CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NC_002696	Caulobacter vibrioides CB15, complete sequence	1 crisprs	csa3,WYL,DEDDh,DinG,cas3	0	0	2	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_002696_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_002696_1

751825-751929

Orphan

Consensus_repeat	Method
GGACTTCCTTAGAAGTCCATGTCGCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_002696_1

>merge|NC_002696|1|751825-751929|CRISPRCasFinder
GGACTTCCTTAGAAGTCCATGTCGCCGCTCTGGATCGGCTGGGCCGATCCAGATCTCTTTGGGAGATGGGCGACTTTATGGACTTCCTTAGAAGTCCATGTCGCC

>NC_002696|1|1|751825-751929|CRISPRCasFinder
GGACTTCCTTAGAAGTCCATGTCGCC	GCTCTGGATCGGCTGGGCCGATCCAGATCTCTTTGGGAGATGGGCGACTTTAT
GGACTTCCTTAGAAGTCCATGTCGCC

Protein	Signature genes	Signature genes Name	Protein_function
NC_002696.2\|WP_010918582.1\|763356_764409_+\|TraB/GumN-family-protein	unknown	unknown	gnl\|CDD\|350613
NC_002696.2\|WP_010918575.1\|754919_755582_-\|methylated-DNA--[protein]-cysteine-S-methyltransferase	unknown	unknown	gnl\|CDD\|223427
NC_002696.2\|WP_024265592.1\|747702_747957_-\|hypothetical-protein	unknown	unknown	unknown
NC_002696.2\|WP_010918581.1\|761330_763244_-\|DNA-mismatch-repair-endonuclease-MutL	unknown	unknown	gnl\|CDD\|234630
NC_002696.2\|WP_010918580.1\|760403_761171_+\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133381
NC_002696.2\|WP_010918564.1\|745360_745537_-\|hypothetical-protein	unknown	unknown	unknown
NC_002696.2\|WP_010918578.1\|757765_758929_+\|hypothetical-protein	unknown	unknown	unknown
NC_002696.2\|WP_010918574.1\|754290_754719_+\|DUF4345-family-protein	unknown	unknown	unknown
NC_002696.2\|WP_012640036.1\|748363_749605_+\|HlyD-family-efflux-transporter-periplasmic-adaptor-subunit	unknown	unknown	gnl\|CDD\|130902
NC_002696.2\|WP_024265593.1\|747987_748248_-\|hypothetical-protein	unknown	unknown	unknown
NC_002696.2\|WP_010918572.1\|753612_753903_-\|co-chaperone-GroES	unknown	unknown	gnl\|CDD\|178988
NC_002696.2\|WP_024265588.1\|745105_745297_-\|hypothetical-protein	unknown	unknown	unknown
NC_002696.2\|WP_012640035.1\|745856_746753_-\|CPBP-family-intramembrane-metalloprotease	unknown	unknown	gnl\|CDD\|376806
NC_002696.2\|WP_024265589.1\|745690_745804_-\|hypothetical-protein	unknown	unknown	unknown
NC_002696.2\|WP_024265594.1\|757096_757693_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|224584
NC_002696.2\|WP_024265590.1\|746759_746864_-\|hypothetical-protein	unknown	unknown	unknown
NC_002696.2\|WP_010918570.1\|749565_751746_+\|peptidase-domain-containing-ABC-transporter	unknown	unknown	gnl\|CDD\|225183
NC_002696.2\|WP_024265595.1\|759023_760328_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|237030
NC_002696.2\|WP_010918576.1\|755632_756940_-\|acyl-CoA-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|173844
NC_002696.2\|WP_024265591.1\|747406_747700_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NC_002696.2\|WP_010918582.1\|763356_764409_+\|TraB/GumN-family-protein	gnl\|CDD\|350613	cd14788, GumN, poorly characterized family of proteins related to gumN pathogenicity factor of Xanthomonas. GumN, a poorly characterized protein, is part of the large gum cluster of pathogenicity factors of the plant pathogen Xanthomonas. Except for GumN, the gum cluster is conserved, and proteins of this operon are involved in the production of xanthan, an extracellular polysaccharide that promotes plant disease. Xanthomonas campestri is responsible for 'black rot' disease in certain crop plants. GumN has sequence similarity to the Tiki/TraB protease family, but lacks the typical conserved residues of the active site.	1.20213e-69
NC_002696.2\|WP_010918575.1\|754919_755582_-\|methylated-DNA--[protein]-cysteine-S-methyltransferase	gnl\|CDD\|223427	COG0350, Ada, Methylated DNA-protein cysteine methyltransferase [DNA replication, recombination, and repair].	2.67004e-57
NC_002696.2\|WP_010918572.1\|753612_753903_-\|co-chaperone-GroES	gnl\|CDD\|178988	PRK00364, groES, co-chaperonin GroES; Reviewed.	6.24247e-56
NC_002696.2\|WP_010918581.1\|761330_763244_-\|DNA-mismatch-repair-endonuclease-MutL	gnl\|CDD\|234630	PRK00095, mutL, DNA mismatch repair endonuclease MutL.	0
NC_002696.2\|WP_012640035.1\|745856_746753_-\|CPBP-family-intramembrane-metalloprotease	gnl\|CDD\|376806	pfam02517, Abi, CAAX protease self-immunity. Members of this family are probably proteases (after a isoprenyl group is attached to the Cys residue in the C-terminal CAAX motif of a protein to attach it to the membrane, the AAX tripeptide being removed by one of the CAAX prenyl proteases). The family contains the CAAX prenyl protease. The proteins contain a highly conserved Glu-Glu motif at the amino end of the alignment. The alignment also contains two histidine residues that may be involved in zinc binding. While they are involved in membrane anchoring of proteins in eukaryotes, little is known about their function in prokaryotes. In some known bacteriocin loci, Abi genes have been found downstream of bacteriocin structural genes where they are probably involved in self-immunity. Investigation of the bacteriocin-like loci in the Gram positive bacteria locus from Lactobacillus sakei 23K confirmed that the bacteriocin-like genes (sak23Kalphabeta) exhibited antimicrobial activity when expressed in a heterologous host and that the associated Abi gene (sak23Ki) conferred immunity against the cognate bacteriocin. Interestingly, the immunity genes from three similar systems conferred a high degree of cross-immunity against each other's bacteriocins, suggesting the recognition of a common receptor. Site-directed mutagenesis demonstrated that the conserved motifs constituting the putative proteolytic active site of the Abi proteins are essential for the immunity function of Sak23Ki - thus a new concept in self-immunity.	7.44372e-12
NC_002696.2\|WP_024265594.1\|757096_757693_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|224584	COG1670, RimL, Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis].	2.22772e-22
NC_002696.2\|WP_010918580.1\|760403_761171_+\|MerR-family-transcriptional-regulator	gnl\|CDD\|133381	cd01106, HTH_TipAL-Mta, Helix-Turn-Helix DNA binding domain of the transcription regulators TipAL, Mta, and SkgA. Helix-turn-helix (HTH) TipAL, Mta, and SkgA transcription regulators, and related proteins, N-terminal domain. TipAL regulates resistance to and activation by numerous cyclic thiopeptide antibiotics, such as thiostrepton. Mta is a global transcriptional regulator; the N-terminal DNA-binding domain of Mta interacts directly with the promoters of mta, bmr, blt, and ydfK, and induces transcription of these multidrug-efflux transport genes. SkgA has been shown to control stationary-phase expression of catalase-peroxidase in Caulobacter crescentus. These proteins are comprised of distinct domains that harbor an N-terminal active (DNA-binding) site and a regulatory (effector-binding) site. The conserved N-terminal domain of these transcription regulators contains winged HTH motifs that mediate DNA binding. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. Unique to this family, is a TipAL-like, lineage specific Bacilli subgroup, which has five conserved cysteines in the C-terminus of the protein.	6.80486e-49
NC_002696.2\|WP_010918570.1\|749565_751746_+\|peptidase-domain-containing-ABC-transporter	gnl\|CDD\|225183	COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms].	0
NC_002696.2\|WP_024265595.1\|759023_760328_+\|hypothetical-protein	gnl\|CDD\|237030	PRK12270, kgd, multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine pyrophosphate-binding subunit/dihydrolipoyllysine-residue succinyltransferase subunit.	3.19302e-08
NC_002696.2\|WP_010918576.1\|755632_756940_-\|acyl-CoA-dehydrogenase-family-protein	gnl\|CDD\|173844	cd01155, ACAD_FadE2, Acyl-CoA dehydrogenases similar to fadE2. FadE2-like Acyl-CoA dehydrogenase (ACAD). Acyl-CoA dehydrogenases (ACAD) catalyze the alpha,beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of ACAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. The ACAD family includes the eukaryotic beta-oxidation, as well as amino acid catabolism enzymes. These enzymes share high sequence similarity, but differ in their substrate specificities. ACAD's are generally homotetramers and have an active site glutamate at a conserved position.	0
NC_002696.2\|WP_012640036.1\|748363_749605_+\|HlyD-family-efflux-transporter-periplasmic-adaptor-subunit	gnl\|CDD\|130902	TIGR01843, Hemolysin_secretion_protein_D_plasmid, type I secretion membrane fusion protein, HlyD family. Type I secretion is an ABC transport process that exports proteins, without cleavage of any signal sequence, from the cytosol to extracellular medium across both inner and outer membranes. The secretion signal is found in the C-terminus of the transported protein. This model represents the adaptor protein between the ATP-binding cassette (ABC) protein of the inner membrane and the outer membrane protein, and is called the membrane fusion protein. This model selects a subfamily closely related to HlyD; it is defined narrowly and excludes, for example, colicin V secretion protein CvaA and multidrug efflux proteins. [Protein fate, Protein and peptide secretion and trafficking].	2.04755e-26

>NC_002696.2|WP_010918570.1|749565_751746_+|peptidase-domain-containing-ABC-transporter
MVARSPLRGRTPLMDIPAELNFARRRRLPVIVGAEAAECGLACMAMVARYHGHDVDLNGLRQRFTLSMSGATLRSIMGFADHLGFAPRALKVELSALDKVRLPAILHWDLNHFVVLKSVQGGRAVVHDPALGARTYSLDELSKHFTGVALELTPSGRFEKITARAPIKLTSLWSRMIGFWPAFFQILGLSLALQVAVFAMPFQMQLVVDEAIFRADRDLLTVLALGFGALVIIQSAIEALRAWALQVFGQMLSFQIVGNLVRHMMRLPSDWYEKRHVGDILSRIGSASAIQDVLTRGVIAAIIDGLMAVVAIIILLLYAPTLAAVVVGAVALNLGLALALFPAMRARTEEQILESAREQSHVMETVRAATTIKLMGREAERESSWRNLYANAINAAVSVGKFQISLSFTQALITGLQTVIVIYLGARTILAGDGFSVGMLFAFLSFRQTFTDRANALINQFIQFKFLNLHLERLADIVTAETEAADTAAPRLEVAGALQLKDVSFRYGAADRPVLQGVDLEVAPGEFLAITGASGGGKTTLLKLMLGLRAPTEGTITLDGQPASPQLWRAWREQVGVVAQDDRLLSGTIADNIAFFDPDLDMERVQHAAMAAQVHDDIARMPMQYLSLVGDMGSTLSGGQKQRVLLARALYRRPRILVLDEGTANLDVQTEELIADLIAQLPITRIVVAHRPALLKRASRILVVEGGVLSTTCSELSRAEPKRAVF
>NC_002696.2|WP_012640036.1|748363_749605_+|HlyD-family-efflux-transporter-periplasmic-adaptor-subunit
MSDLFRKEAVVHATRRLAGEVVLATSVPSRVLAGLVCLVVLAGATFAATASYARKETVVGWLTPQAGMIRLAARQGGIVANVHVREGDRVVVGQPIATLTLSSALEGGDSFAVLSRSLGAQSSAAGSRAAATQAALAAESRQLTQRRAALNRELAEAKRSLALQTERLTLARAEVARAETIAAQGFLSPRELQARRSAELAVQQEASTLSSQALSYERQIGEVDARLAAIPIDLQAARAEAASTLAGLEQQATQVEAQGRYVVVATVAGRVAALPVEAGQTVGVGAAVAVLTPGDSALVAELYAPSRAAGFVRQGQEVRLMYQAFPHQKFGVGEGVVTAVSRTVLAPSEVAIPGLQVQEPVFRIRVKLARDNVAAYGETLPLQPGMLLSADVVIDRRSLLEWLLDPLYAVGRR
>NC_002696.2|WP_024265593.1|747987_748248_-|hypothetical-protein
MTALAMNVRELSFEEVDEVAGANMRAASVGVGGVAGAGAGWHAGVAVAARGAMWGARVGAIGGVGGAVAGVVLGAAIALIAYDLAE
>NC_002696.2|WP_024265592.1|747702_747957_-|hypothetical-protein
MKTLTLAEIDYVSGGSERGAMVSGAAVAGGVGGANYARAAIHGASWGARIGAVGGVAGIVAGALVGAAAGGILAYALYEAVDGS
>NC_002696.2|WP_024265591.1|747406_747700_-|hypothetical-protein
MTKRATLQFTQILNWTIGILLVFGWLQLIGVFSVKGLDPVVLFGVSAFLTGYISLRDFRSMGLGNIKSFIASSALGILILGLVTLLSKATEYIPKLF
>NC_002696.2|WP_024265590.1|746759_746864_-|hypothetical-protein
MISSAVNPCDDAPHPHKALSEAHSTLGRRRSSAA
>NC_002696.2|WP_012640035.1|745856_746753_-|CPBP-family-intramembrane-metalloprotease
MIGIDNSVPTPSLARQAISILAGALGGFASGLIAVSILLGVLGIFDLRPLTDSERLSVFENGALYTAELAIILLALAVGFVGTAGAVLKRPFVEWLTDGRGLRFDLCLYGLTLGAAATLAGLIGNAAIDGDRLGFIGSTPSGLAPGIWVYLVAMPLGFLVAAFAEELFFRGYLLKLLRWWGAHPVVAITVTSIAFAAFHLEFQPEVFALRMLSGAALAWSVYRLGGIEFAVGAHAAGNIVLAFFIPPLSETTTSSADLYGVGIEILTSAMIIIGVEVVRARLSFRADTFSLWAKEGGT
>NC_002696.2|WP_024265589.1|745690_745804_-|hypothetical-protein
MKSPFKRPHTNEAKTLEFALGVILGGIATAIAIVILV
>NC_002696.2|WP_010918564.1|745360_745537_-|hypothetical-protein
MMTHAPRTKAIARLLRRWWFAEPAFKAAVLASAALLVVSTVNALIEIGALVHDAVCPH
>NC_002696.2|WP_024265588.1|745105_745297_-|hypothetical-protein
MSQRRLDLIFVGLLPALIGLAWGRSSDVFPEQPYAFGAVVTLLAWAGVLWFFLAGPGKTPRDP
>NC_002696.2|WP_010918572.1|753612_753903_-|co-chaperone-GroES
MKFRPLGDRVLVKRVEEETKTKGGIIIPDTAKEKPQEGEVVAVGPGARNDKGDVVALDVKAGDRILFGKWSGTEVKVDGQDLLIMKESDVLGVVEA
>NC_002696.2|WP_010918574.1|754290_754719_+|DUF4345-family-protein
MSSYVLSLLLAVIACVIGGTLGGMILARPATLLEAAGLSNDDTPKPPLFAEGRALGGVLIASHGVAALYLGYQPRIGAAMALALALAWLGAAAGRAVSLALDGDAGRYNRGAMLFNALIGVTLTLPWFQIGKVVLRGPLGLA
>NC_002696.2|WP_010918575.1|754919_755582_-|methylated-DNA--[protein]-cysteine-S-methyltransferase
MRGRCGGPFFVKGGPVFPPLIRPSGPPSPARGEGRNYRADSRARLGDHRPMPRPAHLFLDRAPSPLGDLLIVTDETGLLRAVDFHDFEPRLRRLARLHYGDLVLETGPAPAAIKAAFARYFAGDLAALVSLAWATNGTPFQQAVWTALTQIPAGQTITYSELARRAGRPLAIRAAGAANGANPLSLVAPCHRVIGTDGALTGYAGGIDRKRWLLAHEGAL
>NC_002696.2|WP_010918576.1|755632_756940_-|acyl-CoA-dehydrogenase-family-protein
MDFDISPKQRAFLDRVTAFMDEHVYPAIPAYEAEMNVLGAERWKVVQVVEDLKKKAKAAGLWNFFMPPHSGQTHVDDTFQFEGVQLTNLEYSLIAEQLGKVGFASEVFNCSAPDTGNMEVLMRYGTLAQKEKWLRPLMNGEIRSAFLMTEPAVASSDATNIETRIERDGDHYVINGRKWWSSGVGDPRCKVAIVMGKTDPDNASRHAQQSQVLVPLDSPGIEIVRMLPVFGYDDAPHGHAEVILKNVRVPIEDALLLGEGRGFEIAQGRLGPGRIHHCMRTIGTAEVALEKMCQRLMSRKAFGKYVSDHSVWEERVADARIDIEMCRLLCLKAADMMDKAGNKSARLEIAMIKVAAPRLALKIIDDAIQAHGGGGVTTDFGLAKAYAGIRTLRLADGPDEVHQRTIARMEYGKYGDLMYKQKAEKEAALHVPGIR
>NC_002696.2|WP_024265594.1|757096_757693_+|GNAT-family-N-acetyltransferase
MLNLTADILQGRYVRLEPVTVDHHDELKAAIDCDPASWEIMSVNGCGEGFEDFWGALQGETDRGERIGFAIRRLVDGKVVGTSSYLNIRRLHGGLEIGATFLNPEARSGPVNPESKRLMLGHAFDKAGAIRVELVTDVRNARSQAAIQKLGATKEGVLRNHKVTWTGHVRDTAVFSITDYDWPAIRERLEFRLSETFA
>NC_002696.2|WP_010918578.1|757765_758929_+|hypothetical-protein
MAGMACLRICIEHGARSVTLDGVTPAKIDKVASGYIDVNWRAPRRHGRVGPGAYVLIDPSAETLNGEELRQMAAELQVHLFGTQGQQDLCMLTFEGDEEQVLKFTTLPEEELLAMRGGAEPPPPEGRTRIVSQDGIRELAPWGSTPRVAAEQEKVEAPPVRLGWRGVYSLPSQRFEAAQVQSFLKPGEAEPQSDADFMDRDLQALDRAVAALEGDPRLKAWVGVRLWTVARGGLRDTCRERFAAIPPSVRERLGAMVYDAPRDLPFSAIGPLRDLVQPYFARVGLCVNDPGFYVQALPDALVHCVVFQLPEEDEKARVLKAHRFLSARGQYVARSLRMGLAGVKTPRELELARKMGAHMVKGPMISALFATPVSDQVVPVTELPLRT
>NC_002696.2|WP_024265595.1|759023_760328_+|hypothetical-protein
MTAIACLRILFTADADMRAGDMPKHKAQGVADAFLKAKWRKPRKCGAVAPLAFVLADHNATELDPTEVQGLAVELEKVLFPNRPIGQIALMTFEGDETAVLHFSALSQKELASLMAGEGYGGEPGRVHVVTADAVKPMPVTREEAKVYAAEKAKAAEAEKPAAAAPAAAAPAPVQAPAPSPAKSAPAPAPTPAPVAAKVVTPQRPADTGWWGVYDLSQGAFVGSTVAMRADLVEPPPEDDAKLLKRDLVALTDVQAALKTASFGEIQASFGFWNLITPASQESYKARLSRYPLDARPRLTASIYGAPREASIGMLQQMRAQLSGAFAAMDLRITDPTFPVQGLPPELLESVTLVLSGETEHDRLKQILKFVERKSAYAAKGVMQCVANVASAVELEACKVAGVVRVQGPAVTDFMDTPVAAADGAPLALAKSAA
>NC_002696.2|WP_010918580.1|760403_761171_+|MerR-family-transcriptional-regulator
MSVYTVKQMARLSGVSVRALHHYDAIGLLKPRAVGANGYRYYDRQDLLRLQQILFHRALETPLKDIQAALDQPGFDLAAALRAQRERLAAQAERYARLVDVVDRTLADLEGDETMDDKHLFEGFDPEKQARHEAWLVEHYGDEATRRIADAKAGMKSWGKKDWSQFQEEAKAIEHDLAKALTQGLPVDSAPVTAIMRRHWAWVGRSWNREPTPDAFAGLGHLYQANPEFTARYEAIAPGLTEYFSEAMRAFARGR
>NC_002696.2|WP_010918581.1|761330_763244_-|DNA-mismatch-repair-endonuclease-MutL
MPIRRLPPETVNRIAAGEVVERPASAIKELVDNAIDAGATRIEVEAHGGGLTRILVADDGCGLSPEELPVAIERHATSKLAPDADGLWDLLRIHTMGFRGEALPSIGSVARLQISSRAKGAKDAFSILVEGGQVGEVAPAAFPGPHGARIEVRDLFYATPARLKFMKSERAEALAITEEIKRQAMANESVGFSLDIDGRRVLRLPPEHPGPQGRLARLAAVLGREFQENALEIDQTRDGVRLSGFAGLPTYNRGNAAHQYLFVNGRPVRDRLLQGALRAAYADFLARDRHPTAALYVTLETTEVDVNVHPAKAEVRFRDPALVRGLIVGALRHALAGAGHRASTTVAAQALDSIRAQQSPFPGYQPQYQPGPSPAGFSAWREGGWTPPTQRPMDLPGLNEVSARVEPSYGGDLAGVVREAYAAAAFEDRPPTDYPGATAPFDPVDYPLGAARAQVHETYIVAQTRDGMVIVDQHAAHERLVYERMKGEMASGGVTRQTLLLPEVVDLDPAEAERVVARAEELAGLGLVLESFGPGAVLVRETPALLGKTDAAALVRDIADDLAENGQALALKERLEEVCSTMACHGSVRAGRRLNGAEMNALLREMEATPHSGQCNHGRPTYVELKLADIEKLFGRR
>NC_002696.2|WP_010918582.1|763356_764409_+|TraB/GumN-family-protein
MTLVRFRAPSRNRKIVTLTRFAAAGLAFSLLCGGSALAQVQGKNEVSIHQTKPVDLTPVDSQANLVEELIVNARLPGPAWWKVSDGDTNVYVMGVPAFAPQKLDFDDSVLRRRLDGANVLIIGQEPEVRILSLLALIPGRGKQFIMDKPMRDTLPPDLRARLEKHLTARSKPVNEHDQLKPALAGFIIANDKGGGVSITIGDLTDRIQKLAKSKDIAVQPRVKKLDDYDLIGMVKSLGEAPQPLQELCLDAGLKETENGLAGVRETADQWAEGQVKAVVAAERGYQRCLASTPWIARQFKDGQDEAVGAITQALKKPGKAVAVIELRSLLTEGGVLDRLRAKGFTVTAPE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1742428 : 1751000

uncultured_Mediterranean_phage(57.14%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012640276.1\|1742428_1743691_+	adenosylmethionine--8-amino-7-oxononanoate transaminase	A0A1V0SKB7	Klosneuvirus	9.2e-17	30.3
WP_012640277.1\|1743687_1744629_+	EamA family transporter	NA	NA	NA	NA
WP_010919453.1\|1744678_1745203_-	superoxide dismutase family protein	Q9MC02	Salmonella_phage	2.3e-14	34.4
WP_010919454.1\|1745327_1748087_+	DNA gyrase subunit A	G3M9Z5	Bacillus_virus	1.5e-96	31.9
WP_010919455.1\|1748113_1748605_+	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	6.5e-35	49.7
WP_012640278.1\|1748762_1749596_+	peptidylprolyl isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	8.2e-22	34.5
WP_012640279.1\|1749592_1750441_+	peptidylprolyl isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	1.8e-24	37.3
WP_010919458.1\|1750532_1751000_+	peptidylprolyl isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	3.6e-35	52.8

DBSCAN-SWA_2

2944179 : 2995896

Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage(10.0%)

transposase,tail,head

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_076611856.1\|2944179_2945533_+\|transposase	IS3-like element ISCc3 family transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	7.3e-12	24.8
WP_010920574.1\|2945586_2947551_-	hypothetical protein	NA	NA	NA	NA
WP_010920575.1\|2947556_2947928_-	hypothetical protein	NA	NA	NA	NA
WP_024265842.1\|2947998_2948202_-	hypothetical protein	NA	NA	NA	NA
WP_012640570.1\|2948880_2948994_+	hypothetical protein	NA	NA	NA	NA
WP_012640571.1\|2949219_2949375_-	hypothetical protein	NA	NA	NA	NA
WP_010920578.1\|2949384_2951274_+	pilus assembly protein TadG	A0A2I7RHS5	Vibrio_phage	1.3e-06	40.0
WP_010920579.1\|2951497_2952832_-	type II toxin-antitoxin system HipA family toxin	NA	NA	NA	NA
WP_010920580.1\|2952828_2953683_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_024265843.1\|2953689_2953836_-	hypothetical protein	NA	NA	NA	NA
WP_012640572.1\|2953931_2954057_-	hypothetical protein	NA	NA	NA	NA
WP_010920582.1\|2954241_2954595_+	hypothetical protein	NA	NA	NA	NA
WP_012640573.1\|2955128_2956151_+\|transposase	IS110-like element ISCc4 family transposase	NA	NA	NA	NA
WP_096053990.1\|2956275_2957461_+\|transposase	IS3-like element IS511 family transposase	S5WIU1	Leptospira_phage	5.9e-50	43.0
WP_010920585.1\|2957433_2958618_+	S8 family serine peptidase	NA	NA	NA	NA
WP_024265845.1\|2958614_2958740_-	hypothetical protein	NA	NA	NA	NA
WP_193343182.1\|2958995_2959157_+	DNA repair protein	NA	NA	NA	NA
WP_010920586.1\|2959235_2959793_+	DUF2272 domain-containing protein	A0A1V0EFA5	Caulobacter_phage	8.5e-100	100.0
WP_012640575.1\|2959885_2961154_+	dipeptidase	NA	NA	NA	NA
WP_010920588.1\|2961175_2961937_-	protein-methionine-sulfoxide reductase heme-binding subunit MsrQ	NA	NA	NA	NA
WP_010920589.1\|2961967_2962909_-	protein-methionine-sulfoxide reductase catalytic subunit MsrP	NA	NA	NA	NA
WP_010920590.1\|2962957_2963587_-	periplasmic heavy metal sensor	NA	NA	NA	NA
WP_010920591.1\|2963583_2964036_-	hypothetical protein	NA	NA	NA	NA
WP_010920592.1\|2964052_2964613_-	RNA polymerase sigma factor	NA	NA	NA	NA
WP_010920593.1\|2964639_2965041_-	EF-hand domain-containing protein	NA	NA	NA	NA
WP_024265846.1\|2965318_2968195_-	bifunctional [glutamine synthetase] adenylyltransferase/[glutamine synthetase]-adenylyl-L-tyrosine phosphorylase	NA	NA	NA	NA
WP_024265847.1\|2968313_2969201_+	MecR1 antirepressor protein	NA	NA	NA	NA
WP_012640577.1\|2969288_2969528_+	hypothetical protein	NA	NA	NA	NA
WP_010920596.1\|2969558_2970965_-	two-component system sensor histidine kinase UczS	NA	NA	NA	NA
WP_010920597.1\|2970969_2971272_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_012640578.1\|2971284_2971503_-	type II toxin-antitoxin system antitoxin ParD3	NA	NA	NA	NA
WP_010920598.1\|2971535_2972207_-	two-component system response regulator UczR	W8CYM9	Bacillus_phage	2.3e-30	35.7
WP_010920599.1\|2972649_2974242_-	Do family serine endopeptidase	A0A1B1IT49	uncultured_Mediterranean_phage	7.7e-21	28.4
WP_010920600.1\|2974421_2974874_-	cytochrome c-type biogenesis protein CcmH	NA	NA	NA	NA
WP_010920601.1\|2974870_2976853_-	heme lyase CcmF/NrfE family subunit	NA	NA	NA	NA
WP_010920602.1\|2977007_2977496_-	cytochrome c maturation protein CcmE	NA	NA	NA	NA
WP_010920603.1\|2977492_2978605_-	c-type cytochrome biogenesis protein CcmI	NA	NA	NA	NA
WP_024265848.1\|2978704_2979397_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_012640579.1\|2979397_2980768_-	hypothetical protein	NA	NA	NA	NA
WP_010920606.1\|2980928_2982326_-	sensor histidine kinase	NA	NA	NA	NA
WP_010920607.1\|2982456_2983134_-	response regulator transcription factor	NA	NA	NA	NA
WP_010920608.1\|2983152_2983470_-	PepSY domain-containing protein	NA	NA	NA	NA
WP_010920609.1\|2983598_2984108_-	hypothetical protein	NA	NA	NA	NA
WP_010920611.1\|2984309_2985617_-	type II toxin-antitoxin system HipA family toxin	NA	NA	NA	NA
WP_010920612.1\|2985613_2985973_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_010920613.1\|2986135_2987080_-	J domain-containing protein	A0A2L0UZR4	Agrobacterium_phage	8.1e-18	26.2
WP_010920616.1\|2991004_2991625_-	C40 family peptidase	F4YXU4	Roseobacter_phage	1.9e-36	53.3
WP_010920617.1\|2991621_2992248_-	DUF2163 domain-containing protein	A0A0K1Y6Z2	Rhodobacter_phage	4.9e-19	41.0
WP_012640582.1\|2992247_2992883_-	TIGR02217 family protein	A0A0B5A2K3	Paracoccus_phage	2.7e-41	44.3
WP_024265849.1\|2993030_2993495_+	DUF805 domain-containing protein	NA	NA	NA	NA
WP_010920620.1\|2993668_2994175_-	hypothetical protein	NA	NA	NA	NA
WP_012640583.1\|2994171_2994351_-\|tail	phage tail assembly chaperone	NA	NA	NA	NA
WP_012640584.1\|2994347_2994632_-	gene transfer agent family protein	NA	NA	NA	NA
WP_010920622.1\|2994787_2995204_-\|tail	phage major tail protein, TP901-1 family	NA	NA	NA	NA
WP_024265850.1\|2995219_2995618_-	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_024265851.1\|2995614_2995896_-\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage