CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NC_000964	Bacillus subtilis subsp. subtilis str. 168 complete genome	3 crisprs	csa3,cas3,DEDDh,WYL,DinG	0	1	11	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_000964_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_000964_1

937945-938050

Orphan

Consensus_repeat	Method
AGAAAACAAAACCAACAATCAGCTG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_000964_1

>merge|NC_000964|1|937945-938050|CRISPRCasFinder
AGAAAACAAAACCAACAATCAGCTGCTGGTCAAGGTCAATTTGGCACTGAATTTGCTAGCGAAACAAACGCTCAGCAAGTCAGAAAACAAAACCAGCAATCAGCTG

>NC_000964|1|1|937945-938050|CRISPRCasFinder
AGAAAACAAAACCAACAATCAGCTG	CTGGTCAAGGTCAATTTGGCACTGAATTTGCTAGCGAAACAAACGCTCAGCAAGTC
AGAAAACAAAACCAGCAATCAGCTG

Protein	Signature genes	Signature genes Name	Protein_function
NC_000964.3\|NP_388739.1\|929724_930585_+\|stress-induced-epoxide-hydrolase	unknown	unknown	gnl\|CDD\|223669
NC_000964.3\|YP_054574.1\|943890_944364_+\|peroxiredoxin-with-versatile-activity	unknown	unknown	gnl\|CDD\|224146
NC_000964.3\|NP_388736.1\|928388_928658_+\|conserved-hypothetical-protein	unknown	unknown	gnl\|CDD\|379438
NC_000964.3\|NP_388744.1\|936772_936997_-\|conserved-protein-related-to-sporulation	unknown	unknown	unknown
NC_000964.3\|NP_388750.1\|941167_942229_-\|putative-membrane-protein	unknown	unknown	gnl\|CDD\|226614
NC_000964.3\|NP_388743.1\|935655_936765_+\|A/G-specific-adenine-glycosylase-or-DNA-(apurinic-or-apyrimidinic-site)-lyase	unknown	unknown	gnl\|CDD\|130156
NC_000964.3\|NP_388740.1\|930817_931807_+\|putative-bactoprenol-glycosyl-transferase,-phage-origin	unknown	unknown	gnl\|CDD\|133030
NC_000964.3\|NP_388756.2\|953372_954149_-\|protein-involved-in-the-control-of-the-cell-cycle-as-a-function-of-the-environment	unknown	unknown	gnl\|CDD\|226776
NC_000964.3\|NP_388755.1\|945519_946404_+\|conserved-hypothetical-protein	unknown	unknown	gnl\|CDD\|379641
NC_000964.3\|NP_388748.3\|938730_939261_+\|putative-RNA-binding-factor	unknown	unknown	gnl\|CDD\|184219
NC_000964.3\|NP_388745.1\|937078_937831_+\|enoyl-acyl-carrier-protein-reductase-III	unknown	unknown	gnl\|CDD\|236145
NC_000964.3\|NP_388749.2\|939348_941091_+\|putative-ABC-transporter-(ATP-binding-protein)	unknown	unknown	gnl\|CDD\|224055
NC_000964.3\|YP_054575.1\|944958_945312_-\|putative-membrane-protein	unknown	unknown	gnl\|CDD\|371346
NC_000964.3\|NP_388737.1\|928802_929321_+\|putative-exported-protein	unknown	unknown	gnl\|CDD\|214600
NC_000964.3\|NP_388751.3\|942448_943738_-\|glutamate-1-semialdehyde-aminotransferase,-class-III-aminotransferase	unknown	unknown	gnl\|CDD\|183493
NC_000964.3\|NP_388741.2\|931878_934464_+\|conserved-membrane-protein	unknown	unknown	gnl\|CDD\|226888
NC_000964.3\|NP_388753.1\|944486_944924_+\|transcriptional-regulator-(Fur-family)	unknown	unknown	gnl\|CDD\|223806
NC_000964.3\|NP_388747.1\|938242_938587_+\|conserved-hypothetical-protein	unknown	unknown	gnl\|CDD\|372951
NC_000964.3\|NP_388738.1\|929405_929738_+\|factor-for-peptide-SdpC-immunity	unknown	unknown	gnl\|CDD\|227945
NC_000964.3\|NP_388742.1\|934456_935440_-\|putative-membrane-hydrolase	unknown	unknown	gnl\|CDD\|224899

Protein	Function_ID	Function_description	E-value
NC_000964.3\|NP_388739.1\|929724_930585_+\|stress-induced-epoxide-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	3.87358e-38
NC_000964.3\|YP_054574.1\|943890_944364_+\|peroxiredoxin-with-versatile-activity	gnl\|CDD\|224146	COG1225, Bcp, Peroxiredoxin [Posttranslational modification, protein turnover, chaperones].	6.45936e-86
NC_000964.3\|NP_388736.1\|928388_928658_+\|conserved-hypothetical-protein	gnl\|CDD\|379438	pfam14043, WVELL, WVELL protein. This family includes the B. subtilis YfjH protein, which is functionally uncharacterized. This is not a homolog of E. coli YfjH, a synonym for IscX, which belongs to pfam04384. This family of proteins is found in bacteria. Proteins in this family are approximately 90 amino acids in length and contain a highly conserved WVELL motif.	4.98563e-41
NC_000964.3\|NP_388753.1\|944486_944924_+\|transcriptional-regulator-(Fur-family)	gnl\|CDD\|223806	COG0735, Fur, Fe2+/Zn2+ uptake regulation proteins [Inorganic ion transport and metabolism].	2.19115e-56
NC_000964.3\|NP_388750.1\|941167_942229_-\|putative-membrane-protein	gnl\|CDD\|226614	COG4129, COG4129, Predicted membrane protein [Function unknown].	2.49461e-90
NC_000964.3\|NP_388747.1\|938242_938587_+\|conserved-hypothetical-protein	gnl\|CDD\|372951	pfam14182, YgaB, YgaB-like protein. The YgaB-like protein family includes the B. subtilis YgaB protein, which is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 90 amino acids in length.	1.16495e-28
NC_000964.3\|NP_388740.1\|930817_931807_+\|putative-bactoprenol-glycosyl-transferase,-phage-origin	gnl\|CDD\|133030	cd04187, DPM1_like_bac, Bacterial DPM1_like enzymes are related to eukaryotic DPM1. A family of bacterial enzymes related to eukaryotic DPM1; Although the mechanism of eukaryotic enzyme is well studied, the mechanism of the bacterial enzymes is not well understood. The eukaryotic DPM1 is the catalytic subunit of eukaryotic Dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. The enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. This protein family belongs to Glycosyltransferase 2 superfamily.	2.54502e-85
NC_000964.3\|NP_388756.2\|953372_954149_-\|protein-involved-in-the-control-of-the-cell-cycle-as-a-function-of-the-environment	gnl\|CDD\|226776	COG4326, Spo0M, Sporulation control protein [General function prediction only].	1.87454e-155
NC_000964.3\|NP_388755.1\|945519_946404_+\|conserved-hypothetical-protein	gnl\|CDD\|379641	pfam14540, NTF-like, Nucleotidyltransferase-like. Structural comparisons with Structure 1kny indicate that this N-terminal domain resembles a nucleotidyltransferase fold.	1.16999e-58
NC_000964.3\|NP_388748.3\|938730_939261_+\|putative-RNA-binding-factor	gnl\|CDD\|184219	PRK13662, PRK13662, hypothetical protein; Provisional.	7.36814e-127
NC_000964.3\|NP_388749.2\|939348_941091_+\|putative-ABC-transporter-(ATP-binding-protein)	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	0
NC_000964.3\|YP_054575.1\|944958_945312_-\|putative-membrane-protein	gnl\|CDD\|371346	pfam11023, DUF2614, Zinc-ribbon containing domain. This is a family of proteins conserved in the Bacillaceae family. Some members are annotated as being protein YgzB. The function is not known.	3.8424e-68
NC_000964.3\|NP_388737.1\|928802_929321_+\|putative-exported-protein	gnl\|CDD\|214600	smart00287, SH3b, Bacterial SH3 domain homologues.	2.69836e-13
NC_000964.3\|NP_388751.3\|942448_943738_-\|glutamate-1-semialdehyde-aminotransferase,-class-III-aminotransferase	gnl\|CDD\|183493	PRK12389, PRK12389, glutamate-1-semialdehyde aminotransferase; Provisional.	0
NC_000964.3\|NP_388742.1\|934456_935440_-\|putative-membrane-hydrolase	gnl\|CDD\|224899	COG1988, COG1988, Predicted membrane-bound metal-dependent hydrolases [General function prediction only].	2.00254e-44
NC_000964.3\|NP_388743.1\|935655_936765_+\|A/G-specific-adenine-glycosylase-or-DNA-(apurinic-or-apyrimidinic-site)-lyase	gnl\|CDD\|130156	TIGR01084, A/G-specific_adenine_glycosylase, A/G-specific adenine glycosylase. This equivalog model identifies mutY members of the pfam00730 superfamily (HhH-GPD: Helix-hairpin-helix and Gly/Pro rich loop followed by a conserved aspartate). The major members of the superfamily are nth and mutY. [DNA metabolism, DNA replication, recombination, and repair].	5.10517e-157
NC_000964.3\|NP_388745.1\|937078_937831_+\|enoyl-acyl-carrier-protein-reductase-III	gnl\|CDD\|236145	PRK08063, PRK08063, enoyl-[acyl-carrier-protein] reductase FabL.	2.59874e-172
NC_000964.3\|NP_388738.1\|929405_929738_+\|factor-for-peptide-SdpC-immunity	gnl\|CDD\|227945	COG5658, COG5658, Predicted integral membrane protein [Function unknown].	1.0168e-26
NC_000964.3\|NP_388741.2\|931878_934464_+\|conserved-membrane-protein	gnl\|CDD\|226888	COG4485, COG4485, Predicted membrane protein [Function unknown].	0

>NC_000964.3|NP_388745.1|937078_937831_+|enoyl-acyl-carrier-protein-reductase-III
MEQNKCALVTGSSRGVGKAAAIRLAENGYNIVINYARSKKAALETAEEIEKLGVKVLVVKANVGQPAKIKEMFQQIDETFGRLDVFVNNAASGVLRPVMELEETHWDWTMNINAKALLFCAQEAAKLMEKNGGGHIVSISSLGSIRYLENYTTVGVSKAALEALTRYLAVELSPKQIIVNAVSGGAIDTDALKHFPNREDLLEDARQNTPAGRMVEIKDMVDTVEFLVSSKADMIRGQTIIVDGGRSLLV
>NC_000964.3|NP_388744.1|936772_936997_-|conserved-protein-related-to-sporulation
MYVGRDMSELNMVSKKDWKNSELAYFHHAFQQIMPYLNEEGQSKYRELTQEIEARGGMKRNEADYSHGTRVSYD
>NC_000964.3|NP_388743.1|935655_936765_+|A/G-specific-adenine-glycosylase-or-DNA-(apurinic-or-apyrimidinic-site)-lyase
MNVLEDKLKQKDIQQFRDDLISWFEREQRVLPWREDQDPYKVWVSEVMLQQTRVETVIPYFLRFVEQFPTVEALADADEEKVLKAWEGLGYYSRVRNLQSAVKEVKQEYGGIVPPDEKDFGGLKGVGPYTKGAVLSIAYNKPIPAVDGNVMRVMSRILSIWDDIAKPKTRTIFEDAIRAFISKEKPSEFNQGLMELGALICTPKSPSCLLCPVQQHCSAFEEGTERELPVKSKKKKPGIKTMAAIVLTDEDGQVYIHKRPSKGLLANLWEFPNLETQKGIKTEREQLIAFLENEYGIQADISDLQGVVEHVFTHLVWNISVFFGKVKQVSDTSKLKKVTKEELEQFAFPVSHQKIWKMAGEAAAISAAP
>NC_000964.3|NP_388742.1|934456_935440_-|putative-membrane-hydrolase
MDTGTHVVMGIALGGIATLDPVVGSDPAMAHAVMIATLAGSQAPDIDTVLKLKNNAVYIRNHRGFTHSIPAVLFWSVIIPAILYLFYPQADFLHLWLWTLLAVVLHVFVDIFNAYGTQAIRPFSKKWVALGLINTFDPFIFISHLAAIAIWYAGGSPGITFLSLYIILVGYYLVRLIMQLRIKRKLHEMIHDEIESIIISPTMKFRQWRIAVTTAHAFYVGRSMEGHVVILDTFNRVPVPETDVMHAAKQDDNIAAFLSFSPVYRWEVDTFKDHYEVRFIDLRYRSKGHYPFVAIVHIGHDLTIRSSYTGWIFSEEKLQKKLKLGSI
>NC_000964.3|NP_388741.2|931878_934464_+|conserved-membrane-protein
MKRKHIMIYAASLLVSVLAHAFFVKEWAEGRYMTGPGDGLAQMIVFKKLLFDQYTHGNFFYNYSFGLGGGTFSQLGYYFSASFLFLAVSAAVWLLQAVQLIGETDTLFWAESAVFISIFKLSLIIFTSASVFHYLLKHRAASFTGAVLYGVSIIYFRHEAYWEFFTDTMVWLPLLVLGAEKIIRERRPAWFIVACSLTLINNFYFAYINLIFIGIYVLFRWLIRLEPHEEKRWIQIRLFLVSGFISFGISAAAFVPVVYGFLNNLRPPYSQKIEWLNFDDNILFSSRIIIVPAAFLLFLFIISFYKNRVFRLFAGLSLLFILFHFSPYAASVFNGFSAPQNRFEYVLAFTIAGAAAAGLSQLSELKRKELLPAAAVVLLLYLYHIQRYKLDIWKPANESILLLLLMTIAALFAAAFAKKRAKMAVYGIIILSSLFVANSYQKYALSEGGDLDSVTKEYLTSEEYRGRESSELIRRLQKEDDDPLMRIDWMNGVRNNTPIIYGFNGFSAYSSILNKDLLAFYWNDLSIDMGRESVSRYASLGDRANLYSLLYGKYYMTEKTNEASVPYGFKKHLETEHYAVYENQYMLPFVKTADAIYSESELDRLPALAKEQAMLKGIILKDPSGKTEQTPKPSNLITKSDITAKQAQYQNGLLTVTGENGGELIITPKQPSSAPGDYYVSFYLKSKAKDKGFTLKVNDYVTTRKSNKSIYKTGVNNITVRVPKSGHISINLPKGTYELRNIALYEENYQTLKNAVMQNKTEKADKLNWNKNRLTFSYHLSKDQYIMLPIPYEKGWELKINGKTQKIEKADYAFIGFKAQKGDNHIELTYYPPYFKISAIISLVSLLLAVFYIRRKKPGSI
>NC_000964.3|NP_388740.1|930817_931807_+|putative-bactoprenol-glycosyl-transferase,-phage-origin
MKQGLISIIIPSYNEGYNVKLIHESLKKEFKNIHYDYEIFFINDGSVDDTLQQIKDLAATCSRVKYISFSRNFGKEAAILAGFEHVQGEAVIVMDADLQHPTYLLKEFIKGYEEGYDQVIAQRNRKGDSFVRSLLSSMYYKFINKAVEVDLRDGVGDFRLLSRQAVNALLKLSEGNRFSKGLFCWIGFDQKIVFYENVERKNGTSKWSFSSLFNYGMDGVVSFNHKPLRLCFYTGIFILLLSIIYIIATFVKILTNGISVPGYFTIISAVLFLGGVQLLSLGIIGEYIGRIYYETKKRPHYLIKEANIPNKDLPETNELKSMRRLTKMH
>NC_000964.3|NP_388739.1|929724_930585_+|stress-induced-epoxide-hydrolase
MDGVKCQFVNTNGITLHVAAAGREDGPLIVLLHGFPEFWYGWKNQIKPLVDAGYRVIAPDQRGYNLSDKPEGIDSYRIDTLRDDIIGLITQFTDEKAIVIGHDWGGAVAWHLASTRPEYLEKLIAINIPHPHVMKTVTPLYPPQWLKSSYIAYFQLPDIPEASLRENDYDTLDKAIGLSDRPALFTSEDVSRYKEAWKQPGALTAMLNWYRALRKGSLAEKPSYETVPYRMIWGMEDRFLSRKLAKETERHCPNGHLIFVDEASHWINHEKPAIVNQLILEYLKNQ
>NC_000964.3|NP_388738.1|929405_929738_+|factor-for-peptide-SdpC-immunity
MTGLVGGGLMIIAGILIKLFPPKSINSVYGYRTRRSMSDQRLWNEANRYSASLMILSGLVIAGMGLLLGSNLFILQLILLIAACVITFMLTEKRLKIMTHSQGGDRSGRS
>NC_000964.3|NP_388737.1|928802_929321_+|putative-exported-protein
MKKKQVMLALTAAAGLGLTALHSAPAAKAAPLHDISVSMPSSDTYIIKAGKLNVRTEPNHEGDILGTVSSEQKVKVDRFVNADWAQIHFKGKKAYISTHFLMKTASQAKTTKQTAFYTPTPENGKAKQLSSGTEVTILGWGFSENGGFDFTWAFVDYGGVKGYIHTKDLQMR
>NC_000964.3|NP_388736.1|928388_928658_+|conserved-hypothetical-protein
MNMYIEKLTNLLLEKNEMISYIQAKTWVELLWSDFEATYAKAGHAYQGEKMTEKIVTQWIENYGGQLHLFQSSRNDVNDYLNQSRGLLH
>NC_000964.3|NP_388747.1|938242_938587_+|conserved-hypothetical-protein
MSQRVCFMEIEMIKGGNVYTFIRLKEEPMTEFEKLVSEQMKTMDKLLDLQSELDRCKQIEAELRHLERDARLRGIQAEIAVKRKHLADIQDMFQKQTEQVIRSYRSSEKPSSFV
>NC_000964.3|NP_388748.3|938730_939261_+|putative-RNA-binding-factor
MGYPKEGETIQIHSYKHNGLIHRIWNETTILKSTEMCVIGANDRTMVTESDGRTWITREPAICYFHARQWFNVIGMLREDGVHYYCNISSPFAYDGEAIKYIDYDLDVKVFPDMTYNILDEDEYDDHRKAMNYPKEIDSILRDYLNTLLHWIHQRQGPFAPEFVDMWYERYLRYTK
>NC_000964.3|NP_388749.2|939348_941091_+|putative-ABC-transporter-(ATP-binding-protein)
MGVMKRYMQFVKPYKKQIFVTVLIGIVKFSIPLALPLLLKYVVDDIIQGGGTASDKTTSLFTIMAIMFALFLILRPPVEYYRQYFAQWTASKVLYDIRAKLFDHIQKLSLRFYANTRTGEVISRVINDVEQTKDFVITGLMNIWLDMLTILIVISIMLTLDVKLTLISIVLFPLYGISVKYFYGRLRKLTRERSQALAQVQGHLHERIQGMPVIRSFAIEDHEQAQFNEKNGHFLDKAIRHTNWNAKTFAVVNTITDLAPLIVIACAGYFVINGPLTVGTMVAFVGYIDRMYNPVRRLINSSTTLTQSIASMDRVFEFIDEPYELTDKPNAIKADQIRGGVEFQNVSFQYEKDKENILHDVSLKVNRGETVALVGMSGGGKSTLVSLIPRFYDVTSGRLLIDGTDIRDYEARSLRNQVGMVLQDTFLFSETIRENIAIGKPDATLEEIIEAAKAANAHEFIMSFPEGYETRVGERGVKLSGGQKQRISIARVFLKNPPLLILDEATSALDLESEHYIQEAMDKLAKDRTTFVVAHRLSTITHADKIVVMENGTIIEIGTHDELMDYESQYKHLFTIQNLN
>NC_000964.3|NP_388750.1|941167_942229_-|putative-membrane-protein
MKLGARIFKTGIAITLALYLASWIGLPAPIFAGIAAIFAIQPSIYRSFLIIIDQVQANIIGAVIATVFGLIFGPSPIMIGLTAVIVITIMLKLKIEHTISIALVTVIAILESAGDDFLMFALIRTSTVILGVLSSFIVNLVFLPPKYETKLIHNTVENTEEIMKWIRLSMRQSTEHSILKEDIEKLKEKMIKLDQTYLLYKEERSYFKKTTYVKSRKLVLFRQAIITANRALDTLKKLHRLENEIYHMPEEFQETLTEELDYLLYWHERILMRFVGKIKPHDDAVEEGIRYKQLLTKSFLKNQQNTDEELIDYNMLNIMASAVEYREQLEHLETLITSFQTYHPKDCEIETEE
>NC_000964.3|NP_388751.3|942448_943738_-|glutamate-1-semialdehyde-aminotransferase,-class-III-aminotransferase
MHTKSIELHNEALQHIVGGVNSPSRSYKAVGGGSPVAMEKASGAYFWDVDGNKYIDYLAAYGPIITGHAHPHITEAIKKAAENGVLYGTPTKHEVTFAKMLKEAIPAMDKVRFVNSGTEAVMTTIRVARAYTGRTKIIKFAGCYHGHSDLVLVAAGSGPSTLGTPDSAGVPKSIANEVITVPFNDIDSYKAALEKWGSEIAAVLVEPIVGNFGIVEPKEGFLEQVNELTHNAGALVIYDEVITAFRFMYGGAQDLLQVKPDLTALGKIIGGGLPIGAYGGKQEIMEQVAPLGPAYQAGTMAGNPASILSGIACLEVLKEKGVYEKLDHLGAMLEEGILKHAETHGITITVNRLKGALTVYFSDEKVENYEQAERSDGETFSTFFKLMLERGINLAPSKYEAWFITTAHTEQDIKDTLTAVEDAFKHLKN
>NC_000964.3|YP_054574.1|943890_944364_+|peroxiredoxin-with-versatile-activity
MTIEIGQKAPDLELKGDHGETVKLSDYKGKYIVLYFYPKDMTPGCTTEACDFRDSHESFAELDAVIIGVSPDSQEKHGKFKEKHNLPFLLLVDDEHKLAEAFDVWKLKKNFGKEYMGIERSTFLIDKEGRLIKEWRKVKVKDHVAEALQTLKDMSEK
>NC_000964.3|NP_388753.1|944486_944924_+|transcriptional-regulator-(Fur-family)
MAAHELKEALETLKETGVRITPQRHAILEYLVNSMAHPTADDIYKALEGKFPNMSVATVYNNLRVFRESGLVKELTYGDASSRFDFVTSDHYHAICENCGKIVDFHYPGLDEVEQLAAHVTGFKVSHHRLEIYGVCQECSKKENH
>NC_000964.3|YP_054575.1|944958_945312_-|putative-membrane-protein
MAKYSSKINKIRTFALSLVFVGFIIMYIGIFFKESVLLSSLFMILGLLSIGLSTVVYFWIGMLSTKAVRVICPGCDKETKVLGVVDMCMHCREPLTLDKGLEGKEFDESYNKKKMSK
>NC_000964.3|NP_388755.1|945519_946404_+|conserved-hypothetical-protein
MENLLRPIYQERASHPNTLAVIMIERRNKTSSLTDNFDAALLVIVKDADEPVFIKHYEFDHQTASLHVVTDSQIQEWILLGTNRRIIDWIVNGRVLFDRNEYVVELIDRLNTFPFAERKLKIGLEYGKLIRRYVEGKAFFEANQFLDAYNAVVHALHHLARIEVIDRGFHPETTVWSQVRQMEPQVYKLYSELIESHESLEKRLELLFLANDFLIHSKAEIGSAHLFEVMKEKDIWQFGELLQHHDLKHFTQDLGVMLDYLTEKGLINVCQIETKGQAVYHRGYSFKKGVDSDS
>NC_000964.3|NP_388756.2|953372_954149_-|protein-involved-in-the-control-of-the-cell-cycle-as-a-function-of-the-environment
MSFFKKLAASAGIGAAKVDTILEKDAYFPGEEVQGTVHVKGGKIAQDIRYIDLQLSTRYVIVKDDEEHRKYATIHSFRVTGSFTIQPGEEHQFPFTFTLPLDTPITVGKVEVAVVTDLDIQGGIDKSDHDRIFVEAHPWIENVLEAIENLGFRLNEADCEQAPYFQRRLPFVQEFEFVPTSGYYRQMLDELELIFLLDEDGLEIIFEVDRRARGLRGWLEEMYNDGEQLVRVRFSQSELEDTEELEEVLEEILDQYAE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_000964_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_000964_2

3172256-3172363

Orphan

Consensus_repeat	Method
TGATGGGAATCGAACCCACGACAT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_000964_2

>merge|NC_000964|2|3172256-3172363|CRISPRCasFinder
TGATGGGAATCGAACCCACGACATCAGCTTGGAAGGCTGAGGTTTTACCACTAAACTACACCCGCAATTTTTATTTGGGGCGATTGATGGGAATCGAACCCACGAATG

>NC_000964|2|2|3172256-3172363|CRISPRCasFinder
TGATGGGAATCGAACCCACGACAT	CAGCTTGGAAGGCTGAGGTTTTACCACTAAACTACACCCGCAATTTTTATTTGGGGCGAT
TGATGGGAATCGAACCCACGAATG

Protein	Signature genes	Signature genes Name	Protein_function
NC_000964.3\|NP_390969.1\|3160760_3161894_-\|spore-coat-protein	unknown	unknown	gnl\|CDD\|340831
NC_000964.3\|NP_390985.1\|3186762_3187305_+\|transcriptional-repressor-for-gbsAB	unknown	unknown	gnl\|CDD\|224427
NC_000964.3\|NP_390986.1\|3187502_3188048_+\|biofilm-hydrophobic-layer-component	unknown	unknown	gnl\|CDD\|379999
NC_000964.3\|NP_390982.1\|3183200_3183779_-\|conserved-protein-of-unknown-function	unknown	unknown	gnl\|CDD\|377051
NC_000964.3\|NP_390967.1\|3159257_3159689_-\|outer-spore-coat-protein	unknown	unknown	unknown
NC_000964.3\|NP_390970.1\|3162083_3163157_+\|spore-coat-kinase	unknown	unknown	gnl\|CDD\|131952
NC_000964.3\|NP_390978.1\|3179925_3180447_-\|putative-N-acetyltransferase	unknown	unknown	gnl\|CDD\|224168
NC_000964.3\|NP_390968.1\|3159690_3160746_-\|spore-coat-protein	unknown	unknown	gnl\|CDD\|131952
NC_000964.3\|NP_390973.1\|3166117_3167572_-\|glycogen-(starch)-synthase	unknown	unknown	gnl\|CDD\|234809
NC_000964.3\|NP_390979.1\|3180464_3181994_-\|flotillin-lipid-rafts-scaffold-protein	unknown	unknown	gnl\|CDD\|225177
NC_000964.3\|NP_390984.1\|3185091_3186564_-\|glycine-betaine-aldehyde-dehydrogenase,-NAD+-dependent	unknown	unknown	gnl\|CDD\|143437
NC_000964.3\|NP_390976.1\|3169762_3171646_-\|1,4-alpha-glucan-branching-enzyme	unknown	unknown	gnl\|CDD\|273667
NC_000964.3\|NP_390972.1\|3163734_3166131_-\|glycogen-phosphorylase	unknown	unknown	gnl\|CDD\|273967
NC_000964.3\|NP_390975.1\|3168623_3169766_-\|glucose-1-phosphate-adenylyltransferase-(ADP-glucose-pyrophosphorylase)-subunit-alpha	unknown	unknown	gnl\|CDD\|179997
NC_000964.3\|NP_390983.2\|3183866_3185075_-\|choline-dehydrogenase	unknown	unknown	gnl\|CDD\|341481
NC_000964.3\|NP_390974.1\|3167568_3168600_-\|glucose-1-phosphate-adenylyltransferase-(ADP-glucose-pyrophosphorylase)-beta-subunit	unknown	unknown	gnl\|CDD\|273966
NC_000964.3\|NP_390980.1\|3182014_3182539_-\|putative-membrane-integrity-integral-membrane-protein	unknown	unknown	gnl\|CDD\|376684
NC_000964.3\|NP_390981.1\|3182706_3183195_+\|conserved-protein-of-unknown-function	unknown	unknown	gnl\|CDD\|378981
NC_000964.3\|NP_390971.1\|3163236_3163704_+\|putative-receptor	unknown	unknown	gnl\|CDD\|226007
NC_000964.3\|NP_390977.1\|3179305_3179884_+\|thiamin-permease	unknown	unknown	gnl\|CDD\|226377

Protein	Function_ID	Function_description	E-value
NC_000964.3\|NP_390969.1\|3160760_3161894_-\|spore-coat-protein	gnl\|CDD\|340831	cd03801, GT4_PimA-like, phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.	1.47076e-74
NC_000964.3\|NP_390985.1\|3186762_3187305_+\|transcriptional-repressor-for-gbsAB	gnl\|CDD\|224427	COG1510, COG1510, Predicted transcriptional regulators [Transcription].	4.43641e-73
NC_000964.3\|NP_390986.1\|3187502_3188048_+\|biofilm-hydrophobic-layer-component	gnl\|CDD\|379999	pfam17735, BslA, Biofilm surface layer A. This family includes members such as BslA (previously called YuaB). Secreted BslA from Bacillus subtillis has been shown to form surface layers around the biofilm self-assembling at interfaces of B. subtilis biofilms, forming an elastic film. structural analysis revealed that BslA consists of an Ig-type fold with the addition of an unusual, extremely hydrophobic cap region. The hydrophobic cap exhibits physiochemical properties similar to the hydrophobic surface found in fungal hydrophobins; thus, BslA is defined as member of a class of bacterially produced hydrophobins.	5.35887e-46
NC_000964.3\|NP_390982.1\|3183200_3183779_-\|conserved-protein-of-unknown-function	gnl\|CDD\|377051	pfam03473, MOSC, MOSC domain. The MOSC (MOCO sulfurase C-terminal) domain is a superfamily of beta-strand-rich domains identified in the molybdenum cofactor sulfurase and several other proteins from both prokaryotes and eukaryotes. These MOSC domains contain an absolutely conserved cysteine and occur either as stand-alone forms or fused to other domains such as NifS-like catalytic domain in Molybdenum cofactor sulfurase. The MOSC domain is predicted to be a sulfur-carrier domain that receives sulfur abstracted by the pyridoxal phosphate-dependent NifS-like enzymes, on its conserved cysteine, and delivers it for the formation of diverse sulfur-metal clusters.	1.34032e-05
NC_000964.3\|NP_390970.1\|3162083_3163157_+\|spore-coat-kinase	gnl\|CDD\|131952	TIGR02906, Spore_coat_protein_S, spore coat protein, CotS family. Members of this family include the spore coat proteins CotS and YtaA from Bacillus subtilis and, from other endospore-forming bacteria, homologs that are more closely related to these two than to the spore coat proteins YutH and YsxE. The CotS family is more broadly distributed than YutH or YsxE, but still is not universal among spore-formers. [Cellular processes, Sporulation and germination].	1.3698e-134
NC_000964.3\|NP_390978.1\|3179925_3180447_-\|putative-N-acetyltransferase	gnl\|CDD\|224168	COG1247, COG1247, Sortase and related acyltransferases [Cell envelope biogenesis, outer membrane].	4.15425e-10
NC_000964.3\|NP_390968.1\|3159690_3160746_-\|spore-coat-protein	gnl\|CDD\|131952	TIGR02906, Spore_coat_protein_S, spore coat protein, CotS family. Members of this family include the spore coat proteins CotS and YtaA from Bacillus subtilis and, from other endospore-forming bacteria, homologs that are more closely related to these two than to the spore coat proteins YutH and YsxE. The CotS family is more broadly distributed than YutH or YsxE, but still is not universal among spore-formers. [Cellular processes, Sporulation and germination].	3.56293e-130
NC_000964.3\|NP_390973.1\|3166117_3167572_-\|glycogen-(starch)-synthase	gnl\|CDD\|234809	PRK00654, glgA, glycogen synthase GlgA.	0
NC_000964.3\|NP_390979.1\|3180464_3181994_-\|flotillin-lipid-rafts-scaffold-protein	gnl\|CDD\|225177	COG2268, COG2268, Uncharacterized protein conserved in bacteria [Function unknown].	6.12922e-123
NC_000964.3\|NP_390984.1\|3185091_3186564_-\|glycine-betaine-aldehyde-dehydrogenase,-NAD+-dependent	gnl\|CDD\|143437	cd07119, ALDH_BADH-GbsA, Bacillus subtilis NAD+-dependent betaine aldehyde dehydrogenase-like. Included in this CD is the NAD+-dependent, betaine aldehyde dehydrogenase (BADH, GbsA, EC=1.2.1.8) of Bacillus subtilis involved in the synthesis of the osmoprotectant glycine betaine from choline or glycine betaine aldehyde.	0
NC_000964.3\|NP_390976.1\|3169762_3171646_-\|1,4-alpha-glucan-branching-enzyme	gnl\|CDD\|273667	TIGR01515, branching_enzym, alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase. This model describes the glycogen branching enzymes which are responsible for the transfer of chains of approx. 7 alpha(1--4)-linked glucosyl residues to other similar chains (in new alpha(1--6) linkages) in the biosynthesis of glycogen. This enzyme is a member of the broader amylase family of starch hydrolases which fold as (beta/alpha)8 barrels, the so-called TIM-barrel structure. All of the sequences comprising the seed of this model have been experimentally characterized. This model encompasses both bacterial and eukaryotic species. No archaea have this enzyme, although Aquifex aolicus does. Two species, Bacillus thuringiensis and Clostridium perfringens have two sequences each which are annotated as amylases. These annotations are aparrently in error. GP\|18143720 from C. perfringens, for instance, contains the note "674 aa, similar to gp:A14658_1 amylase (1,4-alpha-glucan branching enzyme (EC 2.4.1.18) ) from Bacillus thuringiensis (648 aa); 51.1% identity in 632 aa overlap." A branching enzyme from Porphyromonas gingivales, OMNI\|PG1793, appears to be more closely related to the eukaryotic species (across a deep phylogenetic split) and may represent an instance of lateral transfer from this species' host. A sequence from Arabidopsis thaliana, GP\|9294564, scores just above trusted, but appears either to contain corrupt sequence or, more likely, to be a pseudogene as some of the conserved catalytic residues common to the alpha amylase family are not conserved here. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0
NC_000964.3\|NP_390972.1\|3163734_3166131_-\|glycogen-phosphorylase	gnl\|CDD\|273967	TIGR02093, Glycogen_phosphorylase, glycogen/starch/alpha-glucan phosphorylases. This family consists of phosphorylases. Members use phosphate to break alpha 1,4 linkages between pairs of glucose residues at the end of long glucose polymers, releasing alpha-D-glucose 1-phosphate. The nomenclature convention is to preface the name according to the natural substrate, as in glycogen phosphorylase, starch phosphorylase, maltodextrin phosphorylase, etc. Name differences among these substrates reflect differences in patterns of branching with alpha 1,6 linkages. Members include allosterically regulated and unregulated forms. A related family, TIGR02094, contains examples known to act well on particularly small alpha 1,4 glucans, as may be found after import from exogenous sources. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0
NC_000964.3\|NP_390975.1\|3168623_3169766_-\|glucose-1-phosphate-adenylyltransferase-(ADP-glucose-pyrophosphorylase)-subunit-alpha	gnl\|CDD\|179997	PRK05293, glgC, glucose-1-phosphate adenylyltransferase; Provisional.	0
NC_000964.3\|NP_390983.2\|3183866_3185075_-\|choline-dehydrogenase	gnl\|CDD\|341481	cd08551, Fe-ADH, iron-containing alcohol dehydrogenases (Fe-ADH)-like. This family contains large metal-containing alcohol dehydrogenases (ADH), known as iron-containing alcohol dehydrogenases. They contain a dehydroquinate synthase-like protein structural fold and mostly contain iron. They are distinct from other alcohol dehydrogenases which contains different protein domains. There are several distinct families of alcohol dehydrogenases: Zinc-containing long-chain alcohol dehydrogenases, insect-type, or short-chain alcohol dehydrogenases, iron-containing alcohol dehydrogenases, among others. The iron-containing family has a Rossmann fold-like topology that resembles the fold of the zinc-dependent alcohol dehydrogenases, but lacks sequence homology, and differs in strand arrangement. ADH catalyzes the reversible oxidation of alcohol to acetaldehyde with the simultaneous reduction of NAD(P)+ to NAD(P)H.	1.69004e-175
NC_000964.3\|NP_390974.1\|3167568_3168600_-\|glucose-1-phosphate-adenylyltransferase-(ADP-glucose-pyrophosphorylase)-beta-subunit	gnl\|CDD\|273966	TIGR02092, Glycogen_biosynthesis_protein_GlgD, glucose-1-phosphate adenylyltransferase, GlgD subunit. This family is GlgD, an apparent regulatory protein that appears in an alpha2/beta2 heterotetramer with GlgC (glucose-1-phosphate adenylyltransferase, TIGR02091) in a subset of bacteria that use GlgC for glycogen biosynthesis. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0
NC_000964.3\|NP_390980.1\|3182014_3182539_-\|putative-membrane-integrity-integral-membrane-protein	gnl\|CDD\|376684	pfam01957, NfeD, NfeD-like C-terminal, partner-binding. NfeD-like proteins are widely distributed throughout prokaryotes and are frequently associated with genes encoding stomatin-like proteins (slipins). There appear to be three major groups: an ancestral group with only an N-terminal serine protease domain and this C-terminal beta sheet-rich domain which is structurally very similar to the OB-fold domain, associated with its neighboring slipin cluster; a second major group with an additional middle, membrane-spanning domain, associated in some species with eoslipin and in others with yqfA; a final 'artificial' group which unites truncated forms lacking the protease region and associated with their ancestral gene partner, either yqfA or eoslipin. This NefD, C-terminal, domain appears to be the major one for relating to the associated protein. NfeD homologs are clearly reliant on their conserved gene neighbor which is assumed to be necessary for function, either through direct physical interaction or by functioning in the same pathway, possibly involve with lipid-rafts.	0.00016613
NC_000964.3\|NP_390981.1\|3182706_3183195_+\|conserved-protein-of-unknown-function	gnl\|CDD\|378981	pfam12867, DinB_2, DinB superfamily. The DinB family are an uncharacterized family of potential enzymes. The structure of these proteins is composed of a four helix bundle.	3.20062e-17
NC_000964.3\|NP_390971.1\|3163236_3163704_+\|putative-receptor	gnl\|CDD\|226007	COG3476, COG3476, Tryptophan-rich sensory protein (mitochondrial benzodiazepine receptor homolog) [Signal transduction mechanisms].	1.0961e-40
NC_000964.3\|NP_390977.1\|3179305_3179884_+\|thiamin-permease	gnl\|CDD\|226377	COG3859, COG3859, Predicted membrane protein [Function unknown].	1.328e-72

>NC_000964.3|NP_390976.1|3169762_3171646_-|1,4-alpha-glucan-branching-enzyme
MAAASPTAHDVYLFHEGSLFKSYQLFGSHYRELNGKSGYEFCVWAPHASEVRVAGDFNSWSGEEHVMHRVNDNGIWTLFIPGIGEKERYKYEIVTNNGEIRLKADPYAIYSEVRPNTASLTYDLEGYSWQDQKWQKKQKAKTLYEKPVFIYELHLGSWKKHSDGRHYSYKELSQTLIPYIKKHGFTHIELLPVYEHPYDRSWGYQGTGYYSPTSRFGPPHDLMKFVDECHQQNIGVILDWVPGHFCKDAHGLYMFDGEPLYEYKEERDRENWLWGTANFDLGKPEVHSFLISNALYWAEFYHIDGFRVDAVANILYWPNQDERHTNPYAVDFLKKLNQTMREAYPHVMMIAEDSTEWPQVTGAVEEGGLGFHYKWNMGWMNDVLKYMETPPEERRHCHQLISFSLLYAFSEHFVLPFSHDEVVYGKKSLLNKMPGDYWQKFAQYRLLLGYMTVHPGKKLIFMGSEFAQFDEWKDTEQLDWFLDSFPMHQKASVFTQDLLRFYQKSKILYEHDHRAQSFEWIDVHNDEQSIFSFIRYGQKHGEALVIICNFTPVVYHQYDVGVPFFTQYIEVLNSDSETYGGSGQINKKPLSAKKGALHHKPCYITMTIPPYGISILRAVKKRGEIKR
>NC_000964.3|NP_390975.1|3168623_3169766_-|glucose-1-phosphate-adenylyltransferase-(ADP-glucose-pyrophosphorylase)-subunit-alpha
MKKQCVAMLLAGGKGSRLSGLTKNMAKPAVSFGGKYRIIDFTLSNCSNSGIDTVGILTQYQPLELNSYIGIGSAWDLDRYNGGVTVLPPYAESSEVKWYKGTASSIYENLNYLNQYDPEYVLILSGDHIYKMDYGKMLDYHIEKKADVTISVIEVGWEEASRFGIMKANPDGTITHFDEKPKFPKSNLASMGIYIFNWPLLKQYLEMDDQNPYSSHDFGKDIIPLLLEEKKKLSAYPFKGYWKDVGTVQSLWEANMDLLKEDSELKLFERKWKIYSVNPNQPPQFISSDAQVQDSLVNEGCVVYGNVSHSVLFQGVTVGKHTTVTSSVIMPDVTIGEHVVIENAIVPNGMVLPDGAVIRSEKDIEEVLLVSEEFVEKELI
>NC_000964.3|NP_390974.1|3167568_3168600_-|glucose-1-phosphate-adenylyltransferase-(ADP-glucose-pyrophosphorylase)-beta-subunit
MFNNQMLGVIDETTYKHSLQDLTAQRSLGAIPFAGRYRLIDFMLSNMVNADIRSVAIFPKYRYRSLMDHLGAGKEWDLHRKKDGLFFFPSPHLHHEYDEFGSFRQFSDHLDYFHRSTQQYAVISNSHTVCNIQFQYVLKRHQEVGCDVTEVFQDGQSLQIYIMSTTLLKDLIYGHSEKGYKTIQEAVEKESSALTICPYEYSGYAAVIDSVEKYYTHSMELIQPRFWQQVFLPQQPIYTKVKDEPPTKYGKHSTVKNSLVANGCVLEGEVENCILFRAVHVGKGTKLKNCIIMQKTQIGEDCLLEQVISDKDVKIGKATEAAGTAEQPLVLRKGLVQGELMNS
>NC_000964.3|NP_390973.1|3166117_3167572_-|glycogen-(starch)-synthase
MKILFAVSECTPFVKSGGLADVAGALPKALARLGNEVAVMLPKYSQIPEPWKKRMKKQAECTVAVGWRQQYCGIEHMAENDVNYYFIDNEYYFNRDSLYGHYDDGERFAFFSRAVLEAAKVVNVQADIVHTHDWHTAMVNYLLKEEYRKHPFYERMKSVLTIHNLQFQGIFPPDVTHDLLGLEMDHFHYERLECNGFVNFMKAGIIAADHVTTVSPTYRNEIMTPYYGEQLEQVLQYREDDVTGILNGIDDTFYQPKSDPYIEAQYDSGDLACKLENKTKLQQRMGLPEKNDIPLISMVTRLTKQKGLDLVRRIMHELLEEQDIQLVVLGTGEREFEDYFRYAEFAFHEKCRAYIGFDEPLAHQIYAGSDMFLMPSKFEPCGLGQLIALQYGAIPIVRETGGLYDTVRAYQEEEGTGNGFTFSAFNAHDLKFTIERALSFYCQQDVWKSIVKTAMNADYSWGKSAKEYQRIFEQVTRSGRDVLE
>NC_000964.3|NP_390972.1|3163734_3166131_-|glycogen-phosphorylase
MFSSKERFADLFLKRLEMTCGKSFKDSAKLDQYKTLGNMVREYISADWIETNEKSRSNSGKQTYYLSIEFLLGQLLEQNLMNLGVRDVVEAGLKEIGINLEEILQIENDAGLGNGGLGRLAACFLDSLASLNLPGHGMGIRYKHGLFEQKIVDGHQVELPEQWLKNGNVWEVRNADQAVDVPFWGEVHMTEKSGRLHFRHEQATIVTAVPYDIPIIGYETGTVNTLRLWNAEPYAHYHGGNILSYKRETEAVSEFLYPDDTHDEGKILRLKQQYFLVCASLKSIVNNYRKTHKSLSGLHKKVSIHINDTHPALAVPELMRILLDEENMSWEEAWHITVHTISYTNHTTLSEALEKWPIHLFKPLLPRMYMIIEEINERFCRAVWEKYPGDWKRIENMAITAHGVVKMAHLAIVGSYSVNGVAKIHSDILKEREMRDFHLLFPNRFNNKTNGIAHRRWLLKANPGLSAIITEAIGDEWVKQPESLIRLEPYATDPAFIEQFQNNKSKKKQELADLIFCTAGVVVNPESIFDVQVKRLHAYKRQLLNVLHIMYLYNRLKEDSGFSIYPQTFIFGAKASPSYYYAKKIIKLIHSVAEKVNYDPAVKQLIKVVFLENYRVSMAERIFPASDVSEQISTASKEASGTGNMKFMMNGALTIGTHDGANIEILERVGPDCIYTFGLKADEVLSYQENGGYRSREYYQHDRRIRQVADQLINGFFEGEADEFESIFDSLLPHNDEYFVLKDFSSYADAQERIQADYRERRKWSEHSIVNIAHSGYFSSDRTIREYAKDIWGIKPMM
>NC_000964.3|NP_390971.1|3163236_3163704_+|putative-receptor
MKKIVGALAVFVITYALFSAAGYLFPVDQEWYNSLKKPDWTPSGTAIGIIWAILFALISLSAAIVYAAFSFKGAKSFWFTLLINYVLNQAFSYFQFTQKNLLAASLDCLLVAITAIVLLIIAKKYSRAASYLLLPYFLWSAFATFLSFTINSMNL
>NC_000964.3|NP_390970.1|3162083_3163157_+|spore-coat-kinase
MCPLMAENHEVIEEGNSSELPLSAEDAKKLTELAENVLQGWDVQAEKIDVIQGNQMALVWKVHTDSGAVCLKRIHRPEKKALFSIFAQDYLAKKGMNVPGILPNKKGSLYSKHGSFLFVVYDWIEGRPFELTVKQDLEFIMKGLADFHTASVGYQPPNGVPIFTKLGRWPNHYTKRCKQMETWKLMAEAEKEDPFSQLYLQEIDGFIEDGLRIKDRLLQSTYVPWTEQLKKSPNLCHQDYGTGNTLLGENEQIWVIDLDTVSFDLPIRDLRKMIIPLLDTTGVWDDETFNVMLNAYESRAPLTEEQKQVMFIDMLFPYELYDVIREKYVRKSALPKEELESAFEYERIKANALRQLI
>NC_000964.3|NP_390969.1|3160760_3161894_-|spore-coat-protein
MKIALIATEKLPVPSVRGGAIQIYLEAVAPLIAKKHEVTVFSIKDPNLADREKVDGVHYVHLDEDRYEEAVGAELKKSRFDLVHVCNRPSWVPKLKKQAPDAVFILSVHNEMFAYDKISQAEGEICIDSVAQIVTVSDYIGQTITSRFPSARSKTKTVYSGVDLKTYHPRWTNEGQRAREEMRSELGLHGKKIVLFVGRLSKVKGPHILLQALPDIIEEHPDVMMVFIGSKWFGDNELNNYVKHLHTLGAMQKDHVTFIQFVKPKDIPRLYTMSDVFVCSSQWQEPLARVHYEAMAAGLPIITSNRGGNPEVIEEGKNGYIIHDFENPKQYAERINDLLSSSEKRERLGKYSRREAESNFGWQRVAENLLSVYEKNR
>NC_000964.3|NP_390968.1|3159690_3160746_-|spore-coat-protein
MYQKEHEEQIVSEILSYYPFHIDHVALKSNKSGRKIWEVETDHGPKLLKEAQMKPERMLFITQAHAHLQEKGLPIAPIHQTKNGGSCLGTDQVSYSLYDKVTGKEMIYYDAEQMKKVMSFAGHFHHASKGYVCTDESKKRSRLGKWHKLYRWKLQELEGNMQIAASYPDDVFSQTFLKHADKMLARGKEALRALDDSEYETWTKETLEHGGFCFQDFTLARLTEIEGEPFLKELHSITYDLPSRDLRILLNKVMVKLSVWDTDFMVALLAAYDAVYPLTEKQYEVLWIDLAFPHLFCAIGHKYYLKQKKTWSDEKYNWALQNMISVEESKDSFLDKLPELYKKIKAYREAN
>NC_000964.3|NP_390967.1|3159257_3159689_-|outer-spore-coat-protein
MRSSRQKASISKLDLDQFVFTPPGPMGWQAHDSISAEKEEEEKHLDVGSIRELPHINAPKEYQKETKEKETDRKIVDDEEETKFETTLEPEEERDSKRSAPPYEEEDEDEEPDLAEEAKVEIIILPSESKPAPWFSQTVKRKA
>NC_000964.3|NP_390977.1|3179305_3179884_+|thiamin-permease
MNQSKQLVRLIEIAIMTAAAVILDIVSGMFLSMPQGGSVSIMMIPIFLISFRWGVKAGLTTGLLTGLVQIAIGNLFAQHPVQLLLDYIVAFAAIGISGCFASSVRKAAVSKTKGKLIVSVVSAVFIGSLLRYAAHVISGAVFFGSFAPKGTPVWIYSLTYNATYMVPSFIICAIVLCLLFMTAPRLLKSDKA
>NC_000964.3|NP_390978.1|3179925_3180447_-|putative-N-acetyltransferase
MVTVREAKLEDIKDIAKVHVDSWRTTYHEIIPIDYLNSLNYKEFEDKWKSRSLKGVFVAQDEKGSVFGFASFGPIRSEQEGYDGELYAIYLLEERQRQGAGRALLAKGAEFLLQHGFSSMFVWVIEQNPSIIFYQAYSPERVAEDNFEIAGVRLKEVGLGWPDLSALKTLLNR
>NC_000964.3|NP_390979.1|3180464_3181994_-|flotillin-lipid-rafts-scaffold-protein
MTMPIIMIIGVVFFLLIALIAVFITKYRTAGPDEALIVTGSYLGNKNVHVDEGGNRIKIVRGGGTFVLPVFQQAEPLSLLSSKLDVSTPEVYTEQGVPVMADGTAIIKIGGSIGEIATAAEQFLGKSKDDREQEAREVLEGHLRSILGSMTVEEIYKNREKFSQEVQRVASQDLAKMGLVIVSFTIKDVRDKNGYLESLGKPRIAQVKRDADIATAEADKETRIKRAEADKDAKKSELERATEIAEAEKINQLKMAEFRREQDTAKANADQAYDLETARARQQVTEQEMQVKIIERQKQIELEEKEILRRERQYDSEVKKKADADRYSVEQSAAAEKAKQLAEADAKKYSIEAMAKAEAEKVRIDGLAKAEAEKAKGETEAEVIRLKGLAEAEAKEKIAAAFEQYGQAAIFDMIVKMLPEYAKQAAAPLSNIDKITVVDTGGSGESSGANKVTSYATNLMSSLQESLKASSGIDVKEMLENFSGKGNVKQSINELTNEIKEAKTIQKSE
>NC_000964.3|NP_390980.1|3182014_3182539_-|putative-membrane-integrity-integral-membrane-protein
MELFGVPIQTMYLYTLIIAGSLTLLFLFFGDVFSGLSEGIPFLNPTLVLSFFTCFSAGGYIGELVLPLSSLLIALLSCILSIMLVVLLHIFVLVPLSSAEESLAYREDDLRGRLGKVITAVPVDGFGEVVIEGIGGTISKSAVSFDNQQISYGTTVLVVDINNGVLSVTPHEPI
>NC_000964.3|NP_390981.1|3182706_3183195_+|conserved-protein-of-unknown-function
MSIFNEARLETWNELKGLSDEKLNQKPSAEEWSIREVLDHLKKIDMTAQKMLKERVKDAPIKEIEEKPLEVAQDRNNKRKAPSHLEPAHDFISGSQMKRELDVVREQLTAAIASLKEEDFERVLPHPVFQELTVRQWIDFIGHHEKRHLSQMKEIKEKIERA
>NC_000964.3|NP_390982.1|3183200_3183779_-|conserved-protein-of-unknown-function
MWKRMTAKAEGLYIADTKSFVTKQMDKLDFDYGGIPGDLHFGLTKKAGAREPMFSRGTEIFNRRQISIVSIEECNEIALKMGVPRILPEWLGANVAVSGMPDLTSLKEGSRIIFPSGAALLCEGENDPCIQPGEVIQSYYPDQPKLASAFVRHALGIRGIVCIVERPGAVYTGDEIEVHSYQRKVKRKAERV
>NC_000964.3|NP_390983.2|3183866_3185075_-|choline-dehydrogenase
MTLNMKVESMQKFHTFEIPTVIKHGIGAIKHTGEEVAALGVSKALLVTDPGIYKAGVADPVIESLKEAGIEVVLFNKVEPNPPVRLVNEGSELYKKENCNGLVAVGGGSSMDTAKAIGVEATHEGSVLDYEAADGKKPLENRIPPLTTIPTTAGTGSEVTQWAVITDEEREFKFNTGGPLIAAHLTIIDPELHVSMPPHVTAMTGIDALAHAIECYTMKFAQPITDAVALMAIEYAAHYIKRAFADGEDLEARYGMAQAAMLAGLSYGSESAGAAHAMSQTLGGIIPVAHGQCVAAMMGPVMEYNWKGYPEKFARIAKAFGIDTSKMTTEEAAKASVNWMYDLVEDLEVPTLEEQGVSPDMIERLSKEAMKDPQTFGNPRDLNEKAYNWIYKRCFNLTPKTV
>NC_000964.3|NP_390984.1|3185091_3186564_-|glycine-betaine-aldehyde-dehydrogenase,-NAD+-dependent
MSQTLFIDGEWISAEKEQIRSIINPFNQEEIATVSEGGREDAIKAIAAARRAFDKGEWSSLSGLERGKIVLKIAELIRRDLEELAELESLDTGKTLEESKADMDDIANVFQYYAGLADKDGGEIISSPIPDSESKIIREPIGVCGQITPWNYPLLQASWKIAPALAAGNTIVMKPSEITPLTTIKVFKLMEEAGVPKGVANLVLGPGATVGDELAVNKDVDLISFTGGIETGKKIMRAASGNVKKIALELGGKNPNIVFKDADLEVAVDQALNAVFFHAGQVCSAGSRLLVEDAIHDQFLAELVKRAKRIKLGNGFHAETESGPLISAEHRAKVEKYVEIGIEEGAKLETGGKRPEDPELQNGFFYEPTIFSNCNSDMRIVQEEVFGPVLTVETFSSEEEVIELANDTIYGLAGAVWSKDIEKCERVAARLRMGTVWINDFHPYFAQAPWGGYKQSGFGRELGKIGLEEYTEVKHVYRNTKPAAVNWFNS
>NC_000964.3|NP_390985.1|3186762_3187305_+|transcriptional-repressor-for-gbsAB
MDENPEFAAIEQARDLVIDSIAETMDLYGITRSVGILYGTMYMRDEMTLDEMREELQMSKPSMSTGVKKLQDLNVVKKTFHRGIRKHTFVAEKDFFKFFTNFFPPKWEREVQVNVTAIEEAQADLQKVLCKEDLDEDIKNEALQLYDQLESSKAYYDWLKRLAESVQTGEIFKFIPVETK
>NC_000964.3|NP_390986.1|3187502_3188048_+|biofilm-hydrophobic-layer-component
MKRKLLSSLAISALSLGLLVSAPTASFAAESTSTKAHTESTMRTQSTASLFATITGASKTEWSFSDIELTYRPNTLLSLGVMEFTLPSGFTANTKDTLNGNALRTTQILNNGKTVRVPLALDLLGAGEFKLKLNNKTLPAAGTYTFRAENKSLSIGNKFYAEASIDVAKRSTPPTQPCGCN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_000964_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_000964_3

3714992-3715104

Orphan

Consensus_repeat	Method
GAAGATTTTAGTGATCGTTTAGATGATTTTGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_000964_3

>merge|NC_000964|3|3714992-3715104|CRISPRCasFinder
GAAGATTTTAGTGATCGTTTAGATGATTTTGAAGAACTTTTTGAACGTGACGAACGACCAGATTTGGATGATTGATCATCTGAAGATTTTAGTGATCGTTTAGATGATTTTGA

>NC_000964|3|3|3714992-3715104|CRISPRCasFinder
GAAGATTTTAGTGATCGTTTAGATGATTTTGA	AGAACTTTTTGAACGTGACGAACGACCAGATTTGGATGATTGATCATCT
GAAGATTTTAGTGATCGTTTAGATGATTTTGA

Protein	Signature genes	Signature genes Name	Protein_function
NC_000964.3\|NP_391492.1\|3720924_3721401_+\|transcriptional-negative-regulator-of-chromate-transport-(Lrp/AsnC-family)	unknown	unknown	gnl\|CDD\|214628
NC_000964.3\|NP_391483.1\|3711497_3712406_+\|transcriptional-regulator-controlling-alsSD,-ictEP-expression-(LysR-family)	unknown	unknown	gnl\|CDD\|176143
NC_000964.3\|NP_391484.1\|3712616_3713945_+\|putative-Na+/H+-antiporter	unknown	unknown	gnl\|CDD\|238538
NC_000964.3\|NP_391491.1\|3719133_3720711_-\|oxamate-amidohydrolase	unknown	unknown	gnl\|CDD\|129176
NC_000964.3\|NP_391489.1\|3717998_3718616_+\|putative-flavin-binding-monooxygenase	unknown	unknown	gnl\|CDD\|224766
NC_000964.3\|NP_391487.1\|3716008_3717097_-\|spore-coat-protein-kinase	unknown	unknown	gnl\|CDD\|227642
NC_000964.3\|NP_391476.1\|3705164_3706133_+\|ribose-ABC-transporter-(permease)	unknown	unknown	gnl\|CDD\|181922
NC_000964.3\|NP_391488.1\|3717237_3717825_+\|spore-morphogenetic-protein	unknown	unknown	unknown
NC_000964.3\|NP_391478.1\|3707143_3707680_+\|putative-cell-wall-binding-enzyme	unknown	unknown	gnl\|CDD\|214600
NC_000964.3\|YP_009514005.1\|3717325_3717805_+\|doubtful-CDS-(putative-in-frame-frameshift)	unknown	unknown	unknown
NC_000964.3\|NP_391494.1\|3722004_3722541_+\|chromate-transporter-subunit-C	unknown	unknown	gnl\|CDD\|224970
NC_000964.3\|NP_391485.1\|3714001_3714679_-\|conserved-protein-of-unknown-function	unknown	unknown	unknown
NC_000964.3\|NP_391479.1\|3707835_3708132_+\|conserved-protein-of-unknown-function	unknown	unknown	gnl\|CDD\|379026
NC_000964.3\|NP_391490.1\|3718793_3719129_+\|conserved-protein-of-unknown-function	unknown	unknown	gnl\|CDD\|372726
NC_000964.3\|NP_391482.2\|3709627_3711340_-\|alpha-acetolactate-synthase	unknown	unknown	gnl\|CDD\|236312
NC_000964.3\|NP_391495.1\|3722567_3722789_-\|conserved-protein-of-unknown-function	unknown	unknown	unknown
NC_000964.3\|NP_391480.1\|3708171_3708699_-\|nitroreductase-(unknown-substrate)	unknown	unknown	gnl\|CDD\|225158
NC_000964.3\|NP_391493.1\|3721414_3722008_+\|chromate-transporter-subunit-N	unknown	unknown	gnl\|CDD\|224970
NC_000964.3\|NP_391481.1\|3708798_3709566_-\|alpha-acetolactate-decarboxylase	unknown	unknown	gnl\|CDD\|273524
NC_000964.3\|NP_391477.1\|3706144_3707062_+\|ribose-ABC-transporter-(ribose-binding-lipoprotein)	unknown	unknown	gnl\|CDD\|380546

Protein	Function_ID	Function_description	E-value
NC_000964.3\|NP_391492.1\|3720924_3721401_+\|transcriptional-negative-regulator-of-chromate-transport-(Lrp/AsnC-family)	gnl\|CDD\|214628	smart00344, HTH_ASNC, helix_turn_helix ASNC type. AsnC: an autogenously regulated activator of asparagine synthetase A transcription in Escherichia coli).	4.48628e-37
NC_000964.3\|NP_391483.1\|3711497_3712406_+\|transcriptional-regulator-controlling-alsSD,-ictEP-expression-(LysR-family)	gnl\|CDD\|176143	cd08452, PBP2_AlsR, The C-terminal substrate binding domain of LysR-type trnascriptional regulator AlsR, which regulates acetoin formation under stationary phase growth conditions; contains the type 2 periplasmic binding fold. AlsR is responsible for activating the expression of the acetoin operon (alsSD) in response to inducing signals such as glucose and acetate. Like many other LysR family proteins, AlsR is transcribed divergently from the alsSD operon. The alsS gene encodes acetolactate synthase, an enzyme involved in the production of acetoin in cells of stationary-phase. AlsS catalyzes the conversion of two pyruvate molecules to acetolactate and carbon dioxide. Acetolactate is then converted to acetoin at low pH by acetolactate decarboxylase which encoded by the alsD gene. Acetoin is an important physiological metabolite excreted by many microorganisms grown on glucose or other fermentable carbon sources. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	3.7247e-130
NC_000964.3\|NP_391484.1\|3712616_3713945_+\|putative-Na+/H+-antiporter	gnl\|CDD\|238538	cd01118, ArsB_permease, Anion permease ArsB. These permeases have been shown to export arsenate and antimonite in eubacteria and archaea. A typical ArsB permease contains 8-13 transmembrane helices and can function either independently as a chemiosmotic transporter or as a channel-forming subunit of an ATP-driven anion pump (ArsAB). The ArsAB complex is similar in many ways to ATP-binding cassette transporters, which have two groups of six transmembrane-spanning helical segments and two nucleotide-binding domains. The ArsB proteins belong to the ArsB/NhaD superfamily of permeases that translocate sodium, arsenate, sulfate, and organic anions across biological membranes in all three kingdoms of life.	5.48885e-104
NC_000964.3\|NP_391491.1\|3719133_3720711_-\|oxamate-amidohydrolase	gnl\|CDD\|129176	TIGR00066, Contains:_Gamma-glutamyltranspeptidase_large_chain, gamma-glutamyltranspeptidase. Also called gamma-glutamyltranspeptidase (ggt). Some members of this family have antibiotic synthesis or resistance activities. In the case of a cephalosporin acylase from Pseudomonas sp., the enzyme was shown to retain some gamma-glutamyltranspeptidase activity. Other, more distantly related proteins have ggt-related activities and score below the trusted cutoff. [Biosynthesis of cofactors, prosthetic groups, and carriers, Glutathione and analogs].	0
NC_000964.3\|NP_391487.1\|3716008_3717097_-\|spore-coat-protein-kinase	gnl\|CDD\|227642	COG5337, CotH, Spore coat assembly protein [Cell envelope biogenesis, outer membrane].	0
NC_000964.3\|NP_391489.1\|3717998_3718616_+\|putative-flavin-binding-monooxygenase	gnl\|CDD\|224766	COG1853, COG1853, Conserved protein/domain typically associated with flavoprotein oxygenases, DIM6/NTAB family [General function prediction only].	2.41792e-45
NC_000964.3\|NP_391478.1\|3707143_3707680_+\|putative-cell-wall-binding-enzyme	gnl\|CDD\|214600	smart00287, SH3b, Bacterial SH3 domain homologues.	1.32357e-11
NC_000964.3\|NP_391494.1\|3722004_3722541_+\|chromate-transporter-subunit-C	gnl\|CDD\|224970	COG2059, ChrA, Chromate transport protein ChrA [Inorganic ion transport and metabolism].	7.8803e-49
NC_000964.3\|NP_391476.1\|3705164_3706133_+\|ribose-ABC-transporter-(permease)	gnl\|CDD\|181922	PRK09512, rbsC, ribose ABC transporter permease protein; Reviewed.	2.96133e-116
NC_000964.3\|NP_391479.1\|3707835_3708132_+\|conserved-protein-of-unknown-function	gnl\|CDD\|379026	pfam13031, DUF3892, Protein of unknown function (DUF3892). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria and archaea. Proteins in this family are typically between 87 and 104 amino acids in length.	4.59339e-16
NC_000964.3\|NP_391490.1\|3718793_3719129_+\|conserved-protein-of-unknown-function	gnl\|CDD\|372726	pfam13789, DUF4181, Domain of unknown function (DUF4181).	0.000225734
NC_000964.3\|NP_391482.2\|3709627_3711340_-\|alpha-acetolactate-synthase	gnl\|CDD\|236312	PRK08617, PRK08617, acetolactate synthase AlsS.	0
NC_000964.3\|NP_391480.1\|3708171_3708699_-\|nitroreductase-(unknown-substrate)	gnl\|CDD\|225158	COG2249, MdaB, Putative NADPH-quinone reductase (modulator of drug activity B) [General function prediction only].	1.33013e-57
NC_000964.3\|NP_391493.1\|3721414_3722008_+\|chromate-transporter-subunit-N	gnl\|CDD\|224970	COG2059, ChrA, Chromate transport protein ChrA [Inorganic ion transport and metabolism].	1.86288e-53
NC_000964.3\|NP_391481.1\|3708798_3709566_-\|alpha-acetolactate-decarboxylase	gnl\|CDD\|273524	TIGR01252, Alpha-acetolactate_decarboxylase, alpha-acetolactate decarboxylase. Puruvate can be fermented to 2,3-butanediol. It is first converted to alpha-acetolactate by alpha-acetolactate synthase, then decarboxylated to acetoin by this enzyme. Acetoin can be reduced in some species to 2,3-butanediol by acetoin reductase. [Energy metabolism, Fermentation].	1.81642e-136
NC_000964.3\|NP_391477.1\|3706144_3707062_+\|ribose-ABC-transporter-(ribose-binding-lipoprotein)	gnl\|CDD\|380546	cd06323, PBP1_ribose_binding, periplasmic sugar-binding domain of the thermophilic Thermoanaerobacter tengcongensis ribose binding protein (ttRBP) and its mesophilic homologs. Periplasmic sugar-binding domain of the thermophilic Thermoanaerobacter tengcongensis D-ribose binding protein (ttRBP) and its mesophilic homologs. Members of this group belong to the type 1 periplasmic binding protein superfamily, whose members are involved in chemotaxis, ATP-binding cassette transport, and intercellular communication in central nervous system. The thermophilic and mesophilic ribose-binding proteins are structurally very similar, but differ substantially in thermal stability.	2.81146e-138

>NC_000964.3|NP_391485.1|3714001_3714679_-|conserved-protein-of-unknown-function
MKGLNQFLNTDVEVVISGDTRFVGTLIDIGQDIFVIFDGCNYLYIPLLHLHQINKAKIVTSTEKPFLINPEDPMIEAETQAFSYRNTLNKVKGQFIEVYVTGGRSIHGYVTNVLNDYIVFFSPVFKILFISMHHLKWFTPYSTEQTPYTLDNSQLPVVPSKVPLVRNFEEQIKKNIGELVIFDMGEVPEKVGLLKGVSNNIIELINASGEPVIWKLNHLKTMHLP
>NC_000964.3|NP_391484.1|3712616_3713945_+|putative-Na+/H+-antiporter
MLAFFVTMIFIFWRPKGLNEAIPATFGALMVLLCGSVSLADLGEIGTKVTGASVTILATMIMAIALESFGFFYWVAAKLLQQSKGSGIKLFWLTNLLCFLMTIFLNNDGSILITTPILLLVLKYLGLKKHQKAPYLLSGVLIATASSAPIGVSNIVNLISLKIIGMDLYLHTAMMFVPSMMGLIFMTCLLFMFFYKRLPKSLPDIPGHFQSLRHRRYHPLHSPSAPLPERNQTKIMLFVLAFVFLVRMSLFAASYTGISVPLVAVIGSFILLSWRWIYFKTSPRDLLYKSPWHIFIFAFTMYVLIYGLHNIGFTELLVSYFEPVVSGSLAHATFASGISTSVFSNLFNNHPALMISTFTLTEMTLNPSTTKIIYLANIIGSDIGSLLLPMGTLATLIWMHILKQHDESISWGEYIKTTIIIIPLTVLFTLTCLYFWISWLFL
>NC_000964.3|NP_391483.1|3711497_3712406_+|transcriptional-regulator-controlling-alsSD,-ictEP-expression-(LysR-family)
MELRHLQYFIAVAEELHFGKAARRLNMTQPPLSQQIKQLEEEVGVTLLKRTKRFVELTAAGEIFLNHCRMALMQIGQGIELAQRTARGEQGLLVIGFVGSATYEFLPPIVREYRKKFPSVKIELREISSSRQQEELLKGNIDIGILHPPLQHTALHIETAQSSPCVLALPKQHPLTSKESITIEDLRDEPIITVAKEAWPTLYMDFIQFCEQAGFRPNIVQEATEYQMVIGLVSAGIGMTFVPSSAKKLFNLDVTYRKMDQIQLNAEWVIAYRKDNHNPLIKHFIHISNCQQTRTKESDAGT
>NC_000964.3|NP_391482.2|3709627_3711340_-|alpha-acetolactate-synthase
MTKATKEQKSLVKNRGAELVVDCLVEQGVTHVFGIPGAKIDAVFDALQDKGPEIIVARHEQNAAFMAQAVGRLTGKPGVVLVTSGPGASNLATGLLTANTEGDPVVALAGNVIRADRLKRTHQSLDNAALFQPITKYSVEVQDVKNIPEAVTNAFRIASAGQAGAAFVSFPQDVVNEVTNTKNVRAVAAPKLGPAADDAISAAIAKIQTAKLPVVLVGMKGGRPEAIKAVRKLLKKVQLPFVETYQAAGTLSRDLEDQYFGRIGLFRNQPGDLLLEQADVVLTIGYDPIEYDPKFWNINGDRTIIHLDEIIADIDHAYQPDLELIGDIPSTINHIEHDAVKVEFAEREQKILSDLKQYMHEGEQVPADWKSDRAHPLEIVKELRNAVDDHVTVTCDIGSHAIWMSRYFRSYEPLTLMISNGMQTLGVALPWAIGASLVKPGEKVVSVSGDGGFLFSAMELETAVRLKAPIVHIVWNDSTYDMVAFQQLKKYNRTSAVDFGNIDIVKYAESFGATGLRVESPDQLADVLRQGMNAEGPVIIDVPVDYSDNINLASDKLPKEFGELMKTKAL
>NC_000964.3|NP_391481.1|3708798_3709566_-|alpha-acetolactate-decarboxylase
MKRESNIQVLSRGQKDQPVSQIYQVSTMTSLLDGVYDGDFELSEIPKYGDFGIGTFNKLDGELIGFDGEFYRLRSDGTATPVQNGDRSPFCSFTFFTPDMTHKIDAKMTREDFEKEINSMLPSRNLFYAIRIDGLFKKVQTRTVELQEKPYVPMVEAVKTQPIFNFDNVRGTIVGFLTPAYANGIAVSGYHLHFIDEGRNSGGHVFDYVLEDCTVTISQKMNMNLRLPNTADFFNANLDNPDFAKDIETTEGSPE
>NC_000964.3|NP_391480.1|3708171_3708699_-|nitroreductase-(unknown-substrate)
MKILVLAVHPHMETSVVNKAWAEELSKHDNITVRDLYKEYPDEAIDVAKEQQLCEEYDRIVFQFPLYWYSSPPLLKKWQDLVLTYGWAFGSEGNALHGKELMLAVSTGSEAEKYQAGGANHYSISELLKPFQATSNLIGMKYLPPYVFYGVNYAAAEDISHSAKRLAEYIQQPFV
>NC_000964.3|NP_391479.1|3707835_3708132_+|conserved-protein-of-unknown-function
MDQFEAAYESYKARQTTADQENVPSGKEEIIAVRRNEEDNIIAVKTNTGRELDYPTALSEAKSGKLAHVDVFHKYGRDILRSEPDGIKENNLSELPDF
>NC_000964.3|NP_391478.1|3707143_3707680_+|putative-cell-wall-binding-enzyme
MNKPTKLFSTLALAAGMTAAAAGGAGTIHAQQPETTVSIDDLYSYPIDSYLVSAEALNVRTKPSASSQKADTLHLGDSLKLISFSNADWAKVKYKNGKTGFVSTHYIVKAATTVKTKTKTKVYTSADGKSIKTLPADTSVSFLGWSKTNKGGFDFDWVFVDYGGTTGYMKTKDLHMTK
>NC_000964.3|NP_391477.1|3706144_3707062_+|ribose-ABC-transporter-(ribose-binding-lipoprotein)
MKKAVSVILTLSLFLLTACSLEPPQWAKPSNSGNKKEFTIGLSVSTLNNPFFVSLKKGIEKEAKKRGMKVIIVDAQNDSSKQTSDVEDLIQQGVDALLINPTDSSAISTAVESANAVGVPVVTIDRSAEQGKVETLVASDNVKGGEMAAAFIADKLGKGAKVAELEGVPGASATRERGSGFHNIADQKLQVVTKQSADFDRTKGLTVMENLLQGHPDIQAVFAHNDEMALGALEAINSSGKDILVIGFDGNKDALASIKDRKLSATVAQQPELIGKLATEAADDILHGKKVQKTISAPLKLETQK
>NC_000964.3|NP_391476.1|3705164_3706133_+|ribose-ABC-transporter-(permease)
MKTEQLQTEQKRIHFDGVMQKLGPFLGLFILVIIVSILNPSFLEPLNILNLLRQVAINGLIAFGMTFVILTGGIDLSVGAILALSSALVAGMIVSGVDPVLAIILGCIIGAVLGMINGLLITKGKMAPFIATLATMTVFRGLTLVYTDGNPITGLGTNYGFQMFGRGYFLGIPVPAITMVLAFVILWVLLHKTPFGRRTYAIGGNEKAALISGIKVTRVKVMIYSLAGLLSALAGAILTSRLHSAQPTAGESYELDAIAAVVLGGTSLSGGRGRIVGTLIGVLIIGTLNNGLNLLGVSSFYQLVVKGIVILIAVLLDRKKSA
>NC_000964.3|NP_391487.1|3716008_3717097_-|spore-coat-protein-kinase
MKNQSNLPLYQLFVHPKDLRELKKDIWDDDPVPAVMKVNQKRLDIDIAYRGSHIRDFKKKSYHISFYQPKTFRGAREIHLNAEYKDPSLMRNKLSLDFFSELGTLSPKAEFAFVKMNGKNEGVYLELESVDEYYLAKRKLADGAIFYAVDDDANFSLMSDLERETKTSLELGYEKKTGTEEDDFYLQDMIFKINTVPKAQFKSEVTKHVDVDKYLRWLAGIVFTSNYDGFVHNYALYRSGETGLFEVIPWDYDATWGRDIHGERMAADYVRIQGFNTLTARILDESEFRKSYKRLLEKTLQSLFTIEYMEPKIMAMYERIRPFVLMDPYKKNDIERFDREPDVICEYIKNRSQYLKDHLSIL
>NC_000964.3|NP_391488.1|3717237_3717825_+|spore-morphogenetic-protein
MGHYSHSDIEEAVKSAKKEGLKDYLYQEPHGKKRSHKKSHRTHKKSRSHKKSYCSHKKSRSHKKSFCSHKKSRSHKKSYCSHKKSRSHKKSYRSHKKSRSYKKSYRSYKKSRSYKKSCRSYKKSRSYKKSYCSHKKKSRSYKKSCRTHKKSYRSHKKYYKKPHHHCDDYKRHDDYDSKKEYWKDGNCWVVKKKYK
>NC_000964.3|YP_009514005.1|3717325_3717805_+|doubtful-CDS-(putative-in-frame-frameshift)
MEKNAVIKSRTALTKNLAAIKNHTALTKNLAVTKNHSVLTKNLAATKNHTALTRNLAATKNRTVLTKNLAAIKNLTVLTKNLVAIKNLAVLTKNLAATKSLTVLTRKNLAAIRSHAAHTKNLIVPIRNTTKNRTTTATTTKDTMIMTAKKNTGKTAIAG
>NC_000964.3|NP_391489.1|3717998_3718616_+|putative-flavin-binding-monooxygenase
MYIFQADQLSAKDTYKLLSGTVIPRPIAFVTTLSSGGAVNAAPFSFYNVVSSDPPLLSISVNRTEGRQKDTARNAVENGEFVVHVSDEAIIEDINETAASLRPDESELTRTSLHPVESKAVSVPGIKEARVRFECKLERHITFDNDQGITTADLLIGRVVCFHLDEKVYDAEKGYILTDELKPASRLAGNHYAKLGEEFTLIRPS
>NC_000964.3|NP_391490.1|3718793_3719129_+|conserved-protein-of-unknown-function
MTNFWILMLIAITISLASQFFIKKKYGIDKSGWRYKHVSNTHKWIEITLLILFVFSLSFFPVEYLLLLFFIVIDSIRIFMEWHYRPEDKQYMYHIVEVSLMFMLLIYVCTL
>NC_000964.3|NP_391491.1|3719133_3720711_-|oxamate-amidohydrolase
MNKSVIGTKQMVVSPHYLASQAGNRILDKGGNAFDAAVAVSACLAVVYPHMTGLGGDSFWLTFHQETKAVKVYNGSGRSGKNVTRDVYKGKSAIPLRGIDSAITVPGMVDSWDAVLKEYGRLSLADVLEPARDYAQNGFPVSADQCRHTEKNIELLASTPYTADIFTRRGKAPVPGERFVQKELADSLNLIAEKGRSAFYEGDLAQRIVSHLQNNGSYMTIDDFKAHRGEWAAPVSSDYRGYSVYQAPPNSQGFTGLLTLNILENYDFTQIEHGSFEYYHVLVEALKKSFLDRDAVLTDPAFADIPLERLLDKRYAKQLAEEIGYLAIPAESRPVGSDTAYAAVIDADGNAVSFIQSLYFEFGSAVTAGDTGILLQNRGSFFSLDENHVNTLEPRKRTFHTLMPAMVCKGGKPKILYGTQGGEGQPQTQTAIITRMLDYGMHPQQAISEPRWVWGRTWGEEYEGLRVEGRFTDKTIQKLKDSGHLVEVVGDYDPLMGQAAAIKVDEEGFLQGGADPRGDGAAVGI
>NC_000964.3|NP_391492.1|3720924_3721401_+|transcriptional-negative-regulator-of-chromate-transport-(Lrp/AsnC-family)
MSHEYQIPNLVLDETDKQILTILHEEGRISYTDLGKRVDLSRVAVQARINQLIEAGVIEKFTAVINPAKIGIHVSVFFNVEVEPQFLEEVALKLEEEPAVTSLYHMTGPSKLHMHGIFTNDQEMEEFLTKRLYPLRGVVSVDCQMLIKRYKSRMGMKL
>NC_000964.3|NP_391493.1|3721414_3722008_+|chromate-transporter-subunit-N
MKNHPYRDMTAAMVRTGILGFGGGPSVIPLIRHEAVNKYKWIDDDEFGEILAIANALPGPIATKMAAYLGFKLKGTLGAIVAILAHILPTCLAMVGLFAAVNVLSHSAIVAGMIGAVTPVIAVMLGIMAYEFGQKALKGFGWVTGILFFIIAFIGLQTLQINPGLVIIIFLAYGAFHFKLKDKITNKHSKDKGMSAS
>NC_000964.3|NP_391494.1|3722004_3722541_+|chromate-transporter-subunit-C
MISIYLFMAFFIANLLGYGGGPASIPLMFEEVVNRYSWLSNDQFSNMLALANALPGPIATKIAAYVGYSAGGWPGFLIALIATVVPSALALIVLLRIIQRFRQSPVIKGMTLSVQPVIAVMMLILTWQIGADGIKAIGWVQSIVITGISLLAMTKFKMHPAFLIIAAFLYGGLVIPYL
>NC_000964.3|NP_391495.1|3722567_3722789_-|conserved-protein-of-unknown-function
MKFLLSVIAGLLILALYLFWKVQPPVWIQVETNSSQLKQSVRMAGTTLQVKHMIKSDAGEETAVISNGISGLK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_000964_2	2.1\|3172280\|60\|NC_000964\|CRISPRCasFinder	3172280-3172339	60	NZ_CP024037	Bacillus aryabhattai strain K13 plasmid unnamed2	10417-10476	7	0.883
NC_000964_2	2.1\|3172280\|60\|NC_000964\|CRISPRCasFinder	3172280-3172339	60	NZ_CP026740	Bacillus megaterium strain YC4-R4 plasmid unnamed4	70764-70823	7	0.883
NC_000964_2	2.1\|3172280\|60\|NC_000964\|CRISPRCasFinder	3172280-3172339	60	NC_017139	Bacillus megaterium WSH-002 plasmid WSH-002_p1, complete sequence	1318-1377	7	0.883
NC_000964_2	2.1\|3172280\|60\|NC_000964\|CRISPRCasFinder	3172280-3172339	60	NZ_CP010587	Bacillus megaterium Q3 plasmid p1, complete sequence	838-897	7	0.883
NC_000964_2	2.1\|3172280\|60\|NC_000964\|CRISPRCasFinder	3172280-3172339	60	NZ_CP023319	Bacillus megaterium strain A plasmid p2, complete sequence	75825-75884	7	0.883
NC_000964_2	2.1\|3172280\|60\|NC_000964\|CRISPRCasFinder	3172280-3172339	60	NC_020451	Vibrio coralliilyticus strain ATCC BAA-450 plasmid, complete sequence	1960-2019	9	0.85
NC_000964_2	2.1\|3172280\|60\|NC_000964\|CRISPRCasFinder	3172280-3172339	60	NZ_CP015440	Anoxybacillus amylolyticus strain DSM 15939 plasmid pDSM15939_2, complete sequence	64773-64832	12	0.8
NC_000964_2	2.1\|3172280\|60\|NC_000964\|CRISPRCasFinder	3172280-3172339	60	NZ_CP033045	Bacillus foraminis strain Bac44 plasmid unnamed, complete sequence	483791-483850	13	0.783
NC_000964_2	2.1\|3172280\|60\|NC_000964\|CRISPRCasFinder	3172280-3172339	60	NZ_LR134399	Listeria monocytogenes strain NCTC7974 plasmid 2, complete sequence	57361-57420	14	0.767

1. spacer 2.1|3172280|60|NC_000964|CRISPRCasFinder matches to NZ_CP024037 (Bacillus aryabhattai strain K13 plasmid unnamed2) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

2. spacer 2.1|3172280|60|NC_000964|CRISPRCasFinder matches to NZ_CP026740 (Bacillus megaterium strain YC4-R4 plasmid unnamed4) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

3. spacer 2.1|3172280|60|NC_000964|CRISPRCasFinder matches to NC_017139 (Bacillus megaterium WSH-002 plasmid WSH-002_p1, complete sequence) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

4. spacer 2.1|3172280|60|NC_000964|CRISPRCasFinder matches to NZ_CP010587 (Bacillus megaterium Q3 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

5. spacer 2.1|3172280|60|NC_000964|CRISPRCasFinder matches to NZ_CP023319 (Bacillus megaterium strain A plasmid p2, complete sequence) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

6. spacer 2.1|3172280|60|NC_000964|CRISPRCasFinder matches to NC_020451 (Vibrio coralliilyticus strain ATCC BAA-450 plasmid, complete sequence) position: , mismatch: 9, identity: 0.85

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcattttagttatggcccggg	Protospacer
****************************************** ***   * ***  **.

7. spacer 2.1|3172280|60|NC_000964|CRISPRCasFinder matches to NZ_CP015440 (Anoxybacillus amylolyticus strain DSM 15939 plasmid pDSM15939_2, complete sequence) position: , mismatch: 12, identity: 0.8

cagcttggaaggctgaggttttaccactaaactacacccgca-------atttttatttg	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcataataatatataccattg	Protospacer
******************************************       ** * .  ***

8. spacer 2.1|3172280|60|NC_000964|CRISPRCasFinder matches to NZ_CP033045 (Bacillus foraminis strain Bac44 plasmid unnamed, complete sequence) position: , mismatch: 13, identity: 0.783

cagcttggaaggctgaggttttaccactaaactacacccgc--------aatttttattt	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatggttaaaagttttgcca	Protospacer
*****************************************        ** ****...

9. spacer 2.1|3172280|60|NC_000964|CRISPRCasFinder matches to NZ_LR134399 (Listeria monocytogenes strain NCTC7974 plasmid 2, complete sequence) position: , mismatch: 14, identity: 0.767

cagcttggaaggctgaggttttaccactaaactacacccgc---------aatttttatt	CRISPR spacer
cagcttggaaggctgtagttttaccactaaactacacccgcatagtaagtagttcttagt	Protospacer
*************** .************************         *.**.*** *

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

700231 : 708597

Synechococcus_phage(50.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
NP_388526.1\|700231_701527_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	5.9e-19	25.7
NP_388527.1\|701600_702326_+	phosphoribosylaminoimidazole succinocarboxamide synthetase	A0A0E3G7P8	Synechococcus_phage	7.0e-46	44.1
NP_388528.1\|702318_702573_+	factor required for phosphoribosylformylglycinamidine synthetase activity	NA	NA	NA	NA
NP_388529.1\|702569_703253_+	phosphoribosylformylglycinamidine synthetase subunit I	NA	NA	NA	NA
NP_388530.2\|703236_705465_+	phosphoribosylformylglycinamidine synthetase subunit II	A6N228	Microbacterium_phage	3.8e-159	40.1
NP_388531.2\|705440_706871_+	glutamine phosphoribosylpyrophosphate amidotransferase	A0A0M3SGR2	Mollivirus	1.2e-52	32.5
NP_388532.2\|706972_708013_+	phosphoribosylaminoimidazole synthetase	A0A0E3F760	Synechococcus_phage	1.1e-63	41.7
NP_388533.2\|708009_708597_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	7.0e-28	40.4

DBSCAN-SWA_2

1207817 : 1251590

Planktothrix_phage(25.0%)

tRNA,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
NP_389014.1\|1207817_1208057_-\|coat	spore coat protein	NA	NA	NA	NA
NP_389015.1\|1208221_1209160_+	beta-ketoacyl-acyl carrier protein synthase III 1	NA	NA	NA	NA
NP_389016.1\|1209182_1210424_+	beta-ketoacyl-acyl carrier protein synthase II (involved in pimelate synthesis)	NA	NA	NA	NA
NP_389017.1\|1210499_1211285_+	conserved hypothetical protein	NA	NA	NA	NA
NP_389018.1\|1211476_1212463_+	oligopeptide ABC transporter (ATP-binding protein)	G9BWD6	Planktothrix_phage	5.7e-22	32.9
NP_389019.2\|1212459_1213449_+	oligopeptide ABC transporter (ATP-binding protein)	F2Y302	Organic_Lake_phycodnavirus	6.7e-07	26.1
NP_389021.2\|1215242_1216193_+	oligopeptide ABC transporter (permease)	NA	NA	NA	NA
NP_389022.1\|1216209_1217121_+	oligopeptide ABC transporter (permease)	NA	NA	NA	NA
NP_389023.1\|1217325_1218078_+	putative sporulation nucleic acid binding protein	A0A0A0RP53	Bacillus_phage	5.4e-49	43.9
NP_389024.1\|1218112_1219105_-\|tRNA	tryptophanyl-tRNA synthetase	NA	NA	NA	NA
NP_389025.1\|1219848_1221486_+	oligopeptide ABC transporter (binding lipoprotein)	NA	NA	NA	NA
NP_389026.1\|1221593_1222529_+	oligopeptide ABC transporter (permease)	NA	NA	NA	NA
NP_389027.1\|1222532_1223450_+	oligopeptide ABC transporter (permease)	NA	NA	NA	NA
NP_389028.1\|1223454_1224531_+	oligopeptide ABC transporter (ATP-binding protein)	G9BWD6	Planktothrix_phage	2.1e-17	30.8
NP_389029.1\|1224532_1225450_+	oligopeptide ABC transporter (ATP-binding protein)	M1HP82	Acanthocystis_turfacea_Chlorella_virus	1.2e-05	24.6
NP_389030.2\|1225556_1226774_+	putative exporter	NA	NA	NA	NA
NP_389031.2\|1226937_1227516_+	putative thiol oxidation management factor; putative acetyltransferase	NA	NA	NA	NA
NP_389032.1\|1227696_1228092_+	redox-sensitive regulator	NA	NA	NA	NA
NP_389033.1\|1228134_1228791_-	putative membrane protein of unknown function	A0A2R2YAT9	Pseudomonas_phage	1.1e-29	38.0
YP_009513949.1\|1228960_1229101_+	conserved hypothetical protein	NA	NA	NA	NA
NP_389034.1\|1229067_1229724_+	adaptor protein controlling oligomerization of the AAA+ protein ClpC	NA	NA	NA	NA
YP_009513950.1\|1229718_1229841_-	conserved hypothetical protein	NA	NA	NA	NA
NP_389035.1\|1229914_1231036_+	protein involved in establishment of DNA transport in competence	NA	NA	NA	NA
NP_389036.2\|1231082_1233095_+	oligoendopeptidase F	NA	NA	NA	NA
YP_003097703.1\|1233132_1233300_-	conserved hypothetical protein	NA	NA	NA	NA
NP_389037.2\|1233613_1234513_-	thiol management effector of SpxA degradation	NA	NA	NA	NA
NP_389038.1\|1234509_1234908_-	putative thiol management oxidoreductase component	NA	NA	NA	NA
NP_389039.1\|1235162_1235708_-	bifunctional muramidase and murein lytic transglycosylase	A0A1P8CWQ1	Bacillus_phage	4.8e-39	60.4
NP_389040.1\|1235911_1236484_-	putative RNA/thiamine triphosphatase	NA	NA	NA	NA
NP_389041.1\|1236608_1236977_+	conserved protein of unknown function	NA	NA	NA	NA
NP_389042.1\|1237005_1237641_+	(p)ppGpp synthetase	NA	NA	NA	NA
NP_389043.1\|1237659_1238460_+	inorganic polyphosphate/ATP-NAD kinase (quinolate activated)	NA	NA	NA	NA
NP_389044.1\|1238522_1239374_+	pseudouridylate synthase	NA	NA	NA	NA
NP_389045.1\|1239386_1240121_-	phosphorylated protein phosphatase E and diadenosine-polyphosphate hydrolase	M4Q4T6	Vibrio_phage	3.2e-06	25.0
NP_389046.1\|1240355_1242200_+	gated K+/H+ antiporter	NA	NA	NA	NA
NP_389047.1\|1242448_1243159_+	thiaminase II	NA	NA	NA	NA
NP_389048.1\|1243133_1243751_+	thiazole tautomerase	NA	NA	NA	NA
NP_389049.1\|1243734_1244844_+	FAD-dependent glycine oxidase	NA	NA	NA	NA
NP_389050.1\|1244843_1245044_+	sulfur carrier for synthesis of hydroxyethylthiazole phosphate	NA	NA	NA	NA
NP_389051.1\|1245040_1245811_+	hydroxyethylthiazole phosphate synthetase (thiamine biosynthesis)	NA	NA	NA	NA
NP_389052.1\|1245807_1246818_+	adenylate transferase and sulfur transferase (thiamine biosynthesis)	NA	NA	NA	NA
NP_389053.1\|1246836_1247652_+	phosphomethylpyrimidine kinase, 4-amino-5-hydroxymethyl-2-methylpyrimidine and 4-amino-5-hydroxymethyl-2-methylpyrimidine pyrophosphate kinase	NA	NA	NA	NA
NP_389054.2\|1247787_1248564_+	enoyl-acyl carrier protein reductase	NA	NA	NA	NA
NP_389055.1\|1248664_1249348_+\|coat	spore outer coat protein	NA	NA	NA	NA
NP_389056.1\|1249441_1249888_-\|coat	spore coat protein (insoluble fraction, crust layer)	NA	NA	NA	NA
NP_389057.1\|1250015_1250504_-\|coat	outer spore coat protein (crust layer, insoluble fraction)	NA	NA	NA	NA
NP_389058.1\|1250655_1251174_-\|coat	spore coat protein (insoluble fraction)	NA	NA	NA	NA
NP_389059.1\|1251272_1251590_-\|coat	spore coat protein (outemost layer)	NA	NA	NA	NA

DBSCAN-SWA_3

1314452 : 1359285

uncultured_Caudovirales_phage(27.78%)

terminase,holin,capsid,protease,portal,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
NP_389124.1\|1314452_1315724_+	informational ATPase possibly involved in protein degradation	A0A1V0SEI6	Indivirus	8.6e-15	37.1
NP_389125.1\|1315868_1317005_+	response regulator aspartate phosphatase	A0A1P8CWN8	Bacillus_phage	8.3e-94	47.4
NP_389126.1\|1316994_1317129_+	secreted inhibitor of the activity of phosphatase RapA (quorum sensing)	NA	NA	NA	NA
NP_389127.2\|1317156_1317414_-	putative enzyme	NA	NA	NA	NA
NP_389128.1\|1317534_1318488_+	phage PBSX; N-acetylmuramoyl-L-alanine amidase	A0A218KC88	Bacillus_phage	7.3e-67	74.1
NP_389129.1\|1318527_1318905_-	phage PBSX; conserved hypothetical protein	A5GYQ0	Lactococcus_phage	6.1e-17	42.3
NP_389130.1\|1319010_1319613_+	phage PBSX; gamma-polyglutamate hydrolase	F8WQ53	Bacillus_phage	3.8e-45	49.2
NP_389131.2\|1319689_1320526_+	phage PBSX; manganese-containing peroxidase	NA	NA	NA	NA
NP_389132.3\|1320569_1321166_-	phage PBSX; putative peptidase	A0A2H4JA43	uncultured_Caudovirales_phage	8.1e-40	51.7
NP_389133.1\|1321328_1321670_-	phage PBSX transcriptional regulator	A0A2H4J6F9	uncultured_Caudovirales_phage	1.3e-18	45.8
YP_003097711.1\|1321847_1322027_+	phage PBSX; conserved hypothetical protein	NA	NA	NA	NA
NP_389134.2\|1322013_1322850_+	phage PBSX; conserved hypothetical protein	S6BFM4	Thermus_phage	1.8e-24	28.2
NP_389135.2\|1322749_1323550_+	phage PBSX; putative DNA binding protein	A6XMI1	Bacillus_virus	5.0e-61	51.7
YP_003097712.1\|1323549_1323717_+	phage PBSX; conserved hypothetical protein	NA	NA	NA	NA
NP_389136.1\|1323801_1324152_+	phage PBSX; conserved hypothetical protein	NA	NA	NA	NA
NP_389137.1\|1324148_1324355_+	phage PBSX; conserved protein of unknown function	A0A2H4J4M6	uncultured_Caudovirales_phage	1.6e-11	50.0
NP_389138.1\|1324470_1324980_+	phage PBSX; putative RNA polymerase PBSX sigma factor-like	A0A1L2JY33	Aeribacillus_phage	1.9e-21	38.6
NP_389139.1\|1325095_1325893_+\|terminase	phage PBSX; prophage terminase (small subunit)	A0A0S2MVB6	Bacillus_phage	8.0e-59	50.2
NP_389140.1\|1325889_1327191_+\|terminase	phage PBSX; prophage terminase (large subunit)	A0A2P1JTW5	Anoxybacillus_phage	2.4e-153	60.2
NP_389141.2\|1327194_1328682_+\|capsid,portal	phage PBSX; phage capsid portal protein	A0A1B1P7C8	Bacillus_phage	1.7e-139	55.7
NP_389142.2\|1328701_1329529_+	phage PBSX; conserved hypothetical protein	A0A1B1P7E4	Bacillus_phage	2.1e-54	58.7
NP_389143.1\|1329554_1330490_+	phage PBSX; putative phage chromosome binding protein	A0A1B1P7E3	Bacillus_phage	1.1e-104	63.8
YP_003097713.1\|1330511_1330895_+	phage PBSX; conserved hypothetical protein	A0A1B1P7D6	Bacillus_phage	1.9e-13	40.2
NP_389144.1\|1330891_1331248_+	phage PBSX; conserved hypothetical protein	NA	NA	NA	NA
NP_389145.1\|1331244_1331730_+	phage PBSX; conserved hypothetical protein	A0A249XXA4	Clostridium_phage	2.1e-38	47.0
NP_389146.1\|1331742_1332183_+	phage PBSX; conserved hypothetical protein	NA	NA	NA	NA
YP_003097714.1\|1332186_1332405_+	phage PBSX; conserved hypothetical protein	NA	NA	NA	NA
NP_389147.2\|1332401_1333802_+	phage PBSX; conserved hypothetical protein	A0A0A7S087	Clostridium_phage	2.3e-77	39.3
NP_389148.1\|1333803_1334247_+	phage PBSX; conserved hypothetical protein	A0A0K2CNG3	Brevibacillus_phage	8.4e-26	45.2
NP_389149.2\|1334338_1334785_+	phage PBSX; conserved hypothetical protein	A0A249XXA9	Clostridium_phage	7.5e-14	33.6
YP_003097715.1\|1334814_1334964_+	phage PBSX; conserved hypothetical protein	NA	NA	NA	NA
NP_389150.2\|1334965_1338964_+	phage PBSX; putative tape measure protein	A0A1L2JY60	Aeribacillus_phage	2.1e-43	44.9
NP_389151.2\|1338956_1339616_+	phage PBSX; putative murein binding protein	A0A090DBR9	Clostridium_phage	3.7e-25	34.0
NP_389152.1\|1339631_1340609_+	phage PBSX; conserved hypothetical protein	H7BV96	unidentified_phage	1.0e-39	32.6
NP_389153.1\|1340608_1340875_+	phage PBSX; conserved hypothetical protein	S6C459	Thermus_phage	1.7e-05	36.4
NP_389154.1\|1340931_1341357_+	phage PBSX; conserved hypothetical protein	A0A2H4J6K5	uncultured_Caudovirales_phage	7.8e-13	38.0
NP_389155.1\|1341349_1342396_+\|plate	phage PBSX; putative base plate assembly protein	S6AVU3	Thermus_phage	4.4e-73	44.3
NP_389156.1\|1342379_1342958_+	phage PBSX; conserved hypothetical protein	A0A2H4J717	uncultured_Caudovirales_phage	3.0e-15	34.2
YP_003097716.1\|1342954_1343227_+	phage PBSX; conserved hypothetical protein	NA	NA	NA	NA
NP_389158.1\|1343229_1345293_+	phage PBSX; conserved hypothetical protein	A0A2H4J4R1	uncultured_Caudovirales_phage	4.8e-31	37.4
NP_389159.1\|1345304_1345634_+	phage PBSX; conserved hypothetical protein	A0A2H4JCI0	uncultured_Caudovirales_phage	1.7e-15	41.3
NP_389160.1\|1345630_1345795_+	phage PBSX; conserved hypothetical protein	A0A2H4JAA1	uncultured_Caudovirales_phage	3.2e-15	66.0
NP_389161.2\|1345838_1346678_+	phage PBSX; lytic exoenzyme	NA	NA	NA	NA
NP_389162.1\|1346730_1347000_+	phage PBSX; putative enzyme	A0A2H4JD40	uncultured_Caudovirales_phage	6.2e-24	64.8
NP_389163.1\|1347012_1347276_+\|holin	phage PBSX; holin	A0A2H4J6M0	uncultured_Caudovirales_phage	4.7e-24	65.5
NP_389164.1\|1347288_1348182_+	phage PBSX; N-acetylmuramoyl-L-alanine amidase	Q9ZXD7	Bacillus_phage	1.8e-83	69.7
YP_009513952.1\|1348218_1348356_-	three component toxin / antitoxin / antitoxin SpoIISABC, antitoxin C	NA	NA	NA	NA
NP_389165.1\|1348441_1348612_-	three-component apoptotic control system component B (antitoxin B)	NA	NA	NA	NA
NP_389166.1\|1348611_1349358_-	three-component apoptosis factor (ABC toxin/antitoxin/antitoxin system)	NA	NA	NA	NA
NP_389167.2\|1349467_1350469_-	putative low-affinity inorganic phosphate transporter	NA	NA	NA	NA
NP_389168.1\|1350481_1351099_-	putative PitB transporter accessory protein	NA	NA	NA	NA
NP_389169.1\|1351374_1352691_-	serine / threonine exchanger	NA	NA	NA	NA
NP_389170.1\|1353079_1354030_+	hydroquinone-specific extradiol dioxygenase	NA	NA	NA	NA
YP_009513953.1\|1354130_1354277_+	hypothetical protein	NA	NA	NA	NA
NP_389171.2\|1354284_1356435_+	putative membrane glycosyl transferase	NA	NA	NA	NA
NP_389172.2\|1356446_1357418_+	putative glycosyltransferase	A0A2H5BFL1	Salmonella_phage	1.9e-62	41.0
NP_389173.2\|1357935_1359285_-\|protease	membrane bound serine protease Do, quality control protease and chaperone (heat-shock protein)	A0A1B1IT49	uncultured_Mediterranean_phage	5.7e-25	33.7

DBSCAN-SWA_4

1724028 : 1770195

Bodo_saltans_virus(18.18%)

tRNA,coat,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
NP_389538.1\|1724028_1725297_+\|protease	inner membrane zinc metalloprotease required for the extracytoplasmic stress response mediated by sigma(W)	NA	NA	NA	NA
NP_389539.1\|1725329_1727024_+\|tRNA	prolyl-tRNA synthetase	NA	NA	NA	NA
NP_389540.1\|1727132_1731446_+	DNA polymerase III (alpha subunit)	A0A0A7RWA3	Clostridium_phage	1.6e-23	33.2
NP_389541.1\|1731775_1732246_+	ribosome maturation factor	NA	NA	NA	NA
NP_389542.1\|1732280_1733396_+	transcription translation coupling factor involved in Rho-dependent transcription termination	NA	NA	NA	NA
NP_389543.1\|1733409_1733685_+	molecular ruler co-factor for RNA; new fold	NA	NA	NA	NA
NP_389544.1\|1733686_1733989_+	K-turn RNA binding protein	NA	NA	NA	NA
NP_389545.1\|1734008_1736159_+	initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	3.8e-23	25.2
NP_389547.1\|1736450_1736804_+	pre-ribosomal (17S) RNA binding factor A	NA	NA	NA	NA
NP_389548.1\|1736885_1737815_+\|tRNA	tRNA pseudouridine 55 synthase	NA	NA	NA	NA
NP_389549.1\|1737833_1738784_+	bifunctional riboflavin kinase FAD synthase	A0A1V0SD03	Indivirus	2.0e-08	28.5
NP_389550.1\|1738940_1739210_+	ribosomal protein S15 (BS18)	NA	NA	NA	NA
NP_389551.1\|1739382_1741500_+	polynucleotide phosphorylase (PNPase)	NA	NA	NA	NA
NP_389552.1\|1741617_1742577_+	putative sugar deacetylase	NA	NA	NA	NA
NP_389553.2\|1742616_1743846_+\|protease	specific processing protease	G3MBJ8	Bacillus_virus	8.8e-49	32.1
NP_389554.1\|1743923_1744181_+	PRC barrel protein involved in sporulation	NA	NA	NA	NA
NP_389555.1\|1744366_1745260_+	spore dipicolinate synthase subunit A	NA	NA	NA	NA
NP_389556.1\|1745262_1745865_+	spore dipicolinate synthase subunit B	NA	NA	NA	NA
NP_389557.1\|1745990_1747031_+	aspartate-semialdehyde dehydrogenase	NA	NA	NA	NA
NP_389558.2\|1747122_1748337_+	aspartokinase I (alpha and beta subunits)	NA	NA	NA	NA
NP_389559.1\|1748367_1749240_+	4-hydroxy-tetrahydrodipicolinate synthase	NA	NA	NA	NA
NP_389560.2\|1749417_1751085_+	dual activity 5' exo-and endoribonuclease J2	NA	NA	NA	NA
NP_389561.3\|1751200_1751938_+\|protease	protein export-enhancing protease (spore outgrowth)	NA	NA	NA	NA
YP_003097729.1\|1751934_1752147_+	modulator of TepA activity (spore outgrowth)	NA	NA	NA	NA
NP_389562.3\|1752277_1754641_+	spore DNA directional translocase (motor ATPase)	A0A218M9A2	Mycobacterium_phage	1.4e-87	47.1
NP_389563.1\|1754784_1755510_+	putative transcriptional regulator (GntR family, possibly involved in biofilm formation)	NA	NA	NA	NA
NP_389564.2\|1755648_1756857_+	bacillibactin exporter	NA	NA	NA	NA
NP_389566.2\|1757036_1758317_+\|protease	putative metalloprotease	A0A1X9I714	Streptococcus_phage	7.5e-51	29.1
NP_389568.2\|1758313_1759600_+\|protease	putative processing protease	A0A2H4UVM3	Bodo_saltans_virus	6.1e-08	27.9
NP_389569.2\|1759654_1760383_+	EF-P-5 aminopentanone reductase (EF-P repair enzyme), NADPH-dependent	Q06VL0	Trichoplusia_ni_ascovirus	4.2e-14	28.4
NP_389570.1\|1760463_1760721_+	putative enzyme	NA	NA	NA	NA
NP_389573.3\|1761706_1762573_+	cell shape determination factor	NA	NA	NA	NA
NP_389574.2\|1762622_1763204_+	CDP-diacylglycerol-glycerol-3-phosphate 3-phosphatidyltransferase	NA	NA	NA	NA
NP_389575.2\|1763221_1764472_+	competence-damage inducible regulator	NA	NA	NA	NA
NP_389576.2\|1764644_1765691_+	multifunctional SOS repair factor	A0A0S2MVG1	Bacillus_phage	1.9e-137	73.7
NP_389577.1\|1765858_1767034_+	penicillin-binding endopeptidase X (lysozyme resistance)	A0A0B5A438	Mycobacterium_phage	1.5e-08	24.8
NP_389578.1\|1767309_1768872_+	endoribonuclease Y	NA	NA	NA	NA
NP_389579.2\|1768940_1769735_+	2'3' and 3'5' cyclic nucleotide monophosphates phosphodiesterase involved in biofilm formation	NA	NA	NA	NA
NP_389580.1\|1769934_1770195_+\|coat	regulator required for dehydratation of the spore core and assembly of the coat (stage V sporulation)	J9PTX7	Bacillus_phage	1.2e-08	42.5

DBSCAN-SWA_5

1868616 : 1875171

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
NP_389619.1\|1868616_1869009_+	co-factor of ribonucleotide diphosphate reductase	G3MBF1	Bacillus_virus	2.5e-29	58.3
NP_389620.1\|1868968_1871071_+	ribonucleoside-diphosphate reductase (major subunit)	U5PY35	Bacillus_phage	0.0e+00	87.0
NP_389621.1\|1871088_1872078_+	ribonucleoside-diphosphate reductase (minor subunit)	F8WQ21	Bacillus_phage	1.9e-155	83.5
NP_389622.1\|1872127_1872748_+	putative cofactor involved in deoxyribonucleotide synthesis	A0A127AYS1	Bacillus_phage	1.6e-46	48.4
NP_389623.2\|1872811_1873579_-	N-acetylmuramoyl-L-alanine amidase (sporulation-specific)	E5DV68	Deep-sea_thermophilic_phage	9.1e-52	49.5
NP_389624.2\|1874202_1875171_+	mother cell sporulation ATPase	G3MAX6	Bacillus_virus	5.2e-52	40.5

DBSCAN-SWA_6

2152085 : 2286408

195

Bacillus_phage(98.88%)

lysis,integrase,tail,holin

attL 2152048:2152063|attR 2286414:2286429

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2152048:2152063	attL	NA	NA	NA	NA
NP_389863.1\|2152085_2152262_-	recombination directionality factor; phage SPbeta	O64196	Bacillus_phage	5.3e-24	100.0
NP_389864.1\|2152264_2152852_-	hypothetical protein; phage SPbeta	O64195	Bacillus_phage	3.6e-109	100.0
NP_389865.1\|2152926_2153169_+	putative transcriptional regulator; phage SPbeta	O64194	Bacillus_phage	8.6e-41	100.0
NP_389866.1\|2153170_2153356_-	putative nucleic acid binding protein; phage SPbeta	O64193	Bacillus_phage	2.1e-26	100.0
NP_389867.1\|2153439_2153652_-	hypothetical protein; phage SPbeta	O64192	Bacillus_phage	5.2e-34	100.0
NP_389868.1\|2153717_2154080_-	conserved hypothetical protein; phage SPbeta	A0A1P8CX73	Bacillus_phage	1.1e-63	100.0
NP_389869.1\|2154076_2154250_-	putative sensor or permease; phage SPbeta	O64190	Bacillus_phage	3.4e-23	100.0
NP_389870.1\|2154265_2154583_-	hypothetical protein; phage SPbeta	A0A1P8CX53	Bacillus_phage	2.1e-55	100.0
NP_389871.1\|2154595_2154673_-	hypothetical protein; phage SPbeta	A0A1P8CX55	Bacillus_phage	7.4e-07	100.0
NP_389872.1\|2154704_2154851_-	hypothetical protein; phage SPbeta	A0A1P8CX49	Bacillus_phage	1.0e-17	100.0
YP_009513967.1\|2154780_2154972_+	hypothetical protein	NA	NA	NA	NA
NP_389873.1\|2154886_2155018_-	conserved protein with rubredoxin fold; phage SPbeta	A0A1P8CX61	Bacillus_phage	2.6e-20	100.0
NP_389874.1\|2155057_2155249_-	hypothetical protein; phage SPbeta	A0A1P8CX54	Bacillus_phage	1.0e-33	100.0
NP_389875.1\|2155292_2156120_-	putative metallo-dependent hydrolase; phage SPbeta	O64184	Bacillus_phage	4.4e-169	100.0
NP_389876.1\|2156238_2156457_+	small acid-soluble spore protein (alpha/beta-type SASP); SPbeta phage protein	Q77YX0	Bacillus_phage	5.6e-31	100.0
NP_389878.1\|2156756_2157110_-	conserved hypothetical protein; phage SPbeta	A0A1P8CX43	Bacillus_phage	3.9e-34	64.1
NP_389879.1\|2157340_2157682_-	conserved hypothetical protein; phage SPbeta	O64181	Bacillus_phage	5.1e-55	100.0
NP_389880.1\|2157828_2158119_-	conserved hypothetical protein; phage SPbeta	O64180	Bacillus_phage	4.3e-47	100.0
YP_003097747.1\|2158119_2158287_-	hypothetical protein	A0A1P8CX64	Bacillus_phage	1.8e-21	88.9
NP_389881.1\|2158438_2158684_+	hypothetical protein	A0A1P8CX50	Bacillus_phage	1.6e-31	100.0
NP_389882.1\|2158723_2159173_-	putative transcription modulator; phage SPbeta	A0A1P8CX48	Bacillus_phage	2.0e-83	100.0
NP_389883.1\|2159267_2159696_-	SPbeta phage deoxyuridine 5'-triphosphate nucleotidohydrolase	A0A1P8CX51	Bacillus_phage	5.4e-78	100.0
NP_389886.2\|2159980_2161778_-	phage SPbeta ribonucleoside diphosphate reductase	R4JMU8	Bacillus_phage	5.5e-150	81.4
NP_389885.1\|2160564_2161086_-	SPbeta phage endodeoxyribonuclease (homing endonuclease, responsible for intron mobility)	A0A1P8CX39	Bacillus_phage	7.4e-98	100.0
NP_389888.2\|2162107_2165614_-	SPbeta phage ribonucleoside reductase alpha (large) subunit	A0A1P8CX40	Bacillus_phage	0.0e+00	96.8
NP_389889.2\|2165576_2165972_-	SPbeta phage subunit of ribonucleoside diphosphate reductase	A0A1P8CX56	Bacillus_phage	3.7e-65	95.4
NP_389890.1\|2165971_2166325_-	conserved protein of unknown function; phage SPbeta	O64171	Bacillus_phage	1.1e-60	100.0
NP_389891.1\|2166412_2166613_-	hypothetical protein; phage SPbeta	O64170	Bacillus_phage	2.1e-32	100.0
NP_389892.1\|2166657_2166852_-	hypothetical protein; phage SPbeta	O64169	Bacillus_phage	7.6e-32	100.0
NP_389893.1\|2166872_2167007_-	hypothetical protein; phage SPbeta	O64168	Bacillus_phage	2.5e-18	100.0
NP_389894.1\|2167038_2167509_-	conserved hypothetical protein; phage SPbeta	O64167	Bacillus_phage	1.4e-82	100.0
NP_389895.1\|2167569_2167932_-	conserved protein of unknown function; phage SPbeta	O64166	Bacillus_phage	8.6e-61	100.0
NP_389896.1\|2167974_2168100_-	hypothetical protein; phage SPbeta	O64165	Bacillus_phage	3.5e-14	100.0
NP_389897.1\|2168113_2168461_-	conserved protein of unknown function; phage SPbeta	O64164	Bacillus_phage	1.2e-56	100.0
NP_389898.1\|2168475_2168871_-	conserved protein of unknown function; phage SPbeta	O64163	Bacillus_phage	4.1e-72	100.0
NP_389899.1\|2168909_2169452_-	conserved hypothetical protein; phage SPbeta	O64162	Bacillus_phage	1.4e-99	100.0
NP_389900.1\|2169496_2169676_-	conserved hypothetical protein; phage SPbeta	O64161	Bacillus_phage	6.8e-27	100.0
NP_389901.1\|2169806_2169926_+	putative type I toxin; phage SPbeta	NA	NA	NA	NA
NP_389902.1\|2170029_2170242_-	conserved hypothetical protein; phage SPbeta	O64159	Bacillus_phage	1.2e-35	100.0
NP_389903.1\|2170308_2170491_-	putative nucleotide binding protein; phage SPbeta	O64158	Bacillus_phage	1.5e-26	100.0
NP_389904.1\|2170503_2170731_-	conserved hypothetical protein; phage SPbeta	O64157	Bacillus_phage	9.2e-37	100.0
NP_389905.1\|2170770_2171136_-	conserved hypothetical protein; phage SPbeta	O64156	Bacillus_phage	4.9e-64	100.0
NP_389906.1\|2171138_2171357_-	putative nucleic acid binding protein; phage SPbeta	O64155	Bacillus_phage	4.3e-31	100.0
NP_389907.1\|2171400_2172732_-	DNA (cytosine-5-)-methyltransferase; phage SPbeta	Q77YW9	Bacillus_phage	1.5e-256	100.0
NP_389908.1\|2172780_2172900_-	conserved hypothetical protein; phage SPbeta	O64154	Bacillus_phage	1.7e-13	100.0
NP_389909.1\|2172931_2173450_-	putative 5'(3')-deoxyribonucleotidase; phage SPbeta	A0A1P8CX15	Bacillus_phage	2.2e-97	100.0
NP_389910.1\|2173458_2173956_-	putative nucleotide kinase or triphosphate hydrolase; phage SPbeta	A0A1P8CX28	Bacillus_phage	1.0e-88	100.0
NP_389911.1\|2173955_2174111_-	conserved hypothetical protein; phage SPbeta	A0A1P8CX36	Bacillus_phage	2.0e-22	100.0
NP_389912.1\|2174103_2174319_-	conserved hypothetical protein; phage SPbeta	O64150	Bacillus_phage	7.9e-38	100.0
NP_389913.1\|2174351_2174549_-	conserved hypothetical protein; phage SPbeta	O64149	Bacillus_phage	1.9e-30	100.0
NP_389914.1\|2174584_2174734_-	conserved hypothetical protein; phage SPbeta	O64148	Bacillus_phage	7.9e-21	100.0
NP_389915.1\|2174851_2175568_-	putative murein hydrolase; phage SPbeta	O64147	Bacillus_phage	2.1e-127	100.0
NP_389916.1\|2175595_2179513_-	DNA polymerase with 3'-5' exonuclease activity; phage SPbeta	A0A1P8CX14	Bacillus_phage	0.0e+00	96.9
NP_389917.1\|2179525_2181256_-	putative single-strand DNA-specific exonuclease; phage SPbeta	A0A1P8CX07	Bacillus_phage	0.0e+00	98.3
NP_389918.1\|2181255_2182392_-	putative DNA replication initiation protein; phage SPbeta	A0A1P8CX05	Bacillus_phage	1.2e-225	100.0
NP_389919.1\|2182407_2183922_-	putative replicative DNA helicase (DnaB family); phage SPbeta	A0A1P8CWZ7	Bacillus_phage	3.6e-286	100.0
NP_389920.1\|2183936_2184407_-	conserved hypothetical protein; phage SPbeta	A0A1P8CX08	Bacillus_phage	1.4e-87	100.0
NP_389921.1\|2184449_2185421_-	putative ATP/GTP binding protein; phage SPbeta	A0A1P8CX29	Bacillus_phage	1.7e-180	100.0
NP_389922.1\|2185503_2186418_-	conserved hypothetical protein; phage SPbeta	O64140	Bacillus_phage	3.0e-171	100.0
NP_389923.1\|2186439_2186811_-	conserved protein of unknown function; phage SPbeta	O64139	Bacillus_phage	2.6e-65	100.0
NP_389924.1\|2186984_2187299_-	stress protein SCP1; phage SPbeta	NA	NA	NA	NA
NP_389925.1\|2187375_2187756_-	conserved protein of unknown function; phage SPbeta	O64137	Bacillus_phage	3.8e-67	100.0
NP_389926.1\|2187818_2188115_-	conserved hypothetical protein; phage SPbeta	O64136	Bacillus_phage	8.1e-49	100.0
NP_389927.1\|2188203_2189964_-	putative uronase; phage SPbeta	O64135	Bacillus_phage	0.0e+00	100.0
NP_389928.1\|2189960_2190785_-	gamma-polyglutamate hydrolase; phage SPbeta	O64134	Bacillus_phage	7.8e-150	100.0
NP_389929.1\|2190883_2191279_-	hypothetical protein; phage SPbeta	O64133	Bacillus_phage	7.7e-71	100.0
NP_389930.1\|2191333_2191555_-	conserved protein of unknown function; SPbeta phage	O64132	Bacillus_phage	5.8e-36	100.0
NP_389931.1\|2191625_2192300_+	putative stress-associated peptidase; putative general secretion pathway protein; phage SPbeta	A0A1P8CX02	Bacillus_phage	5.9e-79	98.6
NP_389932.1\|2192369_2193182_+	DNA ligase-like protein; bacteriophage SPbeta	O64130	Bacillus_phage	2.5e-156	100.0
NP_389933.1\|2193247_2193661_-	conserved hypothetical protein; phage SPbeta	O64129	Bacillus_phage	1.8e-78	100.0
NP_389934.1\|2193826_2193976_+	conserved hypothetical protein; phage SPbeta	O64128	Bacillus_phage	2.7e-21	100.0
NP_389935.1\|2194052_2194400_-	putative RNA-binding protein; phage SPbeta	O64127	Bacillus_phage	1.1e-60	100.0
NP_389936.1\|2194401_2194758_-	hypothetical protein; phage SPbeta	O64126	Bacillus_phage	1.6e-51	100.0
NP_389937.1\|2194717_2195059_-	conserved hypothetical protein; phage SPbeta	O64125	Bacillus_phage	8.1e-61	100.0
NP_389938.1\|2195172_2195547_+	putative membrane protein; phage SPbeta	A0A1P8CWZ2	Bacillus_phage	3.4e-60	100.0
NP_389939.1\|2195563_2195782_-	consserved hypothetical protein; phage SPbeta	O64123	Bacillus_phage	2.7e-33	100.0
NP_389940.1\|2195985_2196264_+	putative membrane bound or exported protein; phage SPbeta	O64122	Bacillus_phage	2.3e-45	100.0
NP_389941.1\|2196388_2197081_-	putative endonuclease; phage SPbeta	O64121	Bacillus_phage	7.2e-133	100.0
NP_389942.1\|2197120_2197324_-	hypothetical protein; phage SPbeta	O64120	Bacillus_phage	8.5e-34	100.0
NP_389943.1\|2197343_2197859_-	conserved hypothetical protein; phage SPbeta	O64119	Bacillus_phage	3.3e-98	100.0
NP_389944.1\|2198069_2198264_-	conserved hypothetical protein; phage SPbeta	O64118	Bacillus_phage	3.2e-30	100.0
NP_389945.1\|2198312_2198765_-	conserved hypothetical protein; phage SPbeta	O64117	Bacillus_phage	6.7e-79	100.0
NP_389946.1\|2198847_2199105_-	conserved hypothetical protein; phage SPbeta	O64116	Bacillus_phage	3.0e-44	100.0
NP_389947.1\|2199149_2199353_-	hypothetical protein; phage SPbeta	O64115	Bacillus_phage	1.3e-34	100.0
NP_389948.1\|2199361_2199526_-	hypothetical protein; phage SPbeta	O64114	Bacillus_phage	1.7e-24	100.0
NP_389949.1\|2199579_2200335_-	putative DNA-binding protein anti-repressor; phage SPbeta	A0A1P8CWY0	Bacillus_phage	1.1e-137	100.0
NP_389950.1\|2200375_2200783_-	putative SOS nucleotide-binding protein; phage SPbeta	A0A1P8CWY3	Bacillus_phage	2.6e-74	100.0
NP_389951.1\|2200789_2201128_-	conserved hypothetical protein; phage SPbeta	O64111	Bacillus_phage	8.9e-52	100.0
NP_389952.1\|2201124_2201475_-	hypothetical protein; phage SPbeta	O64110	Bacillus_phage	3.7e-61	100.0
NP_389953.1\|2201487_2201691_-	conserved hypothetical protein; phage SPbeta	A0A1P8CWX9	Bacillus_phage	5.7e-30	100.0
NP_389954.1\|2201704_2201983_-	conserved hypothetical protein; phage SPbeta	A0A1P8CWX5	Bacillus_phage	9.2e-47	100.0
NP_389955.1\|2201979_2202384_-	conserved protein of unknown function; phage SPbeta	A0A1P8CWX0	Bacillus_phage	2.9e-73	100.0
NP_389956.1\|2202380_2202716_-	hypothetical protein; phage SPbeta	A0A1P8CWX6	Bacillus_phage	3.2e-46	100.0
NP_389957.1\|2202804_2202999_-	hypothetical protein; phage SPbeta	O64105	Bacillus_phage	1.9e-27	100.0
NP_389958.1\|2203110_2203308_-	hypothetical protein; phage SPbeta	O64104	Bacillus_phage	3.6e-29	100.0
NP_389959.1\|2203377_2203596_-	conserved protein of unknown function; phage SPbeta	O64103	Bacillus_phage	6.6e-32	100.0
NP_389960.1\|2203778_2204003_+	putative transcriptional regulator, lambda repressor-like; phage SPbeta	O64102	Bacillus_phage	1.9e-34	100.0
NP_389961.2\|2204191_2205169_-	putative DNA breaking-rejoining enzyme; phage SPbeta	O64101	Bacillus_phage	4.0e-177	99.7
NP_389962.1\|2205192_2206575_-	conserved hypothetical protein; phage SPbeta	O64100	Bacillus_phage	1.3e-263	100.0
NP_389963.1\|2206681_2207758_-\|integrase	putative phage integrase; phage SPbeta	O64099	Bacillus_phage	1.5e-198	100.0
NP_389964.1\|2207747_2207960_-	putative transcriptional regulator, lambda repressor-like; phage SPbeta	O64098	Bacillus_phage	8.6e-29	100.0
NP_389965.1\|2208007_2208325_-	hypothetical protein; phage SPbeta	NA	NA	NA	NA
NP_389966.1\|2208327_2208528_-	hypothetical protein; phage SPbeta	O64096	Bacillus_phage	9.0e-28	100.0
NP_389967.1\|2208854_2208980_-\|lysis	arbitrium lysis /lysogeny regulatory peptide; phage SPbeta	NA	NA	NA	NA
NP_389968.1\|2208993_2210154_-	arbitrium peptide sensor regulator; phage SPbeta	NA	NA	NA	NA
NP_389969.1\|2210330_2210747_-	conserved protein of unknown function; phage SPbeta	O64093	Bacillus_phage	1.2e-71	100.0
NP_389970.1\|2210748_2211282_-	conserved protein of unknown function; phage SPbeta	O64092	Bacillus_phage	9.3e-88	100.0
NP_389971.1\|2211308_2211845_-	superinfection exclusion protein B; phage SPbeta	O64091	Bacillus_phage	2.2e-97	100.0
NP_389972.1\|2211883_2212015_-	hypothetical protein; phage SPbeta	O64090	Bacillus_phage	1.7e-19	100.0
NP_389973.1\|2212025_2212241_-	conserved protein of unknown function; phage SPbeta	O64089	Bacillus_phage	5.0e-32	100.0
NP_389974.1\|2212244_2212496_-	conserved membrane protein of unknown function; phage SPbeta	A0A1P8CWV6	Bacillus_phage	1.6e-37	100.0
YP_003097748.1\|2212566_2212746_+	conserved protein of unknown function; phage SPbeta	A0A1P8CWV7	Bacillus_phage	3.6e-28	96.6
YP_003097749.1\|2212847_2213078_+	conserved membrane protein of unknown function; phage SPbeta	NA	NA	NA	NA
NP_389976.1\|2213082_2213478_-	conserved membrane protein of unknown function; phage SPbeta	O64087	Bacillus_phage	1.0e-62	100.0
NP_389977.1\|2213535_2214864_-	conserved protein of unknown function; phage SPbeta	O64086	Bacillus_phage	8.7e-260	100.0
NP_389978.1\|2214971_2215199_-	putative transcriptional regulator, lambda repressor-like; phage SPbeta	O64085	Bacillus_phage	1.0e-35	100.0
NP_389979.1\|2215459_2216776_-	conserved protein of unknown function; phage SPbeta	O64084	Bacillus_phage	1.1e-257	100.0
NP_389980.1\|2217132_2217639_-	conserved protein of unknown function; phage SPbeta	O64083	Bacillus_phage	4.9e-70	100.0
NP_389981.1\|2217966_2219199_-	conserved protein of unknown function; phage SPbeta	O64082	Bacillus_phage	1.7e-238	100.0
NP_389982.1\|2219280_2219469_-	conserved protein of unknown function; phage SPbeta	O64081	Bacillus_phage	1.5e-24	100.0
YP_003097750.1\|2219513_2219765_-	conserved protein of unknown function (toxin/antitoxin island); phage SPbeta	A0A1P8CWU4	Bacillus_phage	1.6e-29	94.4
NP_389983.1\|2219783_2219960_-	toxin; phage SPbeta	O64080	Bacillus_phage	6.7e-11	100.0
NP_389984.1\|2220334_2220946_-	putative hydrolase lipoprotein; phage SPbeta	O64079	Bacillus_phage	5.0e-85	100.0
NP_389985.1\|2221060_2221387_-	putative transcriptional regulator (Xre family); phage SPbeta	O64078	Bacillus_phage	9.8e-56	100.0
NP_389986.1\|2222339_2222534_+	hypothetical protein; phage SPbeta	O64077	Bacillus_phage	2.7e-29	100.0
NP_389987.1\|2222573_2225093_+	conserved protein of unknown function; phage SPbeta	O64076	Bacillus_phage	0.0e+00	100.0
NP_389988.1\|2225336_2225615_+	HU-related DNA-binding protein; phage SPbeta	A0A1P8CWT5	Bacillus_phage	1.2e-30	76.9
YP_009513968.1\|2226175_2226346_+	hypothetical protein; phage SPbeta	NA	NA	NA	NA
NP_389989.1\|2227296_2227488_+	conserved protein of unknown function; phage SPbeta	O64074	Bacillus_phage	1.5e-27	100.0
NP_389990.2\|2227504_2228722_+	conserved protein of unknown function; phage SPbeta	O64073	Bacillus_phage	1.3e-230	99.8
NP_389991.1\|2228755_2229166_-	conserved hypothetical protein; phage SPbeta	A0A1P8CWT0	Bacillus_phage	8.8e-70	100.0
NP_389992.1\|2229384_2229885_+	conserved protein of unknown function; phage SPbeta	A0A1P8CWS3	Bacillus_phage	3.6e-89	100.0
NP_389993.1\|2229987_2230908_+	conserved protein of unknown function; phage SPbeta	A0A1P8CWS6	Bacillus_phage	5.4e-176	100.0
NP_389994.1\|2230894_2232664_+	putative P-loop ATPase; phage SPbeta	O64069	Bacillus_phage	0.0e+00	100.0
NP_389995.1\|2232681_2234202_+	conserved protein of unknown function; phage SPbeta	O64068	Bacillus_phage	1.4e-282	100.0
NP_389996.1\|2234232_2235669_+	conserved protein of unknown function; phage SPbeta	A0A1P8CWR1	Bacillus_phage	2.7e-267	100.0
NP_389997.1\|2235693_2236230_+	conserved protein of unknown function; phage SPbeta	A0A1P8CWS2	Bacillus_phage	3.6e-95	100.0
NP_389998.1\|2236268_2237285_+	conserved protein of unknown function; phage SPbeta	A0A1P8CWR9	Bacillus_phage	1.3e-186	100.0
NP_389999.1\|2237320_2237791_+	conserved protein of unknown function; phage SPbeta	A0A1P8CWS5	Bacillus_phage	6.7e-82	100.0
NP_390000.1\|2237805_2238201_+	conserved protein of unknown function; phage SPbeta	A0A1P8CWR5	Bacillus_phage	2.5e-69	100.0
NP_390001.1\|2238197_2238452_+	conserved protein of unknown function; phage SPbeta	A0A1P8CWS7	Bacillus_phage	2.2e-39	100.0
NP_390002.1\|2238435_2239086_+	conserved protein of unknown function; phage SPbeta	A0A1P8CWR8	Bacillus_phage	3.2e-122	100.0
NP_390003.1\|2239082_2239589_+	conserved protein of unknown function; phage SPbeta	O64060	Bacillus_phage	5.9e-92	100.0
NP_390004.1\|2239585_2240296_+	conserved protein of unknown function; phage SPbeta	A0A1P8CWQ7	Bacillus_phage	1.8e-131	100.0
NP_390005.1\|2240338_2241136_+	conserved protein of unknown function; phage SPbeta	A0A1P8CWR0	Bacillus_phage	2.1e-91	100.0
YP_003097751.1\|2241153_2241765_+	conserved protein of unknown function; phage SPbeta	A0A1P8CWQ5	Bacillus_phage	3.3e-65	100.0
NP_390006.1\|2241764_2241992_+	hypothetical protein; phage SPbeta	A0A1P8CWR2	Bacillus_phage	6.4e-38	100.0
NP_390007.1\|2242055_2242412_+	putative phage-related lytic exoenzyme; phage SPbeta	O64055	Bacillus_phage	1.4e-58	100.0
NP_390008.1\|2242413_2243631_+	conserved protein of unknown function; phage SPbeta	A0A1P8CWR7	Bacillus_phage	2.5e-173	100.0
NP_390009.1\|2243641_2243992_+\|tail	putative tail phage assembly protein; phage SPbeta	O64053	Bacillus_phage	5.4e-60	100.0
NP_390010.1\|2243988_2244180_+	conserved phage protein of unknown function; phage SPbeta	A0A1P8CWR4	Bacillus_phage	3.5e-29	100.0
NP_390011.1\|2244229_2244730_+	conserved protein of unknown function; phage SPbeta	A0A1P8CWQ6	Bacillus_phage	5.7e-87	100.0
NP_390012.1\|2244713_2245133_+	conserved protein of unknown function; phage SPbeta	A0A1P8CWQ4	Bacillus_phage	4.8e-71	100.0
NP_390013.1\|2245146_2246148_+\|integrase	putative integrase; phage SPbeta	A0A1P8CWP6	Bacillus_phage	4.8e-194	100.0
NP_390014.1\|2246150_2246480_-	hypothetical protein; phage SPbeta	A0A1P8CWQ2	Bacillus_phage	1.2e-61	99.1
NP_390015.1\|2246655_2247342_-	conserved exported protein of unknown function; phage SPbeta	O64048	Bacillus_phage	2.2e-126	100.0
YP_003097752.1\|2247366_2247543_-	conserved phage protein of unknown function; phage SPbeta	NA	NA	NA	NA
NP_390016.1\|2247888_2248335_+	conserved protein of unknown function; phage SPbeta	O64047	Bacillus_phage	8.1e-77	100.0
NP_390017.1\|2248416_2249100_+	protein conferring self-immunity to the host; phage SPbeta	Q37974	Bacillus_phage	2.1e-116	100.0
NP_390018.2\|2249153_2256011_+	lytic transglycosylase; SPbeta phage protein	A0A1P8CWQ1	Bacillus_phage	0.0e+00	67.7
NP_390019.1\|2256061_2256820_+	conserved protein of unknown function; phage SPbeta	O64045	Bacillus_phage	1.4e-145	100.0
NP_390020.1\|2256831_2259459_+	putative DNA wielding protein; SPbeta phage	O64044	Bacillus_phage	0.0e+00	100.0
NP_390021.1\|2259474_2260296_+	conserved hypothetical protein; phage SPbeta	O64043	Bacillus_phage	1.2e-134	100.0
NP_390022.1\|2260332_2262267_+	putative glycosyl hydrolase; phage SPbeta	O64042	Bacillus_phage	0.0e+00	100.0
NP_390023.1\|2262436_2263261_+	conserved protein of unknown function; phage SPbeta	A0A1P8CWP0	Bacillus_phage	1.5e-164	100.0
YP_009513969.1\|2263250_2263469_+	hypothetical protein; phage SPbeta	A0A1P8CWN7	Bacillus_phage	1.7e-35	100.0
NP_390024.1\|2263488_2264592_+	bacteriophage SPbeta N-acetylmuramoyl-L-alanine amidase	O64040	Bacillus_phage	2.8e-187	100.0
NP_390025.1\|2264679_2264892_+\|holin	holin-like protein; bacteriophage SPbeta	A0A290GDY2	Caldibacillus_phage	4.2e-15	59.7
NP_390026.1\|2264902_2265169_+\|holin	holin-like protein; bacteriophage SPbeta	A0A2H4J6M0	uncultured_Caudovirales_phage	1.1e-15	50.0
NP_390027.1\|2265224_2265671_-	thiol-disulfide oxidoreductase B; bacteriophage SPbeta	NA	NA	NA	NA
NP_390028.1\|2265667_2266936_-	sublancin glycosyltransferase; phage SPbeta	NA	NA	NA	NA
NP_390029.1\|2266935_2267349_-	bacteriophage SPbeta thiol-disulfide oxidoreductase	NA	NA	NA	NA
NP_390030.1\|2267345_2269463_-	sublancin 168 lantibiotic transporter	W8CYL7	Bacillus_phage	6.9e-25	26.1
NP_390031.1\|2269520_2269691_-	sublancin 168 lantibiotic antimicrobial precursor peptide; SPBeta prophage	NA	NA	NA	NA
NP_390032.1\|2269987_2270305_-	protein of immunity to sublancin	NA	NA	NA	NA
NP_390033.2\|2270406_2271657_-	lesion bypass phage DNA polymerase; phage SPbeta	O64031	Bacillus_phage	9.4e-240	99.8
NP_390034.1\|2271649_2271982_-	conserved hypothetical protein; phage SPbeta	O64030	Bacillus_phage	1.3e-55	100.0
NP_390035.1\|2272155_2272491_+	conserved phage protein of unknown function; phage SPbeta	O64029	Bacillus_phage	2.1e-53	100.0
NP_390036.1\|2272533_2272890_-	conserved protein of unknown function; phage SPbeta	O64028	Bacillus_phage	5.0e-61	100.0
NP_390037.1\|2272895_2273363_-	conserved exported protein of unknown function; SPbeta phage	O64027	Bacillus_phage	5.1e-82	100.0
YP_009513970.1\|2273593_2273710_+	phage toxin; type I toxin-antitoxin system	Q96209	Bacillus_phage	9.8e-11	100.0
NP_390038.1\|2273988_2274522_-	putative N-acetyltransferase; phage SPbeta	O64026	Bacillus_phage	6.2e-100	100.0
NP_390039.1\|2274557_2275136_-	conserved protein of unknown function; phage SPbeta	O64025	Bacillus_phage	9.4e-110	100.0
NP_390040.1\|2275199_2275697_-	conserved protein of unknown function; phage SPbeta	O64024	Bacillus_phage	1.9e-95	100.0
NP_390041.2\|2275705_2277421_-	putative RNase; phage SPbeta	O64023	Bacillus_phage	1.4e-302	99.8
NP_390042.1\|2277520_2278078_-	conserved protein of unknown function; phage SPbeta	O64022	Bacillus_phage	3.6e-106	100.0
NP_390043.1\|2278601_2279675_-	conserved protein of unknown function; phage SPbeta	O64021	Bacillus_phage	9.3e-204	100.0
NP_390044.1\|2279976_2280867_+	calcium-dependent DNA nuclease, lipoprotein; phage SPbeta	O64020	Bacillus_phage	3.3e-114	100.0
NP_390045.1\|2280880_2281363_+	conserved protein of unknown function; phage SPbeta	O64019	Bacillus_phage	2.5e-84	100.0
NP_390046.1\|2281666_2282485_+	aminoglycoside N3'-acetyltransferase	O64018	Bacillus_phage	1.9e-156	100.0
YP_009513971.1\|2282504_2282639_-	hypothetical protein; phage SPbeta	NA	NA	NA	NA
YP_009513972.1\|2282800_2282956_-	hypothetical protein; phage SPbeta	NA	NA	NA	NA
NP_390047.1\|2283135_2283651_-	conserved hypothetical protein; phage SPbeta	O64017	Bacillus_phage	2.0e-95	100.0
NP_390048.1\|2283857_2284568_-	hypothetical protein; phage SPbeta	O64016	Bacillus_phage	3.7e-108	100.0
NP_390049.1\|2284770_2286408_+\|integrase	serine-type phage integrase; phage SPbeta	O64015	Bacillus_phage	2.8e-308	100.0
2286414:2286429	attR	NA	NA	NA	NA

DBSCAN-SWA_7

2425247 : 2431343

Staphylococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
NP_390202.1\|2425247_2425841_-	chromosome condensation and segregation factor	A0A1B1IVT7	uncultured_Mediterranean_phage	2.0e-14	35.4
NP_390203.1\|2425830_2426586_-	chromosome condensation and partitioning factor	A0A1B1IVW1	uncultured_Mediterranean_phage	5.5e-09	29.2
NP_390204.1\|2426866_2427391_+	conserved protein of unknown function	NA	NA	NA	NA
NP_390205.1\|2427404_2427779_-	putative riboflavin synthesis-related N-acetyltransferase	NA	NA	NA	NA
NP_390206.1\|2427891_2428356_-	6,7-dimethyl-8-ribityllumazine synthase, beta subunit	A0A2H4PQS3	Staphylococcus_phage	5.5e-44	60.0
NP_390207.1\|2428388_2429585_-	fused 3,4-dihydroxy-2-butanone 4-phosphate synthase and GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	6.9e-115	54.9
NP_390208.1\|2429599_2430247_-	riboflavin synthase (alpha subunit)	A0A2H4PQS5	Staphylococcus_phage	5.0e-43	45.9
NP_390209.1\|2430257_2431343_-	fused diaminohydroxyphosphoribosylaminopyrimidine deaminase; 5-amino-6-(5-phosphoribosylamino) uracil reductase	A0A2H4PQS8	Staphylococcus_phage	5.1e-56	36.1

DBSCAN-SWA_8

2634504 : 2699243

Bacillus_phage(29.27%)

capsid,holin,terminase,protease,tail,head,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
NP_390432.1\|2634504_2635611_-\|protease	spore germination protease	NA	NA	NA	NA
NP_390433.2\|2635814_2636081_+	ribosomal protein S20 (BS20)	NA	NA	NA	NA
NP_390434.1\|2636095_2637139_-	DNA polymerase clamp loader delta subunit	NA	NA	NA	NA
YP_009513978.1\|2637178_2637328_-	hypothetical protein	NA	NA	NA	NA
YP_003097762.1\|2637368_2637503_+	conserved protein of unknown function	NA	NA	NA	NA
NP_390435.1\|2637542_2639873_-	DNA channel for uptake in competent cells	Q332B9	Clostridium_botulinum_C_phage	4.3e-36	35.1
NP_390436.1\|2639876_2640446_-	dCMP deaminase associated to DNA transport (competence)	A0A127AWN5	Bacillus_phage	2.8e-34	52.5
NP_390437.1\|2640512_2641130_-	membrane bound high-affinity DNA-binding receptor	NA	NA	NA	NA
NP_390438.1\|2641213_2642035_+	putative pyrroline-5'-carboxylate reductase	NA	NA	NA	NA
NP_390439.1\|2642100_2642844_-	putative methyltransferase	NA	NA	NA	NA
NP_390440.1\|2642840_2643197_-	ribosomal silencing factor	NA	NA	NA	NA
NP_390441.1\|2643214_2643775_-	putative hydrolase	NA	NA	NA	NA
NP_390442.1\|2643764_2644334_-	nicotinate-nucleotide adenylyltransferase	G3MA22	Bacillus_virus	1.1e-22	31.5
NP_390443.1\|2644345_2644636_-	50S RNA-binding protein	NA	NA	NA	NA
NP_390444.2\|2644629_2645472_-	shikimate 5-dehydrogenase	NA	NA	NA	NA
NP_390445.1\|2645489_2646590_-	potassium-dependent GTPase involved in ribosome 30S assembly	NA	NA	NA	NA
NP_390446.1\|2646593_2647112_-	phosphatase (active on GMP and Glc-6-P)	NA	NA	NA	NA
YP_054588.1\|2647455_2647614_+	check point factor coupling initiation of sporulation and replication initiation	NA	NA	NA	NA
NP_390447.1\|2647919_2648651_-	putative lipoprotein; putative esterase	NA	NA	NA	NA
NP_390448.1\|2648902_2649655_-	N-acetylmuramoyl-L-alanine amidase	Q9ZXD7	Bacillus_phage	1.6e-69	65.3
NP_390449.1\|2649841_2650468_+	conserved membrane protein of unknown function	NA	NA	NA	NA
NP_390450.1\|2650486_2651380_-	putative catabolic 6-phospho-gluconate dehydrogenase (NAD[+]-dependent)	M4SJX8	Cyanophage	3.4e-58	36.0
NP_390451.2\|2651631_2652354_+	conserved protein of unknown function	NA	NA	NA	NA
NP_390452.1\|2652386_2652797_-	sporulation-specific matrix degrading exported DNase	F8WPS9	Bacillus_phage	7.8e-42	60.6
NP_390454.2\|2653370_2654873_-	site-specific DNA recombinase; skin element	A0A2H4J3Q1	uncultured_Caudovirales_phage	1.8e-19	28.1
NP_390455.1\|2655321_2655741_-	thioredoxin-coupled arsenate reductase; skin element	A0A2H4PQT9	Staphylococcus_phage	1.2e-45	64.9
NP_390456.2\|2655752_2656793_-	arsenite efflux transporter; skin element	NA	NA	NA	NA
NP_390457.2\|2656815_2657256_-	putative thiol lyase	NA	NA	NA	NA
NP_390458.1\|2657316_2657634_-	transcriptional regulator (ArsR-arsenate); skin element	NA	NA	NA	NA
NP_390459.2\|2658005_2658770_-	conserved protein of unknown function; skin element	NA	NA	NA	NA
NP_390460.2\|2659212_2660340_+	response regulator aspartate phosphatase; skin element	A0A1P8CWN8	Bacillus_phage	1.5e-71	39.1
NP_390461.1\|2660329_2660464_+	regulator peptide of the activity of phosphatase RapE; skin element	NA	NA	NA	NA
NP_390462.1\|2660573_2660732_+	hypothetical protein; skin element	NA	NA	NA	NA
NP_390463.1\|2661101_2662697_+	phage ribonuclease toxin; skin element	A0A1P8CWI7	Bacillus_phage	6.9e-78	61.3
NP_390464.1\|2662711_2663290_+	antitoxin factor of ribonuclease toxin RttG; skin element	NA	NA	NA	NA
YP_009513979.1\|2663407_2663554_+	hypothetical protein	NA	NA	NA	NA
NP_390465.1\|2663550_2663913_-	hypothetical protein; skin element	NA	NA	NA	NA
NP_390466.1\|2663928_2664408_-	hypothetical protein; skin element	NA	NA	NA	NA
NP_390467.1\|2664572_2665391_-	N-acetylmuramoyl-L-alanine amidase; skin element	A0A218KC88	Bacillus_phage	1.0e-64	74.4
NP_390468.1\|2665435_2665858_-\|holin	putative holin; skin element	D6R405	Bacillus_phage	3.3e-48	73.7
NP_390469.1\|2665902_2666796_-	putative phage-related lytic exoenzyme; skin element	NA	NA	NA	NA
NP_390470.1\|2666883_2667048_-	conserved phage protein of unknown function; skin element	A0A2H4JAA1	uncultured_Caudovirales_phage	2.7e-14	67.9
NP_390471.1\|2667044_2667380_-	conserved phage protein of unknown function; skin element	NA	NA	NA	NA
NP_390472.2\|2667389_2668490_-	conserved phage protein of unknown function; skin element	M4ZRP1	Bacillus_phage	1.7e-19	56.1
NP_390473.1\|2668492_2668765_-	conserved phage protein of unknown function; skin element	NA	NA	NA	NA
NP_390474.2\|2668761_2669340_-\|plate,tail	putative phage tail baseplate protein; skin element	A0A2H4J717	uncultured_Caudovirales_phage	1.5e-14	33.8
NP_390475.1\|2669323_2670370_-\|plate	putative phage baseplate assembly protein; skin element	S6AVU3	Thermus_phage	8.3e-72	43.5
NP_390476.1\|2670362_2670788_-	conserved phage protein of unknown function; skin element	A0A0A8WJV8	Clostridium_phage	1.5e-11	36.4
NP_390477.1\|2670800_2671064_-	conserved phage protein of unknown function; skin element	NA	NA	NA	NA
NP_390478.1\|2671060_2672041_-	conserved phage protein of unknown function; skin element	H7BV96	unidentified_phage	2.1e-40	32.0
NP_390479.1\|2672053_2672713_-	putative phage murein-binding protein; skin element	A0A090DBR9	Clostridium_phage	4.8e-25	34.7
NP_390480.2\|2672705_2677463_-	putative tape measure protein; skin element	A0A1L2JY60	Aeribacillus_phage	1.3e-44	47.2
NP_390482.1\|2678239_2678419_+	toxic peptide of toxin-antitoxin system; skin element	NA	NA	NA	NA
YP_009513980.1\|2678798_2678888_+	skin region; type I toxin	NA	NA	NA	NA
NP_390483.2\|2679141_2679585_-\|tail	putative tail tube protein; skin element	A0A0K2CNG3	Brevibacillus_phage	3.2e-25	45.4
NP_390485.2\|2679587_2680988_-\|tail	putative phage tail sheath protein; skin element	S5MNC1	Brevibacillus_phage	4.1e-74	39.1
YP_003097763.1\|2680988_2681180_-	conserved phage protein of unknown function; skin element	NA	NA	NA	NA
NP_390486.2\|2681176_2681614_-	conserved phage protein of unknown function; skin element	NA	NA	NA	NA
NP_390487.1\|2681626_2682130_-\|tail	putative phage tail component; skin element	A0A249XXA4	Clostridium_phage	8.3e-38	46.9
NP_390488.1\|2682126_2682489_-	conserved phage protein of unknown function; skin element	A0A249XXE9	Clostridium_phage	6.9e-10	39.3
NP_390489.2\|2682485_2682881_-	conserved phage protein of unknown function; skin element	NA	NA	NA	NA
NP_390490.1\|2682884_2683196_-	hypothetical protein; skin element	NA	NA	NA	NA
NP_390491.2\|2683206_2684142_-\|capsid	putative phage capsid protein; skin element	A0A1B1P7E3	Bacillus_phage	8.6e-105	65.0
NP_390492.2\|2684160_2685129_-	putative nucleic acid-binding protein; skin element	A0A1B1P7E4	Bacillus_phage	7.4e-59	57.3
NP_390493.1\|2685161_2685815_-	conserved phage protein of unknown function; skin element	NA	NA	NA	NA
NP_390494.1\|2685855_2686773_-\|head	putative phage head morphogenesis protein; skin element	A0A1B1P7D7	Bacillus_phage	2.4e-51	39.1
NP_390495.1\|2686769_2688302_-\|capsid	putative phage capsid protein; skin element	A0A1B1P7C8	Bacillus_phage	4.7e-148	51.9
NP_390496.1\|2688305_2689601_-\|terminase	putative phage-related terminase large subunit; skin element	A0A2P1JTW5	Anoxybacillus_phage	1.1e-155	63.4
NP_390497.1\|2689593_2690313_-\|terminase	putative phage-related terminase small subunit; skin element	A0A2P1JTW4	Anoxybacillus_phage	1.7e-55	55.9
NP_390498.1\|2690380_2690845_-	hypothetical protein; skin element	NA	NA	NA	NA
NP_390499.1\|2690988_2691444_-	putative phage DNA-binding protein; skin element	A0A2H4J4R7	uncultured_Caudovirales_phage	2.4e-60	74.8
NP_390500.1\|2691641_2692571_+	conserved phage protein of unknown function; skin element	NA	NA	NA	NA
NP_390501.1\|2692644_2692851_-	conserved phage protein of unknown function; skin element	A0A2H4J4M6	uncultured_Caudovirales_phage	5.5e-20	71.6
NP_390502.1\|2692932_2693361_-	putative Holliday junction resolvase; skin element	S6B1L9	Thermus_phage	5.6e-43	65.7
YP_003097764.1\|2693456_2693606_-	hypothetical protein; skin element	NA	NA	NA	NA
NP_390503.3\|2693596_2694538_-	putative helicase loader; skin element	A6XMI1	Bacillus_virus	8.0e-58	52.2
NP_390504.2\|2694419_2695097_-	putative DNA-binding protein; skin element	A0A2H4J6G9	uncultured_Caudovirales_phage	1.1e-05	31.8
NP_390505.1\|2695172_2696027_-	putative DNA recombination protein; skin element	A0A2H4JCY8	uncultured_Caudovirales_phage	7.1e-122	79.0
NP_390506.1\|2696029_2696989_-	putative nuclease; skin element	A0A2H4JA52	uncultured_Caudovirales_phage	2.2e-135	72.9
NP_390507.1\|2697094_2697289_-	hypothetical protein; skin element	NA	NA	NA	NA
YP_009513981.1\|2697248_2697422_-	hypothetical protein; skin element	NA	NA	NA	NA
NP_390508.1\|2697418_2697676_-	skin element; factor binding to DnaA	A0A2H4J4M9	uncultured_Caudovirales_phage	6.4e-10	42.2
NP_390509.1\|2697672_2698242_-	putative transcriptional regulator; skin element	A0A2H4J884	uncultured_Caudovirales_phage	1.5e-64	61.0
NP_390510.1\|2698315_2698456_-	hypothetical protein; skin element	NA	NA	NA	NA
NP_390511.1\|2698485_2698716_-	putative transcriptional regulator; skin element	A8ATK0	Listeria_phage	1.1e-08	53.4
NP_390512.1\|2698892_2699243_+	skin element; transcriptional repressor of yqaF-yqaN operon (Xre family)	A0A2H4J6F9	uncultured_Caudovirales_phage	2.0e-06	30.6

DBSCAN-SWA_9

2832726 : 2886043

uncultured_Mediterranean_phage(12.5%)

tRNA,lysis,coat,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
NP_390649.1\|2832726_2833872_-\|tRNA	tRNA-guanine transglycosylase	A0A1B1IVQ4	uncultured_Mediterranean_phage	3.4e-87	44.0
NP_390650.1\|2833898_2834927_-\|tRNA	S-adenosylmethionine tRNA ribosyltransferase-isomerase	NA	NA	NA	NA
YP_003097768.1\|2834956_2835157_-	conserved membrane protein of unknown function	NA	NA	NA	NA
YP_054590.1\|2835149_2836154_-	Holliday junction DNA helicase, ATP-dependent component	B3GAM6	uncultured_virus	1.1e-07	30.8
NP_390652.1\|2836164_2836770_-	Holliday junction DNA helicase	NA	NA	NA	NA
NP_390653.1\|2836908_2837421_-	bypass of forespore C, intercompartmental signaling factor	NA	NA	NA	NA
NP_390654.2\|2837468_2838776_-	putative catecholate siderophose exporter	NA	NA	NA	NA
NP_390655.1\|2838846_2839872_-	putative inositol-related oxidoreductase	NA	NA	NA	NA
NP_390656.2\|2840109_2840757_+	putative serine/threonine-protein kinase	A0A2R3ZQF2	Marseillevirus	5.4e-05	26.3
YP_009513992.1\|2840802_2840925_-	hypothetical protein	NA	NA	NA	NA
NP_390658.2\|2841009_2841300_+	hypothetical protein	NA	NA	NA	NA
YP_003097769.1\|2841306_2841447_+	hypothetical protein	NA	NA	NA	NA
NP_390659.2\|2841610_2843065_+	sodium/proton-dependent alanine transporter	NA	NA	NA	NA
NP_390660.1\|2843105_2843828_-	putative factor regulating gene expression	NA	NA	NA	NA
NP_390661.2\|2843930_2844527_-	spore germination protein	NA	NA	NA	NA
NP_390662.1\|2844674_2845838_-	morphogenetic protein associated with SpoVID	NA	NA	NA	NA
NP_390663.1\|2845954_2847061_-	quinolinate synthetase	NA	NA	NA	NA
NP_390664.1\|2847047_2847917_-	nicotinate-nucleotide pyrophosphorylase (quinolinate phosphoribosyltransferase)	NA	NA	NA	NA
NP_390665.1\|2847870_2849466_-	L-aspartate oxidase	NA	NA	NA	NA
NP_390666.1\|2849568_2850756_+	desulfurase involved in iron-sulfur clusters for NAD biosynthesis	A0A141ZJV0	Faustovirus	8.6e-33	27.1
NP_390667.2\|2850715_2851258_+	transcriptional repressor of de novo NAD biosynthesis	NA	NA	NA	NA
NP_390668.1\|2851282_2852140_-	prephenate dehydratase	NA	NA	NA	NA
NP_390669.1\|2852156_2852600_-	transcriptional repressor of operons hom-thrCB and thrD	NA	NA	NA	NA
NP_390670.1\|2852660_2853947_-	ppGpp-binding GTPase involved in cell portioning, DNA repair and ribosome assembly	NA	NA	NA	NA
NP_390671.1\|2853980_2854559_-	sporulation initiation phosphotransferase	NA	NA	NA	NA
YP_009513993.1\|2854636_2854759_+	hypothetical protein	NA	NA	NA	NA
NP_390672.1\|2854879_2855164_-	ribosomal protein L27 (BL24)	NA	NA	NA	NA
NP_390673.2\|2855176_2855515_-\|protease	ribosomal protein L27 specific N-terminal end cysteine protease	NA	NA	NA	NA
NP_390674.1\|2855517_2855826_-	ribosomal protein L21 (BL20)	NA	NA	NA	NA
NP_390675.1\|2855972_2856839_-\|protease,lysis	membrane metalloprotease [proteolysis of pro-sigma(K)]	NA	NA	NA	NA
NP_390676.1\|2856831_2857626_-	regulator of SpoIVFB (stage IV sporulation)	NA	NA	NA	NA
NP_390677.1\|2857775_2858582_-	ATPase activator of MinC	NA	NA	NA	NA
NP_390678.1\|2858583_2859264_-	cell-division regulator (septum placement)	NA	NA	NA	NA
NP_390679.1\|2859316_2859835_-	cell-shape determining protein	NA	NA	NA	NA
NP_390680.2\|2859831_2860704_-	cell-shape determining protein	NA	NA	NA	NA
NP_390681.2\|2860734_2861748_-	cell-shape determining protein	NA	NA	NA	NA
NP_390682.1\|2861839_2862535_-	conserved nucleotide-related metabolism protein	NA	NA	NA	NA
NP_390683.1\|2862571_2863141_-	nucleoside triphosphate pyrophosphatase; septum formation DNA-binding protein (multicopy associated filamentation)	NA	NA	NA	NA
NP_390684.1\|2863293_2864292_-	spatial and temporal regulator of the dissolution of septal peptidoglycan during engulfment (stage II sporulation)	NA	NA	NA	NA
NP_390685.2\|2864425_2865172_-	membrane prepilin peptidase	NA	NA	NA	NA
NP_390686.1\|2865311_2866604_-	folyl-polyglutamate synthase	NA	NA	NA	NA
NP_390687.2\|2866663_2869306_-\|tRNA	valyl-tRNA synthetase	A0A1V0S951	Catovirus	3.7e-161	42.6
YP_003097770.1\|2869753_2869945_+	conserved protein of unknown function	NA	NA	NA	NA
NP_390688.1\|2869963_2870989_-\|coat	spore coat protein	NA	NA	NA	NA
NP_390689.1\|2871021_2872749_-	morphogenetic spore protein (stage VI sporulation)	NA	NA	NA	NA
NP_390690.1\|2872879_2874172_-	glutamate-1-semialdehyde 2,1-aminomutase	NA	NA	NA	NA
NP_390691.1\|2874201_2875176_-	delta-aminolevulinic acid dehydratase (porphobilinogen synthase)	NA	NA	NA	NA
NP_390692.1\|2875172_2875961_-	uroporphyrinogen III cosynthase	NA	NA	NA	NA
NP_390693.1\|2875950_2876895_-	porphobilinogen deaminase (hydroxymethylbilane synthase)	NA	NA	NA	NA
NP_390694.2\|2876927_2877758_-\|tRNA	negative effector of the concentration of glutamyl-tRNA reductase HemA	NA	NA	NA	NA
NP_390695.1\|2877765_2879133_-\|tRNA	glutamyl-tRNA reductase	NA	NA	NA	NA
NP_390696.2\|2879362_2879860_+	putative integral inner membrane protein	NA	NA	NA	NA
NP_390697.1\|2879881_2880469_-	GTPase involved in ribosome 50S subunit assembly (maturation of the central 50S protuberance)	NA	NA	NA	NA
NP_390698.1\|2880465_2882790_-\|protease	class III heat-shock ATP-dependent LonA protease	A0A0R6PGP8	Moraxella_phage	3.4e-182	43.7
NP_390699.1\|2882970_2884629_-\|protease	spore-specific ATP-dependent protease LonB	A0A1V0SHJ7	Hokovirus	8.1e-05	33.7
NP_390700.2\|2884780_2886043_-\|protease	protein unfolding ATPase required for presentation of proteins to proteases; Maxwell's demon	G3M9Z9	Bacillus_virus	1.3e-148	64.9

DBSCAN-SWA_10

3159257 : 3218173

uncultured_Caudovirales_phage(57.14%)

holin,coat,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
NP_390967.1\|3159257_3159689_-\|coat	outer spore coat protein	NA	NA	NA	NA
NP_390968.1\|3159690_3160746_-\|coat	spore coat protein	NA	NA	NA	NA
NP_390969.1\|3160760_3161894_-\|coat	spore coat protein	NA	NA	NA	NA
NP_390970.1\|3162083_3163157_+\|coat	spore coat kinase	NA	NA	NA	NA
NP_390971.1\|3163236_3163704_+	putative receptor	NA	NA	NA	NA
NP_390972.1\|3163734_3166131_-	glycogen phosphorylase	Q8B3H5	Iris_mild_mosaic_virus	1.5e-12	40.2
NP_390973.1\|3166117_3167572_-	glycogen (starch) synthase	NA	NA	NA	NA
NP_390974.1\|3167568_3168600_-	glucose-1-phosphate adenylyltransferase (ADP-glucose pyrophosphorylase) beta subunit	NA	NA	NA	NA
NP_390975.1\|3168623_3169766_-	glucose-1-phosphate adenylyltransferase (ADP-glucose pyrophosphorylase) subunit alpha	NA	NA	NA	NA
NP_390976.1\|3169762_3171646_-	1,4-alpha-glucan branching enzyme	NA	NA	NA	NA
NP_390977.1\|3179305_3179884_+	thiamin permease	NA	NA	NA	NA
NP_390978.1\|3179925_3180447_-	putative N-acetyltransferase	NA	NA	NA	NA
NP_390979.1\|3180464_3181994_-	flotillin lipid rafts scaffold protein	A0A2I2L4B2	Orpheovirus	2.7e-07	27.9
NP_390980.1\|3182014_3182539_-	putative membrane integrity integral membrane protein	NA	NA	NA	NA
NP_390981.1\|3182706_3183195_+	conserved protein of unknown function	NA	NA	NA	NA
NP_390982.1\|3183200_3183779_-	conserved protein of unknown function	NA	NA	NA	NA
NP_390983.2\|3183866_3185075_-\|holin	choline dehydrogenase	NA	NA	NA	NA
NP_390984.1\|3185091_3186564_-	glycine betaine aldehyde dehydrogenase, NAD+-dependent	NA	NA	NA	NA
NP_390985.1\|3186762_3187305_+	transcriptional repressor for gbsAB	NA	NA	NA	NA
NP_390986.1\|3187502_3188048_+	biofilm hydrophobic layer component	NA	NA	NA	NA
NP_390987.1\|3188413_3189082_+	potassium uptake protein	NA	NA	NA	NA
NP_390988.1\|3189088_3190426_+	potassium transporter ATPase	NA	NA	NA	NA
NP_390989.1\|3190461_3190725_-	conserved protein of unknown function	NA	NA	NA	NA
NP_390990.1\|3190833_3191682_-	exoglucosaminidase	A0A0K2CP65	Brevibacillus_phage	1.0e-24	41.1
NP_390991.1\|3191842_3193378_-	putative efflux transporter	NA	NA	NA	NA
NP_390992.1\|3193862_3194348_+	cysteine dioxygenase	NA	NA	NA	NA
NP_390993.1\|3194634_3195465_-	undecaprenyl-pyrophosphate phosphatase	NA	NA	NA	NA
NP_390994.1\|3195557_3196724_-	putative integral membrane protein	NA	NA	NA	NA
NP_390995.1\|3196905_3197892_+	scyllo-inositol dehydrogenase (NADP+-dependent); biofilm formation	NA	NA	NA	NA
NP_390996.1\|3197932_3199207_-	L-rhamnose isomerase	NA	NA	NA	NA
NP_390997.1\|3199232_3199547_-	L-rhamnose mutarotase	NA	NA	NA	NA
NP_390998.1\|3199564_3201022_-	rhamnulokinase	NA	NA	NA	NA
NP_390999.1\|3201026_3201803_-	transcriptional regulator of the rhamnose operon (RhaR / l-rhamnulose-1-phosphate)	NA	NA	NA	NA
NP_391000.1\|3201859_3203929_-	bifunctional rhamnulose-1-phosphate aldolase/alcohol dehydrogenase	NA	NA	NA	NA
NP_391001.1\|3204066_3206055_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.2e-15	52.0
NP_391002.2\|3206168_3208154_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	3.4e-26	32.2
NP_391003.1\|3208279_3210268_-	methyl-accepting chemotaxis protein (membrane curvature dependent localisation)	A0A2H4J162	uncultured_Caudovirales_phage	2.5e-16	60.7
NP_391004.2\|3210444_3212433_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	4.4e-13	53.4
NP_391005.1\|3212590_3213328_+	protein-glutamine gamma-glutamyltransferase (transglutaminase)	NA	NA	NA	NA
YP_003097776.1\|3213341_3213596_-	conserved protein of unknown function	NA	NA	NA	NA
NP_391006.2\|3213853_3214252_-	conserved protein of unknown function	NA	NA	NA	NA
YP_009514000.1\|3214211_3214346_-	hypothetical protein	NA	NA	NA	NA
NP_391007.2\|3214371_3216036_-	putative oligo-1,6-glucosidase	NA	NA	NA	NA
NP_391008.2\|3216162_3217452_-	putative membrane protein	NA	NA	NA	NA
NP_391009.1\|3217495_3218173_-\|protease	putative metal-dependent protease/peptidase	NA	NA	NA	NA

DBSCAN-SWA_11

3459805 : 3468235

Organic_Lake_phycodnavirus(100.0%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
NP_391250.1\|3459805_3460486_-\|holin	choline ABC transporter (permease)	NA	NA	NA	NA
NP_391251.1\|3460502_3461423_-\|holin	choline ABC transporter (choline-binding lipoprotein)	NA	NA	NA	NA
NP_391252.1\|3461434_3462088_-\|holin	choline ABC transporter (permease)	NA	NA	NA	NA
NP_391253.1\|3462104_3463250_-\|holin	choline ABC transporter (ATP-binding protein)	F2Y2R6	Organic_Lake_phycodnavirus	6.0e-15	32.7
NP_391254.2\|3463533_3464067_+\|holin	putative transcriptional regulator (controlling choline uptake)	NA	NA	NA	NA
NP_391255.1\|3464288_3464765_+	export step of killing factor SdpC	NA	NA	NA	NA
NP_391256.1\|3464761_3465733_+	export step of killing factor SdpC	NA	NA	NA	NA
NP_391257.1\|3465775_3466387_+	precursor of killing factor SdpC	NA	NA	NA	NA
NP_391258.1\|3466433_3467057_-	integral membrane immunity regulator of autophagy	NA	NA	NA	NA
NP_391259.1\|3467053_3467326_-	transcriptional regulator of SdpC synthesis operon (ArsR family)	NA	NA	NA	NA
NP_391260.1\|3467545_3468235_-\|holin	glycine betaine/carnitine/choline/choline sulfate ABC transporter (promiscuous permease)	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_000964

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection