CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NC_003098	Streptococcus pneumoniae R6, complete sequence	3 crisprs	DEDDh,cas3,DinG	1	1	7	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_003098_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_003098_1

96673-96768

Orphan

Consensus_repeat	Method
AATGTGTAAGATTTTTATATATAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_003098_1

>merge|NC_003098|1|96673-96768|CRISPRCasFinder
AATGTGTAAGATTTTTATATATAATTTTTCTACACATACATTGTACATCTAAAAGAAAGCCCTGTCAAGAGAAATGTGTAAAATTTTTATATATAA

>NC_003098|1|1|96673-96768|CRISPRCasFinder
AATGTGTAAGATTTTTATATATAA	TTTTTCTACACATACATTGTACATCTAAAAGAAAGCCCTGTCAAGAGA
AATGTGTAAAATTTTTATATATAA

Protein	Signature genes	Signature genes Name	Protein_function
NC_003098.1\|WP_001030031.1\|91677_92664_+\|rhodanese-related-sulfurtransferase	unknown	unknown	gnl\|CDD\|234663
NC_003098.1\|WP_000714582.1\|87806_88736_+\|sugar-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|226666
NC_003098.1\|WP_001140349.1\|92785_93646_+\|DUF4299-domain-containing-protein	unknown	unknown	gnl\|CDD\|339103
NC_003098.1\|WP_000836441.1\|103910_104414_+\|LysM-peptidoglycan-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|212030
NC_003098.1\|WP_001035701.1\|99216_101067_+\|polysaccharide-biosynthesis-protein	unknown	unknown	gnl\|CDD\|224011
NC_003098.1\|WP_001075102.1\|88749_89673_+\|carbohydrate-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223472
NC_003098.1\|WP_001809441.1\|87266_87488_+\|hypothetical-protein	unknown	unknown	unknown
NC_003098.1\|WP_000723959.1\|105544_107653_+\|bacteriocin-associated-integral-membrane-family-protein	unknown	unknown	gnl\|CDD\|273736
NC_003098.1\|WP_001233696.1\|94844_95756_-\|DUF4097-domain-containing-protein	unknown	unknown	gnl\|CDD\|372574
NC_003098.1\|WP_000744894.1\|96793_97960_-\|CynX/NimT-family-MFS-transporter	unknown	unknown	gnl\|CDD\|340897
NC_003098.1\|WP_000500038.1\|102116_102989_-\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha	unknown	unknown	gnl\|CDD\|129801
NC_003098.1\|WP_000198679.1\|95748_96342_-\|DUF1700-domain-containing-protein	unknown	unknown	gnl\|CDD\|227053
NC_003098.1\|WP_073077611.1\|105196_105490_+\|lactococcin-972-family-bacteriocin	unknown	unknown	gnl\|CDD\|370615
NC_003098.1\|WP_000838912.1\|102997_103669_-\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta	unknown	unknown	gnl\|CDD\|224674
NC_003098.1\|WP_000273864.1\|96328_96655_-\|PadR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224609
NC_003098.1\|WP_000571330.1\|107649_108291_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|188353
NC_003098.1\|WP_000096185.1\|98017_99175_+\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|133016
NC_003098.1\|WP_000808449.1\|93717_94782_-\|membrane-protein	unknown	unknown	gnl\|CDD\|370966
NC_003098.1\|WP_000800407.1\|89930_91406_+\|DUF3502-domain-containing-protein	unknown	unknown	gnl\|CDD\|378792
NC_003098.1\|WP_000200897.1\|101462_102095_-\|HAD-family-hydrolase	unknown	unknown	gnl\|CDD\|319798

Protein	Function_ID	Function_description	E-value
NC_003098.1\|WP_001030031.1\|91677_92664_+\|rhodanese-related-sulfurtransferase	gnl\|CDD\|234663	PRK00142, PRK00142, rhodanese-related sulfurtransferase.	0
NC_003098.1\|WP_000714582.1\|87806_88736_+\|sugar-ABC-transporter-permease	gnl\|CDD\|226666	COG4209, LplB, ABC-type polysaccharide transport system, permease component [Carbohydrate transport and metabolism].	3.01638e-143
NC_003098.1\|WP_001140349.1\|92785_93646_+\|DUF4299-domain-containing-protein	gnl\|CDD\|339103	pfam14132, DUF4299, Domain of unknown function (DUF4299). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 275 and 313 amino acids in length. There are two conserved sequence motifs: RGF and DAY. There are two completely conserved residues (P and D) that may be functionally important.	2.31854e-122
NC_003098.1\|WP_000836441.1\|103910_104414_+\|LysM-peptidoglycan-binding-domain-containing-protein	gnl\|CDD\|212030	cd00118, LysM, Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.	1.95541e-13
NC_003098.1\|WP_001035701.1\|99216_101067_+\|polysaccharide-biosynthesis-protein	gnl\|CDD\|224011	COG1086, COG1086, Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism].	0
NC_003098.1\|WP_001075102.1\|88749_89673_+\|carbohydrate-ABC-transporter-permease	gnl\|CDD\|223472	COG0395, UgpE, ABC-type sugar transport system, permease component [Carbohydrate transport and metabolism].	5.04007e-69
NC_003098.1\|WP_000744894.1\|96793_97960_-\|CynX/NimT-family-MFS-transporter	gnl\|CDD\|340897	cd17339, MFS_NIMT_CynX_like, 2-nitroimidazole and cyanate transporters and similar proteins of the Major Facilitator Superfamily of transporters. This family is composed of Escherichia coli 2-nitroimidazole transporter (NIMT) and cyanate transport protein CynX, and similar proteins. NIMT, also called YeaN, confers resistance to 2-nitroimidazole, the antibacterial and antifungal antibiotic, by mediating the active efflux of this compound. CynX is part of an active transport system that transports exogenous cyanate into E. coli cells. The NIMT/CynX-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	6.06027e-126
NC_003098.1\|WP_000723959.1\|105544_107653_+\|bacteriocin-associated-integral-membrane-family-protein	gnl\|CDD\|273736	TIGR01654, unnamed_protein_product, bacteriocin-associated integral membrane (putative immunity) protein. This model represents a family of integral membrane proteins, most of which are about 650 residues in size and predicted to span the membrane seven times. Nearly half of the members of this family are found in association with a member of the lactococcin 972 family of bacteriocins (TIGR01653). Others may be associated with uncharacterized proteins that may also act as bacteriocins. Although this protein is suggested to be an immunity protein, and the bacteriocin is suggested to be exported by a Sec-dependent process, the role of this protein is unclear. [Cellular processes, Toxin production and resistance].	0
NC_003098.1\|WP_001233696.1\|94844_95756_-\|DUF4097-domain-containing-protein	gnl\|CDD\|372574	pfam13349, DUF4097, Putative adhesin. This has a putative all-beta structure with a twenty-residue repeat with a highly conserved repeating GD, gly-asp, motif. It may form part of a bacterial adhesin.	9.9455e-40
NC_003098.1\|WP_000096185.1\|98017_99175_+\|glycosyltransferase-family-2-protein	gnl\|CDD\|133016	cd02525, Succinoglycan_BP_ExoA, ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.	5.0243e-109
NC_003098.1\|WP_000500038.1\|102116_102989_-\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha	gnl\|CDD\|129801	TIGR00718, Probable_L-serine_dehydratase_alpha_chain, L-serine dehydratase, iron-sulfur-dependent, alpha subunit. This enzyme is also called serine deaminase. L-serine dehydratase converts serine into pyruvate in the gluconeogenesis pathway from serine. This model describes the alpha chain of an iron-sulfur-dependent L-serine dehydratase, found in Bacillus subtilis. A fairly deep split in a UPGMA tree separates members of this family of alpha chains from the homologous region of single chain forms such as found in Escherichia coli. This family of enzymes is not homologous to the pyridoxal phosphate-dependent threonine deaminases and eukaryotic serine deaminases. [Energy metabolism, Amino acids and amines, Energy metabolism, Glycolysis/gluconeogenesis].	2.65225e-106
NC_003098.1\|WP_000198679.1\|95748_96342_-\|DUF1700-domain-containing-protein	gnl\|CDD\|227053	COG4709, COG4709, Predicted membrane protein [Function unknown].	3.4127e-63
NC_003098.1\|WP_073077611.1\|105196_105490_+\|lactococcin-972-family-bacteriocin	gnl\|CDD\|370615	pfam09683, Lactococcin_972, Bacteriocin (Lactococcin_972). These sequences represent bacteriocins related to lactococcin. Members tend to be found in association with a seven transmembrane putative immunity protein.	4.60159e-22
NC_003098.1\|WP_000838912.1\|102997_103669_-\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta	gnl\|CDD\|224674	COG1760, SdaA, L-serine deaminase [Amino acid transport and metabolism].	1.1908e-89
NC_003098.1\|WP_000273864.1\|96328_96655_-\|PadR-family-transcriptional-regulator	gnl\|CDD\|224609	COG1695, COG1695, Predicted transcriptional regulators [Transcription].	3.12912e-19
NC_003098.1\|WP_000571330.1\|107649_108291_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|188353	TIGR03608, L_ocin_972_ABC, putative bacteriocin export ABC transporter, lactococcin 972 group. A gene pair with a fairly wide distribution consists of a polypeptide related to the lactococcin 972 (see TIGR01653) and multiple-membrane-spanning putative immunity protein (see TIGR01654). This model represents a small clade within the ABC transporters that regularly are found adjacent to these bacteriocin system gene pairs and are likely serve as export proteins. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Unknown substrate].	1.18565e-111
NC_003098.1\|WP_000808449.1\|93717_94782_-\|membrane-protein	gnl\|CDD\|370966	pfam10310, DUF5427, Family of unknown function (DUF5427). This is a domain of unknown function. Family members found in Saccharomyces cerevisiae, are synthetic lethal with genes involved in maintenance of telomere capping. However, experimental evidence is yet to verify the exact function of family members and the domain.	1.78763e-06
NC_003098.1\|WP_000800407.1\|89930_91406_+\|DUF3502-domain-containing-protein	gnl\|CDD\|378792	pfam12010, DUF3502, Domain of unknown function (DUF3502). This presumed domain is functionally uncharacterized. This domain is found in bacteria. This domain is about 140 amino acids in length. This domain is found associated with pfam01547.	4.24398e-44
NC_003098.1\|WP_000200897.1\|101462_102095_-\|HAD-family-hydrolase	gnl\|CDD\|319798	cd04302, HAD_5NT, haloacid dehalogenase (HAD)-like 5'-nucleotidases similar to the Pseudomonas aeruginosa PA0065. 5'-nucleotidases dephosphorylate nucleoside 5'-monophosphates to nucleosides and inorganic phosphate. Purified Pseudomonas aeruginosa PA0065 displayed high activity toward 5'-UMP and 5'-IMP, significant activity against 5'-XMP and 5'-TMP, and low activity against 5'-CMP. This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	3.79283e-97

>NC_003098.1|WP_000273864.1|96328_96655_-|PadR-family-transcriptional-regulator
MYFPTSSALIEFLILAVLEQGDSYGYEISQTIKLIANIKESTLYPILKKLEGNSFLTTYSREFQGRMRKYYSLTNGGIEQLLTLKDEWTLYTDTINGIIEGSIRHDKN
>NC_003098.1|WP_000198679.1|95748_96342_-|DUF1700-domain-containing-protein
MTRTEYLTQLELYLKKLPEADRIEAMDYFRELFDDAGIEGEEELIASLGTPKEAAHEVLSNLLDKKINEAPAQKNNRQILHIALLALLAAPIGIPLGIAILVTLFAILVAALTVILAFFAVSILGIIGGFLFLVESFTVLAQAKSAFILIFGSGLLAIGASSLVLLGISYVARFFGLLIVRLVQFVLKKGKRGNQHA
>NC_003098.1|WP_001233696.1|94844_95756_-|DUF4097-domain-containing-protein
MRKWTKGFLIFGVVTTVIGFILLFVGIQSDGIKSLLSMSKEPVYDSRTEKLTFGKEVENLEITLHQHTLTITDSFDDQIHISYHPSLSAHHDLITNQNDRTLSLTDKKLSETPFLSSGIGGILHIASSYSSRFEEVILRLPKGRTLKGINISANRGQTTIINASLENATLNTNSYILRIEGSRIKNSKLTTPNIVNIFDTVLTDSQLESTENHFHAENIQVHGKVELTAKDYLRIILDQKESQRINWDISSNYGSIFQFTREKPESRGTELSNPYKTEKTDVKDQLIARSDDNIDLISTPSRR
>NC_003098.1|WP_000808449.1|93717_94782_-|membrane-protein
MKQEWFESNDFVKTTSKNKPEEQAQEVADKAEETIADLDTPIEKNTQLEEEVSQAEVELESQQEEKIETPEDSEARTKIEEKKASNSTEEEPDLSKETEKVTIAEESQEALPQQKATTKEPLLISKSLESPYIPDQAPKSRDKWKEQVLDFWSWLVEAIKSPTSKLETSITHSYTAFLLLILFSASSFFFSIYHIKHAYYGHIASINSRFPEQLAPLTLFSIVSILVATTLFFFSFLLGSFVVRRFIHQEKDWTLDKVLQQYSQLLAIPIFLTAIASFFAFFDSLRFTALLCVISIGIILLASLHIITRPSQASETDSFYQLFLSVLVNGVIILLFFVAEVALIGDYLRILAFL
>NC_003098.1|WP_001140349.1|92785_93646_+|DUF4299-domain-containing-protein
MAKTFFIPNKQSILGEQEILNAKSILALLDGLESHSYDVVYLRQPLNRLEYIECAIVGQSQFLFKVSYADGQKAYRVDLPDLLTKTDWQIIKSFLDALLAYTGTDIEGLDGFDFEAYFQASIQAYLADPVARFTICQGIFNPIFFSRENLKSFLEADGLAQFEARVRAVQETDAYFARVSFYQDGEGKVHGVYHLAQGVKTVLPREPFVPAAYIEQLVDKEVQWEIDLVQITGDGSKPEDYEAIARLDYAKFLEVLPPSFYHQLDANQIEIQPILGQDFKTLAQEK
>NC_003098.1|WP_001030031.1|91677_92664_+|rhodanese-related-sulfurtransferase
MAKDIRVLLYYLYTPIENAEQFAADHLAFCKSIGLKGRILVADEGINGTVSGDYETTQKYMDYVHSLPGMEELWFKIDEENEQAFKKMFVRYKKEIVHLGLEDNDFDNDINPLETTGAYLSPKEFKEALLDKDTVVLDTRNDYEYDLGHFRGAIRPDIRNFRELPQWVRDNKEKFMDKRVVVYCTGGVRCEKFSGWMVREGYKDVGQLHGGIATYGKDPEVQGELWDGKMYVFDERIAVDVNHVNPTIVGKDWFDGTPCERYVNCGNPFCNRRILTSEENEDKYLRGCSHECRVHPRNRYVSKNELTQAEVIERLAAIGESLDQAATV
>NC_003098.1|WP_000800407.1|89930_91406_+|DUF3502-domain-containing-protein
MKNWKKYAFASASVVALAAGLAACGNLTGNSKKAADSGDKPVIKMYQIGDKPDNLDELLANANKIIEEKVGAKLDIQYLGWGDYGKKMSVITSSGENYDIAFADNYIVNAQKGAYADLTELYKKEGKDLYKALDPAYIKGNTVNGKIYAVPVAANVASSQNFAFNGTLLAKYGIDISGVTSYETLEPVLKQIKEKAPDVVPFAIGKVFIPSDNFDYPVANGLPFVIDLEGDTTKVVNRYEVPRFKEHLKTLHKFYEAGYIPKDVATSDTSFDLQQDTWFVREETVGPADYGNSLLSRVANKDIQIKPITNFIKKNQTTQVANFVISNNSKNKEKSMEILNLLNTNPELLNGLVYGPEGKNWEKIEGKENRVRVLDGYKGNTHMGGWNTGNNWILYINENVTDQQIENSKKELAEAKESPALGFIFNTDNVKSEISAIANTMQQFDTAINTGTVDPDKAIPELMEKLKSEGAYEKVLNEMQKQYDEFLKNKK
>NC_003098.1|WP_001075102.1|88749_89673_+|carbohydrate-ABC-transporter-permease
MAKKKIKKEKIDNVGIHSFSKKADIFFSIISGLIALSCILPFVFVIIISVTDEKSLLQYGYSFFPSQFGLDGFEFLAQFKDKILQALFISVFVTVVGTLTNVFITTTYAYAISRTTFKYRRFFTIFVLLSMLFNAGLVPGYIMVTRVLQLGDTVWALIVPMLLSPFNIILMRSFFKKTIPEAILESARIDGASEARIFFQICLPLSLPGIATITLLTALGFWNDWFNALLYIKSDNLYPLQYLLMQIQQNMDYIAKAVGLTGQLGVALPKETGRMAMVVVATLPIAILYPFFQRYFVKGLTIGGVKE
>NC_003098.1|WP_000714582.1|87806_88736_+|sugar-ABC-transporter-permease
MKKFSKTLRDNWIFLLMVLPGALWLILFFYIPVFGNVVAFKDYHMTSNGFIDSIINSKWVGLDNFRFLFSSRDAFIITRNTVLYNLGFIFLGLVVSVGIAIILSELRSKRMVKIFQTSMLFPYFLSWVIISFFTDAFLNIDKGVFNHLLESLGLKEVNFYADLGIWPYLLLFLGIWKGFGYSSVMYYATIMGIDPTYYEAATVDGASKWQRIRNVTIPQLTPLVTVLTILAVGNIFRADFGLFYQIPHNAGQLYNVTNVLDVYVFNGLTQTADIGMAAAAGLYQSVVGLILVILSNLLARRVDPNSALF
>NC_003098.1|WP_001809441.1|87266_87488_+|hypothetical-protein
MSLQIKLKKLAKELSKLLKDSNLETVDKDVLENSQKELQKAVLFLADEKGSEHTEAEVIDNLKEVIAKLKANA
>NC_003098.1|WP_000744894.1|96793_97960_-|CynX/NimT-family-MFS-transporter
MKKQSLFFVPGIILIGVSLRTPFTVLPIILGNISQGLEVEVSSLGVLTSLPLLMFTLFSPFSTQLAQKIGLEHLFTYSLFFLTIGSLIRLINLPLLYLGTLMVGASVAVINVLLPSLIQANQPKKIGFLTTLYVTSMGIATALASYLAVPITQASSWKGLILLLTLLCLATFLVWLPNHRYNHRLAPQTKQKSQIKVMRNKQVWAIIIFSGFQSLIFYTVMTWLPTMSIHAGLSSHEAGLLTSILSLISIPFSMTIPSLTTSLSTRNRQLMLTLVSLAGVIGISMLFFPINNFIYWLAIHLLIGTATSALFPYLMVNFSLKTSAPEKTAQLSGLSQTGGYILAAFGPTLFGYSFDLFHSWVPSVAALLLIDILMTVALFTVDRADKIL
>NC_003098.1|WP_000096185.1|98017_99175_+|glycosyltransferase-family-2-protein
MSSKVSGFQDKNGKVLKIMIEWWKEKFRRVVVTQNVESLLVSIVISAYNEEKYLPGLIEDLKNQTYPKEDIEILFINAMSTDGTTAIIQQFIKEDTEFNSIRLYNNPKKNQASGFNLGVKHSVGDLILKIDAHSKVTESFVMNNVAIIQQGEFVCGGPRPTIVEGKGKWAETLHLVEENMFGSSIANYRNSSEDRYVSSIFHGMYKREVFQKVGLVNEQLGRTEDNDIHYRIREHGYKIRYSPSILSYQYIRPTFKKMLHQKYSNGLWIGLTSHVQFKCLSLFHYVPCLFVLSLVFSLALLPITFVFITLLLGAYFLLLSLLTLLTLLKHKNGFLIVMPFLLFSIHFAYGLGTIVGLIRGFKWKKEYKGTIIYLDKISQINKNML
>NC_003098.1|WP_001035701.1|99216_101067_+|polysaccharide-biosynthesis-protein
MNKKLTDYVIDLVEILNKQQKQVFWGIFDIFSMVVSIIVSYILFYGLINPAPVDYIIYTSLAFLFYQLMIGFWGLNASISRYSKITDFMKIFFGVTASSVLSYSICYAFLPLFSIRFIILFILLSTFLILLPRITWQLIYSRRKKGSGDGEHRRTFLIGAGDGGALFMDSYQHPTSELELVGILDKDSKKKGQKLGGIPVLGSYDNLPELAKRHQIERVIVAIPSLDPSEYERILQMCNKLGVKCYKMPKVETVVQGLHQAGTGFQKIDITDLLGRQEIRLDESRLGAELTGKTILVTGAGGSIGSEICRQVSRFNPERIVLLGHGENSIYLVYHELIRKFQGIDYVPVIADIQDYDRLLQVFEQYKPAIVYHAAAHKHVPMMERNPKEAFKNNIRGTYNVAKAVDEAKVSKMVMISTDKAVNPPNVMGATKRVAELIVTGFNQRSQSTYCAVRFGNVLGSRGSVIPVFERQIAEGGPVTVTDFRMTRYFMTIPEASRLVIHAGAYAKDGEVFILDMGKPVKIYDLAKKMVLLSGHTESEIPIVEVGIRPGEKLYEELLVSTELVDNQVMDKIFVGKVNVMPLESINQKIREFRTLSGDELKQAIIAFANQTTHIE
>NC_003098.1|WP_000200897.1|101462_102095_-|HAD-family-hydrolase
MTSITAIFFDLDGTLVDSSIGIHNAFTYTFKELGVPSPDAKTIRGFMGPPLESSFATCLSKDQISEAVQIYRSYYKAKGIYEAQLFPQIIDLLEELSSSYPLYITTTKNTSTAQDMAKNLEIHHFFDGIYGSSPEAPHKADVIHQALQTHQLVPQQAIIIGDTKFDMLGARETGIQKLAVTWGFGEQADLLNYQPDYIAHKPLEVLAYFQ
>NC_003098.1|WP_000500038.1|102116_102989_-|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha
MFYSIKELVEQADLDFQGNVAELMITTEFELTGREREEVFLLMERNLEVMKASVQLGLNENKSRSGLTGGDAAKLDHYIENGKTLSDYTILSAARNAIAVNEHNAKMGLVCATPTAGSAGCLPSVLTAAIEKLDLSHEQQLDFLFAAGAFGLVIANNASISGAEGGCQAEVGSASAMSAAALTLAAGGTPYQASQAIAFVIKNMLGLICDPVAGLVEVPCVKRNAMGASFAFIAADMALAGIESKIPVDEVIDAMYQVGASMPTAFRETAEGGLATTPTGRRLQKEIFGE
>NC_003098.1|WP_000838912.1|102997_103669_-|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta
MKSLRFQSVFDIIGPVMIGPSSSHTAGAVRIGKIVSSIFDDTPTEVEFQLFNSFAKTYRGHGTDLALVAGILGMDTDDPEIPNSLEIAHKRGIKIVWTIQKDSNAPHPNTTKITVKNAHKTISVTGISIGGGNIQVTELNGFAVSLNMNTPTIIIVHQDIPGMIALVTEALSRYGINIAQMNVTREKAGEKAIMIIEVDSRNCDEAIEEIRKIPHLHNVNFFK
>NC_003098.1|WP_000836441.1|103910_104414_+|LysM-peptidoglycan-binding-domain-containing-protein
MKSITKKIKATLAGVAALFAVFAPSFVSAQESSTYTVKEGDTLSEIAETHNTTVEKLAENNHIDNIHLIYVDQELVIDGPVAPVATPAPATYAAPAAQDETVSAPVAETPVVSETVVSTVSGSEAEAKEWIAQKESGGSYTATNGRYIGRYGSWTAAKNFWLNNGWY
>NC_003098.1|WP_073077611.1|105196_105490_+|lactococcin-972-family-bacteriocin
MIGEINHEKIGVASLMVCSILASTSVLAVWVDGGQWNYGVGWSGNFGYSDYLHSTRSHTATVKDGNKFSKDRAEAEAWARASIFKFPPTGMEYFYGF
>NC_003098.1|WP_000723959.1|105544_107653_+|bacteriocin-associated-integral-membrane-family-protein
MKKISHLCMLLLLLCTTFFVFNVNYTREVVRIQEMGKTVDSLDLYLKDINEPAASVLRFFEDVSKEYKVSIIKTDSGDEVVKSGVFDKDTFPYQEFGISSLDFTTDGEGVYSNKEISNKLGTIPTFLKAKPIQLMTFQTYIKDTSRSLNGRYTITSTQEMDKDRIVQKWSDFFKIDQATLLEPTYKSAVEVINRDLLLSAIVFVLAILLLVLVTVYQPMMEMKRVGVQKLLGFQDRAVLADVVKGNLYLLLGGALVINLGVFFLLDYKPKDLFPMLWLSHFLLLQLYLFISWLTYLLIQKMTISSLLKGFSSFKFGLIFNYVMKIGTTILLTALLIGVGRSLEQENKELAYQQQWVSQGNYLTLETFKLNDNLWQEELAGSGKSTDYFYRFYQDLVEKTQAGYVQSSSLPVKNFVQSEQIQQYQLTDTVDVYYANRNFLKSKGFKLPDTGIKKVILMPASTKGEEDKNQLLGKLIAFHSMKYEEQQKRTIEEMDVEIAYYEGDWSFFPYSDKRKENLSNPIISLVNDSDMMWDEKASLSTTGLNNPIKIENTVQHQKEITELVEKLSDGNYLKFSSIQAIQQEKVDSYRDAVRNFNLLFALFGLLSMMISYFLLVTTFLLKRRDIITKKFMGWKLVDRYRPLLVLLLLGYSFPLLVLIFFAHAFLPLLLFAGFTCLDILFVLGLASRMEKRSLVELLKGGIL
>NC_003098.1|WP_000571330.1|107649_108291_+|ABC-transporter-ATP-binding-protein
MIELKNITKTIGGKVILDNLSLRIDQGDLVAIVGKSGSGKSTLLNLLGLIDGDYSGRYEIFGQTNLAVNSAKSQTIIREHISYLFQNFALIDDETVEYNLMLALKYVKLPKKDKLKKVEEILERVGLSATLHQRVSELSGGEQQRIAVARAILKPSQLILADEPTGSLDPENRDLVLKFLLEMNREGKTVIIVTHDAYVAQQCHRVIELGEGK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_003098_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_003098_2

1380485-1380606

Orphan

Consensus_repeat	Method
ACTTCTGGTGTCGGTACATTTGGTGTTGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_003098_2

>merge|NC_003098|2|1380485-1380606|CRISPRCasFinder
ACTTCTGGTGTTGAAACAGCTGGAGTTGGTTGTACTGGCACTTCTGGTGTCGGTACATTTGGTGTTGGTTGCGCTGGCACAGGTTTAACCGGTACTTCTGGTGTCGGCACATTTGGTGTTGG

>NC_003098|2|2|1380485-1380606|CRISPRCasFinder
ACTTCTGGTGTTGAAACAGCTGGAGTTGG	TTGTACTGGCACTTCTGGTGTCGGTACATTTGGTGTTGGTTGCGCTGGCACAGGTTTAACCGGT
ACTTCTGGTGTCGGCACATTTGGTGTTGG

Protein	Signature genes	Signature genes Name	Protein_function
NC_003098.1\|WP_000032453.1\|1393745_1396442_-\|cation-translocating-P-type-ATPase	unknown	unknown	gnl\|CDD\|319781
NC_003098.1\|WP_000565221.1\|1377127_1377493_-\|VOC-family-protein	unknown	unknown	gnl\|CDD\|319923
NC_003098.1\|WP_000689596.1\|1372513_1372873_-\|S1-RNA-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|180908
NC_003098.1\|WP_001138809.1\|1399940_1401125_-\|CCA-tRNA-nucleotidyltransferase	unknown	unknown	gnl\|CDD\|237339
NC_003098.1\|WP_000822855.1\|1390808_1392404_-\|hypothetical-protein	unknown	unknown	unknown
NC_003098.1\|WP_000777789.1\|1377485_1378673_-\|pyridoxal-phosphate-dependent-aminotransferase	unknown	unknown	gnl\|CDD\|235596
NC_003098.1\|WP_000412220.1\|1392415_1392826_-\|peptide-deformylase	unknown	unknown	gnl\|CDD\|181704
NC_003098.1\|WP_000813913.1\|1396745_1397930_+\|CDF-family-manganese-efflux-transporter-MntE	unknown	unknown	gnl\|CDD\|223131
NC_003098.1\|WP_000039621.1\|1379478_1380027_+\|NAD(P)H-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|223508
NC_003098.1\|WP_000508266.1\|1390477_1390642_-\|YczI-family-protein	unknown	unknown	gnl\|CDD\|315732
NC_003098.1\|WP_000068664.1\|1374569_1374809_-\|30S-ribosomal-protein-S18	unknown	unknown	gnl\|CDD\|178997
NC_003098.1\|WP_000609607.1\|1374840_1375311_-\|single-stranded-DNA-binding-protein-SsbA	unknown	unknown	gnl\|CDD\|180915
NC_003098.1\|WP_000747251.1\|1378669_1379158_-\|DUF5590-domain-containing-protein	unknown	unknown	gnl\|CDD\|227656
NC_003098.1\|WP_001279128.1\|1398072_1399944_-\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|223562
NC_003098.1\|WP_162496016.1\|1375765_1377112_-\|asparagine--tRNA-ligase	unknown	unknown	gnl\|CDD\|235176
NC_003098.1\|WP_000697775.1\|1389670_1390399_-\|peroxide-stress-protein-YaaA	unknown	unknown	gnl\|CDD\|234999
NC_003098.1\|WP_001277399.1\|1392941_1393733_-\|glutathione-dependent-disulfide-bond-oxidoreductase	unknown	unknown	gnl\|CDD\|183298
NC_003098.1\|WP_001151785.1\|1375322_1375613_-\|30S-ribosomal-protein-S6	unknown	unknown	gnl\|CDD\|179034
NC_003098.1\|WP_001245194.1\|1388135_1389620_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|285470
NC_003098.1\|WP_000339028.1\|1372874_1374275_-\|bifunctional-Cof-type-HAD-IIB-family-hydrolase/peptidylprolyl-isomerase	unknown	unknown	gnl\|CDD\|223725

Protein	Function_ID	Function_description	E-value
NC_003098.1\|WP_000032453.1\|1393745_1396442_-\|cation-translocating-P-type-ATPase	gnl\|CDD\|319781	cd02089, P-type_ATPase_Ca_prok, prokaryotic P-type Ca(2+)-ATPase similar to Synechococcus elongatus sp. strain PCC 7942 PacL and Listeria monocytogenes LMCA1. Ca(2+) transport ATPase is a plasma membrane protein which pumps Ca(2+) ion out of the cytoplasm. This prokaryotic subfamily includes the Ca(2+)-ATPase Synechococcus elongatus PacL, Listeria monocytogenes Ca(2+)-ATPase 1 (LMCA1) which has a low Ca(2+) affinity and a high pH optimum (pH about 9) and may remove Ca(2+) from the microorganism in environmental conditions when e.g. stressed by high Ca(2+) and alkaline pH, and the Bacillus subtilis putative P-type Ca(2+)-transport ATPase encoded by the yloB gene, which is expressed during sporulation. This subfamily belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.	0
NC_003098.1\|WP_000565221.1\|1377127_1377493_-\|VOC-family-protein	gnl\|CDD\|319923	cd07262, VOC_like, uncharacterized subfamily of vicinal oxygen chelate (VOC) family. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	7.17516e-33
NC_003098.1\|WP_000689596.1\|1372513_1372873_-\|S1-RNA-binding-domain-containing-protein	gnl\|CDD\|180908	PRK07252, PRK07252, S1 RNA-binding domain-containing protein.	7.1116e-79
NC_003098.1\|WP_001138809.1\|1399940_1401125_-\|CCA-tRNA-nucleotidyltransferase	gnl\|CDD\|237339	PRK13299, PRK13299, tRNA CCA-pyrophosphorylase; Provisional.	0
NC_003098.1\|WP_000777789.1\|1377485_1378673_-\|pyridoxal-phosphate-dependent-aminotransferase	gnl\|CDD\|235596	PRK05764, PRK05764, aspartate aminotransferase; Provisional.	0
NC_003098.1\|WP_000412220.1\|1392415_1392826_-\|peptide-deformylase	gnl\|CDD\|181704	PRK09218, PRK09218, peptide deformylase; Validated.	5.2801e-91
NC_003098.1\|WP_000813913.1\|1396745_1397930_+\|CDF-family-manganese-efflux-transporter-MntE	gnl\|CDD\|223131	COG0053, MMT1, Predicted Co/Zn/Cd cation transporters [Inorganic ion transport and metabolism].	8.79178e-101
NC_003098.1\|WP_000039621.1\|1379478_1380027_+\|NAD(P)H-dependent-oxidoreductase	gnl\|CDD\|223508	COG0431, COG0431, Predicted flavoprotein [General function prediction only].	7.71803e-33
NC_003098.1\|WP_000508266.1\|1390477_1390642_-\|YczI-family-protein	gnl\|CDD\|315732	pfam13129, DUF3953, Protein of unknown function (DUF3953). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 47 and 76 amino acids in length.	0.00129706
NC_003098.1\|WP_000068664.1\|1374569_1374809_-\|30S-ribosomal-protein-S18	gnl\|CDD\|178997	PRK00391, rpsR, 30S ribosomal protein S18; Reviewed.	3.32721e-37
NC_003098.1\|WP_000609607.1\|1374840_1375311_-\|single-stranded-DNA-binding-protein-SsbA	gnl\|CDD\|180915	PRK07275, PRK07275, single-stranded DNA-binding protein; Provisional.	1.66017e-101
NC_003098.1\|WP_000747251.1\|1378669_1379158_-\|DUF5590-domain-containing-protein	gnl\|CDD\|227656	COG5353, COG5353, Uncharacterized protein conserved in bacteria [Function unknown].	3.50527e-59
NC_003098.1\|WP_001279128.1\|1398072_1399944_-\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|223562	COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only].	0
NC_003098.1\|WP_162496016.1\|1375765_1377112_-\|asparagine--tRNA-ligase	gnl\|CDD\|235176	PRK03932, asnC, asparaginyl-tRNA synthetase; Validated.	0
NC_003098.1\|WP_000697775.1\|1389670_1390399_-\|peroxide-stress-protein-YaaA	gnl\|CDD\|234999	PRK02101, PRK02101, peroxide stress protein YaaA.	5.15942e-96
NC_003098.1\|WP_001277399.1\|1392941_1393733_-\|glutathione-dependent-disulfide-bond-oxidoreductase	gnl\|CDD\|183298	PRK11752, PRK11752, putative S-transferase; Provisional.	0
NC_003098.1\|WP_001151785.1\|1375322_1375613_-\|30S-ribosomal-protein-S6	gnl\|CDD\|179034	PRK00453, rpsF, 30S ribosomal protein S6; Reviewed.	1.40041e-37
NC_003098.1\|WP_001245194.1\|1388135_1389620_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|285470	pfam08270, PRD_Mga, M protein trans-acting positive regulator (MGA) PRD domain. Mga is a DNA-binding protein that activates the expression of several important virulence genes in group A streptococcus in response to changing environmental conditions. This corresponds to the PRD like region.	1.45024e-76
NC_003098.1\|WP_000339028.1\|1372874_1374275_-\|bifunctional-Cof-type-HAD-IIB-family-hydrolase/peptidylprolyl-isomerase	gnl\|CDD\|223725	COG0652, PpiB, Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family [Posttranslational modification, protein turnover, chaperones].	1.96309e-61

>NC_003098.1|WP_000039621.1|1379478_1380027_+|NAD(P)H-dependent-oxidoreductase
MSKKVLFIVGSLRQGSFNHQMALEAEKALAGKAEVSYLDYSALPLFSQDLEVPTHPAVAAAREAVLVADAIWIFSPVYNFSIPGTVKNLLDWLSRALDLSDTRRVSALQDKFVTVSSVANAGHDQLFAIYKDLLPFIRTQGVGDFTAARVNDSAWADGKLVLEETVLNSLEKQAQDLVEAIQ
>NC_003098.1|WP_000747251.1|1378669_1379158_-|DUF5590-domain-containing-protein
MKKRQNKAKNNLLWQYGLGMTILFVVISASFLYMVSLSMKPYQTAKSEGEKLAQQYAGLEQADQVDLYNGLESYYSVLGRNKQQEALAVLIGKDDHKIYVYQLNQGISQEKAETVSKEKGAGEIDKITFGRYQDKPIWEVKSGSDFYLVDFETGALVNKEGL
>NC_003098.1|WP_000777789.1|1377485_1378673_-|pyridoxal-phosphate-dependent-aminotransferase
MKLSNRVLEMEESVTLAAGARAKALKAEGRDILSLTLGEPDFTTPKNIQDAAIASIRDGRASFYTVTSGLPELKAVVNSYFERFYGYSVASNQVTVAAGAKYSLYTFFMAVVNPGDEVIIPTPYWVSYGDQVKMAEGVPVFVSAKEDNHFKVTVEQLEAARTDKTKVLVLNSPSNPTGMIYTREELLAIGNWAVENDILILADDIYGRLVYNGHEFTPISSLSEAIRKQTVVINGVSKTYAMTGWRIGYAVGEADIIAAMSKIAGQTTSNPSAVAQYAAVEALSGEQDTVESMRQAFEERLNTIYPLLAEVPGFEVVKPQGAFYLFPNVKKAMEMKGYTDVTDFTTAILEEAEVALVTGAGFGAPENVRLSYATDLDTLKEAVERLKAFMGSEND
>NC_003098.1|WP_000565221.1|1377127_1377493_-|VOC-family-protein
MIDHFEIKVKDLQISEGFYRSFLAPLDYKLAFKTSSLISFLSPNSPHPGGDFWLTQGTQDPVHFAFLAENKEEVQACYEAGLEAGGRDNGVPGYRSEHPIYYAAFMIDLDGNNIEVVCHKE
>NC_003098.1|WP_162496016.1|1375765_1377112_-|asparagine--tRNA-ligase
MMTKRVTIIDVKDYVGQEVTIGAWVANKSGKGKIAFLQLRDGTAFFQGVAFKPNFVEKFGEEVGLEKFDVIKRLSQETSVYVTGIVKEDERSKFGYELDITDIEVIGESQDYPITPKEHGTDFLMDNRHLWLRSRKQVAVLQIRNAIIYVTYEFFDKNGFMKFDSPILSGNAAEDSTELFETDYFGTPAYLSQSGQLYLEAGAMALGRVFDFGPVFRAEKSKTRRHLTEFWMMDAEYSYLTHDESLDLQEAYVKALLQGVLDRAPQALETLERDTELLKRYIAEPFKRITYDQAIDLLQEHENDEDADYEHLEHGDDFGSPHETWISNHFGVPTFVMNYPAAIKAFYMKPVPGNPERVLCADLLAPEGYGEIIGGSMREEDYDALVAKMDELGMDRTEYEFYLDLRKYGTVPHGGFGIGIERMVTFAAGTKHIREAIPFPRMLHRIKP
>NC_003098.1|WP_001151785.1|1375322_1375613_-|30S-ribosomal-protein-S6
MAKYEILYIIRPNIEEEAKNALVARFDSILTDNGATVVESKTWEKRRLAYEIQDFREGLYHIVNVEANDDAALKEFDRLSKINADILRHMIVKIDA
>NC_003098.1|WP_000609607.1|1374840_1375311_-|single-stranded-DNA-binding-protein-SsbA
MINNVVLVGRMTRDAELRYTPSNVAVATFTLAVNRTFKSQNGEREADFINVVMWRQQAENLANWAKKGSLIGVTGRIQTRSYDNQQGQRVYVTEVVAENFQMLESRSVREGHTGGAYSAPTANYSAPTNSVPDFSRNENPFGATNPLDISDDDLPF
>NC_003098.1|WP_000068664.1|1374569_1374809_-|30S-ribosomal-protein-S18
MAQQRRGGFKRRKKVDYIAANKIEYVDYKDTELLSRFVSERGKILPRRVTGTSAKNQRKVTTAIKRARVMALMPFVNED
>NC_003098.1|WP_000339028.1|1372874_1374275_-|bifunctional-Cof-type-HAD-IIB-family-hydrolase/peptidylprolyl-isomerase
MDAKLRYKAKKIKIVFFDIDDTLRNSKTGFIPTTIPTVFKQLREKGILTGIASGRGIFGVVPEIRDLKPDFFVTLNGAYIEDKKGQVIYQHQIEKSYVEEYISWAKQEGIEYGLVGSHDAKLSTRTDMMSEAINPIYPDLDVDPDFHEKEDIYQMWTFEDKGDDLHLPDSLSDKLRMVRWHQHSSDIVPISGSKATGVEKVVEHLGLKPEKVMVFGDGLNDLELFDYAGISVAMGISHDKIKEKADYITKTLEEDGIFDALEVFGMVEKELHFPQVDIETVEGPLATIKTNHGDLRIKLFPEHAPKTVANFVSLSKDGYYDGVIFHRIIKDFMIQGGDPTGTGMGGESIYGESFEDEFSEELYNIRGALSMANAGPNTNGSQFFIVQNQHLPYSKKEITRGGWPEPIAEIYANQGGTPHLDRRHTVFGQLADEASYAVLDVIAAVETGAMDKPVEDVVIETIEIED
>NC_003098.1|WP_000689596.1|1372513_1372873_-|S1-RNA-binding-domain-containing-protein
MKIGDKLKGRITGIQPYGAFVELETGDTGLIHISEIRTGFIENIHETLKVDEEVQVQVVDLDEFTGKASLSIRTLEEEKYQFPRRRRFSSDRFNYGFAPFRRMLPIWTGEALHHLKKKK
>NC_003098.1|WP_001245194.1|1388135_1389620_+|helix-turn-helix-domain-containing-protein
MRNLLSTKVQRQLRLMETLIQNRNWMKLHELAEKLGCTERILKSDLNELRIAFPSINIQSSVNGIMIDLEVNTSVEDIYQYFLANSQSFQLLEYMFFNEGLPIYRTIENLYFSSANLYRLGRNITKVLSSQFQIELSFTPSEIRGNEIDIRYFFAQYFSERYYFLDWPFPDLPEEDLTEFADFFYKITNYPMRFSIYRMYKLMIAISIHRVKNGHFIDLPNHFYKEYYPLLKSIPNFQETLAYFSKHFGLEMTPDTIAQIFISFLQNDIFLDPQEFFNSLEDNSQARYSYQLLSQILEGLSKQYKITFTNHDELIWHLHNTAFFERQEIFSTPILFEQKALTIKKFEVYFPDFMGSARQELAQYRQAIGQHDHPEQLEHLMYTILTHAENLSTQLLENRPPIKVLIISNFDHAISLTFVDMLSYYCNNRFTFDIWDELKTSPEILNQTDYDIIVSNFYIPGITKKFICRNHLSIMNLVNHLNTLSNEIHLSNTL
>NC_003098.1|WP_000697775.1|1389670_1390399_-|peroxide-stress-protein-YaaA
MKILIPTAKEMNTDLPSIEAIPLKPESQTVLDALALYSASQLESFYKVSAEKAAEEFQNIQALKRQTAQHYPALKLFDGLMYRNIKRDKLTEAEQDYLENHVFITSALYGVVPALSPMAPHRLDFLMKLKVAGKTLKSHWKAVYDEALKKEEVIFSLLSSEFETVFSKEIRAKMVTFKFMEDRGGQLKIHSTISKKARGAFLTALIENQVQTVGEARRLNFAGFVYREDLSQPQGLVFVKEV
>NC_003098.1|WP_000508266.1|1390477_1390642_-|YczI-family-protein
MGFYLMVASMLLGLLALKIGFSQFKEKKDKFLSILTSLAGIALVLAAVWLGWPK
>NC_003098.1|WP_000822855.1|1390808_1392404_-|hypothetical-protein
MKRIVFELIFIATTWYIFLPPLNLTSWEFLFFLCGHLLVVAILFGFGKGINLVKTVHVRHGKAEAALNLEGFKINRLGKILLASIGGILLLAALVSLVTSSMFQAKNYANVVTVTEKDFTEFPKSDTSKVPILDRSTAEKIGDRYLGSLTDKVSQYVAADTYTQLTIDGKPYRVTPLEYADPIKWFNNQAKGIGEYIKVDMVTGNADLVDLKTPIKYSDSEYFNRDVKRHLRLKYPTKIFKTPSFEVDDEGNPFYVATVYQKQFGLAVPRPASVIILDATNGETKEYSLSDVPEWVDRIYPAEETIEQINYNGKYKDGFLNAMISKKNVTQTTKGYNYLSIGNDIYLYTGVTSANADESNLGFILENMRTGEITKYSLASATEESARESAEGAVQEKSYKATFPILINLNDKPLYIMGLKDNAGLVKEYALVDAVEYQNVIVATTVEEMLSKYANKNDLEIDNATTESIKGVVADLKSAVIKGDTVYFFKVDGKIYKVKASVSDDLPYLENGKTFEGQVGKDNYLKTFKVQ
>NC_003098.1|WP_000412220.1|1392415_1392826_-|peptide-deformylase
MEKKIVKDILFLSQVSQPASQEDLYLARDLQDTLLANRDTCVGLAANMIGVQKRVIIFNLGLVPVVMFNPVLLSFEGSYEAEEGCLSLVGVRSTKRYETIRLAYRDSKWQEQTITLTGFPAQICQHELDHLEGRII
>NC_003098.1|WP_001277399.1|1392941_1393733_-|glutathione-dependent-disulfide-bond-oxidoreductase
MSAYQLPTVWQDEASNQGAFTGLNRPTAGARFEQNLPKGEQAFQLYSLGTPNGVKVTILLEELLEAGFKEAAYDLYKIAIMDGDQFGSDFVKLNPNSKIPALLDQSGTEDVRVFESAHILLYLAEKFGAFLPSNPVEKVEVLNWLFWQAGAAPFLGGGFGHFFNYAPEKLEYPINRFTMEVKRQLDLLDKELAQKPYIAGNDYTIADIAIWSWYGQLVQGNLYQGSAKFLDASSYQNLVKWAEKIANRPAVKRGLEVTYTEIK
>NC_003098.1|WP_000032453.1|1393745_1396442_-|cation-translocating-P-type-ATPase
MSKEQKRQAFYTQSPEEVLQAVDATEQGLSSSEAEKRLAEFGHNELEEGEKRSILVKFIEQFKDLMIIILVAAAILSVVTSGGEDIADAIIILAVVIINAAFGVYQEGKAEEAIEALKSMSSPVARVLRDGHMAEIDSKELVPGDIVALEAGDVVPADLRLIEANSLKIEEAALTGESVPVEKDLSVDLATDAGIGDRVNMAFQNSNVTYGRGMGVVVNTGMYTEVGHIAGMLQDADETDTPLKQNLNNLSKVLTYAILVIALVTFVVGVFIQGKNPLGELLTSVALAVAAIPEGLPAIVTIVLSLGTQVLAKRHSIVRKLPAVETLGSTEIIASDKTGTLTMNKMTVEKVFYDAVLHDSADDIELGLEMPLLRSVVLANDTKIDVEGNLIGDPTETAFIQYALDKGYDVKGFLEKYPRVAELPFDSDRKLMSTVHPLPDSRFLVAVKGAPDQLLKRCLLRDKAGDIAPIDEKVTNLIHTNNSEMAHQALRVLAGAYKIIDSIPENLTSEELENDLIFTGLIGMIDPERPEAAEAVRVAKEAGIRPIMITGDHQDTAEAIAKRLGIIDANDTEGHVLTGAELNELSDEEFEKVVGQYSVYARVSPEHKVRIVKAWQKQGKVVAMTGDGVNDAPALKTADIGIGMGITGTEVSKGASDMILADDNFATIIVAVEEGRKVFSNIQKTIQYLLSANTAEVLTIFLSTLFGWDVLQPVHLLWINLVTDTFPAIALGVEPAEPGVMNHKPRGRKASFFSGGVLSSIIYQGVLQAALVMSVYGLAIAYPVHVGDNHAIHADALTMAFATLGLIQLFHAYNVKSVYQSILTVGPFKSKTFNWSILVSFILLMATIVVEPLEGIFHVTKLDLSQWGIVMAGSFSMIIIVEIVKFIQRKLGFDKNAI
>NC_003098.1|WP_000813913.1|1396745_1397930_+|CDF-family-manganese-efflux-transporter-MntE
MKQSISNLKLAERGAIISISTYLILSAAKLAAGHLLHSSSLVADGFNNVSDIIGNVALLIGIRMARQPADRDHRFGHWKIEDLASLITSIIMFYVGFDVLRDTIQKILSREESVIDPLGATLGIISAAIMFVVYLYNTRLSKKSNSKALKAAAKDNLSDAVTSLGTAIAILASSFNYPIVDKLVAIIITFFILKTAYDIFIESSFSLSDGFDDRLLEDYQKAIMEIPKISKVKSQRGRTYGSNIYLDITLEMNPDLSVFESHEIADQVESMLENRFGVFDTDVHIEPAPIPEDEILDNVYKKLLMREQLIDQGNQLEELLTDDFVYIRQDGEQMDKEAYKTKKELNSAIKDIQITSISQKTKLICYELDGIIHTSIWRRHETWQNIFHQETKKE
>NC_003098.1|WP_001279128.1|1398072_1399944_-|ABC-F-family-ATP-binding-cassette-domain-containing-protein
MSDFIVEKLSKSVGDKTVFRDISFIIHDLDRIGLIGVNGTGKTTLLDVLSGVSGFDGDVSPFSAKNDYQIGYLTQDPDFDDRKTVLDTVLSSELKEIQLIREYELIMLDYSEDKQARLERVMAEMDSLQAWEIESQVKTVLSKLGIQDLSTPIGELSGGLRRRVQLAQVLLGNHDLLLLDEPTNHLDIAIIEWLTLFLKNSKKTVLFITHDRYFLDALSTRIFELDRAGLTEYQGNYQDYVRLKAEQDERDAALLHKKEQLYKQELAWMRRQPQARATKQQARINRFHDLKKKVSGSSAETDLTMNFETSRIGKKVIEFQAVSFAYENKPILQDFNLLVQAKDRIGIVGDNGVGKSTLLNLIAGSLEPTKGQVVIGETVRIAYFSQQIEGLDESKRVINYLQEVAEEVKTSGGSTTSIAELLEQFLFPRSTHGTLIEKLSGGEKKRLYLLKLLLEKPNVLLLDEPTNDLDIATLTVLENFLQGFAGPVLTVSHDRYFLDKVATKILAFEDGKIRPFFGHYTDYLDEKAFETDMANQVQKVEKEKVVKVREDKKRMTYQEKQEWASIEGDIETLEKRIAAIEEEMQANGSDFGKLATLQKELDEKNEALLEKYERYEYLSEFDS
>NC_003098.1|WP_001138809.1|1399940_1401125_-|CCA-tRNA-nucleotidyltransferase
MPSEFQKALPVLEKIKEAGFEAYFVGGSVRDALLHSPIHDVDIATSSYPEETKQIFPRTADIGIEHGTVLVLDGDEEYEVTTFRTEDVYVDYRRPSAVSFVRSLEEDLKRRDFTVNAFALDETGEIVDLFHGLEDLEKQVLRAVGVASERFNEDALRIMRGFRFQASLGFALEPETFKAMKTLTPLLEKISVERTFVEFDKLLLAPFWRRGLASMIESQAYDYLPDMASSQDKLNRLFDLETDFTFESSEQAWAALLWALEIENAQSFLKSWKTSRQFAKQVQDLLIILALRENGELSKRDCYRFDIDLLLQAENLRQAQGKEVNPQAITEKYQSLTIHDKKEIQINGGILIKEYGYQPGPDLGEILTEIEFAIVDGELENNREAIHAYLREKK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_003098_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_003098_3

1690537-1690654

Orphan

Consensus_repeat	Method
CAAAAAAGAAAGGACAAAATTTGTCCTTTCTCGAGCTTAGCTTTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_003098_3

>merge|NC_003098|3|1690537-1690654|CRISPRCasFinder
CAAAAAAGAAAGGACAAAATTTGTCCTTTCTCGAGCTTAGCTTTTTTTCAACCCACTACAGTTGACAAAGAGCCAAAAAAGAAAGGACGAAATTTGTCCTTTCTCGAGCTTAGCTTTT

>NC_003098|3|3|1690537-1690654|CRISPRCasFinder
CAAAAAAGAAAGGACAAAATTTGTCCTTTCTCGAGCTTAGCTTTT	TTTCAACCCACTACAGTTGACAAAGAGC
CAAAAAAGAAAGGACGAAATTTGTCCTTTCTCGAGCTTAGCTTTT

Protein	Signature genes	Signature genes Name	Protein_function
NC_003098.1\|WP_000775321.1\|1699821_1700355_+\|DUF402-domain-containing-protein	unknown	unknown	gnl\|CDD\|184219
NC_003098.1\|WP_000436473.1\|1701074_1702304_+\|ISL3-family-transposase	unknown	unknown	gnl\|CDD\|225995
NC_003098.1\|WP_000455419.1\|1684517_1685777_-\|extracellular-solute-binding-protein	unknown	unknown	gnl\|CDD\|270452
NC_003098.1\|WP_000282467.1\|1704480_1704876_-\|single-stranded-DNA-binding-protein	unknown	unknown	gnl\|CDD\|180914
NC_003098.1\|WP_000917304.1\|1704040_1704325_-\|co-chaperone-GroES	unknown	unknown	gnl\|CDD\|178988
NC_003098.1\|WP_001050309.1\|1697563_1698919_-\|23S-rRNA-(uracil(1939)-C(5))-methyltransferase-RlmD	unknown	unknown	gnl\|CDD\|225174
NC_003098.1\|WP_000538933.1\|1685868_1688031_-\|alpha-galactosidase	unknown	unknown	gnl\|CDD\|225882
NC_003098.1\|WP_001107755.1\|1704953_1705715_-\|SDR-family-NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|187604
NC_003098.1\|WP_000615767.1\|1706389_1706707_-\|thioredoxin-family-protein	unknown	unknown	gnl\|CDD\|239245
NC_003098.1\|WP_000031573.1\|1702402_1704025_-\|chaperonin-GroEL	unknown	unknown	gnl\|CDD\|234573
NC_003098.1\|WP_000806561.1\|1682790_1683624_-\|carbohydrate-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223472
NC_003098.1\|WP_000705097.1\|1698956_1699733_+\|recombination-regulator-RecX	unknown	unknown	gnl\|CDD\|237619
NC_003098.1\|WP_000742225.1\|1676993_1678973_-\|peptide-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173869
NC_003098.1\|WP_000959952.1\|1688138_1688999_+\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380391
NC_003098.1\|WP_000759901.1\|1675430_1676927_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223674
NC_003098.1\|WP_000578309.1\|1705747_1706374_-\|DUF4479-and-tRNA-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|239196
NC_003098.1\|WP_000757165.1\|1683637_1684504_-\|sugar-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224096
NC_003098.1\|WP_001122333.1\|1680990_1682433_-\|sucrose-phosphorylase	unknown	unknown	gnl\|CDD\|163564
NC_003098.1\|WP_000844520.1\|1688995_1689931_+\|bifunctional-biotin--[acetyl-CoA-carboxylase]-synthetase/biotin-operon-repressor	unknown	unknown	gnl\|CDD\|237010
NC_003098.1\|WP_000835622.1\|1679659_1680853_-\|O-antigen-ligase-family-protein	unknown	unknown	gnl\|CDD\|225844

Protein	Function_ID	Function_description	E-value
NC_003098.1\|WP_000775321.1\|1699821_1700355_+\|DUF402-domain-containing-protein	gnl\|CDD\|184219	PRK13662, PRK13662, hypothetical protein; Provisional.	4.66285e-130
NC_003098.1\|WP_000436473.1\|1701074_1702304_+\|ISL3-family-transposase	gnl\|CDD\|225995	COG3464, COG3464, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	2.72624e-116
NC_003098.1\|WP_000455419.1\|1684517_1685777_-\|extracellular-solute-binding-protein	gnl\|CDD\|270452	cd14749, PBP2_XBP1_like, The periplasmic-binding component of ABC transport systems specific for xylo-oligosaccharides; possesses type 2 periplasmic binding fold. This group represents the periplasmic component of an ABC transport system XBP1 that shows preference for xylo-oligosaccharides in the order of xylotriose > xylobiose > xylotetraose. Members of this group belong to the type 2 periplasmic-binding fold superfamily. PBP2 proteins are comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. The majority of PBP2 proteins function in the uptake of small soluble substrates in eubacteria and archaea. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	3.25897e-107
NC_003098.1\|WP_000282467.1\|1704480_1704876_-\|single-stranded-DNA-binding-protein	gnl\|CDD\|180914	PRK07274, PRK07274, single-stranded DNA-binding protein; Provisional.	4.33544e-89
NC_003098.1\|WP_000917304.1\|1704040_1704325_-\|co-chaperone-GroES	gnl\|CDD\|178988	PRK00364, groES, co-chaperonin GroES; Reviewed.	2.49846e-37
NC_003098.1\|WP_001050309.1\|1697563_1698919_-\|23S-rRNA-(uracil(1939)-C(5))-methyltransferase-RlmD	gnl\|CDD\|225174	COG2265, TrmA, SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis].	5.28456e-180
NC_003098.1\|WP_000538933.1\|1685868_1688031_-\|alpha-galactosidase	gnl\|CDD\|225882	COG3345, GalA, Alpha-galactosidase [Carbohydrate transport and metabolism].	0
NC_003098.1\|WP_001107755.1\|1704953_1705715_-\|SDR-family-NAD(P)-dependent-oxidoreductase	gnl\|CDD\|187604	cd05346, SDR_c5, classical (c) SDR, subgroup 5. These proteins are members of the classical SDR family, with a canonical active site tetrad and a typical Gly-rich NAD-binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	1.04079e-139
NC_003098.1\|WP_000615767.1\|1706389_1706707_-\|thioredoxin-family-protein	gnl\|CDD\|239245	cd02947, TRX_family, TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains. Group I TRX is a small ancient protein that alter the redox state of target proteins via the reversible oxidation of an active site dithiol, present in a CXXC motif, partially exposed at the protein's surface. TRX reduces protein disulfide bonds, resulting in a disulfide bond at its active site. Oxidized TRX is converted to the active form by TRX reductase, using reducing equivalents derived from either NADPH or ferredoxins. By altering their redox state, TRX regulates the functions of at least 30 target proteins, some of which are enzymes and transcription factors. It also plays an important role in the defense against oxidative stress by directly reducing hydrogen peroxide and certain radicals, and by serving as a reductant for peroxiredoxins. At least two major types of functional TRXs have been reported in most organisms; in eukaryotes, they are located in the cytoplasm and the mitochondria. Higher plants contain more types (at least 20 TRX genes have been detected in the genome of Arabidopsis thaliana), two of which (types f amd m) are located in the same compartment, the chloroplast. Also included in the alignment are TRX-like domains which show sequence homology to TRX but do not contain the redox active CXXC motif. Group II proteins, in addition to either a redox active TRX or a TRX-like domain, also contain additional domains, which may or may not possess homology to known proteins.	3.69517e-23
NC_003098.1\|WP_000031573.1\|1702402_1704025_-\|chaperonin-GroEL	gnl\|CDD\|234573	PRK00013, groEL, chaperonin GroEL; Reviewed.	0
NC_003098.1\|WP_000806561.1\|1682790_1683624_-\|carbohydrate-ABC-transporter-permease	gnl\|CDD\|223472	COG0395, UgpE, ABC-type sugar transport system, permease component [Carbohydrate transport and metabolism].	6.38217e-68
NC_003098.1\|WP_000705097.1\|1698956_1699733_+\|recombination-regulator-RecX	gnl\|CDD\|237619	PRK14135, recX, recombination regulator RecX; Provisional.	2.79835e-112
NC_003098.1\|WP_000742225.1\|1676993_1678973_-\|peptide-ABC-transporter-substrate-binding-protein	gnl\|CDD\|173869	cd08504, PBP2_OppA, The substrate-binding component of an ABC-type oligopetide import system contains the type 2 periplasmic binding fold. This family represents the periplasmic substrate-binding component of an ATP-binding cassette (ABC)-type oligopeptide transport system comprised of 5 subunits. The transport system OppABCDEF contains two homologous integral membrane proteins OppB and OppF that form the translocation pore; two homologous nucleotide-binding domains OppD and OppF that drive the transport process through binding and hydrolysis of ATP; and the substrate-binding protein or receptor OppA that determines the substrate specificity of the transport system. The dipeptide (DppA) and oligopeptide (OppA) binding proteins differ in several ways. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	3.81605e-110
NC_003098.1\|WP_000959952.1\|1688138_1688999_+\|AraC-family-transcriptional-regulator	gnl\|CDD\|380391	cd06986, cupin_MmsR-like_N, AraC/XylS family transcriptional regulators similar to MmsR, N-terminal cupin domain. This family contains bacterial proteins containing an AraC/XylS family helix-turn-helix (HTH) DNA-binding domain C-terminal to a cupin domain, and may be possible transcriptional regulators. Included is MmsR, a bacterial transcriptional regulator thought to positively regulate the expression of the mmsAB operon. The mmsAB operon contains two structural genes involved in valine metabolism: mmsA which encodes methylmalonate-semialdehyde dehydrogenase, and mmsB which encodes 3-hydroxyisobutyrate dehydrogenase. The cupin domain of members of this subfamily does not contain a metal binding site.	6.10575e-38
NC_003098.1\|WP_000759901.1\|1675430_1676927_-\|ABC-transporter-permease	gnl\|CDD\|223674	COG0601, DppB, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	3.60763e-60
NC_003098.1\|WP_000578309.1\|1705747_1706374_-\|DUF4479-and-tRNA-binding-domain-containing-protein	gnl\|CDD\|239196	cd02796, tRNA_bind_bactPheRS, tRNA-binding-domain-containing prokaryotic phenylalanly tRNA synthetase (PheRS) beta chain. PheRS aminoacylate phenylalanine transfer RNAs (tRNAphe). PheRSs belong structurally to class II aminoacyl tRNA synthetases (aaRSs) but, as they aminoacylate the 2'OH of the terminal ribose of tRNA they belong functionally to class 1 aaRSs. This domain has general tRNA binding properties and is believed to direct tRNAphe to the active site of the enzyme.	3.53492e-46
NC_003098.1\|WP_000757165.1\|1683637_1684504_-\|sugar-ABC-transporter-permease	gnl\|CDD\|224096	COG1175, UgpA, ABC-type sugar transport systems, permease components [Carbohydrate transport and metabolism].	9.41692e-74
NC_003098.1\|WP_001122333.1\|1680990_1682433_-\|sucrose-phosphorylase	gnl\|CDD\|163564	TIGR03852, sucrose_gtfA, sucrose phosphorylase. In the forward direction, this enzyme uses phosphate to cleave sucrose into D-fructose + alpha-D-glucose 1-phosphate. Characterized representatives from Streptococcus mutans and Bifidobacterium adolescentis represent well-separated branches of a molecular phylogenetic tree. In S. mutans, the region including this gene has been associated with neighboring transporter genes and multiple sugar metabolism.	0
NC_003098.1\|WP_000844520.1\|1688995_1689931_+\|bifunctional-biotin--[acetyl-CoA-carboxylase]-synthetase/biotin-operon-repressor	gnl\|CDD\|237010	PRK11886, PRK11886, bifunctional biotin--[acetyl-CoA-carboxylase] ligase/biotin operon repressor BirA.	2.88782e-126
NC_003098.1\|WP_000835622.1\|1679659_1680853_-\|O-antigen-ligase-family-protein	gnl\|CDD\|225844	COG3307, RfaL, Lipid A core - O-antigen ligase and related enzymes [Cell envelope biogenesis, outer membrane].	1.27051e-31

>NC_003098.1|WP_000844520.1|1688995_1689931_+|bifunctional-biotin--[acetyl-CoA-carboxylase]-synthetase/biotin-operon-repressor
MKSYQAVYQILSKETDYISGEKIAEKLSLSRTSIWKAIKRLEQEGIEINSIKNRGYKLMNGDLILPEILEENLPIKVSFKPETKSTQLDAKEAIDLGHEANTLYLASYQTAGRGRFQRSFYSPQGGIYMTLHLKPNLPYDKLPSYTLLVAGAVYKAIKNLTLIDVDIKWVNDIYLNNHKIGGILTEAMTSVETGLVTDIIIGVGINFTIKDFPQELKEKAASLFKATAPITRNELIIEIWRAFFETPAEELLYLYKKQSFILGKEVTFTLEQKDYKGLAKDISENGKLLVQCDNGKEIWLNSGEISLNSWK
>NC_003098.1|WP_000959952.1|1688138_1688999_+|AraC-family-transcriptional-regulator
MLVFSEYQTGTIDLALSFYGYEECTPNYSFGPAIRDTYVLHYISKGQGKFHYKGKIVDLKEGDFFLLKPEELTFYQADSKEPWAYYWLGITGGKSPDYFALSQISDQSYLIQSETCHTQTTAKLISDIVRFAQITKSSELAQLHIMGQLHELMFHLGTIAPNQKKKNISSTHQLYLECKRLIDSHYPQSLTIQDLAKELSVHRSYLSSVFKEFNTLSPKEYLLYVRMHRARQLLENTQESIKVIAYSVGFSDPLHFSKAYKQYFNQSPSHTRKEYSQYQLVRKATL
>NC_003098.1|WP_000538933.1|1685868_1688031_-|alpha-galactosidase
MGVRIENNLFYVESKNLSLIIENRNGYLLLKHLGKTIKNYKGSNSVYERDHAFSGNPTATNRTFSLDTQRQIFGQHGLGDFRKPTIQVQHSVTEVTDFRFVEAKILKGQNGPQGLPSPHSMDDTETLVLMLEDSKAQLSLTLYYTTFNNDATIASYSKLDNNSNQEVVIHKDFSFMADFPAADYEIVTLQGAYAREKTVRRQQVEQGIFSISSNRGASGHAQTPALLLCEQGVTEDAGNVFAIQLMYSGNFEAFVQKNQLNEVRVAIGINPENFSWKLAPEEYFETPVALVTHSDQGLTGISHESQNFVLKHIILSEFSKKERPILINNWEATYFDFQREKLLELADEAKKVGIELFVLDDGWFGNRFDDNRALGDWVVNEEKLGGSLESLISAIHERGLQFGLWLEPEMISVDSDLYRQHPDWAIQVPDYEHTYSRNQLVLNLANPQVVEYLKSVLDQLLSYHEIDYIKWDMNRNITKLGNGLTYLETQMQSHQYMLGLYELVSYLTEKHSHILFESCSGGGGRNDLGMIRYFPQVWASDNTDAIARLPIQYGSSYLYPTISMGAHVSAVPNHQMGRMTPLETRGHVAMMGNLGYELDLTNLSDEEKATIANQVNLYKELRPVVQLGQQYRLINPDTASNEAAVQFNYGNQTIVTYVRVLSVVETMETTLKLKDLDEEGLYKLQENGEVYSGAELMYAGLTVILSQGDFLSRQYIFRKL
>NC_003098.1|WP_000455419.1|1684517_1685777_-|extracellular-solute-binding-protein
MEWYKKIGLLATTGLALFGLGACSNYGKSADGTVTIEYFNQKKEMTKTLEEITRDFEKENPKIKVKVVNVPNAGEVLKTRVLAGDVPDVVNIYPQSIELQEWAKAGVFEDLSNKDYLKRVKNGYAEKYAVNEKVYNVPFTANAYGIYYNKDKFEELGLKVPETWDEFEQLVKDIVAKGQTPFGIAGADAWTLNGYNQLAFATATGGGKEANQYLRYSQPNAIKLSDPIMKDDIKVMDILRINGSKQKNWEGAGYTDVIGAFARGDVLMTPNGSWAITAINEQKPNFKIGTFMIPGKEKGQSLTVGAGDLAWSISATTKHPKEANAFVEYMTRPEVMQKYYDVDGSPTAIEGVKQAGEDSPLAGMTEYAFTDRHLVWLQQYWTSEADFHTLTMNYVLTGDKEGMVNDLNAFFNPMKADVD
>NC_003098.1|WP_000757165.1|1683637_1684504_-|sugar-ABC-transporter-permease
MKKVLQKYWAWAFVVIPLLLQAIFFYVPMFQGAFYSFTNWTGLTYNYKFVGLNNFKLLFMDPKFMNAIGFTAIITIAMVVGEIALGIFIARVLNSKIKGQTFFRSWFFFPAVLSGLTVALIFKQVFNYGLPAIGNALHIEFLQTSLLGTKWGAIFAAVFVLLWQGVAMPIIIFLAGLQSIPTEITEAARIDGATSKQVFWNIELPYLLPSVSIVFILALKGGLTAFDQVFAMTGGGPNNATTSLGLLVYNYAFKNNQFGYANAIAVILFFLIVVISIIQLRVSKKFEI
>NC_003098.1|WP_000806561.1|1682790_1683624_-|carbohydrate-ABC-transporter-permease
MKQDERKALIGKYILLILGSVLILVPLLATLFSSFKPTKDIVDNFFGFPTNFTWDNFSRLLADGIGGYYWNSVVITVLSLLAVMIFIPMAAYSIARNMSKRKAFTIMYTLLILGIFVPFQVIMIPITVMMSKLGLANTFGLILLYLTYAIPQTLFLYVGYIKISIPESLDEAAEIDGANQFTTYFRIIFPMMKPMHATTMIINALWFWNDFMLPLLVLNRDSKMWTLPLFQYNYAGQYFNDYGPSFASYVVGIISITIVYLFFQRHIISGMSNGAVK
>NC_003098.1|WP_001122333.1|1680990_1682433_-|sucrose-phosphorylase
MPIQNKTMLITYSDSLGNNLKDLYDNLEEHFGDAIGGVHLLPFFPSTGDRGFAPVDYDEVDSAFGDWEDVKRLGERYYLMFDFMINHISRQSKYYKDYQEKHEASEFKALFLNWDKFWPENRPTQSDVDLIYKRKDRAPKQEIVFEDGSVEHLWNTFGEEQIDLDVTKEVTMEFIRKTIQHLASNGCDLIRLDAFAYAVKKLDTNDFFVEPDIWDLLDKVRDIAAEYGTELLPEIHEHYSIQFKIADHDYYVYDFALPMVTLYTLYSSRTERLAKWLKMSPMKQFTTLDTHDGIGVVDVKDILTDEEIDYASNELYKVGANVKRKYSSAEYNNLDIYQINSTYYSALGDDDVKYFLARLIQAFAPGIPQVYYVGLLAGKNDLKLLEETKEGRNINRHYYSNEEIAKEVQRPVVKALLNLFSFRNRSEAFDLEGTTEIETPTAHSIVIKRQNKDKSVTAVVEIDLQNQTYRVIENGVEVTF
>NC_003098.1|WP_000835622.1|1679659_1680853_-|O-antigen-ligase-family-protein
MKSIGFIEKLKGLSSKELILLGIILSIFLPFYLFVVVLCLYIISLIFTGDMKSILQKMGEHPMLLLFLSYSTVISILAQNWMGLVASVGMFLFTIFFLHYQSILSHKFFRLILQFVLFGSVLSAAFASLEHFQIVKKFNYAFLSPNMQVWHQNRAEVTFFNPNYYGIICCFCIMIAFYLFTTTKLNWLKVFCVIAGFVNLFGLNFTQNRTAFPAIIAGAIIYLFTTIKNWKAFWLSIGVFAIGLSFLFSSDLGVRMGTLDSSMEERISIWDAGMALFKQNPFWGEGPLTYMHSYPRIHAPYHEHAHSLYIDTILSYGIVGTILLVLSSVAPVRLMMDMSQESGKRPIIGLYLSFLTVVAVHGIFDLALFWIQSGFIFLLVMCSIPLEHRMLVSDMTD
>NC_003098.1|WP_000742225.1|1676993_1678973_-|peptide-ABC-transporter-substrate-binding-protein
MKKNRVFATAGLVLLAAGVLAACSSSKSSDSSAPKAYGYVYTADPETLDYLISRKNSTTVVTSNGIDGLFTNDNYGNLAPAVAEDWEVSKDGLTYTYKIRKGVKWFTSDGEEYAEVTAKDFVNGLKHAADKKSEAMYLAENSVKGLADYLSGTSTDFSTVGVKAVDDYTLQYTLNQPEPFWNSKLTYSIFWPLNEEFETSKGSDFAKPTDPTSLLYNGPFLLKGLTAKSSVEFVKNEQYWDKENVHLDTINLAYYDGSDQESLERNFTSGAYSYARLYPTSSNYSKVAEEYKDNIYYTQSGSGIAGLGVNIDRQSYNYTSKTTDSEKVATKKALLNKDFRQALNFALDRSAYSAQINGKDGAALAVRNLFVKPDFVSAGEKTFGDLVAAQLPAYGDEWKGVNLADGQDGLFNADKAKAEFAKAKKALEADGVQFPIHLDVPVDQASKNYISRIQSFKQSVETVLGVENVVVDIQQMTSDEFLNITYYAANASSEDWDVSGGVSWGPDYQDPSTYLDILKTTSSETTKTYLGFDNPNSPSVVQVGLKEYDKLVDEAAKETSDLNVRYEKYAAAQAWLTDSSLFIPAMASSGAAPVLSRIVPFTGASAQTGSKGSDVYFKYLKLQDKAVTKEEYEKAREKWLKEKAESNEKAQKELASHVK
>NC_003098.1|WP_000759901.1|1675430_1676927_-|ABC-transporter-permease
MKKYIFMRVLRSLVSIFLVTTLTYTIIYTLVPRKLIFKQDPNYNKIATTADKRDNYENTVFERMGYIEYYDTKELQEKASSMDSSVTVEANATNKAIYEKYINQLGHGWTLGEFTESGQFYATREIPIFERVFHFYANLIDIDHTNKIQDPENPDLKRYLRFENDPAIGWSLVGSGTKHKYLLYFNSQFPFVHQNFVNLNLGDSYPTYANTPVLQVITQGQGQTKTAQVQFPTGKKTSSVNIYSRTYKSPSQADSREVASYGKDDPYTATESNYQYPSMIVSSAITGLIGLVLAYALAVPLGSAMARFKNTWIDSLSTGALTFLLALPTIALVYIVRLIGSSIALPDSFPILGAGDWRSYVLPAVILGLLGAPGTAIWIRRYMIDLQSQDFVRFARAKGLSEKEISNKHIFKNAMVPLVSGIPAAIIGVIGGATLTETVFAFPGMGKMLIDSVKASNNSMVVGLVFIFTCISIFSRLLGDIWMTIIDPRIKLTEKGGK
>NC_003098.1|WP_001050309.1|1697563_1698919_-|23S-rRNA-(uracil(1939)-C(5))-methyltransferase-RlmD
MNLKVKQKIPLKIKRMGINGEGIGFYQKTLVFVPGALKGEDIYCQITSIRRNFVEAKLLKVNKKSKFRIVPSCTIYNECGGCQIMHLHYDKQLEFKTDLLHQALKKFAPAGYENYEIRPTIGMQEPKYYRAKLQFQTRKFKNQVKAGLYAQNSHYLVELKDCLVQDKETQVIANRLAELLTYHQIPITDERKVLGVRTIMVRRARKTGQVQIIIVTNRQLNLTQLVKELVKDFPEVVTVAVNTNTAKTSEIYGEKTEIIWGQESIQEGVLNYEFSLSPRAFYQLNPEQTEVLYSEAVKALDVDKEDHLIDAYCGVGTIGFAFAKKVKTLRGMDIIPEAIEDAKRNAKRMGFDNTHYEAGTAEEIIPRWYKEGYRADALIVDPPRTGLDDKLLDTILTYVPEKMVYISCNVSTLARDLVRLVEVYDLHYIQSVDMFPHTARTEAVVKLIKKV
>NC_003098.1|WP_000705097.1|1698956_1699733_+|recombination-regulator-RecX
MKITKLEKKKRLYLMELDNGDKCYITEDTIVRFMLSRDKVISEEELKEIQDFAQFSYGKNLALYHLSFKARTEKEVREYLKKYDIDKNIVSQVIANLKEDKWINDGQYAYAIINTNQLSGDKGPYVLTQKLAQKGISKSTIEENLKEFDFSEVAQRVANKLLKKYEGKLPARALQDKIIQNLTNKGFSYSDAKIAFDDLDSQVDQETTQELIFKELDKQYTKYARKYEGYELKQRLTQVLARKGYDFSDIASALREYL
>NC_003098.1|WP_000775321.1|1699821_1700355_+|DUF402-domain-containing-protein
MKLPKEGDFITIQSYKHDGSLHRTWRDTMVLKTTENAIIGVNDHTLVTESDGRRWVTREPAIVYFHKKYWFNIIAMIRDNGTSYYCNMASPYYLDEEALKYIDYDLDVKIFTDGEKRLLDVEEYERHKRKMNYSDDLDYILKEHVKILVDWINNGRGPFSEAYVNIWYKRYVELKNR
>NC_003098.1|WP_000436473.1|1701074_1702304_+|ISL3-family-transposase
MEQLHFITKLLDIKDPNIQILDIINKDTHKEIIAKLDYDAPSCPECGSQMKKYDFQKPSKIPYLETTGMPTRILLRKRRFKCYHCSKMMVAETSIVKKNHQIPRIINQKIAQKLIEKISMTDIAHQLSISTSTVIRKLNDFHFKHDFSCLPEIMSWDEYAFTKGKMSFIAQDFNNLNIITVLEGRTQAVIRDHFLKYDRAVRCRVKIITMDMFSPYYGLAKQLRFHIVQHLSRAMSRVRVQIMNQFHRKSHEYKAIKRYWKLIQQDSRKLSDKQFYRPTFRMHLTNKEILNKLLSYSEDLKHHYQLYQLLLFHFQNKEPEKFFGLIEDNLKQVHPIFQTVFKTFLKDKEKIVNALQLHYSNAKPEATNNLIKLIKRNAFGFRNFENFKKRIFIALNIKKERTKFVLSRA
>NC_003098.1|WP_000031573.1|1702402_1704025_-|chaperonin-GroEL
MSKEIKFSSDARSAMVRGVDILADTVKVTLGPKGRNVVLEKSFGSPLITNDGVTIAKEIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVREGIKNVTAGANPIGIRRGIETAVAAAVEALKNNAIPVANKEAIAQVAAVSSRSEKVGEYISEAMEKVGKDGVITIEESRGMETELEVVEGMQFDRGYLSQYMVTDSEKMVADLENPYILITDKKISNIQEILPLLESILQSNRPLLIIADDVDGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAMLEDIAILTGGTVITEDLGLELKDATIEALGQAARVTVDKDSTVIVEGAGNPEAISHRVAVIKSQIETTTSEFDREKLQERLAKLSGGVAVIKVGAATETELKEMKLRIEDALNATRAAVEEGIVAGGGTALANVIPAVATLELTGDEATGRNIVLRALEEPVRQIAHNAGFEGSIVIDRLKNAELGIGFNAATGEWVNMIDQGIIDPVKVSRSALQNAASVASLILTTEAVVANKPEPVAPAPAMDPSMMGGMM
>NC_003098.1|WP_000917304.1|1704040_1704325_-|co-chaperone-GroES
MLKPLGDRVLLKIEEKEQTVGGFVLAGSAQEKTKTAQVVATGQGVRTLNGDLVAPSVKTGDRVLVEAHAGLDVKDGDEKYIIVGEANILAIIEE
>NC_003098.1|WP_000282467.1|1704480_1704876_-|single-stranded-DNA-binding-protein
MYNKVIMIGRLTSTPELHKTNNDKSVARATIAVNRRYKDQNGEREADFVNMVLWGRLAETLASYATKGSLISVDGELRTRRFEKNGQMNYVTEVLVTGFQLLESRAQRAMRENNAGQDLADLVLEEEELPF
>NC_003098.1|WP_001107755.1|1704953_1705715_-|SDR-family-NAD(P)-dependent-oxidoreductase
MAKNVVITGATSGIGEAIARAYLEQGEDVVLTGRRIDRLEILKSEFAVSFPNQTVWTFPLDVTDMVMVKTVCSDILETIGRIDILVNNAGLALDLAPYQDYEELDMLTMLDTNVKGLMAVTHCFLPAMIKVNQGHIINMGSTAGIYAYAGAAVYSATKAAVKTFSDGLRIDTIATDIKVTTIQPGIVETDFSTVRFHGDKERAASVYQGIEALQAQDIADTVVYVTSQPRRVQITDMTIMANQQATGFMIHKK
>NC_003098.1|WP_000578309.1|1705747_1706374_-|DUF4479-and-tRNA-binding-domain-containing-protein
MIFTYNKEHVGDVLMVIVKNSGDAKLNVERKGKVARVFLKENGETVAWNIFEVSSLFEIAERGQVFLSDEQVARLNQELQAEGFTEEIVNDKEPKFVVGEIVEMVAHPDSDHLNICQVAVASDKIVQIVAGAPNARVGLKTIVALPGAMMPKGNFIFPGELRGEKSFGMMCSPRELHLPNAPQKRGVLELSEDQVVGTPFDPAKHWTA
>NC_003098.1|WP_000615767.1|1706389_1706707_-|thioredoxin-family-protein
MIQPASLEELASLVEKAGKKVFLFVADWCGDCRYIYPALPEIEETNPEFTFIRMDRDQYMDLAKLWDVYGIPSLVVLEKDKEIGRFVNRDRKSKEQINDFLAGLK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Identity
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	NC_003098.1	40191-40218	1.0
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	NC_003098.1	990666-990693	1.0
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	NC_003098.1	1648879-1648906	1.0

1. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to position: 40191-40218, mismatch: 0, identity: 1.0

tttcaacccactacagttgacaaagagc	CRISPR spacer
tttcaacccactacagttgacaaagagc	Protospacer
****************************

2. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to position: 990666-990693, mismatch: 0, identity: 1.0

tttcaacccactacagttgacaaagagc	CRISPR spacer
tttcaacccactacagttgacaaagagc	Protospacer
****************************

3. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to position: 1648879-1648906, mismatch: 0, identity: 1.0

tttcaacccactacagttgacaaagagc	CRISPR spacer
tttcaacccactacagttgacaaagagc	Protospacer
****************************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	KY065475	Streptococcus phage IPP35, complete genome	21704-21731	0	1.0
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	MK448817	Streptococcus phage Javan59, complete genome	41452-41479	2	0.929
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	MK448405	Streptococcus satellite phage Javan293, complete genome	10770-10797	3	0.893
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	MH937476	Streptococcus phage CHPC933, partial genome	26091-26118	3	0.893
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	NC_012642	Streptococcus parasanguinis plasmid pFW213, complete sequence	1560-1587	3	0.893
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	NZ_CP015284	Streptococcus salivarius strain ATCC 25975 plasmid, complete sequence	83115-83142	4	0.857
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	NZ_CP016699	Lactococcus lactis subsp. lactis strain 275 plasmid p275A, complete sequence	36883-36910	4	0.857
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	NZ_CP015284	Streptococcus salivarius strain ATCC 25975 plasmid, complete sequence	55243-55270	5	0.821
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	MN480762	Streptococcus salivarius strain NU10 plasmid pSsal-NU10, complete sequence	10598-10625	5	0.821
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	MN480762	Streptococcus salivarius strain NU10 plasmid pSsal-NU10, complete sequence	168253-168280	5	0.821
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	NZ_CP020429	Streptococcus sp. FDAARGOS_192 plasmid unnamed1, complete sequence	118713-118740	5	0.821
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	NZ_CP020429	Streptococcus sp. FDAARGOS_192 plasmid unnamed1, complete sequence	98135-98162	6	0.786
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	NC_019430	Lactococcus lactis subsp. cremoris UC509.9 plasmid pCIS8, complete sequence	14620-14647	6	0.786
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	NZ_CP018832	Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence	180660-180687	6	0.786
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	NZ_CP040906	Enterococcus faecium strain FB-1 plasmid punnamed, complete sequence	113824-113851	6	0.786
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	NZ_CP027518	Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence	150478-150505	6	0.786
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	NZ_CP027498	Enterococcus faecium strain AUSMDU00004167 plasmid unnamed1, complete sequence	174624-174651	6	0.786
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	NZ_CP016744	Lactococcus lactis subsp. cremoris strain JM2 plasmid pJM2C, complete sequence	19046-19073	6	0.786
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	MT074686	Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence	73336-73363	6	0.786
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	NZ_CP025756	Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence	63468-63495	6	0.786
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	NZ_CP031539	Lactococcus lactis subsp. cremoris strain 3107 plasmid p3107A, complete sequence	22007-22034	6	0.786
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	NZ_LR135476	Enterococcus faecium isolate E8423 plasmid 2	151354-151381	6	0.786
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	NZ_CP016738	Lactococcus lactis subsp. cremoris strain JM3 plasmid pJM3B, complete sequence	19022-19049	6	0.786
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	NC_017493	Lactococcus lactis subsp. cremoris A76 plasmid pQA549, complete sequence	16777-16804	6	0.786
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	NC_021987	Enterococcus faecium Aus0085 plasmid p1, complete sequence	76654-76681	6	0.786
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	NZ_LR135358	Enterococcus faecium isolate E7948 plasmid 2	169632-169659	6	0.786
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	NZ_CP044265	Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence	110148-110175	6	0.786
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	NZ_CP016708	Lactococcus lactis subsp. cremoris strain UC109 plasmid pUC109B, complete sequence	14623-14650	6	0.786
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	NC_017478	Lactococcus lactis plasmid pSK11L, complete sequence	19224-19251	6	0.786
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	NZ_CP020439	Streptococcus equinus strain FDAARGOS_251 plasmid unamed1 sequence	76001-76028	6	0.786
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	NZ_CP018188	Streptococcus salivarius strain ICDC2 plasmid, complete sequence	47121-47148	6	0.786
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	NZ_AP022342	Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence	223062-223089	6	0.786
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	NC_008506	Lactococcus lactis subsp. cremoris SK11 plasmid 4, complete sequence	44473-44500	6	0.786
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	NZ_CP016733	Lactococcus lactis subsp. cremoris strain JM4 plasmid pJM4E, complete sequence	19069-19096	6	0.786
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	NZ_LR135308	Enterococcus faecium isolate E7240 plasmid 2	140234-140261	6	0.786
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	NZ_CP018827	Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence	180660-180687	6	0.786
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	NZ_MF150536	Lactococcus lactis subsp. lactis bv. diacetylactis strain FM03P plasmid pLd8, complete sequence	19158-19185	6	0.786
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	NZ_CP041262	Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence	55029-55056	6	0.786
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	NZ_CP043524	Lactococcus lactis subsp. lactis bv. diacetylactis strain SD96 plasmid pSD96_05, complete sequence	28578-28605	6	0.786
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	NZ_CP013995	Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence	80441-80468	6	0.786
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	NZ_CP014450	Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence	29008-29035	6	0.786
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	NZ_CP027502	Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence	55406-55433	6	0.786
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	NZ_CP016715	Lactococcus lactis subsp. lactis strain UC063 plasmid pUC063A, complete sequence	20508-20535	6	0.786
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	NZ_CP040803	Streptococcus salivarius strain LAB813 plasmid pSAL813, complete sequence	65781-65808	6	0.786
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	NZ_LR135279	Enterococcus faecium isolate E6975 plasmid 2	44791-44818	6	0.786
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	NZ_LR135236	Enterococcus faecium isolate E7067 plasmid 2	36603-36630	6	0.786
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	NZ_AP018502	Lactococcus lactis subsp. cremoris strain C4 plasmid pC43, complete sequence	13248-13275	6	0.786
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	NZ_CP041256	Enterococcus faecium strain 515 plasmid p26, complete sequence	10619-10646	6	0.786
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	NZ_LR135220	Enterococcus faecium isolate E7040 plasmid 2	36627-36654	6	0.786
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	NZ_LR134106	Enterococcus faecium isolate E6043 plasmid 2	36627-36654	6	0.786
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	NZ_CP023514	Enterococcus sp. FDAARGOS_375 plasmid unnamed1, complete sequence	139819-139846	6	0.786
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	NZ_CP040876	Enterococcus faecium strain DB-1 plasmid punnamed2	74007-74034	6	0.786
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	NZ_CP019993	Enterococcus faecium isolate 2014-VREF-268 plasmid p268-1, complete sequence	46625-46652	6	0.786
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	NZ_CP035655	Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence	78878-78905	6	0.786
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	NZ_CP035661	Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence	72511-72538	6	0.786
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	NZ_CP035667	Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence	72513-72540	6	0.786
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	NZ_CP035649	Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence	78881-78908	6	0.786
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	NZ_CP051519	Lactococcus lactis subsp. cremoris strain F plasmid pScrF52, complete sequence	39090-39117	6	0.786
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	NZ_CP041271	Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence	55028-55055	6	0.786
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	NZ_CP040237	Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence	55030-55057	6	0.786
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	NC_020208	Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence	121228-121255	6	0.786
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	NZ_CP034948	Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence	64834-64861	6	0.786
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	NZ_CP012461	Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p1, complete sequence	55439-55466	6	0.786
NC_003098_3	3.1\|1690582\|28\|NC_003098\|CRISPRCasFinder	1690582-1690609	28	NZ_CP016687	Lactococcus lactis subsp. cremoris strain 158 plasmid p158C, complete sequence	17331-17358	6	0.786

1. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to KY065475 (Streptococcus phage IPP35, complete genome) position: , mismatch: 0, identity: 1.0

tttcaacccactacagttgacaaagagc	CRISPR spacer
tttcaacccactacagttgacaaagagc	Protospacer
****************************

2. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to MK448817 (Streptococcus phage Javan59, complete genome) position: , mismatch: 2, identity: 0.929

tttcaacccactacagttgacaaagagc	CRISPR spacer
catcaacccactacagttgacaaagagc	Protospacer
. **************************

3. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to MK448405 (Streptococcus satellite phage Javan293, complete genome) position: , mismatch: 3, identity: 0.893

tttcaacccactacagttgacaaagagc	CRISPR spacer
catctacccactacagttgacaaagagc	Protospacer
. ** ***********************

4. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to MH937476 (Streptococcus phage CHPC933, partial genome) position: , mismatch: 3, identity: 0.893

tttcaacccactacagttgacaaagagc	CRISPR spacer
catctacccactacagttgacaaagagc	Protospacer
. ** ***********************

5. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to NC_012642 (Streptococcus parasanguinis plasmid pFW213, complete sequence) position: , mismatch: 3, identity: 0.893

tttcaacccactacagttgacaaagagc	CRISPR spacer
tgtccacccactacagttgacaatgagc	Protospacer
* ** ****************** ****

6. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to NZ_CP015284 (Streptococcus salivarius strain ATCC 25975 plasmid, complete sequence) position: , mismatch: 4, identity: 0.857

tttcaacccactacagttgacaaagagc	CRISPR spacer
tcgtcacccactacagttgacaaagagc	Protospacer
*. . ***********************

7. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to NZ_CP016699 (Lactococcus lactis subsp. lactis strain 275 plasmid p275A, complete sequence) position: , mismatch: 4, identity: 0.857

tttcaacccactacagttgacaaagagc	CRISPR spacer
catctacccactacggttgacaaagagc	Protospacer
. ** *********.*************

8. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to NZ_CP015284 (Streptococcus salivarius strain ATCC 25975 plasmid, complete sequence) position: , mismatch: 5, identity: 0.821

tttcaacccactacagttgacaaagagc	CRISPR spacer
tcgtcacccactacagttgacaaagaac	Protospacer
*. . *********************.*

9. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to MN480762 (Streptococcus salivarius strain NU10 plasmid pSsal-NU10, complete sequence) position: , mismatch: 5, identity: 0.821

tttcaacccactacagttgacaaagagc	CRISPR spacer
tcgtcacccactacagttgacagagagc	Protospacer
*. . *****************.*****

10. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to MN480762 (Streptococcus salivarius strain NU10 plasmid pSsal-NU10, complete sequence) position: , mismatch: 5, identity: 0.821

tttcaacccactacagttgacaaagagc	CRISPR spacer
tcgtcacccactacagttgacagagagc	Protospacer
*. . *****************.*****

11. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to NZ_CP020429 (Streptococcus sp. FDAARGOS_192 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

tttcaacccactacagttgacaaagagc	CRISPR spacer
tcatcacccactacagttgacaaggagc	Protospacer
*. . ******************.****

12. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to NZ_CP020429 (Streptococcus sp. FDAARGOS_192 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

tttcaacccactacagttgacaaagagc	CRISPR spacer
tcgtcacccactacagttgacaaggatc	Protospacer
*. . ******************.** *

13. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to NC_019430 (Lactococcus lactis subsp. cremoris UC509.9 plasmid pCIS8, complete sequence) position: , mismatch: 6, identity: 0.786

tttcaacccactacagttgacaaagagc	CRISPR spacer
tcgtcacccactacagttgacatagacc	Protospacer
*. . ***************** *** *

14. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to NZ_CP018832 (Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence) position: , mismatch: 6, identity: 0.786

tttcaacccactacagttgacaaagagc	CRISPR spacer
tcgtcacccactacagttgacatagacc	Protospacer
*. . ***************** *** *

15. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to NZ_CP040906 (Enterococcus faecium strain FB-1 plasmid punnamed, complete sequence) position: , mismatch: 6, identity: 0.786

tttcaacccactacagttgacaaagagc	CRISPR spacer
tcgtcacccactacagttgacatagacc	Protospacer
*. . ***************** *** *

16. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to NZ_CP027518 (Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

tttcaacccactacagttgacaaagagc	CRISPR spacer
tcgtcacccactacagttgacatagacc	Protospacer
*. . ***************** *** *

17. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to NZ_CP027498 (Enterococcus faecium strain AUSMDU00004167 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

tttcaacccactacagttgacaaagagc	CRISPR spacer
tcgtcacccactacagttgacatagacc	Protospacer
*. . ***************** *** *

18. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to NZ_CP016744 (Lactococcus lactis subsp. cremoris strain JM2 plasmid pJM2C, complete sequence) position: , mismatch: 6, identity: 0.786

tttcaacccactacagttgacaaagagc	CRISPR spacer
tcgtcacccactacagttgacatagacc	Protospacer
*. . ***************** *** *

19. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to MT074686 (Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence) position: , mismatch: 6, identity: 0.786

tttcaacccactacagttgacaaagagc	CRISPR spacer
tcgtcacccactacagttgacatagacc	Protospacer
*. . ***************** *** *

20. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to NZ_CP025756 (Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence) position: , mismatch: 6, identity: 0.786

tttcaacccactacagttgacaaagagc	CRISPR spacer
tcgtcacccactacagttgacatagacc	Protospacer
*. . ***************** *** *

21. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to NZ_CP031539 (Lactococcus lactis subsp. cremoris strain 3107 plasmid p3107A, complete sequence) position: , mismatch: 6, identity: 0.786

tttcaacccactacagttgacaaagagc	CRISPR spacer
tcgtcacccactacagttgacatagacc	Protospacer
*. . ***************** *** *

22. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to NZ_LR135476 (Enterococcus faecium isolate E8423 plasmid 2) position: , mismatch: 6, identity: 0.786

tttcaacccactacagttgacaaagagc	CRISPR spacer
tcgtcacccactacagttgacatagacc	Protospacer
*. . ***************** *** *

23. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to NZ_CP016738 (Lactococcus lactis subsp. cremoris strain JM3 plasmid pJM3B, complete sequence) position: , mismatch: 6, identity: 0.786

tttcaacccactacagttgacaaagagc	CRISPR spacer
tcgtcacccactacagttgacatagacc	Protospacer
*. . ***************** *** *

24. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to NC_017493 (Lactococcus lactis subsp. cremoris A76 plasmid pQA549, complete sequence) position: , mismatch: 6, identity: 0.786

tttcaacccactacagttgacaaagagc	CRISPR spacer
tcgtcacccactacagttgacatagacc	Protospacer
*. . ***************** *** *

25. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to NC_021987 (Enterococcus faecium Aus0085 plasmid p1, complete sequence) position: , mismatch: 6, identity: 0.786

tttcaacccactacagttgacaaagagc	CRISPR spacer
tcgtcacccactacagttgacatagacc	Protospacer
*. . ***************** *** *

26. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to NZ_LR135358 (Enterococcus faecium isolate E7948 plasmid 2) position: , mismatch: 6, identity: 0.786

tttcaacccactacagttgacaaagagc	CRISPR spacer
tcgtcacccactacagttgacatagacc	Protospacer
*. . ***************** *** *

27. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to NZ_CP044265 (Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence) position: , mismatch: 6, identity: 0.786

tttcaacccactacagttgacaaagagc	CRISPR spacer
tcgtcacccactacagttgacatagacc	Protospacer
*. . ***************** *** *

28. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to NZ_CP016708 (Lactococcus lactis subsp. cremoris strain UC109 plasmid pUC109B, complete sequence) position: , mismatch: 6, identity: 0.786

tttcaacccactacagttgacaaagagc	CRISPR spacer
tcgtcacccactacagttgacatagacc	Protospacer
*. . ***************** *** *

29. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to NC_017478 (Lactococcus lactis plasmid pSK11L, complete sequence) position: , mismatch: 6, identity: 0.786

tttcaacccactacagttgacaaagagc	CRISPR spacer
tcgtcacccactacagttgacatagacc	Protospacer
*. . ***************** *** *

30. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to NZ_CP020439 (Streptococcus equinus strain FDAARGOS_251 plasmid unamed1 sequence) position: , mismatch: 6, identity: 0.786

tttcaacccactacagttgacaaagagc	CRISPR spacer
tcgtcacccactacaattgacatagagc	Protospacer
*. . **********.****** *****

31. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to NZ_CP018188 (Streptococcus salivarius strain ICDC2 plasmid, complete sequence) position: , mismatch: 6, identity: 0.786

tttcaacccactacagttgacaaagagc	CRISPR spacer
tcgtcacccactacagttgacatcgagc	Protospacer
*. . *****************  ****

32. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to NZ_AP022342 (Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence) position: , mismatch: 6, identity: 0.786

tttcaacccactacagttgacaaagagc	CRISPR spacer
tcgtcacccactacagttgacatagacc	Protospacer
*. . ***************** *** *

33. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to NC_008506 (Lactococcus lactis subsp. cremoris SK11 plasmid 4, complete sequence) position: , mismatch: 6, identity: 0.786

tttcaacccactacagttgacaaagagc	CRISPR spacer
tcgtcacccactacagttgacatagacc	Protospacer
*. . ***************** *** *

34. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to NZ_CP016733 (Lactococcus lactis subsp. cremoris strain JM4 plasmid pJM4E, complete sequence) position: , mismatch: 6, identity: 0.786

tttcaacccactacagttgacaaagagc	CRISPR spacer
tcatcacccactacagttgacatagacc	Protospacer
*. . ***************** *** *

35. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to NZ_LR135308 (Enterococcus faecium isolate E7240 plasmid 2) position: , mismatch: 6, identity: 0.786

tttcaacccactacagttgacaaagagc	CRISPR spacer
tcgtcacccactacagttgacatagacc	Protospacer
*. . ***************** *** *

36. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to NZ_CP018827 (Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence) position: , mismatch: 6, identity: 0.786

tttcaacccactacagttgacaaagagc	CRISPR spacer
tcgtcacccactacagttgacatagacc	Protospacer
*. . ***************** *** *

37. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to NZ_MF150536 (Lactococcus lactis subsp. lactis bv. diacetylactis strain FM03P plasmid pLd8, complete sequence) position: , mismatch: 6, identity: 0.786

tttcaacccactacagttgacaaagagc	CRISPR spacer
tcgtcacccactacagttgacatagacc	Protospacer
*. . ***************** *** *

38. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to NZ_CP041262 (Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence) position: , mismatch: 6, identity: 0.786

tttcaacccactacagttgacaaagagc	CRISPR spacer
tcgtcacccactacagttgacatagacc	Protospacer
*. . ***************** *** *

39. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to NZ_CP043524 (Lactococcus lactis subsp. lactis bv. diacetylactis strain SD96 plasmid pSD96_05, complete sequence) position: , mismatch: 6, identity: 0.786

tttcaacccactacagttgacaaagagc	CRISPR spacer
tcgtcacccactacagttgacatagacc	Protospacer
*. . ***************** *** *

40. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to NZ_CP013995 (Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

tttcaacccactacagttgacaaagagc	CRISPR spacer
tcgtcacccactacagttgacatagacc	Protospacer
*. . ***************** *** *

41. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to NZ_CP014450 (Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

tttcaacccactacagttgacaaagagc	CRISPR spacer
tcgtcacccactacagttgacatagacc	Protospacer
*. . ***************** *** *

42. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to NZ_CP027502 (Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

tttcaacccactacagttgacaaagagc	CRISPR spacer
tcgtcacccactacagttgacatagacc	Protospacer
*. . ***************** *** *

43. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to NZ_CP016715 (Lactococcus lactis subsp. lactis strain UC063 plasmid pUC063A, complete sequence) position: , mismatch: 6, identity: 0.786

tttcaacccactacagttgacaaagagc	CRISPR spacer
tcgtcacccactacagttgacatagacc	Protospacer
*. . ***************** *** *

44. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to NZ_CP040803 (Streptococcus salivarius strain LAB813 plasmid pSAL813, complete sequence) position: , mismatch: 6, identity: 0.786

tttcaacccactacagttgacaaagagc	CRISPR spacer
tcgtcactcactacagttgactaagagc	Protospacer
*. . **.************* ******

45. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to NZ_LR135279 (Enterococcus faecium isolate E6975 plasmid 2) position: , mismatch: 6, identity: 0.786

tttcaacccactacagttgacaaagagc	CRISPR spacer
tcgtcacccactacagttgacatagacc	Protospacer
*. . ***************** *** *

46. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to NZ_LR135236 (Enterococcus faecium isolate E7067 plasmid 2) position: , mismatch: 6, identity: 0.786

tttcaacccactacagttgacaaagagc	CRISPR spacer
tcgtcacccactacagttgacatagacc	Protospacer
*. . ***************** *** *

47. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to NZ_AP018502 (Lactococcus lactis subsp. cremoris strain C4 plasmid pC43, complete sequence) position: , mismatch: 6, identity: 0.786

tttcaacccactacagttgacaaagagc	CRISPR spacer
tcgtcacccactacagttgacatagacc	Protospacer
*. . ***************** *** *

48. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to NZ_CP041256 (Enterococcus faecium strain 515 plasmid p26, complete sequence) position: , mismatch: 6, identity: 0.786

tttcaacccactacagttgacaaagagc	CRISPR spacer
tcgtcacccactacagttgacatagacc	Protospacer
*. . ***************** *** *

49. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to NZ_LR135220 (Enterococcus faecium isolate E7040 plasmid 2) position: , mismatch: 6, identity: 0.786

tttcaacccactacagttgacaaagagc	CRISPR spacer
tcgtcacccactacagttgacatagacc	Protospacer
*. . ***************** *** *

50. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to NZ_LR134106 (Enterococcus faecium isolate E6043 plasmid 2) position: , mismatch: 6, identity: 0.786

tttcaacccactacagttgacaaagagc	CRISPR spacer
tcgtcacccactacagttgacatagacc	Protospacer
*. . ***************** *** *

51. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to NZ_CP023514 (Enterococcus sp. FDAARGOS_375 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

tttcaacccactacagttgacaaagagc	CRISPR spacer
tcgtcacccactacagttgacatagacc	Protospacer
*. . ***************** *** *

52. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to NZ_CP040876 (Enterococcus faecium strain DB-1 plasmid punnamed2) position: , mismatch: 6, identity: 0.786

tttcaacccactacagttgacaaagagc	CRISPR spacer
tcgtcacccactacagttgacatagacc	Protospacer
*. . ***************** *** *

53. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to NZ_CP019993 (Enterococcus faecium isolate 2014-VREF-268 plasmid p268-1, complete sequence) position: , mismatch: 6, identity: 0.786

tttcaacccactacagttgacaaagagc	CRISPR spacer
tcgtcacccactacagttgacatagacc	Protospacer
*. . ***************** *** *

54. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to NZ_CP035655 (Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

tttcaacccactacagttgacaaagagc	CRISPR spacer
tcgtcacccactacagttgacatagacc	Protospacer
*. . ***************** *** *

55. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to NZ_CP035661 (Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

tttcaacccactacagttgacaaagagc	CRISPR spacer
tcgtcacccactacagttgacatagacc	Protospacer
*. . ***************** *** *

56. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to NZ_CP035667 (Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

tttcaacccactacagttgacaaagagc	CRISPR spacer
tcgtcacccactacagttgacatagacc	Protospacer
*. . ***************** *** *

57. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to NZ_CP035649 (Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

tttcaacccactacagttgacaaagagc	CRISPR spacer
tcgtcacccactacagttgacatagacc	Protospacer
*. . ***************** *** *

58. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to NZ_CP051519 (Lactococcus lactis subsp. cremoris strain F plasmid pScrF52, complete sequence) position: , mismatch: 6, identity: 0.786

tttcaacccactacagttgacaaagagc	CRISPR spacer
tcgtcacccactacagttgacatagacc	Protospacer
*. . ***************** *** *

59. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to NZ_CP041271 (Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence) position: , mismatch: 6, identity: 0.786

tttcaacccactacagttgacaaagagc	CRISPR spacer
tcgtcacccactacagttgacatagacc	Protospacer
*. . ***************** *** *

60. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to NZ_CP040237 (Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

tttcaacccactacagttgacaaagagc	CRISPR spacer
tcgtcacccactacagttgacatagacc	Protospacer
*. . ***************** *** *

61. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to NC_020208 (Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence) position: , mismatch: 6, identity: 0.786

tttcaacccactacagttgacaaagagc	CRISPR spacer
tcgtcacccactacagttgacatagacc	Protospacer
*. . ***************** *** *

62. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to NZ_CP034948 (Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence) position: , mismatch: 6, identity: 0.786

tttcaacccactacagttgacaaagagc	CRISPR spacer
tcgtcacccactacagttgacatagacc	Protospacer
*. . ***************** *** *

63. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to NZ_CP012461 (Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p1, complete sequence) position: , mismatch: 6, identity: 0.786

tttcaacccactacagttgacaaagagc	CRISPR spacer
tcgtcacccactacagttgacatagacc	Protospacer
*. . ***************** *** *

64. spacer 3.1|1690582|28|NC_003098|CRISPRCasFinder matches to NZ_CP016687 (Lactococcus lactis subsp. cremoris strain 158 plasmid p158C, complete sequence) position: , mismatch: 6, identity: 0.786

tttcaacccactacagttgacaaagagc	CRISPR spacer
tcgtcacccactacagttgacatagacc	Protospacer
*. . ***************** *** *

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

41901 : 53357

Cyanophage(33.33%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000668290.1\|41901_44055_+	peptide cleavage/export ABC transporter	W8CYL7	Bacillus_phage	1.0e-44	28.0
WP_000801613.1\|44067_45417_+	HlyD family secretion protein	NA	NA	NA	NA
WP_000043299.1\|45586_46294_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A1D7SE76	Cyanophage	1.8e-41	39.7
WP_000361172.1\|46495_50221_+	phosphoribosylformylglycinamidine synthase	A6N228	Microbacterium_phage	2.1e-37	25.8
WP_000220650.1\|50313_51756_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	2.6e-55	35.4
WP_000182582.1\|51792_52815_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A1D7SE90	Cyanophage	1.6e-64	43.9
WP_000717506.1\|52811_53357_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	7.4e-24	35.0

DBSCAN-SWA_2

105196 : 137520

Streptococcus_phage(40.0%)

bacteriocin,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_073077611.1\|105196_105490_+\|bacteriocin	lactococcin 972 family bacteriocin	NA	NA	NA	NA
WP_000723959.1\|105544_107653_+\|bacteriocin	bacteriocin-associated integral membrane family protein	NA	NA	NA	NA
WP_000571330.1\|107649_108291_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.3e-23	34.8
WP_001038474.1\|108496_109303_+	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_001814401.1\|109319_110516_+	argininosuccinate synthase	NA	NA	NA	NA
WP_001107614.1\|110544_111936_+	argininosuccinate lyase	NA	NA	NA	NA
WP_001268172.1\|112224_113088_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_000093185.1\|113907_115773_+	peptidase domain-containing ABC transporter	W8CYL7	Bacillus_phage	2.5e-39	25.7
WP_001096142.1\|115765_116233_+	GyrI-like domain-containing protein	NA	NA	NA	NA
WP_000781030.1\|116229_117582_+	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_000424424.1\|117727_118108_+\|bacteriocin	SP_0115 family bacteriocin-like peptide	NA	NA	NA	NA
WP_001811647.1\|118610_118931_-	hypothetical protein	NA	NA	NA	NA
WP_000424429.1\|119687_120059_+\|bacteriocin	SPH_0218 family bacteriocin-like peptide	NA	NA	NA	NA
WP_000909533.1\|120066_120279_+	hypothetical protein	NA	NA	NA	NA
WP_001812342.1\|121083_122142_+	hypothetical protein	NA	NA	NA	NA
WP_000792249.1\|122455_123433_+	hypothetical protein	NA	NA	NA	NA
WP_000424414.1\|123809_124184_+\|bacteriocin	SPH_0224 family bacteriocin-like peptide	NA	NA	NA	NA
WP_000619760.1\|124391_125294_+	hypothetical protein	NA	NA	NA	NA
WP_000424442.1\|125349_125703_+	hypothetical protein	NA	NA	NA	NA
WP_000072891.1\|125699_126428_+	hypothetical protein	NA	NA	NA	NA
WP_000770317.1\|127562_127802_+	hypothetical protein	M1Q0Z8	Streptococcus_phage	1.8e-14	51.4
WP_001819759.1\|127786_128065_+	hypothetical protein	M1Q0Z8	Streptococcus_phage	2.5e-20	50.5
WP_001035315.1\|128355_130215_+	pneumococcal surface protein A	NA	NA	NA	NA
WP_001282986.1\|130615_131737_+\|tRNA	tRNA 2-thiouridine(34) synthase MnmA	NA	NA	NA	NA
WP_000193624.1\|131877_132333_+	NUDIX hydrolase	NA	NA	NA	NA
WP_000639151.1\|132342_134256_+\|tRNA	tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme MnmG	NA	NA	NA	NA
WP_000331983.1\|134635_136315_-	ribonuclease J	S0A5H7	Cellulophaga_phage	1.5e-06	29.9
WP_000639589.1\|136316_136550_-	DNA-dependent RNA polymerase auxiliary subunit epsilon family protein	NA	NA	NA	NA
WP_000977347.1\|137367_137520_-\|bacteriocin	fratricide two-peptide bacteriocin subunit CibB	NA	NA	NA	NA

DBSCAN-SWA_3

306051 : 352277

Escherichia_phage(27.27%)

protease,transposase,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001063452.1\|306051_308157_+\|protease	ATP-dependent Clp protease ATP-binding subunit	H6X3M6	Enterobacteria_phage	3.4e-117	37.7
WP_000032550.1\|308452_308935_-	S-ribosylhomocysteine lyase	NA	NA	NA	NA
WP_000743599.1\|309029_310514_-	DUF1846 domain-containing protein	NA	NA	NA	NA
WP_001156772.1\|310666_312274_+	alpha-glucosidase	NA	NA	NA	NA
WP_001022228.1\|312432_312606_+	S-ribosylhomocysteinase	NA	NA	NA	NA
WP_001163596.1\|314739_315585_+	hypothetical protein	NA	NA	NA	NA
WP_000167408.1\|315714_316872_+	glycosyltransferase	NA	NA	NA	NA
WP_000091276.1\|316868_318278_+	oligosaccharide flippase family protein	NA	NA	NA	NA
WP_000685095.1\|318313_319552_+	nucleotide sugar dehydrogenase	M1I6D5	Acanthocystis_turfacea_Chlorella_virus	3.3e-104	49.9
WP_001819836.1\|319580_320186_+	UDP-galactopyranose mutase	E4ZFQ1	Streptococcus_phage	1.7e-69	62.6
WP_000676152.1\|320263_321133_+	glucose-1-phosphate thymidylyltransferase RfbA	K7QKA7	Escherichia_phage	2.2e-102	64.6
WP_000131446.1\|321133_321727_+	dTDP-4-dehydrorhamnose 3,5-epimerase family protein	H9NC63	Sphingomonas_phage	3.9e-10	33.1
WP_000141499.1\|321739_322789_+	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	1.8e-71	44.5
WP_000600899.1\|322854_323706_+	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	1.5e-26	35.4
WP_000927992.1\|323781_324228_+\|transposase	transposase	NA	NA	NA	NA
WP_000248706.1\|324230_324680_+\|transposase	transposase	S5VTD3	Leptospira_phage	1.5e-06	29.7
WP_001811052.1\|324750_324909_+\|transposase	transposase domain-containing protein	NA	NA	NA	NA
WP_000842604.1\|325110_327093_+	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_001032523.1\|327392_332696_+	YSIRK-type signal peptide-containing protein	NA	NA	NA	NA
WP_001039991.1\|332862_335022_-	PBP1A family penicillin-binding protein	NA	NA	NA	NA
WP_000248787.1\|335018_335615_-	Holliday junction resolvase RecU	R9TMF8	Paenibacillus_phage	7.4e-25	37.2
WP_000179549.1\|335680_336208_+	DUF1273 domain-containing protein	NA	NA	NA	NA
WP_000146522.1\|336277_336607_+	cell division regulator GpsB	NA	NA	NA	NA
WP_000711391.1\|337092_338250_+	class I SAM-dependent RNA methyltransferase	NA	NA	NA	NA
WP_000039255.1\|338262_339657_+	mid-cell-anchored protein MapZ	NA	NA	NA	NA
WP_000158781.1\|339732_341157_+	NADP-dependent phosphogluconate dehydrogenase	M4QQM4	Ostreococcus_lucimarinus_virus	1.6e-41	29.6
WP_000518011.1\|341168_341858_+	response regulator transcription factor	W8CYM9	Bacillus_phage	2.2e-12	26.1
WP_000771103.1\|341955_342972_+\|holin	choline-binding protein CbpC	NA	NA	NA	NA
WP_000163321.1\|343093_343972_+	mevalonate kinase	NA	NA	NA	NA
WP_000373458.1\|343953_344907_+	diphosphomevalonate decarboxylase	NA	NA	NA	NA
WP_000562411.1\|344893_345901_+	phosphomevalonate kinase	NA	NA	NA	NA
WP_000210629.1\|345884_346895_+	type 2 isopentenyl-diphosphate Delta-isomerase	NA	NA	NA	NA
WP_001224634.1\|346972_347671_+	cell wall-active antibiotics response protein	NA	NA	NA	NA
WP_000743667.1\|347667_348663_+	sensor histidine kinase	NA	NA	NA	NA
WP_000698434.1\|348676_349309_+	response regulator transcription factor	NA	NA	NA	NA
WP_075218746.1\|349476_349788_+	DNA alkylation repair protein	NA	NA	NA	NA
WP_001819829.1\|350228_350423_+	hypothetical protein	NA	NA	NA	NA
WP_000771073.1\|351392_352277_+\|holin	choline-binding protein CbpF	NA	NA	NA	NA

DBSCAN-SWA_4

828734 : 840518

Streptococcus_phage(72.73%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001025704.1\|828734_829643_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	3.1e-06	27.7
WP_000745389.1\|829639_830101_+	signal peptidase II	NA	NA	NA	NA
WP_000403198.1\|830090_830978_+	RluA family pseudouridine synthase	A0A2H4UV25	Bodo_saltans_virus	6.5e-09	27.5
WP_000728289.1\|830980_832864_+\|holin	phosphorylcholine esterase CbpE	I2E8W4	Clostridium_phage	2.0e-12	24.3
WP_010976490.1\|832943_834074_+	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	1.9e-114	58.4
WP_000254686.1\|834083_835346_+	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	2.5e-139	64.5
WP_000689711.1\|835349_836147_+	pyrroline-5-carboxylate reductase	A0A1X9I6T5	Streptococcus_phage	2.7e-59	50.6
WP_000033364.1\|836262_836901_+	dTMP kinase	M1PSC7	Streptococcus_phage	1.3e-75	68.1
WP_000806712.1\|836897_837788_+	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	4.9e-73	51.7
WP_000358228.1\|837827_838145_+	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	2.9e-28	60.0
WP_001166880.1\|838147_839017_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	2.7e-116	76.1
WP_001261452.1\|839243_839762_+	ClbS/DfsB family four-helix bundle protein	NA	NA	NA	NA
WP_001819936.1\|839870_840518_+	replication initiator protein A	A0A2P0VK56	Streptococcus_phage	7.0e-13	33.7

DBSCAN-SWA_5

1102915 : 1113019

Bacillus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000150986.1\|1102915_1104787_-	Eco57I restriction-modification methylase domain-containing protein	A0A1V0SF91	Hokovirus	9.7e-15	25.1
WP_001809704.1\|1104861_1105116_-	type II toxin-antitoxin system RelE/ParE family toxin	A0A1S5S8E8	Streptococcus_phage	5.3e-17	51.2
WP_000208080.1\|1105117_1105360_-	hypothetical protein	NA	NA	NA	NA
WP_001289493.1\|1105450_1106260_-	MBL fold metallo-hydrolase	A0A0C5AFC1	Paenibacillus_phage	1.8e-34	39.0
WP_000886210.1\|1106261_1107611_-	cell wall metabolism sensor histidine kinase VicK	W8CYF6	Bacillus_phage	1.8e-34	34.6
WP_000722076.1\|1107603_1108308_-	response regulator transcription factor	W8CYM9	Bacillus_phage	2.8e-39	39.8
WP_000886145.1\|1108362_1109538_-	A/G-specific adenine glycosylase	G3CB03	Aeropyrum_pernix_spindle-shaped_virus	8.8e-22	29.8
WP_000845292.1\|1109866_1111537_-	formate--tetrahydrofolate ligase	NA	NA	NA	NA
WP_000699498.1\|1111766_1112456_+	phosphopantothenate--cysteine ligase	Q9HH70	Methanothermobacter_phage	5.0e-17	31.6
WP_001284128.1\|1112467_1113019_+	phosphopantothenoylcysteine decarboxylase	A0A1V0S7W6	Shearwaterpox_virus	3.1e-25	36.1

DBSCAN-SWA_6

1300762 : 1306540

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001272961.1\|1300762_1301374_+	peptide deformylase	E3SLL2	Synechococcus_phage	4.9e-16	42.4
WP_000855753.1\|1301418_1302147_+	23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB	NA	NA	NA	NA
WP_000272302.1\|1302185_1303097_-	thioredoxin-disulfide reductase	G3MA85	Bacillus_virus	4.5e-90	51.8
WP_000926599.1\|1303162_1303387_-	DUF4059 family protein	NA	NA	NA	NA
WP_000590970.1\|1303464_1304208_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.7e-29	40.5
WP_001103449.1\|1304207_1305008_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_000889093.1\|1305165_1305522_-	arsenate reductase family protein	M1PLC0	Streptococcus_phage	1.2e-33	57.3
WP_001170347.1\|1305515_1306046_-	methylated-DNA--[protein]-cysteine S-methyltransferase	M1PFU9	Streptococcus_phage	1.4e-46	54.3
WP_000405853.1\|1306045_1306540_-	GNAT family N-acetyltransferase	M1PSC3	Streptococcus_phage	5.5e-42	51.5

DBSCAN-SWA_7

2016272 : 2025026

Streptococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000510406.1\|2016272_2017112_-	energy-coupling factor transporter ATPase	A0A2K9L3Z8	Tupanvirus	1.0e-16	29.8
WP_000835715.1\|2017096_2017924_-	energy-coupling factor transporter ATPase	G9BWD6	Planktothrix_phage	2.8e-22	32.9
WP_000712132.1\|2017920_2018466_-	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase	NA	NA	NA	NA
WP_001227958.1\|2018476_2019298_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_000170194.1\|2019339_2020623_-	insulinase family protein	A0A167R9K4	Powai_lake_megavirus	7.1e-17	23.6
WP_000424263.1\|2020619_2021870_-	insulinase family protein	A0A1X9I714	Streptococcus_phage	3.5e-93	42.3
WP_000455903.1\|2022028_2022397_+	S4 domain-containing protein YaaA	A0A1X9I5V8	Streptococcus_phage	7.0e-18	57.3
WP_000266662.1\|2022399_2023497_+	DNA replication/repair protein RecF	NA	NA	NA	NA
WP_000073428.1\|2023547_2025026_-	IMP dehydrogenase	A0A1V0SHK8	Klosneuvirus	2.2e-94	40.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_003098

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection