WP_003129889.1\|2144820_2145183_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_003129888.1\|2145302_2145932_-	hypothetical protein	NA	NA	NA	NA
WP_010906293.1\|2145996_2147082_-	PIN/TRAM domain-containing protein	NA	NA	NA	NA
WP_010906258.1\|2147272_2148220_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	8.9e-33	33.0

DBSCAN-SWA_14

2196128 : 2268523

unidentified_phage(18.18%)

transposase,tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010906324.1\|2196128_2197979_-\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
WP_010906325.1\|2198048_2199335_-\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
WP_003130590.1\|2199353_2200157_-	phosphatidate cytidylyltransferase	NA	NA	NA	NA
WP_010906326.1\|2200156_2200891_-	isoprenyl transferase	R9W0U9	Flavobacterium_phage	5.9e-16	37.0
WP_003130588.1\|2201262_2201595_-	preprotein translocase subunit YajC	NA	NA	NA	NA
WP_003130585.1\|2202405_2202885_-	23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH	NA	NA	NA	NA
WP_003130410.1\|2202923_2203871_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	3.4e-32	33.0
WP_010906329.1\|2204340_2205567_+\|protease	serine protease	A0A1B1IRD3	uncultured_Mediterranean_phage	4.9e-07	26.3
WP_010906330.1\|2205692_2206691_+	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_010906331.1\|2206816_2208157_+	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_003130579.1\|2208264_2208489_+	YkuJ family protein	NA	NA	NA	NA
WP_010906332.1\|2208630_2209635_+	hypothetical protein	NA	NA	NA	NA
WP_010906333.1\|2209675_2210428_-\|tRNA	tRNA1(Val) (adenine(37)-N6)-methyltransferase	NA	NA	NA	NA
WP_010906334.1\|2210774_2213408_-	DNA polymerase I	A0A068EMS7	Bacillus_phage	7.7e-50	31.4
WP_010906335.1\|2213645_2214455_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_095586744.1\|2214944_2216092_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	2.3e-46	41.0
WP_101928107.1\|2216164_2217537_-\|transposase	IS3-like element ISLla3 family transposase	A0A1B1P773	Bacillus_phage	2.4e-55	43.8
WP_021214976.1\|2223527_2224019_-	protein ComX	NA	NA	NA	NA
WP_003132670.1\|2224276_2226007_-	septation ring formation regulator EzrA	NA	NA	NA	NA
WP_010906339.1\|2226192_2227221_-	elongation factor Ts	NA	NA	NA	NA
WP_010906340.1\|2227342_2228110_-	30S ribosomal protein S2	NA	NA	NA	NA
WP_010906341.1\|2228468_2229494_+	lactonase family protein	NA	NA	NA	NA
WP_010906342.1\|2229726_2232438_+	bifunctional acetaldehyde-CoA/alcohol dehydrogenase	NA	NA	NA	NA
WP_010906343.1\|2232775_2233273_-	nitroreductase family protein	NA	NA	NA	NA
WP_003132661.1\|2233259_2233469_-	hypothetical protein	NA	NA	NA	NA
WP_010906344.1\|2233465_2234293_-	radical SAM protein	NA	NA	NA	NA
WP_010906345.1\|2234285_2236409_-	radical SAM protein	NA	NA	NA	NA
WP_010906346.1\|2236511_2237369_-	transcriptional regulator	A0A1X9I6E0	Streptococcus_phage	2.3e-11	28.7
WP_010906347.1\|2237489_2238518_-	PDZ domain-containing protein	NA	NA	NA	NA
WP_010906348.1\|2238504_2239002_-	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	8.9e-16	31.4
WP_015427191.1\|2239049_2239589_-	16S rRNA (guanine(966)-N(2))-methyltransferase RsmD	NA	NA	NA	NA
WP_003132654.1\|2239759_2240980_-	MFS transporter	NA	NA	NA	NA
WP_010906350.1\|2241063_2242290_-	multidrug efflux MFS transporter LmrP	NA	NA	NA	NA
WP_010906351.1\|2242477_2242972_+	RNA polymerase sigma factor	NA	NA	NA	NA
WP_010906352.1\|2242995_2244102_+	anti sigma factor C-terminal domain-containing protein	NA	NA	NA	NA
WP_010906353.1\|2244197_2245544_-	glucose-6-phosphate isomerase	NA	NA	NA	NA
WP_010906354.1\|2245887_2246394_+	YkgJ family cysteine cluster protein	NA	NA	NA	NA
WP_010906355.1\|2246427_2247273_-	NmrA family NAD(P)-binding protein	NA	NA	NA	NA
WP_010906356.1\|2247499_2247778_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_010906357.1\|2247890_2248223_+	hypothetical protein	NA	NA	NA	NA
WP_010906358.1\|2248266_2250909_-\|tRNA	valine--tRNA ligase	A0A1V0S951	Catovirus	2.0e-151	41.2
WP_010906359.1\|2251164_2251821_-	elongation factor G-binding protein	NA	NA	NA	NA
WP_003132639.1\|2252097_2252346_-	DUF1912 family protein	NA	NA	NA	NA
WP_010906360.1\|2252384_2252729_-	MmcQ/YjbR family DNA-binding protein	NA	NA	NA	NA
WP_010906361.1\|2252729_2253239_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_010906362.1\|2253393_2254101_-	B3/4 domain-containing protein	NA	NA	NA	NA
WP_010906363.1\|2254432_2255974_-	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	E4ZFI6	Streptococcus_phage	1.2e-71	32.7
WP_164752716.1\|2256202_2256487_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_010906366.1\|2259810_2260623_+	recombination regulator RecX	NA	NA	NA	NA
WP_010906367.1\|2267575_2268523_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	1.7e-31	32.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_002662

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection