CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NC_008379	Rhizobium leguminosarum bv. viciae 3841 plasmid pRL9, complete sequence	0 crisprs	NA	0	0
NC_008380	Rhizobium leguminosarum bv. viciae 3841, complete genome	4 crisprs	WYL,cas3,csa3,DEDDh	4	7
NC_008384	Rhizobium leguminosarum bv. viciae 3841 plasmid pRL11, complete sequence	0 crisprs	csa3,DEDDh	0	1
NC_008381	Rhizobium leguminosarum bv. viciae 3841 plasmid pRL10, complete sequence	0 crisprs	NA	0	2
NC_008383	Rhizobium leguminosarum bv. viciae 3841 plasmid pRL8, complete sequence	0 crisprs	NA	0	0
NC_008378	Rhizobium leguminosarum bv. viciae 3841, complete genome	0 crisprs	csa3	0	0
NC_008382	Rhizobium leguminosarum bv. viciae 3841 plasmid pRL7, complete sequence	0 crisprs	NA	0	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

372504 : 384122

Leptospira_phage(33.33%)

transposase,integrase

attL 367326:367340|attR 382618:382632

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
367326:367340	attL	NA	NA	NA	NA
WP_011652218.1\|372504_373383_+\|integrase	tyrosine-type recombinase/integrase	S5W9T9	Leptospira_phage	3.5e-31	31.7
WP_011652217.1\|373389_374586_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_011655083.1\|375385_376033_+	VOC family protein	NA	NA	NA	NA
WP_011655084.1\|376295_377291_-\|integrase	site-specific integrase	A0A1B1IQT7	uncultured_Mediterranean_phage	4.1e-12	26.8
WP_122330930.1\|377287_378205_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_011655086.1\|378204_379437_-\|integrase	tyrosine-type recombinase/integrase	A0A1L4BKH1	Thermus_phage	2.8e-10	30.4
WP_011655087.1\|379665_379953_-	hypothetical protein	NA	NA	NA	NA
WP_041936910.1\|379970_380228_-	hypothetical protein	NA	NA	NA	NA
WP_011655089.1\|381181_381535_-	hypothetical protein	NA	NA	NA	NA
WP_011655090.1\|381691_381958_-	DUF982 domain-containing protein	NA	NA	NA	NA
WP_129557821.1\|382226_382454_+	hypothetical protein	NA	NA	NA	NA
WP_041936912.1\|382537_382783_-	BON domain-containing protein	NA	NA	NA	NA
382618:382632	attR	NA	NA	NA	NA
WP_011649142.1\|383054_384122_-\|transposase	IS110 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NC_008380

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_008380_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_008380_1

1053886-1053968

Orphan

Consensus_repeat	Method
TGCCGAAAAGTGTGAGCGGTTTTCGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_008380_1

>merge|NC_008380|1|1053886-1053968|CRISPRCasFinder
TGCCGAAAAGTGTGAGCGGTTTTCGGACAAGATCATGCTCCCACTATTAAAGCATGGTGCCGAAAAGTGTGAACGGTTTTCGG

>NC_008380|1|1|1053886-1053968|CRISPRCasFinder
TGCCGAAAAGTGTGAGCGGTTTTCGG	ACAAGATCATGCTCCCACTATTAAAGCATGG
TGCCGAAAAGTGTGAACGGTTTTCGG

Protein	Signature genes	Signature genes Name	Protein_function
NC_008380.1\|WP_011650719.1\|1060047_1060869_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224098
NC_008380.1\|WP_011650715.1\|1056145_1057081_-\|histone-deacetylase-family-protein	unknown	unknown	gnl\|CDD\|212541
NC_008380.1\|WP_003545921.1\|1055891_1056143_-\|exodeoxyribonuclease-VII-small-subunit	unknown	unknown	gnl\|CDD\|179195
NC_008380.1\|WP_011650707.1\|1046330_1047581_-\|class-I-SAM-dependent-RNA-methyltransferase	unknown	unknown	gnl\|CDD\|225174
NC_008380.1\|WP_011650703.1\|1042222_1044001_+\|acyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173842
NC_008380.1\|WP_041936182.1\|1044848_1045853_-\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293841
NC_008380.1\|WP_011650709.1\|1048452_1049448_+\|DUF4424-domain-containing-protein	unknown	unknown	gnl\|CDD\|373054
NC_008380.1\|WP_032986702.1\|1061698_1062739_-\|extracellular-solute-binding-protein	unknown	unknown	gnl\|CDD\|223759
NC_008380.1\|WP_041936183.1\|1049664_1051602_+\|methyl-accepting-chemotaxis-protein	unknown	unknown	gnl\|CDD\|214599
NC_008380.1\|WP_011650711.1\|1051865_1053782_-\|1-deoxy-D-xylulose-5-phosphate-synthase	unknown	unknown	gnl\|CDD\|224076
NC_008380.1\|WP_028742750.1\|1047577_1048363_-\|hemolysin	unknown	unknown	gnl\|CDD\|224110
NC_008380.1\|WP_011650704.1\|1044030_1044786_+\|crotonase/enoyl-CoA-hydratase-family-protein	unknown	unknown	gnl\|CDD\|168351
NC_008380.1\|WP_028742746.1\|1041017_1042013_-\|transporter	unknown	unknown	gnl\|CDD\|213368
NC_008380.1\|WP_011650712.1\|1054027_1054951_-\|pirin-family-protein	unknown	unknown	gnl\|CDD\|224655
NC_008380.1\|WP_041936184.1\|1060861_1061689_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224097
NC_008380.1\|WP_041936531.1\|1055037_1055805_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|212491
NC_008380.1\|WP_011650717.1\|1057905_1058577_-\|flavin-reductase-family-protein	unknown	unknown	gnl\|CDD\|224766
NC_008380.1\|WP_032993046.1\|1045977_1046316_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224647
NC_008380.1\|WP_028742755.1\|1057368_1057770_+\|thioesterase	unknown	unknown	gnl\|CDD\|223894
NC_008380.1\|WP_011650718.1\|1058578_1060003_-\|aminopeptidase-P-family-protein	unknown	unknown	gnl\|CDD\|223085

Protein	Function_ID	Function_description	E-value
NC_008380.1\|WP_011650719.1\|1060047_1060869_-\|ABC-transporter-permease	gnl\|CDD\|224098	COG1177, PotC, ABC-type spermidine/putrescine transport system, permease component II [Amino acid transport and metabolism].	1.67971e-61
NC_008380.1\|WP_011650715.1\|1056145_1057081_-\|histone-deacetylase-family-protein	gnl\|CDD\|212541	cd11599, HDAC_classII_2, Histone deacetylases and histone-like deacetylases, classII. This subfamily includes eukaryotic as well as bacterial Class II histone deacetylase (HDAC) and related proteins. Deacetylases of class II are Zn-dependent enzymes that catalyze hydrolysis of N(6)-acetyl-lysine residues of histones (EC 3.5.1.98) and possibly other proteins to yield deacetylated histones/other proteins. In D. discoideum, where four homologs (HdaA, HdaB, HdaC, HdaD) have been identified, HDAC activity is important for regulating the timing of gene expression during development. Also, inhibition of HDAC activity by trichostatin A is shown to cause hyperacetylation of the histone and a delay in cell aggregation and differentiation.	5.35515e-155
NC_008380.1\|WP_003545921.1\|1055891_1056143_-\|exodeoxyribonuclease-VII-small-subunit	gnl\|CDD\|179195	PRK00977, PRK00977, exodeoxyribonuclease VII small subunit; Provisional.	6.83197e-24
NC_008380.1\|WP_011650707.1\|1046330_1047581_-\|class-I-SAM-dependent-RNA-methyltransferase	gnl\|CDD\|225174	COG2265, TrmA, SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis].	5.24913e-120
NC_008380.1\|WP_011650703.1\|1042222_1044001_+\|acyl-CoA-dehydrogenase	gnl\|CDD\|173842	cd01153, ACAD_fadE5, Putative acyl-CoA dehydrogenases similar to fadE5. Putative acyl-CoA dehydrogenase (ACAD). Mitochondrial acyl-CoA dehydrogenases (ACAD) catalyze the alpha,beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of ACAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. The ACD family includes the eukaryotic beta-oxidation, as well as amino acid catabolism enzymes. These enzymes share high sequence similarity, but differ in their substrate specificities. The mitochondrial ACD's are generally homotetramers and have an active site glutamate at a conserved position.	1.60694e-148
NC_008380.1\|WP_041936182.1\|1044848_1045853_-\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293841	cd16283, RomA-like_MBL-fold, Enterobacter cloacae RomA and related proteins; MBL-fold metallo hydrolase domain. Derepression of the romA-ramA locus results in a multidrug-resistance phenotype. Members of this subgroup belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions. The class B metal beta-lactamases (MBLs) from which this fold was named are only a small fraction of the activities which are included in this superfamily. Activities carried out by superfamily members include class B beta-lactamases, hydroxyacylglutathione hydrolases, AHL (acyl homoserine lactone) lactonases, persulfide dioxygenases, flavodiiron proteins, cleavage and polyadenylation specificity factors such as the Int9 and Int11 subunits of Integrator, Sdsa1-like and AtsA-like arylsulfatases, 5'-exonucleases human SNM1A and yeast Pso2p, ribonuclease J and ribonuclease Z, cyclic nucleotide phosphodiesterases, insecticide hydrolases, and proteins required for natural transformation competence. Classical members of the superfamily are di-, or less commonly mono-, zinc-ion-dependent hydrolases, however the diversity of biological roles is reflected in variations in the active site metallo-chemistry.	1.76418e-75
NC_008380.1\|WP_011650709.1\|1048452_1049448_+\|DUF4424-domain-containing-protein	gnl\|CDD\|373054	pfam14415, DUF4424, Domain of unknown function (DUF4424). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 310 and 361 amino acids in length.	2.97926e-129
NC_008380.1\|WP_032986702.1\|1061698_1062739_-\|extracellular-solute-binding-protein	gnl\|CDD\|223759	COG0687, PotD, Spermidine/putrescine-binding periplasmic protein [Amino acid transport and metabolism].	1.38828e-45
NC_008380.1\|WP_041936183.1\|1049664_1051602_+\|methyl-accepting-chemotaxis-protein	gnl\|CDD\|214599	smart00283, MA, Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer). Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.	2.56788e-68
NC_008380.1\|WP_011650711.1\|1051865_1053782_-\|1-deoxy-D-xylulose-5-phosphate-synthase	gnl\|CDD\|224076	COG1154, Dxs, Deoxyxylulose-5-phosphate synthase [Coenzyme metabolism / Lipid metabolism].	0
NC_008380.1\|WP_028742750.1\|1047577_1048363_-\|hemolysin	gnl\|CDD\|224110	COG1189, COG1189, Predicted rRNA methylase [Translation, ribosomal structure and biogenesis].	2.54178e-116
NC_008380.1\|WP_011650704.1\|1044030_1044786_+\|crotonase/enoyl-CoA-hydratase-family-protein	gnl\|CDD\|168351	PRK06023, PRK06023, crotonase/enoyl-CoA hydratase family protein.	6.47401e-165
NC_008380.1\|WP_028742746.1\|1041017_1042013_-\|transporter	gnl\|CDD\|213368	cd12834, ZntB_u1, Uncharacterized bacterial subgroup of the Salmonella typhimurium Zn2+ transporter ZntB-like subfamily. The MIT superfamily of essential membrane proteins is involved in transporting divalent cations (uptake or efflux) across membranes. The ZntB-like subfamily includes the Zn2+ transporter Salmonella typhimurium ZntB which mediates the efflux of Zn2+ (and Cd2+). Structures of the intracellular domain of Vibrio parahaemolyticus and Salmonella typhimurium ZntB form funnel-shaped homopentamers, the tip of the funnel is formed from two C-terminal transmembrane (TM) helices from each monomer, and the large opening of the funnel from the N-terminal cytoplasmic domains. The GMN signature motif of the MIT superfamily occurs just after TM1, mutation within this motif is known to abolish Mg2+ transport through Salmonella typhimurium CorA, and Mrs2p. Natural variants such as GVN and GIN which occur in proteins belonging to this subfamily, may be associated with the transport of different divalent cations, such as zinc and cadmium. The functional diversity of MIT transporters may also be due to minor structural differences regulating gating, substrate selection, and transport.	7.9276e-112
NC_008380.1\|WP_011650712.1\|1054027_1054951_-\|pirin-family-protein	gnl\|CDD\|224655	COG1741, COG1741, Pirin-related protein [General function prediction only].	7.91547e-105
NC_008380.1\|WP_041936184.1\|1060861_1061689_-\|ABC-transporter-permease	gnl\|CDD\|224097	COG1176, PotB, ABC-type spermidine/putrescine transport system, permease component I [Amino acid transport and metabolism].	2.05366e-69
NC_008380.1\|WP_041936531.1\|1055037_1055805_-\|SDR-family-oxidoreductase	gnl\|CDD\|212491	cd05233, SDR_c, classical (c) SDRs. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human prostaglandin dehydrogenase (PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, PGDH numbering) and/or an Asn (Asn-107, PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	6.80467e-69
NC_008380.1\|WP_011650717.1\|1057905_1058577_-\|flavin-reductase-family-protein	gnl\|CDD\|224766	COG1853, COG1853, Conserved protein/domain typically associated with flavoprotein oxygenases, DIM6/NTAB family [General function prediction only].	8.55664e-42
NC_008380.1\|WP_032993046.1\|1045977_1046316_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|224647	COG1733, COG1733, Predicted transcriptional regulators [Transcription].	1.49099e-24
NC_008380.1\|WP_028742755.1\|1057368_1057770_+\|thioesterase	gnl\|CDD\|223894	COG0824, FcbC, Predicted thioesterase [General function prediction only].	6.76792e-15
NC_008380.1\|WP_011650718.1\|1058578_1060003_-\|aminopeptidase-P-family-protein	gnl\|CDD\|223085	COG0006, PepP, Xaa-Pro aminopeptidase [Amino acid transport and metabolism].	5.44881e-57

>NC_008380.1|WP_011650711.1|1051865_1053782_-|1-deoxy-D-xylulose-5-phosphate-synthase
MTQLPKTPLLDQVIYPADLRKLEDRDLPQLAREVRDEMIDAVSRTGGHLGAGLGVVELTIAIHSVFDTPDDRLIFDVGHQCYPHKILTGRRDRIRTLRQEDGLSGFTRRAESEYDPFGAAHSSTSISAGLGMAIAADLDKSDRRVIAVIGDGAMSAGMAYEALNNAGALDARLIVILNDNDMSIAPPTGAMSAYLARLASGRTYMGFRDFGKKLTAYLGKNIDRAITRAVEHARGYVTGGTMFEEMGFYHIGPIDGHSFDHLLPVLRNVRDNGRGPVLIHVVTQKGKGYPPAEAAADKYHGVNKFDVITGAQARVKPNAPSYTSVFAEALVQEATLDDKIVGITAAMPNGTGLDKLAEAFPSRCFDVGIAEQHAVTFAAGLAAEGYKPFAALYSTFLQRAYDQVVHDVAIQGLPVRFPIDRAGFVGADGPTHAGSFDTAFLTTLPGFVVMAAADEAELKHMVRTAVAYDGGPISFRYPRGEGVGVDMPARGEILQIGKGRIVKEGTKVALLSFGTRLADCLLAAEDLDAAGLSTTVADARFAKPLDHDLIRQLARHHEMVITVEEGSIGGFGSHVMHFLATEGLLDNGLKLRSLVMPDIWMEQAKPEAMNAHAGLDRAGIVSTVFKALGRGVAVGVAG
>NC_008380.1|WP_041936183.1|1049664_1051602_+|methyl-accepting-chemotaxis-protein
MSAKNISLNGKLAATFAALILIFVAVSAFVYSKATASAAASAEQEKSELLVNQIDDALQAMLEQAVNLRGFILFRSDSTYGDVFANRERMLKAIAAAKQTAAGEPQLVEMIDGMQKAADLYFHELAEPQTKARKETDMPIEEVVKIGVNATKGQLDGFRQASAKIKATAREKSEALATIRADANSHLKTTLLAGGIVASVAAAMLAWLMSRTIVRPVVGMTSAMDRLAGGQNDIEVPAVERGDEIGRMAQSVLVFKQAAIEKLRLAGETDRMRDDAERQRRAGDEQKAREESEIRFAIDALAGGLAELANGDMAGRIQTPFASQYDSLRNDFNHAVEKLQAALQSVGRNASAINAGAGEIRSAADDLAHRTEQQAAAVEQTAAALEEVTTTVRDSAKRAEDVGNLVERARLGAEKSGEVVRKAVSAMQQIEKSSGEISNIIGVIDDIAFQTNLLALNAGVEAARAGDAGKGFAVVAQEVRELAQRSAKAAKEIKALITTSGEQVVAGVGLVGETGKALEVIVSEVQEINHHVSAIVTATREQSIGLQEINTAVNNMDQGTQQNAAMVEEQTAASHALAQEANALEELLRQFKLGQVAPAPRASVAGTSSRPVASPAHALTRTVAKAFGGRQASGAATVQEEWTEF
>NC_008380.1|WP_011650709.1|1048452_1049448_+|DUF4424-domain-containing-protein
MLKLFTLIVAVAMASPALANDTMAEVKTGGLIFAQSDDVSMAEEDLFISASEVRVDYVFENSSDKDVESLVAFPMPDISGQVDNNSAISDYDSDNFLHFSTLQDGSPITAKLQQRVVSLGIDVTDEFAKQGIPVLPYSQKTTEALAKLPETVRKDWIARGLVYPMSAGDAKVDLVPLWTLRSTYWWRTTFPAKKKVSVAHRYKPAVGGTVAISFLEGGEPKGERFEEYSSKYCLDGDFVRVAQQRAREAEAGGANYTESWISYVLSTGANWAGPIKRFQLTIDKGKPGSLISFCGSNVRKIGPTTFRMTAEDFDPAKDFDILILNPPETAQ
>NC_008380.1|WP_028742750.1|1047577_1048363_-|hemolysin
MLATGGFAGHAQPMSDQNTQRLDQLLVSLGLFASRSRARDAVQRGTVRIGGQVVTKAGALFSADAAIEIDDPAQDYVSRAALKLAAALDHFRLDPAGHHCLDVGASTGGFTEVLLQRGAAHVTAIDVGHGQMHPRISGDPRVTNKEGLNARNLTADDVDHPATFIVSDVSFITLRLALAPALEIAEPGAVAVLLVKPQFEAGREAIGKGGMLKDPSSAPAVAAELERWFVEDMGWKSLGLIPSPISGGDGNQEFLLAGLKP
>NC_008380.1|WP_011650707.1|1046330_1047581_-|class-I-SAM-dependent-RNA-methyltransferase
MSTETVTIEKLGAQGDGIASSAGGPVYVPFSLPGETVAIARVKSQGTIMSITTPSPDRQEPPCRHFGPDGLNGTCGGCTLQHMADAPYRAFKRQLVIDALKSKGLTPEVGAIVPARPGERRRVVFAARKTEKDMLVGFNQAESHHIVAIEECPISSAGIIARLPAIRAIAASLATSAEPFRIAVLETLSGLDISVDDVKKLSDPQRRKAIETALSLRGIARVSLNGEILVEPSKPMVEFGGVQVSPPPGGFTQATKPAEEAMAELVMAHAGKAKRIADLFAGSGTFSLRLARIGRVHAVEAEAKALAALDHAARNTQGLKPVTVEKRDLFRRPLMTQEFKPYDAVVFDPPRAGAEFQCQELARSAVKKIVAVSCNPLTLARDLAILVEGGYRITQVTPIDQFLWTSHVEVVATLEK
>NC_008380.1|WP_032993046.1|1045977_1046316_+|helix-turn-helix-transcriptional-regulator
MKNRSVRQCPVARGRKSVGDAWSIQVLRDAHTGHTRFDQFRKSLGIVATMLAKRLKALKDDGLLEKRRYSERPPREEYTLTKAGRDFLPALIMIGAWAHRHWHRTAGTREQK
>NC_008380.1|WP_041936182.1|1044848_1045853_-|MBL-fold-metallo-hydrolase
MRRAKRRNPYYDGPVSDHFDGTHFFNPEGIEPLGFRDLLRWQFGGGRERWPRSVPSPYAAAKPDPYVDGEDLRVTMVGHATILVQVAGLNILTDPVWSERASPFAFAGPRRVVRPGIAFDDLPPIDLVLVSHNHYDHLDVATLKRLGEKHRPRVVTPLGNDTIIRRAVPDIQMTSMDWGERISHAGISIDAEPAHHWSARGTADRRMALWASFVLSTPAGKIYHVGDTGFHHGINYKAAQQKHGGFRLAILPFGAYEPRWFMKGQHQNPQEAVIGMKLANAAYVAGHHFATFQLTNEAVDAPARALQDAMSEHDIPPERFRPLRAGEVFNVPAA
>NC_008380.1|WP_011650704.1|1044030_1044786_+|crotonase/enoyl-CoA-hydratase-family-protein
MTDHIIVEQPSAYPGVQSIRFNRPEKKNAITRAMYRTMADALNAANTSPNIRATAFLGTEGCFSAGNDLNDFLAAAMGGRGLEQEILDFLYALVNSEKPVVSGVDGLAVGIGTTIHLHCDLTIASSRSQFRTPFVDLALVPEAGSSLLAPRLMGHQRAFALLAAGEAFSAEEAKEAGLVWKVVEPGEVDALTLGLAAKLAAKPPEALRIARDLIRGDRGEIIARIDEEARYFSARLKSAEARAAFEAFMRR
>NC_008380.1|WP_011650703.1|1042222_1044001_+|acyl-CoA-dehydrogenase
MYKAPVEEIAFTLKHVAGMGDAISEGLLGDLGEDLVDAILAEAGRFATEEVAPLAEIGDRQGARLIDGEVRLPDGWRDLYRHWIAGGWNGLTAPEAFGGQALPHMLNVAALEMWNSGSMAFGLAPTLTMGAIEAVGAHGSAALKDKYLEKMVSGEWTGTMNLTEPHAGSDLGVLKARAERRDDGSYRLFGQKIFITWGEHDAADNIIHLVLARLPDAPAGTRGISLFLVPKFLVNDDGSLGPRNDLFCHSLEHKLGIHGSPTCTMIYGDGKFGGEKGAVGWLVGEENKGLACMFTMMNNARLAVGMQGVAIAEAATQKALAYARERTQGRAPGSSSAGMSPIVEHPDVARMLLTMKALTQGARAISYACAHAIDMSHRAGDISRQWQERAALLTPIAKSFSTDSGVDVASLGIQVHGGMGFIEETGAARYLRDARIAPIYEGTNGIQAIDLVTRKLPLSGGGQVKGFIAELREIANGVRRSNLDGFGETAARLDAAIVDLELATAWLIKTLADDKAAEALSGATPYQRLFGLVLTGCYLAKGGLVESADGAAENRIALCRFAAENLLAETAALRDRVVNGAASLAAARILLA
>NC_008380.1|WP_028742746.1|1041017_1042013_-|transporter
MDTLPVNIPGFVWAYRFSPGEKTAVRLNNSATVAELTADNCFYWLHLNLVDARVPALLDTLDGLTEDAKSALTTRDTHAAITVDEQMLYGTLVDCQRDFAEDTNNLGWLHFAMSDRFLITTRLQPLRSVERARALIDKNPGKFSRPVDLFELLVIEFQRTLIAIVIELTEELNQIEDIVYDSAQRDERRRLAPVRRTVVRLHRHLRTVLALMRRAAAADDDEMPFGFDDVARRLTSRLETVDHDIYALQDRARLLHEEIDSKQSSETNRHLYLLSIMTAFLLPPTLVTGFFGMNTANLPFAVGDYGTEYAVVLIVASIAFAWWLLRRVDIL
>NC_008380.1|WP_011650712.1|1054027_1054951_-|pirin-family-protein
MSFFPGKDPLPGDAFACDAIENLIIPRTSDIGGFQVRRALPSRQRRLVGPFIFFDRMGPAILKPDEALDVKPHPHIGLSTVTYLFDGEIRHRDSLGTEKVIRPGDINLMTAGRGIVHSERTPDNLRGHPLLMSGLQTWLALPDDKEEIDPAFAHTEKSAMPLIETAGVRGRVVIGSFEGMTSPVGVFSDTLYVDLDLQPGAKFPFGAAHEERAVYVLSGEVVISGDRFAADQLLVFRPGDQITLEAGRDGCHLMLFGGAALNSKRYIWWNFVSSSKERIEQAKEEWRTGRFDIVPGDEEEFVPLPEG
>NC_008380.1|WP_041936531.1|1055037_1055805_-|SDR-family-oxidoreductase
MTDRLKGKVAIISGGATGMGGAASKLFAAEGARVAIIDRNGDAAAETVKQIRDAGGKADCWTADVSDEAAVNAAVAGVEKRYGAVTVLFNHAGTIVIKPFLETTVEEWDWLHAVNVRSMFLMTKAVLPKMIASGGGSIVCTSSISAVAATPMEVLYDTTKGAVHMFARAIAVEFRDRNIRCNAVCPGFIRTPHGLREVADLQALGVDVSDAAIAAQQGRIGEPEDVARAALYLASDESGFVNGAHLFVDNGFTAI
>NC_008380.1|WP_003545921.1|1055891_1056143_-|exodeoxyribonuclease-VII-small-subunit
MTDSAKPEVSGLSFEKAVAELESIVARLERGDVALDESIEIYERGEALKKHCETLLSAAENRIEKIRLDRAGKPQGVEPLDGA
>NC_008380.1|WP_011650715.1|1056145_1057081_-|histone-deacetylase-family-protein
MSTRLYEHPIFLEHVTPAGHPERSDRIRAINVALEHPNFERLERRPAPQANEDAVLLAHPEEHLIAVMREIPEEEGEINQIEADTYASSKSLQAALTGIGGAMAAVDDVFTGRADNVFVAARPPGHHAEKMTAMGFCFFNNAAIAARHAQRTHGAERIAIVDWDVHHGNGTQDIFWDDASVLFCSTHQMPLYPGTGAKDEKGKHNTIVNAPLSPNVGSDHFREAFKSRVLPALDDFRPDLIIISAGFDAHHRDPLAQINLTGEDFDWATGRVLELADRHAKNRVVSLLEGGYDLEGLAESAGMHILRMMKG
>NC_008380.1|WP_028742755.1|1057368_1057770_+|thioesterase
MSQSERPDVAEIRVPFRDVDMNGQMFLASYISYAESVLASFWSSRPDVDDEPVYSPSKVSCFLHRPLHYDEPATFTATIDKIGVRSIGFLISIDTGEERAAEVEIIWQAHAPEDQSPASLPEETRDWLYRFLN
>NC_008380.1|WP_011650717.1|1057905_1058577_-|flavin-reductase-family-protein
MTHHKQHTHFDFAKLTERERYKILIGTVIPRPIALVTTVSKEGLPNAGPFSFFNVLTHDPAIVAIGVENYADMRFKDTARNIRETGEFTVHICDDALVDQMEVCAIKFGPEVDELSEAGLATAPGQMVRSPRILAAPAALECRRHTTLQVGPAREIILGEVLGVYVRSDAVNPTNLHIDQQLMDAVGRMGGHTYARTRDQFDIKTQTKEEWSSRKSVSEPVSA
>NC_008380.1|WP_011650718.1|1058578_1060003_-|aminopeptidase-P-family-protein
MNMRATNAGAYRMGSLLADFQPDFDFSAPLPLPVEEFEDRLRRIRRQAVEAGHDALVVHAGSVGWFHASNAYLRYICDWMREGVLIIPTDADKAMVLLSFFTQSVLLPPGGEPVLVDEIWQIGPIGREYADRPGDSVLKTAEKCAEVLASLGLAKAQIGRIGDRTSLTFWSALDELMPKSKFVADNAILDRMQKVRSLPEIEMFRAAAQLISIGTQAAYHVAKPGVTDHEILAVFTYAQMALGGETGDGYQIGINEFGTHCGKPYGHIVRPGDLINLYISNVTYRGYTAQTARMIAVGDISSHQEDVLAACTEGVKRAEKLIRPGALMRDVNNAAFEPMIERGMLTSAEARTMPYNWSPMEDGGARLIPNQYVKDIDWEAQGRKLMHVYPATHGPHNPNLGHSVGMAGGQNSFNISSHNYDRMEEGMVFVLHTQWLEPLSAGCNIGDMYVVTKDGFENLSRHTPLETHRVAAEA
>NC_008380.1|WP_011650719.1|1060047_1060869_-|ABC-transporter-permease
MRDRRENPIPVMLYKAFVYGFGGLCVIYLVAPIVIALTMSFTSGQTLKYPPQGFSLRWYAALLDPVRSATEHIAAWNSLKIAGLAVLGSLIFAVPATIGMTRMKRSTVGTIEPLLLAPLVLPSLVYGLAALIVANFIGFKPSLWLTVSGHVVVFGPLMYRAASVVAQGLNPSLAEASTTMGASWFMTLRRVTLPLLMPGILAGAFLVFIQSLDNVSVSLFLADARTTVLPLRMFALIEESLDVRVAAISGILIGVTLVGLLVARRVLAPPRQA
>NC_008380.1|WP_041936184.1|1060861_1061689_-|ABC-transporter-permease
MKASGFPYVLPMLLLSVAFFATPLAVLVGFSFAGPGGATLEHYARFFGDAFNFRVLVNTARLGLETVIGTTLLGVPIALLYWHGGRNLRQVLIFLTLIPMLTSNVVRTFAWIVILGRQGPISEALVALGLTGMPTSLLFTELGLVMAMCQIDLPLIILPLIAILSRTPVQLTEAAQVSGAGPWRIFVTVLLPLMLPGLLAGWILVFASTSSSFVTQAVIGGARNVYVPQLIYREVGTLFDWPLASAIAVVLLLSTGCLLVALTMISRHRRLVGHA
>NC_008380.1|WP_032986702.1|1061698_1062739_-|extracellular-solute-binding-protein
MKDFQITRRGFGFLAAGVAASAMLPFAARAAGGGAVAATFPGSWEDAYRTVLTPMVKDAGYDLTIAPAMAQDQLAKIMASPGNPPYDTLLMSPGQMAVAIEKDLIQKIDPSKLKNWGMLDPSFQGEYGPTVTIEVNGIAYNPDLVPKPKGYRDLFENPAYSGKVSWTGFASNTAVMAYTEIAKIFGSGPNDMDAVFKLFKDHPEHLKGVVDSTNHQMTLFQQGEIAVFMCSTGNVARLKSLGLNAEFVQPETGSPAAPVNIHLTKGTANLDAAYAYMDAAISKAAQDLLKEPPTEMFPTNKDVALTPGIEAYVTRDQIKTMVYPDWVAINKNRDGWIRQFDALVAG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_008380_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_008380_2

1148547-1148845

Orphan

Consensus_repeat	Method
GANCCGCCNGTGCCGACNGT	CRT

5 spacers

csa3

The CRISPR arrays of NC_008380_2

>merge|NC_008380|2|1148547-1148845|CRT
GAGCCGCCGGTGCCGACCGAGCTGCTCGAAGTGCCCCCACCGGCCGACGAACCGCCGGTGCCAAGCGTCGAAGCAGATCCCGAGCCGGAGCCCGAACCAGCAGCAGAGCCGCCGGTGCCGACAGTGCTGCTGGAGGTGCCGCCACCGGCTGATGAGCCGCCGGTGCCGACCGTCGAGGACGTGCCGGATTTGCAGTTGGTTGCGCCGGCAGGGCAGGTGCCCCCGGCAGAGCTGCCACCAGTACCGACCGTGCTGCTCGCAGTTCCGCCGCCGGCCGACGAACCGCCAGTGCCGACAGT

>NC_008380|2|1|1148547-1148845|CRT
GAGCCGCCGGTGCCGACCGA	GCTGCTCGAAGTGCCCCCACCGGCCGAC
GAACCGCCGGTGCCAAGCGT	CGAAGCAGATCCCGAGCCGGAGCCCGAACCAGCAGCA
GAGCCGCCGGTGCCGACAGT	GCTGCTGGAGGTGCCGCCACCGGCTGAT
GAGCCGCCGGTGCCGACCGT	CGAGGACGTGCCGGATTTGCAGTTGGTTGCGCCGGCAGGGCAGGTGCCCCCGGCAGAG
CTGCCACCAGTACCGACCGT	GCTGCTCGCAGTTCCGCCGCCGGCCGAC
GAACCGCCAGTGCCGACAGT

Protein	Signature genes	Signature genes Name	Protein_function
NC_008380.1\|WP_011650797.1\|1145439_1147269_-\|MCP-four-helix-bundle-domain-containing-protein	unknown	unknown	gnl\|CDD\|185001
NC_008380.1\|WP_041936194.1\|1154173_1154626_+\|hypothetical-protein	unknown	unknown	unknown
NC_008380.1\|WP_011650806.1\|1155756_1156107_+\|antibiotic-biosynthesis-monooxygenase	unknown	unknown	gnl\|CDD\|225209
NC_008380.1\|WP_129557778.1\|1136839_1137043_-\|hypothetical-protein	unknown	unknown	unknown
NC_008380.1\|WP_028742810.1\|1147955_1148303_-\|hypothetical-protein	unknown	unknown	unknown
NC_008380.1\|WP_011650809.1\|1157963_1158578_-\|HAD-family-phosphatase	unknown	unknown	gnl\|CDD\|319790
NC_008380.1\|WP_028742812.1\|1150078_1153693_+\|autotransporter-domain-containing-protein	unknown	unknown	gnl\|CDD\|226973
NC_008380.1\|WP_011650808.1\|1157594_1157960_-\|nuclear-transport-factor-2-family-protein	unknown	unknown	gnl\|CDD\|378915
NC_008380.1\|WP_011650796.1\|1144550_1145240_-\|HAD-family-hydrolase	unknown	unknown	gnl\|CDD\|223710
NC_008380.1\|WP_011650791.1\|1137039_1139952_-\|sensor-domain-containing-phosphodiesterase	unknown	unknown	gnl\|CDD\|238923
NC_008380.1\|WP_041936193.1\|1147502_1147946_-\|hypothetical-protein	unknown	unknown	unknown
NC_008380.1\|WP_011650795.1\|1143582_1144230_+\|hypothetical-protein	unknown	unknown	unknown
NC_008380.1\|WP_011650804.1\|1154671_1155358_-\|helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|378968
NC_008380.1\|WP_028742806.1\|1139951_1140563_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|224584
NC_008380.1\|WP_011650794.1\|1141894_1143319_-\|threonine-synthase	unknown	unknown	gnl\|CDD\|236418
NC_008380.1\|WP_011650807.1\|1156285_1157428_+\|site-specific-DNA-methyltransferase	unknown	unknown	gnl\|CDD\|223931
NC_008380.1\|WP_011650793.1\|1140592_1141891_-\|insulinase-family-protein	unknown	unknown	gnl\|CDD\|223685
NC_008380.1\|WP_049778359.1\|1153764_1153998_+\|hypothetical-protein	unknown	unknown	unknown
NC_008380.1\|WP_011650800.1\|1149085_1149970_-\|hypothetical-protein	unknown	unknown	unknown
NC_008380.1\|WP_011650805.1\|1155430_1155760_+\|NIPSNAP-family-protein	unknown	unknown	gnl\|CDD\|311781

Protein	Function_ID	Function_description	E-value
NC_008380.1\|WP_011650797.1\|1145439_1147269_-\|MCP-four-helix-bundle-domain-containing-protein	gnl\|CDD\|185001	PRK15041, PRK15041, methyl-accepting chemotaxis protein.	1.52602e-63
NC_008380.1\|WP_011650806.1\|1155756_1156107_+\|antibiotic-biosynthesis-monooxygenase	gnl\|CDD\|225209	COG2329, COG2329, Uncharacterized enzyme involved in biosynthesis of extracellular polysaccharides [General function prediction only].	2.58928e-17
NC_008380.1\|WP_011650809.1\|1157963_1158578_-\|HAD-family-phosphatase	gnl\|CDD\|319790	cd02603, HAD_sEH-N_like, N-terminal lipase phosphatase domain of human soluble epoxide hydrolase, Escherichia coli YihX/HAD4 alpha-D-glucose 1-phosphate phosphatase, and related domains, may be inactive. This family includes the N-terminal phosphatase domain of human soluble epoxide hydrolase (sEH). sEH is a bifunctional enzyme with two distinct enzyme activities, the C-terminal domain has epoxide hydrolysis activity and the N-terminal domain (Ntermphos), which belongs to this family, has lipid phosphatase activity. The latter prefers mono-phosphate esters, and lysophosphatidic acids (LPAs) are the best natural substrates found to date. In addition this family includes Gallus gallus sEH and Xenopus sEH which appears to lack phosphatase activity, and Escherichia coli YihX/HAD4 which selectively hydrolyzes alpha-Glucose-1-P, phosphatase, has significant phosphatase activity against pyridoxal phosphate, and has low beta phosphoglucomutase activity. This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	1.23679e-37
NC_008380.1\|WP_028742812.1\|1150078_1153693_+\|autotransporter-domain-containing-protein	gnl\|CDD\|226973	COG4625, COG4625, Uncharacterized protein with a C-terminal OMP (outer membrane protein) domain [Function unknown].	7.48092e-50
NC_008380.1\|WP_011650796.1\|1144550_1145240_-\|HAD-family-hydrolase	gnl\|CDD\|223710	COG0637, COG0637, Predicted phosphatase/phosphohexomutase [General function prediction only].	1.05172e-55
NC_008380.1\|WP_011650791.1\|1137039_1139952_-\|sensor-domain-containing-phosphodiesterase	gnl\|CDD\|238923	cd01948, EAL, EAL domain. This domain is found in diverse bacterial signaling proteins. It is called EAL after its conserved residues and is also known as domain of unknown function 2 (DUF2). The EAL domain has been shown to stimulate degradation of a second messenger, cyclic di-GMP, and is a good candidate for a diguanylate phosphodiesterase function. Together with the GGDEF domain, EAL might be involved in regulating cell surface adhesiveness in bacteria.	3.53319e-97
NC_008380.1\|WP_011650808.1\|1157594_1157960_-\|nuclear-transport-factor-2-family-protein	gnl\|CDD\|378915	pfam12680, SnoaL_2, SnoaL-like domain. This family contains a large number of proteins that share the SnoaL fold.	1.55984e-08
NC_008380.1\|WP_011650804.1\|1154671_1155358_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|378968	pfam12840, HTH_20, Helix-turn-helix domain. This domain represents a DNA-binding Helix-turn-helix domain found in transcriptional regulatory proteins.	2.9595e-13
NC_008380.1\|WP_028742806.1\|1139951_1140563_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|224584	COG1670, RimL, Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis].	1.33546e-38
NC_008380.1\|WP_011650794.1\|1141894_1143319_-\|threonine-synthase	gnl\|CDD\|236418	PRK09225, PRK09225, threonine synthase; Validated.	0
NC_008380.1\|WP_011650807.1\|1156285_1157428_+\|site-specific-DNA-methyltransferase	gnl\|CDD\|223931	COG0863, COG0863, DNA modification methylase [DNA replication, recombination, and repair].	2.42308e-89
NC_008380.1\|WP_011650793.1\|1140592_1141891_-\|insulinase-family-protein	gnl\|CDD\|223685	COG0612, PqqL, Predicted Zn-dependent peptidases [General function prediction only].	6.76714e-133
NC_008380.1\|WP_011650805.1\|1155430_1155760_+\|NIPSNAP-family-protein	gnl\|CDD\|311781	pfam07978, NIPSNAP, NIPSNAP. Members of this family include many hypothetical proteins. It also includes members of the NIPSNAP family which have putative roles in vesicular transport. This domain is often found in duplicate.	2.28853e-26

>NC_008380.1|WP_028742810.1|1147955_1148303_-|hypothetical-protein
MAQFSTIAFSASLALIAGQAMSEEIKLDDGTTCTVVQSQSSQGDMSTTVTAGNGHVSSSTTTGGSSGSSSSSASAGSSAGSGSVDSFSTASITRPDGTVITKRSDGTCSVTKPKK
>NC_008380.1|WP_041936193.1|1147502_1147946_-|hypothetical-protein
MRHISLIAALSITLLASTSAVLAEDCTAAGTVGSAGSASAGGTSASSLGTAGTCRTDDGTTSSIGSGGSAATSDGKAQSKTHINDNGDKLKAQTKAQAVDKGTFSKSRTKTSTDGSTLDSTTRTMSHVPGEKPVKNTTNQKIILPEQ
>NC_008380.1|WP_011650797.1|1145439_1147269_-|MCP-four-helix-bundle-domain-containing-protein
MASIQHKIIIASIAIFALAGGATGVGIWSASTLSENNAEVARSAQILRNHMQADMMHDAMRADVLASMLASNPAAGMDAAAVKADLVEHDASFREMLDANKALAADDKTKTLLASIERPLLTYIESATKIVDLASRDASAALKALPEFMQQFSTLETAMEQAGDQITAASEEISNRSSDVKASVDIVLEALLASAALFAFGLYFLTRKTVTKPILSLSGDMQRLAGGDTAIACTGIGRSDEIGRMASAVEVFRQAAIANKQLEKDAEAARLQGETERVTARKQADDDAAERLRTATSGLAAGLKRLASGDLSFQIEEPFAPDFEGLRHDFNMSIRQLDQTLGAIAAAIAAIDEGTREIASGAGDLSKRTEQQAASLEETAAALDQITANVSNSSKRTDEARTEATDANSNAVKSSEVVSHAEEAMRRIEASSQQISSIIGVIDEIAFQTNLLALNAGVEAARAGDAGKGFAVVAQEVRELAQRSAQAAKEIKGHIQKSSVEVESGVKLVLDTSQVLKAISEQIARINQHMDAIAVSAREQSTGLAEVNTAVNSMDQVTQQNAAMVEQSTAASGQLAEEAAKLRELVSRFRLRATASQSATGRRSGQLAA
>NC_008380.1|WP_011650796.1|1144550_1145240_-|HAD-family-hydrolase
MDGFDLIIFDCDGVLVDSEIIAAEVESALLTEAGYPIDAEEMGERFAGMTWRNILLQIEREASIPFSASLLDKSEHMLDLRLAQDVQAIPGIEFAVSRLPIKRCICSNSSTKRLDMMLSKVGLKPLFAPSIFSAKDLGPDRVKPKPDIFLHGASQMGVSPDKVVVVEDSVHGVHAARAAGMRVIGFTGASHSYPAHADKLTDAGAETAISRMNDLPGVVAALAAWDNVL
>NC_008380.1|WP_011650795.1|1143582_1144230_+|hypothetical-protein
MVLGKVSRLIVSASFLALLAGCNSLGIGGDSQSTAPATQTNGTAQIMPLAPANPSSNNPSIGTATTAQGTVAPVVQGACPQIFMRDQDSIFRTYAKGKKDDPQQIVFQASVGDYTRQCTLNDTNLTMTVVAQLRLITGPAGTPGPVTLPIRISVIDGETVLYSEVTKFPTEIPPGAPGTQVVFRKDGIKMPVGSGALVRVNIGFDTQPAKTKKSS
>NC_008380.1|WP_011650794.1|1141894_1143319_-|threonine-synthase
MMNVDYISTRGEAPSLGFCDALLTGLARDGGLYVPRKWPSFSKKEIRALRGKTYQEIAFTILSPFTNGEIPDDTFRAMIDEAYGTFRHPAIAPLVQTGPNSFVMELFHGTTLAFKDVAMQLLARLMDYALEKRGERATIVGATSGDTGGAAIDAFAGRERTDIFILFPHGKVSPVQQRQMTTSSSANVHALAVEGNFDDCQNLVKAMFNDVTFRDKVRLSGVNSINWARIMAQIVYYFTAAVALGGPDRKISFTVPTGNFGDIFAGYCAKRMGLPIDRLVIATNENDILARTLKTGRYDMKAVKATSSPSMDIQISSNFERLLFEAYDRDASKVRAAMESLKQSNGFEIGSQALKAIRRDFRAGRASEKQVAETIRKTHAETGYLLDPHSAIGVFVAAKKEKPNTPMVTLSTAHPAKFPAAVKSACGIDPALPTWLADLMHREERFQIIKPELKAVETFIGKHARGETTAGAER
>NC_008380.1|WP_011650793.1|1140592_1141891_-|insulinase-family-protein
MTVECTRLKSGLTVVTETMPHLESVALGVWIKSGSRNETDNEHGIAHLLEHMAFKGTARRTARQIAEEIEDVGGEVNAATSTETTSYYARVLKDYVPLAVDILADILTESAFEEEELEREKQVILQEINAANDTPDDVVFDRFSEAAYRDQTLGRAILGTPETVVSFTPQQIRGYLGRNYTTDRMFVVATGAVEHEEFLRMVEDRFASLPTAPSAPPVMEPARYIGGSVREPRDLMDAQILLGFEGKPYHARDFYCSQILANILGGGMSSRLFQEVREFRGLCYSVYAFHWGFSDTGIFGIHAATGGENLPELVPVIIDELHKSADAIHQKEIERARAQIRAQLLMGAESPAARAGQIARQMMLYGRPISNPEMMERLEGITIERLTDLAGRLFYDTVPTLSAIGPLEQLAPMEDITASLTVPASKTLQASR
>NC_008380.1|WP_028742806.1|1139951_1140563_-|GNAT-family-N-acetyltransferase
MPKSVFRFLSRQPEAVELENDRYFLRLPRYQDFNQWHRLRAESRKFLEPWEPTWRRDELTEGAYRARVVRGKQEYASGQAVPLFIFLKGDMTLVGGVTIGYIRRGAAQSCMIGYWMGERHAGQGHMFAALQLVIPYIFAGLELHRIEAACIPDNARSIRLLEKAGFQQEGYLRGYLKINGQWHDHVMFSRLATDTDKGRKTDS
>NC_008380.1|WP_011650791.1|1137039_1139952_-|sensor-domain-containing-phosphodiesterase
MTRDRMLPKSPSGRVIAVIAALFLAAFAFVAGVAQAAEPVKISRDDTALDLTATTEIYTNQGEAFQVSTAAGADGIRRRIEVRASSENHQGDWAVFALANVSEEQLERVIVAPHFRLVNSKLFWPDLGSQRISAITPSEGFALDRQPSDEADVFRITLNPGSVITFVAELSTPELPQIYLWEPNAYKDTINAFTLYRGIVLGIAGLLAVFLTILFVVKGTSMLPATAALAWAVLGYICVDFGFLGKLISVASADQRIWRACAEVALASSFVIFLFTYLNLNRWHAHLGYATLAWVLGLALLFGVAIYDPSIAAGIARLSFALTATMGLLLIIYLGFNRYDRAILLVPAWALILVWLFGAWLTVTGRLDNDIIQPALGGGLVLIVLLIGFTVMQHAFAGGAYQQGLFSDLERQSLALTGSGDMVWDWDVARDRVVTIPDVSIKLGLSQGAMHGAARNWLPRLHPDDRDRFRATLDVLLEHRRGRLNHEFRIRAEDGHFHWLLIRARPVLGSNGEIIRCVGTIVDVTEQKNSVERLLHDALHDNLTGLPNRQVFLDRLQSVLALAPGGDTLRPTVMVIDIDRYKLVNDSLGVAAGDNILIALTRRLRRLLKPQDTLARLAGDQFGLILVSEHNPAKVADFADAISKAIMVPINFANREIILTASVGLASWVDRQESATGLLSDAELAMYRAKRAGGNRVEPFQPAFRDFGTDRLQLETDLRRAIERKELSMVYQPIARLEDVEVAGFEALMRWEHPKRGNIPPSEFIPIAEASDLIGPLGMFALEQATNDLMSWQHQTGELPIFVSINLSSVQLLNNELYDDVRSVLAKTHCQPSRLKLELTESMVMENPEQARLVLQKLKEAGIGLALDDFGTGYSSLAYLTRFPFDTIKLDKALVRDSSDKKATVLRSVIAMARELDMKVVAEGIESNEDAIELAKMGCNYGQSYLFGPPIPSESVLRLLRDRFPLTKRA
>NC_008380.1|WP_129557778.1|1136839_1137043_-|hypothetical-protein
MTRQVSGVFPELGRNCPRGRLRPEAVIEKRIEQLPANRQQALVGYCQSLSLQNSSDHEIASGHQAIY
>NC_008380.1|WP_011650800.1|1149085_1149970_-|hypothetical-protein
MSEIRLYAGVEDFAADSLWVEATGLMRHPSYASALLVYCEAMTARARKLLPANKLFAQKQRYFVSFLLICLYVQWLESRGAPPSLALLQRSAPGSPRQIADFINGLRDRGLIIATSLETDRRTQILKPSLELLREIAQSPLAALGSSELLAPPLTIRPDDLVMDEDRLARWLALSAERYAVKDDLFGPFPAIVRHSERDAGHLVFCAVIAEALRQRTGSPASGSLTYRGLAERFDVSRQHISNIFGEAAQNGWYRISPGGEVALMPDHTLLQFETWVAGQMVHYRHLALAIRER
>NC_008380.1|WP_028742812.1|1150078_1153693_+|autotransporter-domain-containing-protein
MITQSRFSVHFAVAGSAIATFLFPITAYADSSLNSYVEISTGDELGTDQVDMSTGGWIRTVATGTIDLVPEIDILDGATVRFSAIPGSDLNLKLYRVGTGAELHFGGAADSGTVTLADFFFSGGNQDVFVDSGTLLVPEDGQGALLRASTTTVASGATVDLGSHSDWIASLAGSGTIRLNDADLEIRNFSFDGTIDGANRVTFSRGGSWRGRFADVDEVALSANQTLTIVDAGAAANLSTLDSLRLSSGSTFDLTSYDASLNSLYGAGLIGTTETLAIGSGNYSGGIVAGRGLTISGDFQWSGQSQGALSINVLSGATLTANGGNVFGGSADISLDGALYVNASEAVDALTGSGTVEVANNAILSVGAGDSSTTFDGEISGQGGLTKAGTGTFILSSRQSYTGATTVSAGTLQLMSVNAVPATSPLEVRTGAQLNMAGFNQAFASLTGNGNILLGNANFSIGGVGGSGSFSGVISGSGSVTKSGAGTLGLFGNNSFSGGMTVVGGTLAVSSSASLGDGSTTNTLTLDGGTLQTFGSVASPAARGVVIGSAGATVDTNGNAVTFAGGVSGAGQLTKTGAGTLTLSGNNTRSGDTEIDQGRLAVQNGGALADDARVNIADLAGAGLDVATSETIGSLSGGGLSGGDVSLSNAAILTVGGDDSSSTFGGSITGDGSLIKTGSGLFQLTGNSTYTGDTDVLDGTLSVNGSLTGAFNIGSGARLQGTGSVGTTSLAAGSVLAPGNSIGTLTVTGDLNFDPTSNFEVEIGSTGLSDRVDVTGTAFLNGAKVQTILWDPSVSYVNGQSYTIVSAGTVSGTFGDLEIDSAFLKSFLSYSATDVTLTLRTVLSPGSLFPSAALTYNQQQSAYGLDFLDQTSGSSSLALYNAILYSDRAEARDAFDQLSGEIHASLQSGLFSEANDVRNTVFDRLDEVFQSGGRAWTSAYGNISTLESDGNASSATNARGGALYGADWMIDDISAGVFAGFGQSLFEISDLGSTANVDSVHLGLYAAQRSGNFEIKLGASNSWYDIETRRNIAFPGFSDTQTASYHGNTAQVFSEASYDFRFSQSLIVTPFGRLDYGISHRDSFEEDGGAASLSGESAREDMFASTVGLRAQRQSVIADKTVTTGIDVAWRRALYQGTPLSHLTFENGGSFTVKGVQNSSDSVVAGGSVAFQLASDASLALSYRGEFGDGFNRHSGSARLDVRF
>NC_008380.1|WP_049778359.1|1153764_1153998_+|hypothetical-protein
MHAQWERDHEAFSFVRPAAAVVLPFAFTSTDVIAKGKHRSCAQLQAMMDNALTGGKHAGDGDDKRAKIERKMRKKGC
>NC_008380.1|WP_041936194.1|1154173_1154626_+|hypothetical-protein
MNEEEDCMTIEDIIETLEKTDMPDSRIDAFITCAFLLKQLRPAEPSDFDGPHDYLPSSIKSEHGFLMARPFTHDVNHAIDLCREVRPDAVWHLARGRQAADESLYGAQLREIKESESVLGEAESNHAALALTLAALRAHVRQEDEKRAGA
>NC_008380.1|WP_011650804.1|1154671_1155358_-|helix-turn-helix-transcriptional-regulator
MKEGPDIAQIGALIGDPARANMLAALTGGRALTATELAGVGGITVQTASTHLAKLEAGGLLTQRKQGRHRYFTLADEAVARLIESMMGFAAGRGHLRHQPGPKEPALRKARICYDHLAGDYGVRMLDSLIASGSIDAVGDGLALTEKGEGDLKCIGINVGDLRSSRRPLCRSCLDWSERRAHLAGSLGKALLSSFLDKGWARRTAESRSILFSPEGDRQFLKLFPVDP
>NC_008380.1|WP_011650805.1|1155430_1155760_+|NIPSNAP-family-protein
MITCFIRYEIDPFKKEAFAEYARNWGQAIPRNGADLIGYYGPHEGSATTAYGVYNIESLAAYEAYRARLASDPLGRENYEFARREGFILKEDRIFLKNVSAPHAKLVLP
>NC_008380.1|WP_011650806.1|1155756_1156107_+|antibiotic-biosynthesis-monooxygenase
MIAVIFEVEPYMGERHKYLDLAGELRGELEKIDGFISIERFESLTTRGKLLSLSFFRDEAAVKEWRNLEAHRAAQQAGRGGIFADYRLRIASVIRDYGMFERDEAPADSRKVHDAA
>NC_008380.1|WP_011650807.1|1156285_1157428_+|site-specific-DNA-methyltransferase
MASVFPLADLKASVKSDSRPASWVDTIIKGDCVSALEALPSHSVDIIFADPPYNLQLGGTLHRPDQSLVDAVDDDWDQFASFEAYDAFTRAWLLACRRVLKPTGSIWVIGSYHNIFRVGATLQDLNFWILNDIIWRKTNPMPNFKGRRFQNAHETMIWASPSAKAKGYTFNYDALKAANDDVQMRSDWLFPICNGSERLKGEDGKKAHPTQKPEALLARVIMASTKPGDIVLDPFFGSGTTGAVAKRLGRHFVGIEREQDYIDAASARIAAVEPLGKAELTVMTGKKAEVRVAFNVLVESGLIKPGQVLTDARRRYSAIVRADGTVASGGEAGSIHRLGAKVQGLDACNGWTFWHFEDGQSLRPIDDLRSVIRSDLAKAE
>NC_008380.1|WP_011650808.1|1157594_1157960_-|nuclear-transport-factor-2-family-protein
MAFDPAKQIELFHAAINALDFPAIEAYFAEDATYVSNGVGSLAGRAEIMAAFRRYFDDYPDQTAENSLVETLTPLSGRSVWSVRATHSKTGKPLIREGEETITFNAEGRVTRVEVTDYQEF
>NC_008380.1|WP_011650809.1|1157963_1158578_-|HAD-family-phosphatase
MTTDIRHIVFDIGKVLIHYDPHLPFSRLIPDETERNWFFANICTHDWNIEQDRGRTWAEAEALLIKQHPAREEHIRAFRKYWHEMVPHAYDDSVAIMEGLIAEGRDVTMLTNFASDTFREAQARFPFLTKPRGVTVSGDVGLIKPDIAIYETHTKSFGLDPAATIFIDDAPVNVEGAKAFGWNAVLFSGPEKLRSDLAGYGVKV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_008380_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_008380_3

2416760-2416839

Orphan

Consensus_repeat	Method
AGCAATTCCAGCAAAAGTGTGTAG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_008380_3

>merge|NC_008380|3|2416760-2416839|CRISPRCasFinder
AGCAATTCCAGCAAAAGTGTGTAGCGGTTTTTCGTCCGGAATTGCGCAGAAACAAGAGCAATTCCAGCAAAACTGTGTAG

>NC_008380|3|2|2416760-2416839|CRISPRCasFinder
AGCAATTCCAGCAAAAGTGTGTAG	CGGTTTTTCGTCCGGAATTGCGCAGAAACAAG
AGCAATTCCAGCAAAACTGTGTAG

Protein	Signature genes	Signature genes Name	Protein_function
NC_008380.1\|WP_011651875.1\|2415748_2416711_-\|AEC-family-transporter	unknown	unknown	gnl\|CDD\|223751
NC_008380.1\|WP_003539403.1\|2406958_2407201_+\|RNA-chaperone-Hfq	unknown	unknown	gnl\|CDD\|179001
NC_008380.1\|WP_011651873.1\|2414018_2414531_+\|DUF934-domain-containing-protein	unknown	unknown	gnl\|CDD\|226272
NC_008380.1\|WP_011651878.1\|2419287_2420817_-\|aldehyde-dehydrogenase-(NADP(+))	unknown	unknown	gnl\|CDD\|143447
NC_008380.1\|WP_028742013.1\|2426691_2427462_-\|glucose-1-dehydrogenase	unknown	unknown	gnl\|CDD\|235500
NC_008380.1\|WP_011651881.1\|2422736_2423783_-\|LLM-class-flavin-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|274817
NC_008380.1\|WP_041936569.1\|2410575_2412012_+\|uroporphyrinogen-III-C-methyltransferase	unknown	unknown	gnl\|CDD\|381169
NC_008380.1\|WP_011651876.1\|2416935_2417871_-\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293806
NC_008380.1\|WP_011651882.1\|2424170_2425208_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223669
NC_008380.1\|WP_011651883.1\|2425785_2426580_-\|potassium-channel-family-protein	unknown	unknown	gnl\|CDD\|369572
NC_008380.1\|WP_011651868.1\|2408829_2409669_-\|nucleoside-triphosphate-pyrophosphohydrolase	unknown	unknown	gnl\|CDD\|236569
NC_008380.1\|WP_011651869.1\|2409719_2410307_-\|nucleoside-deaminase	unknown	unknown	gnl\|CDD\|223663
NC_008380.1\|WP_011651885.1\|2427550_2428300_-\|cytochrome-c-biogenesis-protein-CcdA	unknown	unknown	gnl\|CDD\|223856
NC_008380.1\|WP_028742016.1\|2421358_2422444_+\|nitronate-monooxygenase	unknown	unknown	gnl\|CDD\|240081
NC_008380.1\|WP_011651871.1\|2412014_2412329_+\|DUF2849-domain-containing-protein	unknown	unknown	gnl\|CDD\|371340
NC_008380.1\|WP_011651877.1\|2418141_2418933_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|212491
NC_008380.1\|WP_011651867.1\|2407278_2408604_+\|GTPase-HflX	unknown	unknown	gnl\|CDD\|274455
NC_008380.1\|WP_011651886.1\|2428804_2429110_-\|DUF1476-family-protein	unknown	unknown	gnl\|CDD\|311347
NC_008380.1\|WP_011651872.1\|2412337_2414008_+\|nitrite/sulfite-reductase	unknown	unknown	gnl\|CDD\|223233
NC_008380.1\|WP_011651874.1\|2414569_2415781_+\|UbiH/UbiF-family-hydroxylase	unknown	unknown	gnl\|CDD\|181001

Protein	Function_ID	Function_description	E-value
NC_008380.1\|WP_011651875.1\|2415748_2416711_-\|AEC-family-transporter	gnl\|CDD\|223751	COG0679, COG0679, Predicted permeases [General function prediction only].	3.43988e-56
NC_008380.1\|WP_003539403.1\|2406958_2407201_+\|RNA-chaperone-Hfq	gnl\|CDD\|179001	PRK00395, hfq, RNA-binding protein Hfq; Provisional.	9.6229e-50
NC_008380.1\|WP_011651873.1\|2414018_2414531_+\|DUF934-domain-containing-protein	gnl\|CDD\|226272	COG3749, COG3749, Uncharacterized protein conserved in bacteria [Function unknown].	4.87264e-62
NC_008380.1\|WP_011651878.1\|2419287_2420817_-\|aldehyde-dehydrogenase-(NADP(+))	gnl\|CDD\|143447	cd07129, ALDH_KGSADH, Alpha-Ketoglutaric Semialdehyde Dehydrogenase. Alpha-Ketoglutaric Semialdehyde (KGSA) Dehydrogenase (KGSADH, EC 1.2.1.26) catalyzes the NAD(P)+-dependent conversion of KGSA to alpha-ketoglutarate. This CD contains such sequences as those seen in Azospirillum brasilense, KGSADH-II (D-glucarate/D-galactarate-inducible) and KGSADH-III (hydroxy-L-proline-inducible). Both show similar high substrate specificity for KGSA and different coenzyme specificity; KGSADH-II is NAD+-dependent and KGSADH-III is NADP+-dependent. Also included in this CD is the NADP(+)-dependent aldehyde dehydrogenase from Vibrio harveyi which catalyzes the oxidation of long-chain aliphatic aldehydes to acids.	0
NC_008380.1\|WP_028742013.1\|2426691_2427462_-\|glucose-1-dehydrogenase	gnl\|CDD\|235500	PRK05557, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Validated.	8.3107e-84
NC_008380.1\|WP_011651881.1\|2422736_2423783_-\|LLM-class-flavin-dependent-oxidoreductase	gnl\|CDD\|274817	TIGR03858, LLM_2I7G, probable oxidoreductase, LLM family. This model describes a highly conserved, somewhat broadly distributed family withing the luciferase-like monooxygenase (LLM) superfamily. Most members are from species incapable of synthesizing coenzyme F420, bound by some members of the LLM superfamily. Members, therefore, are more likely to use FMN as a cofactor.	0
NC_008380.1\|WP_041936569.1\|2410575_2412012_+\|uroporphyrinogen-III-C-methyltransferase	gnl\|CDD\|381169	cd11642, SUMT, Uroporphyrin-III C-methyltransferase (also known as S-Adenosyl-L-methionine:uroporphyrinogen III methyltransferase, SUMT). SUMT is an enzyme of the cobalamin and siroheme biosynthetic pathway. It catalyzes the first of three steps leading to the formation of siroheme from uroporphyrinogen III; it transfers two methyl groups from S-adenosyl-L-methionine to the C-2 and C-7 atoms of uroporphyrinogen III to yield precorrin-2 via the intermediate formation of precorrin-1. Precorrin-2 is also a precursor for the biosynthesis of vitamin B12, coenzyme F430, siroheme and heme d1. This family includes proteins in which the SUMT domain is fused to other functional domains, such as to a uroporphyrinogen-III synthase domain to form bifunctional uroporphyrinogen-III methylase/uroporphyrinogen-III synthase, or to a dual function dehydrogenase-chelatase domain, as in the case of the multifunctional S-adenosyl-L-methionine (SAM)-dependent bismethyltransferase/dehydrogenase/ferrochelatase CysG, which catalyzes all three steps that transform uroporphyrinogen III into siroheme.	1.91594e-107
NC_008380.1\|WP_011651876.1\|2416935_2417871_-\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293806	cd07720, OPHC2-like_MBL-fold, Pseudomonas pseudoalcaligenes organophosphorus hydrolase C2, and related proteins; MBL-fold metallo hydrolase domain. Pseudomonas pseudoalcaligenes OPHC2 is a thermostable organophosphorus hydrolase which a broad substrate activity spectrum: it hydrolyzes various phosphotriesters, esters, and a lactone. This subgroup also includes Pseudomonas oleovorans PoOPH which exhibits high lactonase and esterase activities, and latent PTE activity. However, double mutations His250Ile/Ile263Trp switch PoOPH into an efficient and thermostable PTE. Members of this subgroup belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions.	4.29662e-86
NC_008380.1\|WP_011651882.1\|2424170_2425208_-\|alpha/beta-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	6.58891e-23
NC_008380.1\|WP_011651883.1\|2425785_2426580_-\|potassium-channel-family-protein	gnl\|CDD\|369572	pfam07885, Ion_trans_2, Ion channel. This family includes the two membrane helix type ion channels found in bacteria.	4.77015e-09
NC_008380.1\|WP_011651868.1\|2408829_2409669_-\|nucleoside-triphosphate-pyrophosphohydrolase	gnl\|CDD\|236569	PRK09562, mazG, nucleoside triphosphate pyrophosphohydrolase; Reviewed.	9.49924e-150
NC_008380.1\|WP_011651869.1\|2409719_2410307_-\|nucleoside-deaminase	gnl\|CDD\|223663	COG0590, CumB, Cytosine/adenosine deaminases [Nucleotide transport and metabolism / Translation, ribosomal structure and biogenesis].	3.6915e-36
NC_008380.1\|WP_011651885.1\|2427550_2428300_-\|cytochrome-c-biogenesis-protein-CcdA	gnl\|CDD\|223856	COG0785, CcdA, Cytochrome c biogenesis protein [Posttranslational modification, protein turnover, chaperones].	1.77805e-47
NC_008380.1\|WP_028742016.1\|2421358_2422444_+\|nitronate-monooxygenase	gnl\|CDD\|240081	cd04730, NPD_like, 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites. NDP is a member of the NAD(P)H-dependent flavin oxidoreductase family that reduce a range of alternative electron acceptors. Most use FAD/FMN as a cofactor and NAD(P)H as electron donor. Some contain 4Fe-4S cluster to transfer electron from FAD to FMN.	1.66538e-81
NC_008380.1\|WP_011651871.1\|2412014_2412329_+\|DUF2849-domain-containing-protein	gnl\|CDD\|371340	pfam11011, DUF2849, Protein of unknown function (DUF2849). This bacterial family of proteins has no known function.	4.18174e-31
NC_008380.1\|WP_011651877.1\|2418141_2418933_-\|SDR-family-oxidoreductase	gnl\|CDD\|212491	cd05233, SDR_c, classical (c) SDRs. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human prostaglandin dehydrogenase (PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, PGDH numbering) and/or an Asn (Asn-107, PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	3.25792e-62
NC_008380.1\|WP_011651867.1\|2407278_2408604_+\|GTPase-HflX	gnl\|CDD\|274455	TIGR03156, GTP_HflX, GTP-binding protein HflX. This protein family is one of a number of homologous small, well-conserved GTP-binding proteins with pleiotropic effects. Bacterial members are designated HflX, following the naming convention in Escherichia coli where HflX is encoded immediately downstream of the RNA chaperone Hfq, and immediately upstream of HflKC, a membrane-associated protease pair with an important housekeeping function. Over large numbers of other bacterial genomes, the pairing with hfq is more significant than with hflK and hlfC. The gene from Homo sapiens in this family has been named PGPL (pseudoautosomal GTP-binding protein-like). [Unknown function, General].	6.6962e-174
NC_008380.1\|WP_011651886.1\|2428804_2429110_-\|DUF1476-family-protein	gnl\|CDD\|311347	pfam07345, DUF1476, Domain of unknown function (DUF1476). This family consists of several hypothetical bacterial proteins of around 100 residues in length. Members of this family are found in Bradyrhizobium, Rhizobium, Brucella and Caulobacter species. The function of this family is unknown.	1.00234e-18
NC_008380.1\|WP_011651872.1\|2412337_2414008_+\|nitrite/sulfite-reductase	gnl\|CDD\|223233	COG0155, CysI, Sulfite reductase, beta subunit (hemoprotein) [Inorganic ion transport and metabolism].	0
NC_008380.1\|WP_011651874.1\|2414569_2415781_+\|UbiH/UbiF-family-hydroxylase	gnl\|CDD\|181001	PRK07494, PRK07494, UbiH/UbiF family hydroxylase.	0

>NC_008380.1|WP_011651875.1|2415748_2416711_-|AEC-family-transporter
MADIVSLLLPFFGLILIGYIAAKATKQPAEALGWLNTFIIYAALPALFFKLVSRTPIEELTRVDFIVTDIAATYAVFILLFVIGRLLRGNSLADCTIQSFAGAYGNIGYMGPGLALLALGEGAAVPVALIICFENALHFIMAPALMAAAGDDKRSARRLIADIVRKVALHPFILSMTLGFAVAALHIDPPLAFQRLVDYLAQAAAPCALFAMGVTLALRPLKRIPAEISYIVPAKLILHPIAVFVALTAVGGFEPVWIQAAVLLASLPTATNVFVIGQQYGVWQERASATILITTVFSVVTVSLWLIVIRSGLLPLQLFP
>NC_008380.1|WP_011651874.1|2414569_2415781_+|UbiH/UbiF-family-hydroxylase
MKTFEVAVIGGGLAGMIAAIALARGGRSVALVAPLAPKEDRRTTALMDQSIRFLDRLALWEKLRPAAAPLTSMRIVDGTDRLLRAPTTTFRAAEVGLDAFGYNFPNKALTGILEEAAAGEGNITRSTDMAESIEISAEAVSITLAGGETLSADFAVGADGRGSKLRETSGIAVRNWSYPQAAMVLNFAHSLPHQNISTEFHTKHGPFTQVPLPGSRSSLVWVQDPADAASRMELPLAELGALVEARMQSMLGKVDVEEGVQVWPLSGMMAHRFGKGRIALIGEAAHVFPPIGAQGLNLSLRDIMALADILCDRAELPVPADAGESFDRRRRADIMTRTASVDLLNRSLLSDFLPVQMLRAAGLHILSAIPPLRNIVMREGIEPGRGFRDIPEALREKLKRKKA
>NC_008380.1|WP_011651873.1|2414018_2414531_+|DUF934-domain-containing-protein
MTKIWRETGFVENDPWVIETDEVKATEEQKPLLGLDELIAKADESNDVGLGVLIKPADDVRRLEPYLYRLEIVAVAFPAFNDGRAFSHASLLRQRLGYTNELRAVGDVLIDQVPLMLRVGIDSFSVTNATALKRLSENRLPAIPHHYQPAVRDAEAGKGYSWRRQAKPAA
>NC_008380.1|WP_011651872.1|2412337_2414008_+|nitrite/sulfite-reductase
MYRYDEFDHAFVTERVEQFRDQVERRLSGELAEDAFKPLRLMNGVYLQLHAYMLRIAIPYGTLSSRQLRMLAHIARTYDRGYGHFTTRQNLQFNWPKLCDIPDALADLASVEMHALQTSGNCIRNVTADHFAGAAADEIADPRPYAEILRQWSSVHPEFSFLPRKFKIAVTGAERDRAAIQVHDIGLHVKKNDKGEIGFAVYVGGGQGRTPMIAKLIRDFLPEEDLLSYTTAIVRVYNLHGRRDNKYKARIKILVHETGTEELTRQVEAEFAALKDTELKLPEKDVQSIAAYFAPPDLPQRAEGWENLARWKKADSGFSRWVQQNVQPHKNPDYGMVTISLKPIGGIPGDASDAQMDAIADLAEEYAFDEIRVSHEQNLILPHVALADLEAVYRGLVAINLAEANAGLITDIIACPGLDYCALANARSIPLAQEISRRFGNAERQAEIGELKIKISGCINACGHHHVGHIGLLGVEKKGAELYQITLGGSGDEHTSIGEIIGRGFEPDRVTDAIETIVDTYLGLRLDHSENFLAAYRRVGPQPFKTALYGSAAEAA
>NC_008380.1|WP_011651871.1|2412014_2412329_+|DUF2849-domain-containing-protein
MGDKVLTANRLTDGIAVWLDANGKWSTSLQEALVARHAEAVAALEAIGKKSYADNEVVDVAVVDVQETNGILWPLRLRERIRAQGPTMEYAPGYAPADPEFIAV
>NC_008380.1|WP_041936569.1|2410575_2412012_+|uroporphyrinogen-III-C-methyltransferase
MPPRTEQLSVFPAFFRVEGLKTAVFGNGDEAFAKVRLLLNTKARIIAYADRPEADYHAFLIANRIETVRAAFSAEQVEGSALVFAATGNETDDRSIVDAARATRIPANAVDQPDYCDFFTPALVNRAPVAVAIGTEGAGPVLAQMIRAQIDQLLSPSLGRLAGLATSYRKAVEQLIPRGVSRRVFWRRFFSGAVADAVANGNLPQARHAADRLLHAMDKVAGHVWLVGAGPGAEDLLTLRAQRVMMEADVIVYDALVPQAIVDMGRRDAERLSVGKRKGCHSKSQEEINDLLVDLGRQGKRVVRLKSGDPLVYGRAGEEMAALRAADVTYEVVPGITSAFAAAADFELPLTLRGVASSLVFTTGHDLTGDVLPDWASLAVSGATIAVYMGRTVAASVAERLMQAGIPSETTVAVIENASRADRRLLHGTLADLPDLQRRDELTGPVMVIIGDAVAGANFELSEPLVRANARLEELARS
>NC_008380.1|WP_011651869.1|2409719_2410307_-|nucleoside-deaminase
MPDKTIASRLLSVLEEDILPLTERGVSLGNKVFGAAILRKSDLSLVVAETNNELENPLWHGEVHTLKRFYELGDKPPTKDLIFLSTHEPCTMCMSAITWAGFDNFYYFFSHEDSRDAFAIPHDLKILKEVFGLEPGGYRRQNAFWNSFAIADLVETEEALLKTALKTQTARIKARYDALSTSYQSSKSANDIPLN
>NC_008380.1|WP_011651868.1|2408829_2409669_-|nucleoside-triphosphate-pyrophosphohydrolase
MQPSKDISRLIEIMAALRHPETGCPWDIVQNFETIKPYTIEEAYEVSDAIERGDMDDLCDELGDLLLQVVFHARMAEEAGEFSFGDVVNAITAKMIRRHPHVFARSAADTPDAVKIQWDEIKQAEKRERAERRSRRGLTEDFNSGFLGSVQRSFPALTEALKLQERAAKVGFDWSAPEPILDKIEEEIGELRAALREGDQAKVSDELGDLIFAVVNIGRHVKADPEQAVRGTNTKFRRRFSHIERVLEAEGETLEAASLERMEEIWQAAKAIERAIVAE
>NC_008380.1|WP_011651867.1|2407278_2408604_+|GTPase-HflX
MRATVVVPVLKSRSRGGQSESASTRTPESRLEEATGLAQAIDLDVVNGSIVPVNDPRPATLLGTGKIEEIKALLDERDSGLVIVDHPLTPVQQRNLEKEWNAKVIDRTGLILEIFGRRASTKEGTLQVDLAHLNYQKGRLVRSWTHLERQRGGGGFMGGPGETQIEADRRMLQDRIIKLERELEQVVRTRQLHRAKRRKVPHPIVALVGYTNAGKSTLFNRITGAGVLAEDMLFATLDPTLRRMKLPHGRTVILSDTVGFISDLPTHLVAAFRATLEEVLEADLILHVRDMSDADNQAQSSDVMRILNDLGIDEAEAEKRLIEVWNKIDRLEPEVHDAMVQKSAGASNVVAVSAVSGEGVDTLMEEISRRLSGVMTVATIRLPVDKLALLPWLYDHAIVDGREDNEDGTITLDLRLSETEATELERRIGNGPKSSKEDWER
>NC_008380.1|WP_003539403.1|2406958_2407201_+|RNA-chaperone-Hfq
MAERSQNLQDLFLNTVRKQKISLTIFLINGVKLTGVVTSFDNFCVLLRRDGHSQLVYKHAISTIMPGQPMQMFESEEAAS
>NC_008380.1|WP_011651876.1|2416935_2417871_-|MBL-fold-metallo-hydrolase
MNLETKMSLENTAHTGRPRLDELVPSRYAVRIGEIEVLVVSDGVLPLPTAMLGHNIDPAVRATWLKDMFLPADAFDWALNVVVVRSGDQTILLDAGLGIDPDLHLPRAGQLIKRLEAAGIDLASVTDVVLTHMHMDHIGGLLVDGVKDQLRPDLRIHVAAAEVKFWEAPDFSRVSMPPGFPDALRATAKRFAEEYRSHFRLFDDEYEVAPGVVVHRTGGHTPGHSVIRLASGGDRLMFAGDAVFAVGFEHPDWYNGFEHDPEEAARVRLRLLRELADTGEQLVATHLPFPSVGRVATDGDAFRWVAAFWDY
>NC_008380.1|WP_011651877.1|2418141_2418933_-|SDR-family-oxidoreductase
MQIDLTGKTALVTGSTEGIGYAIVRQFARAGADVVVNGRSEEKTAKAADRLKGEGAKGSVTAVAADLATAGGCDALVAQVPHVDILINNAGIFQPLDFFDADDEVWDRHWQVNVMSAVRLSRAYLPGMQKLDWGRVIFIASESGFNIPVEMIHYGVSKTADIAVARGLAKRMVGTGVTVNSVLPGPTLSEGVEAMLAEERAKTGKPIEEVAADFVKKHRAGSIIQRAASVEEIANLVTYLASPLASATTGASMRVDGGLIDTL
>NC_008380.1|WP_011651878.1|2419287_2420817_-|aldehyde-dehydrogenase-(NADP(+))
MTLSGDLIIGGANVRGAAAAFSAINPANGNPMEPSFAGATKEQVEEATSLAWDAFPVYKETSLDDRARFLEAIAEGIVALGDDLVMRAIDETGLPRGRIEGERARTVGQLRLFAKEVRDGRFQELRFDPADTERRPVAKPDLRLRNVALGPVAVFGASNFPLAFSVAGGDTASALAAGCPVVVKAHSAHPGTSELVGRAVADAVAACGLPRGTFGLLFDAGFEVGQTLVADHRIRAVGFTGSRRGGTALMKIASERKQPIPVYAEMSSINPVILYPNALRSRGAEIGKSFASSLILGAGQFCTNPGLIIAVEGAGLDAFIGSAAAALSESQAQTMLTGGIFDAYCNGVARLSSSPSVSQVAAGKDGTPNQAAAALFETTAAAFLANPELQEEVFGASGLIVRCRDDEELRTVVGSLEGQLTIALHVDAGDIGAASPMISQLELLAGRLLVNGFGTGVEVSPAMVHGGPYPATSDGRSTSVGTLAIYRFLRPVSYQDFPIDLLPEPLKLF
>NC_008380.1|WP_028742016.1|2421358_2422444_+|nitronate-monooxygenase
MTRWPDRRILDLFGIELPIIQAPMAGATTVDMVVATAKAGGLGSLPSALLNVEGLRKALGEIRAATKAPVNVNFFAHLSPADDPSAQARWRALLAPYYAEADLDPATIVAGGVRAPFDPAFCDVVEDLRPEVVSFHFGLPARELVQRVKATGAKVVSSATTVAEAVWLEANGVDAVIAMGFEAGGHRGNFLTDNMATQVGTMALVPQVVDAVRVPVIAAGGIADGRGVAAALMLGASAVQIGTAYLFCPEARIPDVHAEALAASRDDGTAIANVFTGRPARSVVNRLVRELGPISEGVPAFPTAAAALAPIRAKAEADSRDDFTNLWSGQAAKLALRTGAETLTRELYLTALDVLDRRTPF
>NC_008380.1|WP_011651881.1|2422736_2423783_-|LLM-class-flavin-dependent-oxidoreductase
MEIGIDSFAMLLNDPATGRLQSAIDRMESVLAEVELADQVGLDVFGMGEHHRENALDSAPAVILAAAAARTKSIRLTSAVAVLSAADPVRLFQEFATLDLISRGRAEIVVGRGSSVEAYPLFGFDLRDYDALFAEKLDLLLKIREKPRIEWQGRFRPSLSGEGVFPRPHQPTLPIWLGVGGTPESFIRAGTLGLPLMVAIIGGSFERFLPLVELYRRAWLAADHPSEEQRVGVHALGFVGETDKAAREAFFPGWFQMFTDAGRERGWPPPTQAQFDFMCGPNGAFLVGSPQTVAAKIEHINRTLGGVSRLTFQMSTAALETEAMRRSIELLGTHVAPIVRAHRLGRSR
>NC_008380.1|WP_011651882.1|2424170_2425208_-|alpha/beta-hydrolase
MSNLRNGSLTRRSFGGIALGLTAAGILAGHTAGAGQGKKVARKNGHGLVADGQIDAGDLSVGYAELGPSDGSPVLLFHGWPYDINAFAEVAPLLADQGHRVIVPHLRGYGSTKFLADDTMRNGQQSALAVDAIKLMDVLRIERATVAGFDWGARTAGIVAALWPERCKGLVSVSGYLIGNQTAGKVPLPPRAELQWWYQFYFATERGRDGYEKYTNDFARLIWQLASPQWKFDDKTFERSAAAFANPDHVAIVVHNYRWRLGLTEGEARFDEFETKLASAPEIHVPAITMEGDANGAPHPDPKAYAGKFKAKYEHRLIKGGIGHNLPQESPEAFAQAVIDVDAWA
>NC_008380.1|WP_011651883.1|2425785_2426580_-|potassium-channel-family-protein
MKTFESDDGSLQNSLRQVLRRLDRADGRQAVAFRLVFAAIDVAILAFFLLGPYLRSGPSYLIIDYAIAVWIAAEMVGRAVAAYSVREWLRRPMTWIDFVVLATLLLPDLLFNFAFLRIMRLWAIGTSPLLKDLLRKAGYLYLLDVVRAVINLLVFLFMATGFVYTSFFYNREGSEGFVDALYFTVATVTTTGFGDITLPGTLGKLTSVVTMIVGISLFVRLAQAVVRPHKVTYSCHRCGLQRHDADAVHCKACGEVLNIPDEGS
>NC_008380.1|WP_028742013.1|2426691_2427462_-|glucose-1-dehydrogenase
MQKNAPNFSLEGKVTLVTGASRGIGRACALACAAAGSDIVLGVRDVAASASLAAELEGAGRKVLPVELDIPNKAHIAQAVDAALATFGRIDILVNNVGVAPGNLAELVEEKDLDEILDVNIKGTFLMTQAVGRHMIKRNGGRIINISSQAGTVALRGEAIYCMSKAAINHLTRCLAAEWARYDVTVNTVSPTFIHTDGTAPFLSDADNREATLGHIPLGRIGETDDVVGAVVFLASPAASLITGANLLVDGGWSVA
>NC_008380.1|WP_011651885.1|2427550_2428300_-|cytochrome-c-biogenesis-protein-CcdA
MSIADISLWSALIAGALSFLSPCVLPLVPPYLCYMAGISVEQFRGGGAVAVAPDIRRGVFFSALLFTLGFATVFVALGAGASSIGMALRQHLDLLSKIGGLIIIVMGLNFLGLFRIGVLAREARFQGSGKPATLTGAYIMGLAFAFGWTPCIGPVLGAILGVAASRETVGSGAGLLAIYSLGLAIPFWIAAGFSGAFMRFLSRFRRHLGTVEKVMGLFLVLTGLAFLFGWVSNVAIWFQQTFPILMQIG
>NC_008380.1|WP_011651886.1|2428804_2429110_-|DUF1476-family-protein
MADLGDRKKAMEDQYFQDAERSIKLKSRMDRLLAQWIAGLIGRDDVAGYGAEITDARFKGGGDAGVLSKAISDLQAAGQNVSEQDVSAKMSEFLVEAAGQP

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_008380_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_008380_4

2690763-2690905

Orphan

Consensus_repeat	Method
CCTATTCCAGCGATTACACCAACGACAGCGACGGCTTCGCCCCAAGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_008380_4

>merge|NC_008380|4|2690763-2690905|CRISPRCasFinder
CCTATTCCAGCGATTACACCAACGACAGCGACGGCTTCGCCCCAAGCCCGATGTCGAAGCCGGCTCCGGTCCACTATAGCAGCCGCAAGGCCCCGGCCTATTCCAGCGACTACACCAACGACAGCGACGGCTTCGCCCCAAGC

>NC_008380|4|3|2690763-2690905|CRISPRCasFinder
CCTATTCCAGCGATTACACCAACGACAGCGACGGCTTCGCCCCAAGC	CCGATGTCGAAGCCGGCTCCGGTCCACTATAGCAGCCGCAAGGCCCCGG
CCTATTCCAGCGACTACACCAACGACAGCGACGGCTTCGCCCCAAGC

Protein	Signature genes	Signature genes Name	Protein_function
NC_008380.1\|WP_011652101.1\|2684685_2685135_+\|ribose-5-phosphate-isomerase-B	unknown	unknown	gnl\|CDD\|376799
NC_008380.1\|WP_011652118.1\|2699946_2700408_-\|hypothetical-protein	unknown	unknown	unknown
NC_008380.1\|WP_011652106.1\|2689273_2689768_+\|peptide-deformylase	unknown	unknown	gnl\|CDD\|237227
NC_008380.1\|WP_011652112.1\|2694061_2696083_+\|acetyl/propionyl/methylcrotonyl-CoA-carboxylase-subunit-alpha	unknown	unknown	gnl\|CDD\|227111
NC_008380.1\|WP_011652100.1\|2683321_2684521_-\|acyltransferase	unknown	unknown	gnl\|CDD\|224748
NC_008380.1\|WP_011652103.1\|2686144_2687134_+\|DUF1624-domain-containing-protein	unknown	unknown	gnl\|CDD\|226034
NC_008380.1\|WP_011652099.1\|2682882_2683320_+\|VOC-family-protein	unknown	unknown	gnl\|CDD\|319941
NC_008380.1\|WP_011652111.1\|2693281_2693986_+\|hypothetical-protein	unknown	unknown	unknown
NC_008380.1\|WP_028741290.1\|2691149_2691869_-\|lipoyl(octanoyl)-transferase-LipB	unknown	unknown	gnl\|CDD\|237680
NC_008380.1\|WP_011652104.1\|2687158_2687551_-\|MerR-family-DNA-binding-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133403
NC_008380.1\|WP_011652114.1\|2696786_2697254_+\|YaiI/YqxD-family-protein	unknown	unknown	gnl\|CDD\|178882
NC_008380.1\|WP_011652102.1\|2685380_2686145_+\|DUF599-domain-containing-protein	unknown	unknown	gnl\|CDD\|226342
NC_008380.1\|WP_011652117.1\|2698310_2699843_-\|acyl-CoA-carboxylase-subunit-beta	unknown	unknown	gnl\|CDD\|227136
NC_008380.1\|WP_011652105.1\|2687615_2689031_-\|magnesium-transporter	unknown	unknown	gnl\|CDD\|225148
NC_008380.1\|WP_086935548.1\|2696188_2696776_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|225064
NC_008380.1\|WP_011652116.1\|2697778_2698171_-\|DoxX-family-protein	unknown	unknown	gnl\|CDD\|225168
NC_008380.1\|WP_011652115.1\|2697422_2697737_+\|quaternary-ammonium-compound-efflux-SMR-transporter-SugE	unknown	unknown	gnl\|CDD\|171110
NC_008380.1\|WP_011652107.1\|2689852_2690371_+\|BON-domain-containing-protein	unknown	unknown	gnl\|CDD\|335963
NC_008380.1\|WP_011652110.1\|2692233_2693217_+\|DMT-family-transporter	unknown	unknown	gnl\|CDD\|223769
NC_008380.1\|WP_011652098.1\|2681125_2682529_-\|L-serine-ammonia-lyase	unknown	unknown	gnl\|CDD\|273233

Protein	Function_ID	Function_description	E-value
NC_008380.1\|WP_011652101.1\|2684685_2685135_+\|ribose-5-phosphate-isomerase-B	gnl\|CDD\|376799	pfam02502, LacAB_rpiB, Ribose/Galactose Isomerase. This family of proteins contains the sugar isomerase enzymes ribose 5-phosphate isomerase B (rpiB), galactose isomerase subunit A (LacA) and galactose isomerase subunit B (LacB).	1.39763e-65
NC_008380.1\|WP_011652106.1\|2689273_2689768_+\|peptide-deformylase	gnl\|CDD\|237227	PRK12846, PRK12846, peptide deformylase; Reviewed.	6.2893e-87
NC_008380.1\|WP_011652112.1\|2694061_2696083_+\|acetyl/propionyl/methylcrotonyl-CoA-carboxylase-subunit-alpha	gnl\|CDD\|227111	COG4770, COG4770, Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism].	0
NC_008380.1\|WP_011652100.1\|2683321_2684521_-\|acyltransferase	gnl\|CDD\|224748	COG1835, COG1835, Predicted acyltransferases [Lipid metabolism].	1.82422e-35
NC_008380.1\|WP_011652103.1\|2686144_2687134_+\|DUF1624-domain-containing-protein	gnl\|CDD\|226034	COG3503, COG3503, Predicted membrane protein [Function unknown].	8.23135e-81
NC_008380.1\|WP_011652099.1\|2682882_2683320_+\|VOC-family-protein	gnl\|CDD\|319941	cd08353, VOC_like, uncharacterized subfamily of vicinal oxygen chelate (VOC) family. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	2.26351e-88
NC_008380.1\|WP_028741290.1\|2691149_2691869_-\|lipoyl(octanoyl)-transferase-LipB	gnl\|CDD\|237680	PRK14341, PRK14341, lipoyl(octanoyl) transferase LipB.	2.04634e-151
NC_008380.1\|WP_011652104.1\|2687158_2687551_-\|MerR-family-DNA-binding-transcriptional-regulator	gnl\|CDD\|133403	cd04776, HTH_GnyR, Helix-Turn-Helix DNA binding domain of the regulatory protein GnyR. Putative helix-turn-helix (HTH) regulatory protein, GnyR, and other related proteins. GnyR belongs to the gnyRDBHAL cluster, which is involved in acyclic isoprenoid degradation in Pseudomonas aeruginosa. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules.	3.50097e-45
NC_008380.1\|WP_011652114.1\|2696786_2697254_+\|YaiI/YqxD-family-protein	gnl\|CDD\|178882	PRK00124, PRK00124, YaiI/YqxD family protein.	3.08159e-77
NC_008380.1\|WP_011652102.1\|2685380_2686145_+\|DUF599-domain-containing-protein	gnl\|CDD\|226342	COG3821, COG3821, Predicted membrane protein [Function unknown].	2.49978e-105
NC_008380.1\|WP_011652117.1\|2698310_2699843_-\|acyl-CoA-carboxylase-subunit-beta	gnl\|CDD\|227136	COG4799, COG4799, Acetyl-CoA carboxylase, carboxyltransferase component (subunits alpha and beta) [Lipid metabolism].	0
NC_008380.1\|WP_011652105.1\|2687615_2689031_-\|magnesium-transporter	gnl\|CDD\|225148	COG2239, MgtE, Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism].	2.51054e-169
NC_008380.1\|WP_086935548.1\|2696188_2696776_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|225064	COG2153, ElaA, Predicted acyltransferase [General function prediction only].	1.48863e-59
NC_008380.1\|WP_011652116.1\|2697778_2698171_-\|DoxX-family-protein	gnl\|CDD\|225168	COG2259, COG2259, Predicted membrane protein [Function unknown].	8.3163e-18
NC_008380.1\|WP_011652115.1\|2697422_2697737_+\|quaternary-ammonium-compound-efflux-SMR-transporter-SugE	gnl\|CDD\|171110	PRK11431, PRK11431, quaternary ammonium compound efflux SMR transporter SugE.	1.04784e-31
NC_008380.1\|WP_011652107.1\|2689852_2690371_+\|BON-domain-containing-protein	gnl\|CDD\|335963	pfam04972, BON, BON domain. This domain is found in a family of osmotic shock protection proteins. It is also found in some Secretins and a group of potential haemolysins. Its likely function is attachment to phospholipid membranes.	1.05377e-06
NC_008380.1\|WP_011652110.1\|2692233_2693217_+\|DMT-family-transporter	gnl\|CDD\|223769	COG0697, RhaT, Permeases of the drug/metabolite transporter (DMT) superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / General function prediction only].	2.69351e-10
NC_008380.1\|WP_011652098.1\|2681125_2682529_-\|L-serine-ammonia-lyase	gnl\|CDD\|273233	TIGR00720, hypothetical_protein_NEICINOT_00681, L-serine dehydratase, iron-sulfur-dependent, single chain form. This enzyme is also called serine deaminase and L-serine dehydratase 1. L-serine ammonia-lyase converts serine into pyruvate in the gluconeogenesis pathway from serine. This enzyme is comprised of a single chain in Escherichia coli, Mycobacterium tuberculosis, and several other species, but has separate alpha and beta chains in Bacillus subtilis and related species. The beta and alpha chains are homologous to the N-terminal and C-terminal regions, respectively, but are rather deeply branched in a UPGMA tree. This enzyme requires iron and dithiothreitol for activation in vitro, and is a predicted 4Fe-4S protein. Escherichia coli Pseudomonas aeruginosa have two copies of this protein. [Energy metabolism, Amino acids and amines, Energy metabolism, Glycolysis/gluconeogenesis].	0

>NC_008380.1|WP_011652107.1|2689852_2690371_+|BON-domain-containing-protein
MARIGDKTQFSREKPELSREGDYRDLEERNLDEGWPYADGSGAGTGGPDNRPYGETAANFDSDPNKGFRVDGTDEDGNENRLKDLLRADTIDRDESDDLEARVNDNLENIPEVDIDSVEVHADGHVVTLEGSVETIGIARKVELGALSVDGVHHVRNKLQLTGVDAHIPNED
>NC_008380.1|WP_011652106.1|2689273_2689768_+|peptide-deformylase
MPIRPILRYPHPGLKTVCAPVTVFDSSLTALAEDLLATMRAAPGVGITAAHIGVFSRVTVLELDKADGVRLYFNPHITWFSKETMDHTEGSVSMPGATDEVTRPRAIRFRYQDAEGAVHEDGAEDFLAICIQHEVDQLDGIFWLQRLSRLKRDRLVKKWEKAQG
>NC_008380.1|WP_011652105.1|2687615_2689031_-|magnesium-transporter
MTTTDGEDRIRRRPDDEEADIYDEDGNVRGDFLALVGAAIADRDTLFLRQNVARLHESEIGDLLEAIQPDQRLALVRLLGDDFDMTALTEVDEAIRREIVDQMPNAQIAAAIGELDSDDAVYILEDLDKEDREEILAQLPFTERVRLRRALDYPESSAGRRMQTEFVAVPPFWTVGQTIDYMRDEEDLPYSFSQIFVIDPTFKLLGAVDLDQILRTKRQTKIEQIMRETNHPVPAEMDQEEAAQLFEQYDLLSAAVVDENGRLVGVLTIDDVVDVIHEEADEDIKRLGGVGDEELSDNVLSTVRSRFLWLLINLGTAMLSASVIGLFDGSIEKMIALAVLMPIVASMGGNAGTQTMTVTVRALATRDLDIYNAGRIIRREAGVGVLNGIVFASIMGVIAGTWFHDYQLGGVIAAAMVINLMAAALAGILLPLLLDKMGADPAIASSVFVTTVTDCTGFFAFLGIATWWFGI
>NC_008380.1|WP_011652104.1|2687158_2687551_-|MerR-family-DNA-binding-transcriptional-regulator
MPVNKYYSITELTREFGVSTRTLRFYEDEGLIHPERRGRTRLFRQADRRLIGEILRGRRIGFTIAEIREIIQVYKEPPGELGQLKLLMKRVDEKRDDLRQKRKDIDDTLAELDAIEETCLGRLAEIGVTT
>NC_008380.1|WP_011652103.1|2686144_2687134_+|DUF1624-domain-containing-protein
MTLPARETDAAARPPRIGLLDTARGLALIAMASYHFSWDMEFMGYLAPGTAETGWLKIYARAIATTFLFIVGISLALSSTPEIRWPSYWKRFGMIAAAAAVISIATRIAMPNEWIYFGILHCIAVLTLIGVVFLRLPLAFTLIATLALFAAWITDNFGPPGLLRSSFFDPRYLAWIGLAVVTERSNDYVPLFPWATPFFAGLSIASIAIRTRLLHRLAAIGTGSWWPARLGRHSLAFYLIHQPVLIAIAYGISLVVPPQAPDPVATYLRQCNASCVMQQGEALCHSFCQCTLGKLQAQALFTPLQEGAIDIQNDERVQTIAAECSAEAE
>NC_008380.1|WP_011652102.1|2685380_2686145_+|DUF599-domain-containing-protein
MTTADYIALAFFAFVWMGYSWLLHGRTFFGRTSLTHAMTERRRQWIYNSLRRDLKMIDTQIMAGLQNGTAFFASTSIFAIGSCFALLGATEKVDAVFADLPFVFHGGHAVFEMKVGGLAALFGYAFFKFGWSYRLFNYCTILFGSIPMMRDTERDVIAAERAAERVIRMNVIAGSNFNEGLRAIFLSIGYLGWFINPYVFMLTTAIVIFVLTRRQFFSQARLAIMDTGPPSNLHLSAIRRDRPSSDGNDLSEGL
>NC_008380.1|WP_011652101.1|2684685_2685135_+|ribose-5-phosphate-isomerase-B
MPATNRIALSSDHAAIQLRQAIAGHVVAQGWIAVDIGPTTPESTHYPQHGEAAARLVASGDCRFGIILCGTGQGIMMAANKVRGIRCGVCADPFSARMIRQHNDANMLSIGVRVVGEGLALDIVDAFLTARFEGGRHATRVGMIEALEV
>NC_008380.1|WP_011652100.1|2683321_2684521_-|acyltransferase
MSRPDYIPSLDGLRGVAALLVVGAHIGLIFPIRAPHLVTMGDEAVGLFFALSGFLMAHLYGSRPVTRENVLDFLVSRFARIYPVYLVAVVLVAMLSSMQSLDFVQPIAGGTDFVRHVFLLGSSGVFWSIPPEIQFYLLFPVLWLCLAQPYRYSGIIVGLTVAVVVDGLVELPGPGIVLVSKLPYFLFGALAGIMHSHWNRWIPSAFTGISTLVLLAVFFTYRHILPGFSPEFWSLQSAVAAAVIVGLVARQPPIAARVLAAAPVRFFGKISFSLYLFHVPIMFLARLTFDALMPEPALILVTLCVAVVGAWFIHETIEVPGRRLLVLIWQDNRWRLVSRETPADQMDRAILDLQEIEKRMLSDATSATADQPQISATAEPRDGADGTVIQDDRDEKLRA
>NC_008380.1|WP_011652099.1|2682882_2683320_+|VOC-family-protein
MALKRMDNVGIVVDDLEETIDFFRDLGLELEGRATIEGEWAGRVTGLGDQHVEIAMMRTPDGHSRLELSRFLRPPAVADHRNAPVNALGYLRVMFALDDIDETLERLRKRGAQLVGEVVDYQDTYRLCYIRGPGGLLIGLAQELG
>NC_008380.1|WP_011652098.1|2681125_2682529_-|L-serine-ammonia-lyase
MFLSVFDVFKIGVGPSSSHTMGPMSAANRFLELILSNEWPRPSSGVQVTAIKVSLHGSLAHTGIGHGTGRAVILGLMGEAPDSVDPDRMDGIVDAVERTGRITPEGHPAYQFQPKTDLIFDKKQPLPGHANGMVFSAYDRDGRLLVKRIYYSVGGGFVVTDTELEQMRAKKNAPGGTRVPYPFSTAKQMLEMAERSGLSIAQMKRANEESQRSQEELDQGLDRIWEAMRSCIERGLKVEGIMPGGLNVKRRARRIHDKLEEEWRSNRINPLLANDWLSVYAMAVNEENAAGGRVVTAPTNGAAGVIPATIRYYEHFHEDWDQNGIRDYLLTAAAIGGIIKHNASISGAEVGCQGEVGSAAAMAAAGLAAVMGGTPAQIENAAEIALEHHLGMTCDPIAGLVQVPCIERNALGAVKAVTAASLAIKGDGQHFVPLDACIETMRQTGHDMSEKYKETSTGGLAVNVVEC
>NC_008380.1|WP_028741290.1|2691149_2691869_-|lipoyl(octanoyl)-transferase-LipB
MAMLRTDLEFSMLPQLGTRPVRWRFADGLVPYEEAVETMEREVALIADGGDELVWLVEHPPLYTAGTSANARDLVQPNRFPVFATGRGGEYTYHGPGQRVAYVMLDLKRRRQDVRAFVAALEDVVIRTLDMMNVRGERREDRVGVWVRRPEKPLLADGTMAEDKIAALGIRLRKWVTFHGLSLNVDPDLDHFGGIVPCGISAYGVTSLVDLGLPVMMADVDIRLRTAFEAVFGETTGEI
>NC_008380.1|WP_011652110.1|2692233_2693217_+|DMT-family-transporter
MASSSQESAAMSEPHQNSLQGMAIMSGAMLILPIMDAIAKYMATFEAMSPGQVTFYRFFIQIACTLPILFALFGLKALSAQRPWMNLLRGVLHGGASLLFFVAVKYMPLADVFAIYFVEPFMLAALSALFLGEKVGWRRWVAIVVGFGGAMIVIQPSYEIFGLKALLPVACAFLFSLYLFLNRAIGEADSPLTMQTMAGIGGTVFMAAALFLGNSSGNADFAVSLPSSSLGLVLLLALGSISGYAHMLIVRAFRLAPLSLLAPFQYFEIISATVLGYAFFNDFPSFSKWIGIFIIVASGLFIIWRERLQAQSLKSSGPGEYRVNSSS
>NC_008380.1|WP_011652111.1|2693281_2693986_+|hypothetical-protein
MSEFRLAFPACVVAGKHRLTAEDIVLLRKHSFPEGIRTSDDVVAMLALNNSCPEKCADWNAFFVEQLAGFIVHYTYPQGSLDEINVAWIMRMFTTDGVVNSALELELILHVMEISADVPVELRALALDQLRLAITDNIGGYKLSRAIDRRGITRQDIDYAMRIFRSVAEGGVIPVSSVEYGVLQQIEQATLRGANHPHWAGIMAAVELRDYAEPRRSRWLRIVDEEPVAEAAVA
>NC_008380.1|WP_011652112.1|2694061_2696083_+|acetyl/propionyl/methylcrotonyl-CoA-carboxylase-subunit-alpha
MFKKILIANRGEIACRVIKTARRMGILTVAVYSDADRDALHVEMADEAVHIGPAAASESYLVAERIIAACKATGAEAVHPGYGFLSERASFCTELEKQGIIFIGPKPKAIMAMGDKIESKKFANAAGVSTVPGHLGIIEDAAHAEVISAGIGYPVMIKASAGGGGKGMRIAWNQAEVRDGFERARSEAKSSFGDDRVFIEKFVVEPRHIEIQVLADAHGNVVYLGERECSIQRRNQKVAEEAPSPFLDEATRKAMGEQSVALAKAVDYQSAGTVEFIVDRDRNFYFLEMNTRLQVEHPVTELVTGIDLVEQMIRVAAGEPLPFAQEDIRLDGWAVESRLYAEDPYRNFLPSIGRLTRYRPPAEGRTGNVVVRNDTGVFEGAEISMYYDPMIAKLCTWAPTRLEAIEAMGQALDGFVVDGIEHNVPFLSALMKHPRWREGRLSTGFIAEEYPDGFAPMKPDQAEEAVLAGIALSACLIETNRRERFADRLRAAAGALREDWVVKIGDNHVAARLLDGLVTIPFDMDIAIEGAIEGESKSVVTDWRPGDPVWRGKVGGRDITAQIRPVLNGLRIDWQGVSVNTKVFSPRHAELDRLMPVKLPPDTSKLLLCPMPGLVVAIAVAEGQDVKAGETLAIVEAMKMENVLRADRDLVVSKINAAAGESLAVDAVIMEFA
>NC_008380.1|WP_086935548.1|2696188_2696776_+|GNAT-family-N-acetyltransferase
MDVRAAVTAQAAKPLEVTTVQLEGSAAGEVLVVEVKATGAAATYRVDLRSLDELPARELYDLLRMRVDVFVVEQNCPYPELDGKDIDALHLRLLDGAELLGAARILKPYEPQDPSKIGRVVVSPDHRGKRLGDVLMSEAIAACERLYPENPIALSAQAHLRRFYESFGFTAVSQEYLEDGIPHIDMVRQQATQPA
>NC_008380.1|WP_011652114.1|2696786_2697254_+|YaiI/YqxD-family-protein
MIYVDADACPVKPEILKVAERHGLEVTFVANSGLRPSRDPMIHNVIVSNAFDAADNWIAERAGAGDVVVTADVPLAVRCVATGTFVSGPTGRVFDETNIGMASAMRDLGAHLRETGESKGYNAAFSPKDRSRFLETFDRLCRRAKSLAAEAGGQS
>NC_008380.1|WP_011652115.1|2697422_2697737_+|quaternary-ammonium-compound-efflux-SMR-transporter-SugE
MAWFLLFLAGLFECGWAIGLKYTEGFTRPMPTAMTVISMVISIVLLGLAVKHLPIGTAYAVWTGIGTVGTVFLGIWLLGDEASVSRLACISLIVAGIAGLKLTA
>NC_008380.1|WP_011652116.1|2697778_2698171_-|DoxX-family-protein
MSTFDRLFAYQPYGLAALRIITALLFIEHGTMKLFGFPASQMSGSLPPLMLFAALLELVGGILILVGLLTRPVAFLLAGEMAVAYFMAHAPSSFFPAVNQGDAAILFCFVFLYLVFSGPGAFAVDNRKTA
>NC_008380.1|WP_011652117.1|2698310_2699843_-|acyl-CoA-carboxylase-subunit-beta
MKEILEELERRRGIARLGGGEARIAAQHKRGKLTARERIDLFLDEGSFEEFDMFVEHRSTDFGMDKSRIAGDGVVTGWGTVNGRTVFVFAKDFTVFGGSLSEAHAEKIMKVQDMALKNRAPIVGIYDAGGARIQEGVAALGGYAEVFQRNVLASGVIPQISVIMGPCAGGDVYSPAMTDFIFMVRDTSYMFVTGPDVVKTVTNETVTAEELGGAVVHTVRSSIADGAFENDVETLLQVRRLIDFLPLSNTAPLPEIECYQSVTDIDASLDTLVPASSNKPYDIKELIRKVSDEGDFFEIQASFAKNIVCGFGRVEGSTVGFVANQPMVLAGVLDSDASRKAARFVRFCDCFNIPIVTFVDVPGFLPGTAQEYGGLIKHGAKLLFAYAEATVPKLTVITRKAFGGAYDVMASKHLRGDLNYAWPTAQIAVMGAKGAVEIIFRKDTADPEKIAAHTKMYEDRFLSPFVAAERGYVDEVIMPHSTRRRLARGLKMLRNKDLANPWKKHDNIPL
>NC_008380.1|WP_011652118.1|2699946_2700408_-|hypothetical-protein
MNWLRSCFCRATLVCAALTACGSLSATKPAAPVYDVRSAVVLSGPNMPAEVLSGINDRVNAAINATVRDTVLPRVVLTIRVVSVQKGLGFQKDRNVAKISIDAASVEDGSVIAVSAFDVTSIAADPKLADEILAEDAAARIRSVFSLSGRGAK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_008380_3	3.1\|2416784\|32\|NC_008380\|CRISPRCasFinder	2416784-2416815	32	NZ_CP018230	Rhizobium leguminosarum strain Vaf-108 plasmid unnamed2, complete sequence	151128-151159	2	0.938
NC_008380_3	3.1\|2416784\|32\|NC_008380\|CRISPRCasFinder	2416784-2416815	32	NC_009620	Sinorhizobium medicae WSM419 plasmid pSMED01, complete sequence	1243333-1243364	3	0.906
NC_008380_3	3.1\|2416784\|32\|NC_008380\|CRISPRCasFinder	2416784-2416815	32	NZ_CP032685	Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence	820851-820882	3	0.906
NC_008380_3	3.1\|2416784\|32\|NC_008380\|CRISPRCasFinder	2416784-2416815	32	NZ_CP050093	Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b5, complete sequence	248454-248485	3	0.906
NC_008380_3	3.1\|2416784\|32\|NC_008380\|CRISPRCasFinder	2416784-2416815	32	NZ_CP050105	Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b6, complete sequence	550469-550500	3	0.906
NC_008380_3	3.1\|2416784\|32\|NC_008380\|CRISPRCasFinder	2416784-2416815	32	NZ_CP032690	Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence	820399-820430	3	0.906
NC_008380_3	3.1\|2416784\|32\|NC_008380\|CRISPRCasFinder	2416784-2416815	32	NC_008384	Rhizobium leguminosarum bv. viciae 3841 plasmid pRL11, complete sequence	399777-399808	3	0.906
NC_008380_3	3.1\|2416784\|32\|NC_008380\|CRISPRCasFinder	2416784-2416815	32	NZ_CP025014	Rhizobium leguminosarum strain Norway plasmid pRLN2, complete sequence	449537-449568	3	0.906
NC_008380_3	3.1\|2416784\|32\|NC_008380\|CRISPRCasFinder	2416784-2416815	32	NZ_CP015737	Shinella sp. HZN7 plasmid pShin-01, complete sequence	27029-27060	3	0.906
NC_008380_3	3.1\|2416784\|32\|NC_008380\|CRISPRCasFinder	2416784-2416815	32	NZ_CP025508	Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvB, complete sequence	459736-459767	3	0.906
NC_008380_3	3.1\|2416784\|32\|NC_008380\|CRISPRCasFinder	2416784-2416815	32	NZ_CP050110	Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b4, complete sequence	550471-550502	3	0.906
NC_008380_3	3.1\|2416784\|32\|NC_008380\|CRISPRCasFinder	2416784-2416815	32	NZ_CP048282	Rhizobium leguminosarum bv. viciae 248 plasmid pRle248d, complete sequence	261038-261069	3	0.906
NC_008380_3	3.1\|2416784\|32\|NC_008380\|CRISPRCasFinder	2416784-2416815	32	NZ_CP022666	Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR1, complete sequence	1079588-1079619	3	0.906
NC_008380_3	3.1\|2416784\|32\|NC_008380\|CRISPRCasFinder	2416784-2416815	32	NZ_CP022667	Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR2, complete sequence	177837-177868	3	0.906
NC_008380_3	3.1\|2416784\|32\|NC_008380\|CRISPRCasFinder	2416784-2416815	32	NZ_CP050086	Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b7, complete sequence	676724-676755	3	0.906
NC_008380_3	3.1\|2416784\|32\|NC_008380\|CRISPRCasFinder	2416784-2416815	32	NZ_CP050087	Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b5, complete sequence	458520-458551	3	0.906
NC_008380_3	3.1\|2416784\|32\|NC_008380\|CRISPRCasFinder	2416784-2416815	32	NC_008384	Rhizobium leguminosarum bv. viciae 3841 plasmid pRL11, complete sequence	221099-221130	4	0.875
NC_008380_3	3.1\|2416784\|32\|NC_008380\|CRISPRCasFinder	2416784-2416815	32	NZ_CP025014	Rhizobium leguminosarum strain Norway plasmid pRLN2, complete sequence	142455-142486	4	0.875
NC_008380_3	3.1\|2416784\|32\|NC_008380\|CRISPRCasFinder	2416784-2416815	32	NZ_CP050082	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b4, complete sequence	573967-573998	4	0.875
NC_008380_3	3.1\|2416784\|32\|NC_008380\|CRISPRCasFinder	2416784-2416815	32	NZ_CP049732	Rhizobium leguminosarum strain A1 plasmid pRL11, complete sequence	515419-515450	4	0.875
NC_008380_3	3.1\|2416784\|32\|NC_008380\|CRISPRCasFinder	2416784-2416815	32	NZ_CP054023	Rhizobium sp. JKLM12A2 plasmid pPR12A202, complete sequence	7460-7491	4	0.875
NC_008380_3	3.1\|2416784\|32\|NC_008380\|CRISPRCasFinder	2416784-2416815	32	NZ_CP054033	Rhizobium sp. JKLM13E plasmid pPR13E02, complete sequence	161093-161124	4	0.875
NC_008380_2	2.1\|1148567\|28\|NC_008380\|CRT	1148567-1148594	28	NZ_CP045548	Streptomyces sp. SYP-A7193 plasmid unnamed1, complete sequence	491707-491734	5	0.821
NC_008380_2	2.3\|1148672\|28\|NC_008380\|CRT	1148672-1148699	28	NC_014309	Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome	1243370-1243397	5	0.821
NC_008380_2	2.5\|1148798\|28\|NC_008380\|CRT	1148798-1148825	28	NZ_CP022363	Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence	495288-495315	5	0.821
NC_008380_3	3.1\|2416784\|32\|NC_008380\|CRISPRCasFinder	2416784-2416815	32	NC_009620	Sinorhizobium medicae WSM419 plasmid pSMED01, complete sequence	330268-330299	5	0.844
NC_008380_3	3.1\|2416784\|32\|NC_008380\|CRISPRCasFinder	2416784-2416815	32	NZ_CP016289	Rhizobium leguminosarum strain Vaf10 plasmid unnamed2, complete sequence	540159-540190	5	0.844
NC_008380_2	2.1\|1148567\|28\|NC_008380\|CRT	1148567-1148594	28	NZ_CP012383	Streptomyces ambofaciens ATCC 23877 plasmid pSAM1, complete sequence	62081-62108	6	0.786
NC_008380_2	2.1\|1148567\|28\|NC_008380\|CRT	1148567-1148594	28	NC_031265	Gordonia phage Guacamole, complete genome	32615-32642	6	0.786
NC_008380_2	2.1\|1148567\|28\|NC_008380\|CRT	1148567-1148594	28	MK501729	Gordonia phage Walrus, complete genome	32394-32421	6	0.786
NC_008380_2	2.1\|1148567\|28\|NC_008380\|CRT	1148567-1148594	28	MK967389	Gordonia phage JasperJr, complete genome	32615-32642	6	0.786
NC_008380_2	2.1\|1148567\|28\|NC_008380\|CRT	1148567-1148594	28	MT723936	Gordonia phage Hitter, complete genome	32259-32286	6	0.786
NC_008380_2	2.5\|1148798\|28\|NC_008380\|CRT	1148798-1148825	28	NZ_CP044976	Hydrogenophaga sp. PBL-H3 substr. PBL-H3(B2) plasmid pPBL-H3_B2-1, complete sequence	222527-222554	6	0.786
NC_008380_2	2.5\|1148798\|28\|NC_008380\|CRT	1148798-1148825	28	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	1267353-1267380	6	0.786
NC_008380_2	2.5\|1148798\|28\|NC_008380\|CRT	1148798-1148825	28	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	52908-52935	6	0.786
NC_008380_3	3.1\|2416784\|32\|NC_008380\|CRISPRCasFinder	2416784-2416815	32	NC_003078	Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence	1114160-1114191	6	0.812
NC_008380_3	3.1\|2416784\|32\|NC_008380\|CRISPRCasFinder	2416784-2416815	32	NZ_CP021799	Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence	1180383-1180414	6	0.812
NC_008380_3	3.1\|2416784\|32\|NC_008380\|CRISPRCasFinder	2416784-2416815	32	NZ_CP026527	Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence	629269-629300	6	0.812
NC_008380_3	3.1\|2416784\|32\|NC_008380\|CRISPRCasFinder	2416784-2416815	32	NC_020560	Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence	1114166-1114197	6	0.812
NC_008380_3	3.1\|2416784\|32\|NC_008380\|CRISPRCasFinder	2416784-2416815	32	NZ_CP050099	Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b5, complete sequence	322620-322651	6	0.812
NC_008380_3	3.1\|2416784\|32\|NC_008380\|CRISPRCasFinder	2416784-2416815	32	NZ_CP009145	Sinorhizobium meliloti strain RMO17 plasmid pSymA, complete sequence	73125-73156	6	0.812
NC_008380_3	3.1\|2416784\|32\|NC_008380\|CRISPRCasFinder	2416784-2416815	32	NZ_CP023000	Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-B, complete sequence	1142094-1142125	6	0.812
NC_008380_3	3.1\|2416784\|32\|NC_008380\|CRISPRCasFinder	2416784-2416815	32	NZ_CP019486	Sinorhizobium meliloti strain B399 plasmid pSymA, complete sequence	1043349-1043380	6	0.812
NC_008380_2	2.3\|1148672\|28\|NC_008380\|CRT	1148672-1148699	28	NC_006525	Cupriavidus metallidurans CH34 plasmid pMOL28, complete sequence	25291-25318	7	0.75
NC_008380_2	2.3\|1148672\|28\|NC_008380\|CRT	1148672-1148699	28	MK279853	Gordonia phage Gray, complete genome	67177-67204	7	0.75
NC_008380_2	2.3\|1148672\|28\|NC_008380\|CRT	1148672-1148699	28	MN586022	Gordonia phage Chidiebere, complete genome	67246-67273	7	0.75
NC_008380_2	2.3\|1148672\|28\|NC_008380\|CRT	1148672-1148699	28	NZ_CP046330	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed1, complete sequence	81401-81428	7	0.75
NC_008380_2	2.5\|1148798\|28\|NC_008380\|CRT	1148798-1148825	28	MH697592	Mycobacterium phage Rando14, complete genome	165-192	7	0.75
NC_008380_2	2.5\|1148798\|28\|NC_008380\|CRT	1148798-1148825	28	NZ_CP024609	Massilia violaceinigra strain B2 plasmid unnamed, complete sequence	31303-31330	7	0.75
NC_008380_3	3.1\|2416784\|32\|NC_008380\|CRISPRCasFinder	2416784-2416815	32	NZ_CP025014	Rhizobium leguminosarum strain Norway plasmid pRLN2, complete sequence	334178-334209	7	0.781
NC_008380_3	3.1\|2416784\|32\|NC_008380\|CRISPRCasFinder	2416784-2416815	32	NC_003078	Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence	306596-306627	7	0.781
NC_008380_3	3.1\|2416784\|32\|NC_008380\|CRISPRCasFinder	2416784-2416815	32	NZ_CP021799	Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence	374134-374165	7	0.781
NC_008380_3	3.1\|2416784\|32\|NC_008380\|CRISPRCasFinder	2416784-2416815	32	NZ_CP021823	Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence	1674430-1674461	7	0.781
NC_008380_3	3.1\|2416784\|32\|NC_008380\|CRISPRCasFinder	2416784-2416815	32	NZ_CP021814	Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence	1327700-1327731	7	0.781
NC_008380_3	3.1\|2416784\|32\|NC_008380\|CRISPRCasFinder	2416784-2416815	32	NZ_CP026527	Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence	1428587-1428618	7	0.781
NC_008380_3	3.1\|2416784\|32\|NC_008380\|CRISPRCasFinder	2416784-2416815	32	NZ_CP019484	Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence	516320-516351	7	0.781
NC_008380_3	3.1\|2416784\|32\|NC_008380\|CRISPRCasFinder	2416784-2416815	32	NZ_CP019487	Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence	303860-303891	7	0.781
NC_008380_3	3.1\|2416784\|32\|NC_008380\|CRISPRCasFinder	2416784-2416815	32	NC_020560	Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence	306597-306628	7	0.781
NC_008380_3	3.1\|2416784\|32\|NC_008380\|CRISPRCasFinder	2416784-2416815	32	NZ_CP050082	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b4, complete sequence	490406-490437	7	0.781
NC_008380_3	3.1\|2416784\|32\|NC_008380\|CRISPRCasFinder	2416784-2416815	32	NZ_CP049732	Rhizobium leguminosarum strain A1 plasmid pRL11, complete sequence	424675-424706	7	0.781
NC_008380_3	3.1\|2416784\|32\|NC_008380\|CRISPRCasFinder	2416784-2416815	32	NC_017323	Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence	990529-990560	7	0.781
NC_008380_3	3.1\|2416784\|32\|NC_008380\|CRISPRCasFinder	2416784-2416815	32	NZ_CP009146	Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence	1384485-1384516	7	0.781
NC_008380_3	3.1\|2416784\|32\|NC_008380\|CRISPRCasFinder	2416784-2416815	32	NC_018701	Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence	1416770-1416801	7	0.781
NC_008380_3	3.1\|2416784\|32\|NC_008380\|CRISPRCasFinder	2416784-2416815	32	NZ_CP021828	Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence	1559573-1559604	7	0.781
NC_008380_3	3.1\|2416784\|32\|NC_008380\|CRISPRCasFinder	2416784-2416815	32	NZ_CP021802	Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence	16955-16986	7	0.781
NC_008380_3	3.1\|2416784\|32\|NC_008380\|CRISPRCasFinder	2416784-2416815	32	NZ_CP021810	Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence	540667-540698	7	0.781
NC_008380_3	3.1\|2416784\|32\|NC_008380\|CRISPRCasFinder	2416784-2416815	32	NC_019849	Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence	1438899-1438930	7	0.781
NC_008380_3	3.1\|2416784\|32\|NC_008380\|CRISPRCasFinder	2416784-2416815	32	NZ_CP019586	Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence	309373-309404	7	0.781
NC_008380_3	3.1\|2416784\|32\|NC_008380\|CRISPRCasFinder	2416784-2416815	32	NZ_CP021831	Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence	1725-1756	7	0.781
NC_008380_3	3.1\|2416784\|32\|NC_008380\|CRISPRCasFinder	2416784-2416815	32	NZ_CP021806	Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence	1261455-1261486	7	0.781
NC_008380_3	3.1\|2416784\|32\|NC_008380\|CRISPRCasFinder	2416784-2416815	32	NC_017326	Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence	1399664-1399695	7	0.781
NC_008380_3	3.1\|2416784\|32\|NC_008380\|CRISPRCasFinder	2416784-2416815	32	NZ_CP021820	Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence	96051-96082	7	0.781
NC_008380_3	3.1\|2416784\|32\|NC_008380\|CRISPRCasFinder	2416784-2416815	32	NZ_CP021795	Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence	1208726-1208757	7	0.781
NC_008380_3	3.1\|2416784\|32\|NC_008380\|CRISPRCasFinder	2416784-2416815	32	NZ_HG938354	Neorhizobium galegae bv. orientalis str. HAMBI 540 plasmid pHAMBI540a, complete sequence	30809-30840	7	0.781
NC_008380_3	3.1\|2416784\|32\|NC_008380\|CRISPRCasFinder	2416784-2416815	32	NZ_HG938356	Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141 plasmid pHAMBI1141a, complete sequence	29720-29751	7	0.781
NC_008380_3	3.1\|2416784\|32\|NC_008380\|CRISPRCasFinder	2416784-2416815	32	NZ_CP021218	Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence	1593384-1593415	7	0.781
NC_008380_3	3.1\|2416784\|32\|NC_008380\|CRISPRCasFinder	2416784-2416815	32	NZ_CP053208	Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1B, complete sequence	388891-388922	7	0.781
NC_008380_3	3.1\|2416784\|32\|NC_008380\|CRISPRCasFinder	2416784-2416815	32	NZ_CP023068	Ensifer sojae CCBAU 05684 plasmid pSJ05684b, complete sequence	1193573-1193604	7	0.781
NC_008380_3	3.1\|2416784\|32\|NC_008380\|CRISPRCasFinder	2416784-2416815	32	NZ_CP015881	Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence	1545576-1545607	7	0.781
NC_008380_3	3.1\|2416784\|32\|NC_008380\|CRISPRCasFinder	2416784-2416815	32	NZ_CP030263	Ensifer adhaerens strain Corn53 plasmid AA, complete sequence	628818-628849	7	0.781
NC_008380_3	3.1\|2416784\|32\|NC_008380\|CRISPRCasFinder	2416784-2416815	32	NZ_CP015232	Epibacterium mobile F1926 plasmid unnamed2, complete sequence	132158-132189	8	0.75
NC_008380_3	3.1\|2416784\|32\|NC_008380\|CRISPRCasFinder	2416784-2416815	32	NZ_LR027555	Epibacterium mobile isolate EPIB1 plasmid 3, complete sequence	70325-70356	8	0.75

1. spacer 3.1|2416784|32|NC_008380|CRISPRCasFinder matches to NZ_CP018230 (Rhizobium leguminosarum strain Vaf-108 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.938

cggtttttcgtccggaattgcgcagaaacaag	CRISPR spacer
cggttttacgtccggaattgcgcagaaacaaa	Protospacer
******* ***********************.

2. spacer 3.1|2416784|32|NC_008380|CRISPRCasFinder matches to NC_009620 (Sinorhizobium medicae WSM419 plasmid pSMED01, complete sequence) position: , mismatch: 3, identity: 0.906

cggtttttcgtccggaattgcgcagaaacaag	CRISPR spacer
cggttttccgtccggaattgcgcagaaacata	Protospacer
*******.********************** .

3. spacer 3.1|2416784|32|NC_008380|CRISPRCasFinder matches to NZ_CP032685 (Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence) position: , mismatch: 3, identity: 0.906

cggtttttcgtccggaattgcgcagaaacaag	CRISPR spacer
cggttttccgtccggaattgcgtagaaacaaa	Protospacer
*******.**************.********.

4. spacer 3.1|2416784|32|NC_008380|CRISPRCasFinder matches to NZ_CP050093 (Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b5, complete sequence) position: , mismatch: 3, identity: 0.906

cggtttttcgtccggaattgcgcagaaacaag	CRISPR spacer
cggttttgcgtccggaattgcgcggaaacaaa	Protospacer
******* ***************.*******.

5. spacer 3.1|2416784|32|NC_008380|CRISPRCasFinder matches to NZ_CP050105 (Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b6, complete sequence) position: , mismatch: 3, identity: 0.906

cggtttttcgtccggaattgcgcagaaacaag	CRISPR spacer
cggtttttcgtccggaattgcgtaaaaacaaa	Protospacer
**********************.*.******.

6. spacer 3.1|2416784|32|NC_008380|CRISPRCasFinder matches to NZ_CP032690 (Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence) position: , mismatch: 3, identity: 0.906

cggtttttcgtccggaattgcgcagaaacaag	CRISPR spacer
cggttttccgtccggaattgcgtagaaacaaa	Protospacer
*******.**************.********.

7. spacer 3.1|2416784|32|NC_008380|CRISPRCasFinder matches to NC_008384 (Rhizobium leguminosarum bv. viciae 3841 plasmid pRL11, complete sequence) position: , mismatch: 3, identity: 0.906

cggtttttcgtccggaattgcgcagaaacaag	CRISPR spacer
cggttttgcgtccggaattgcgcggaaacaaa	Protospacer
******* ***************.*******.

8. spacer 3.1|2416784|32|NC_008380|CRISPRCasFinder matches to NZ_CP025014 (Rhizobium leguminosarum strain Norway plasmid pRLN2, complete sequence) position: , mismatch: 3, identity: 0.906

cggtttttcgtccggaattgcgcagaaacaag	CRISPR spacer
cggtttttcgtccggaattgcgtaaaaacaaa	Protospacer
**********************.*.******.

9. spacer 3.1|2416784|32|NC_008380|CRISPRCasFinder matches to NZ_CP015737 (Shinella sp. HZN7 plasmid pShin-01, complete sequence) position: , mismatch: 3, identity: 0.906

cggtttttcgtccggaattgcgcagaaacaag	CRISPR spacer
cggttttgcgtccggaattgcggagaaacaaa	Protospacer
******* ************** ********.

10. spacer 3.1|2416784|32|NC_008380|CRISPRCasFinder matches to NZ_CP025508 (Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvB, complete sequence) position: , mismatch: 3, identity: 0.906

cggtttttcgtccggaattgcgcagaaacaag	CRISPR spacer
cggtttttcgtccggaattgcgtaaaaacaaa	Protospacer
**********************.*.******.

11. spacer 3.1|2416784|32|NC_008380|CRISPRCasFinder matches to NZ_CP050110 (Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b4, complete sequence) position: , mismatch: 3, identity: 0.906

cggtttttcgtccggaattgcgcagaaacaag	CRISPR spacer
cggtttttcgtccggaattgcgtaaaaacaaa	Protospacer
**********************.*.******.

12. spacer 3.1|2416784|32|NC_008380|CRISPRCasFinder matches to NZ_CP048282 (Rhizobium leguminosarum bv. viciae 248 plasmid pRle248d, complete sequence) position: , mismatch: 3, identity: 0.906

cggtttttcgtccggaattgcgcagaaacaag	CRISPR spacer
cgattttacgtccggaattgcgcagaaacaaa	Protospacer
**.**** ***********************.

13. spacer 3.1|2416784|32|NC_008380|CRISPRCasFinder matches to NZ_CP022666 (Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR1, complete sequence) position: , mismatch: 3, identity: 0.906

cggtttttcgtccggaattgcgcagaaacaag	CRISPR spacer
cggtttttcgtccggaattgcgtaaaaacaaa	Protospacer
**********************.*.******.

14. spacer 3.1|2416784|32|NC_008380|CRISPRCasFinder matches to NZ_CP022667 (Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR2, complete sequence) position: , mismatch: 3, identity: 0.906

cggtttttcgtccggaattgcgcagaaacaag	CRISPR spacer
cggtttttcgtccggaattgcgtaaaaacaaa	Protospacer
**********************.*.******.

15. spacer 3.1|2416784|32|NC_008380|CRISPRCasFinder matches to NZ_CP050086 (Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b7, complete sequence) position: , mismatch: 3, identity: 0.906

cggtttttcgtccggaattgcgcagaaacaag	CRISPR spacer
cggtttttcgtccggaattgcgtaaaaacaaa	Protospacer
**********************.*.******.

16. spacer 3.1|2416784|32|NC_008380|CRISPRCasFinder matches to NZ_CP050087 (Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b5, complete sequence) position: , mismatch: 3, identity: 0.906

cggtttttcgtccggaattgcgcagaaacaag	CRISPR spacer
cggtttttcgtccggaattgcgtaaaaacaaa	Protospacer
**********************.*.******.

17. spacer 3.1|2416784|32|NC_008380|CRISPRCasFinder matches to NC_008384 (Rhizobium leguminosarum bv. viciae 3841 plasmid pRL11, complete sequence) position: , mismatch: 4, identity: 0.875

cggtttttcgtccggaattgcgcagaaacaag	CRISPR spacer
tggtttttcgtccggaattgcgtaaaaacaaa	Protospacer
.*********************.*.******.

18. spacer 3.1|2416784|32|NC_008380|CRISPRCasFinder matches to NZ_CP025014 (Rhizobium leguminosarum strain Norway plasmid pRLN2, complete sequence) position: , mismatch: 4, identity: 0.875

cggtttttcgtccggaattgcgcagaaacaag	CRISPR spacer
tggtttttcgtccggaattgcgtaaaaacaaa	Protospacer
.*********************.*.******.

19. spacer 3.1|2416784|32|NC_008380|CRISPRCasFinder matches to NZ_CP050082 (Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b4, complete sequence) position: , mismatch: 4, identity: 0.875

cggtttttcgtccggaattgcgcagaaacaag	CRISPR spacer
cggtttttcgtccggaattgcgtaaaaacgaa	Protospacer
**********************.*.****.*.

20. spacer 3.1|2416784|32|NC_008380|CRISPRCasFinder matches to NZ_CP049732 (Rhizobium leguminosarum strain A1 plasmid pRL11, complete sequence) position: , mismatch: 4, identity: 0.875

cggtttttcgtccggaattgcgcagaaacaag	CRISPR spacer
cggtttttcgtccggaattgcgtaaaaacgaa	Protospacer
**********************.*.****.*.

21. spacer 3.1|2416784|32|NC_008380|CRISPRCasFinder matches to NZ_CP054023 (Rhizobium sp. JKLM12A2 plasmid pPR12A202, complete sequence) position: , mismatch: 4, identity: 0.875

cggtttttcgtccggaattgcgcagaaacaag	CRISPR spacer
cggttttgcgtccggaattgcgcggaaaccaa	Protospacer
******* ***************.***** *.

22. spacer 3.1|2416784|32|NC_008380|CRISPRCasFinder matches to NZ_CP054033 (Rhizobium sp. JKLM13E plasmid pPR13E02, complete sequence) position: , mismatch: 4, identity: 0.875

cggtttttcgtccggaattgcgcagaaacaag	CRISPR spacer
cggttttgcgtccggaattgcgcggaaaccaa	Protospacer
******* ***************.***** *.

23. spacer 2.1|1148567|28|NC_008380|CRT matches to NZ_CP045548 (Streptomyces sp. SYP-A7193 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

gctgctcgaagtgcccccaccggccgac	CRISPR spacer
tcttcgcgaagtgcccccaccggctggc	Protospacer
 ** * ******************.*.*

24. spacer 2.3|1148672|28|NC_008380|CRT matches to NC_014309 (Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome) position: , mismatch: 5, identity: 0.821

gctgctggaggtgccgccaccggctgat	CRISPR spacer
gctgctggaggcgccgccaccgccgcag	Protospacer
***********.********** *  *

25. spacer 2.5|1148798|28|NC_008380|CRT matches to NZ_CP022363 (Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence) position: , mismatch: 5, identity: 0.821

gctgctcgcagttccgccgccggccgac	CRISPR spacer
ccggcccgcagttccgccgccggctggc	Protospacer
 * **.******************.*.*

26. spacer 3.1|2416784|32|NC_008380|CRISPRCasFinder matches to NC_009620 (Sinorhizobium medicae WSM419 plasmid pSMED01, complete sequence) position: , mismatch: 5, identity: 0.844

cggtttttcgtccggaattgcgcagaaacaag	CRISPR spacer
cggtttttcgtccggaattgcacaaaacaagg	Protospacer
*********************.**.**  *.*

27. spacer 3.1|2416784|32|NC_008380|CRISPRCasFinder matches to NZ_CP016289 (Rhizobium leguminosarum strain Vaf10 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.844

cggtttttcgtccggaattgcgcagaaacaag	CRISPR spacer
cggtttttcgtccggaattgcgtaaaacaaaa	Protospacer
**********************.*.**  **.

28. spacer 2.1|1148567|28|NC_008380|CRT matches to NZ_CP012383 (Streptomyces ambofaciens ATCC 23877 plasmid pSAM1, complete sequence) position: , mismatch: 6, identity: 0.786

gctgctcgaagtgcccccaccggccgac	CRISPR spacer
cggtctcgaagtgccaccaccggccgcc	Protospacer
    *********** ********** *

29. spacer 2.1|1148567|28|NC_008380|CRT matches to NC_031265 (Gordonia phage Guacamole, complete genome) position: , mismatch: 6, identity: 0.786

gctgctcgaagtgcccccaccggccgac	CRISPR spacer
ggggctcgaagtgcccccacccggcgtg	Protospacer
*  ****************** * **

30. spacer 2.1|1148567|28|NC_008380|CRT matches to MK501729 (Gordonia phage Walrus, complete genome) position: , mismatch: 6, identity: 0.786

gctgctcgaagtgcccccaccggccgac	CRISPR spacer
ggggctcgaagtgcccccacccggcgtg	Protospacer
*  ****************** * **

31. spacer 2.1|1148567|28|NC_008380|CRT matches to MK967389 (Gordonia phage JasperJr, complete genome) position: , mismatch: 6, identity: 0.786

gctgctcgaagtgcccccaccggccgac	CRISPR spacer
ggggctcgaagtgcccccacccggcgtg	Protospacer
*  ****************** * **

32. spacer 2.1|1148567|28|NC_008380|CRT matches to MT723936 (Gordonia phage Hitter, complete genome) position: , mismatch: 6, identity: 0.786

gctgctcgaagtgcccccaccggccgac	CRISPR spacer
ggggctcgaagtgcccccacccggcgtg	Protospacer
*  ****************** * **

33. spacer 2.5|1148798|28|NC_008380|CRT matches to NZ_CP044976 (Hydrogenophaga sp. PBL-H3 substr. PBL-H3(B2) plasmid pPBL-H3_B2-1, complete sequence) position: , mismatch: 6, identity: 0.786

gctgctcgcagttccgccgccggccgac	CRISPR spacer
gctgctcgcagttccggcgcctggccct	Protospacer
**************** **** * *  .

34. spacer 2.5|1148798|28|NC_008380|CRT matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 6, identity: 0.786

gctgctcgcagttccgccgccggccgac	CRISPR spacer
tcggctggcaggtccgccgccggccgga	Protospacer
 * *** **** **************.

35. spacer 2.5|1148798|28|NC_008380|CRT matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 6, identity: 0.786

gctgctcgcagttccgccgccggccgac	CRISPR spacer
tcggctggcaggtccgccgccggccgga	Protospacer
 * *** **** **************.

36. spacer 3.1|2416784|32|NC_008380|CRISPRCasFinder matches to NC_003078 (Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence) position: , mismatch: 6, identity: 0.812

cggtttttcgtccggaattgcgcagaaacaag	CRISPR spacer
cggttttccgtccggaagtgcgcagcgtcaaa	Protospacer
*******.********* ******* . ***.

37. spacer 3.1|2416784|32|NC_008380|CRISPRCasFinder matches to NZ_CP021799 (Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence) position: , mismatch: 6, identity: 0.812

cggtttttcgtccggaattgcgcagaaacaag	CRISPR spacer
cggttttccgtccggaagtgcgcagcgtcaaa	Protospacer
*******.********* ******* . ***.

38. spacer 3.1|2416784|32|NC_008380|CRISPRCasFinder matches to NZ_CP026527 (Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence) position: , mismatch: 6, identity: 0.812

cggtttttcgtccggaattgcgcagaaacaag	CRISPR spacer
cggttttccgtccggaagtgcgcagcgtcaaa	Protospacer
*******.********* ******* . ***.

39. spacer 3.1|2416784|32|NC_008380|CRISPRCasFinder matches to NC_020560 (Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence) position: , mismatch: 6, identity: 0.812

cggtttttcgtccggaattgcgcagaaacaag	CRISPR spacer
cggttttccgtccggaagtgcgcagcgtcaaa	Protospacer
*******.********* ******* . ***.

40. spacer 3.1|2416784|32|NC_008380|CRISPRCasFinder matches to NZ_CP050099 (Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b5, complete sequence) position: , mismatch: 6, identity: 0.812

cggtttttcgtccggaattgcgcagaaacaag	CRISPR spacer
gcggttttcgtccggaattgcgtaaaaacaaa	Protospacer
  * ******************.*.******.

41. spacer 3.1|2416784|32|NC_008380|CRISPRCasFinder matches to NZ_CP009145 (Sinorhizobium meliloti strain RMO17 plasmid pSymA, complete sequence) position: , mismatch: 6, identity: 0.812

cggtttttcgtccggaattgcgcagaaacaag	CRISPR spacer
cggttttccgtccggaagtgcgcagtttcaaa	Protospacer
*******.********* *******   ***.

42. spacer 3.1|2416784|32|NC_008380|CRISPRCasFinder matches to NZ_CP023000 (Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-B, complete sequence) position: , mismatch: 6, identity: 0.812

cggtttttcgtccggaattgcgcagaaacaag	CRISPR spacer
cagttttgcgtccggaattgcgcaaaagctaa	Protospacer
*.***** ****************.**.* *.

43. spacer 3.1|2416784|32|NC_008380|CRISPRCasFinder matches to NZ_CP019486 (Sinorhizobium meliloti strain B399 plasmid pSymA, complete sequence) position: , mismatch: 6, identity: 0.812

cggtttttcgtccggaattgcgcagaaacaag	CRISPR spacer
cggttttccgtccggaagtgcgcagtttcaaa	Protospacer
*******.********* *******   ***.

44. spacer 2.3|1148672|28|NC_008380|CRT matches to NC_006525 (Cupriavidus metallidurans CH34 plasmid pMOL28, complete sequence) position: , mismatch: 7, identity: 0.75

gctgctggaggtgccgccaccggctgat	CRISPR spacer
gctgctggcggtgccgcgaccggagacg	Protospacer
******** ******** *****  .

45. spacer 2.3|1148672|28|NC_008380|CRT matches to MK279853 (Gordonia phage Gray, complete genome) position: , mismatch: 7, identity: 0.75

gctgctggaggtgccgccaccggctgat	CRISPR spacer
gctgctggtggtgccaccaccggtacgc	Protospacer
******** ******.*******.  ..

46. spacer 2.3|1148672|28|NC_008380|CRT matches to MN586022 (Gordonia phage Chidiebere, complete genome) position: , mismatch: 7, identity: 0.75

gctgctggaggtgccgccaccggctgat	CRISPR spacer
gctgctggtggtgccaccaccggtacgc	Protospacer
******** ******.*******.  ..

47. spacer 2.3|1148672|28|NC_008380|CRT matches to NZ_CP046330 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.75

gctgctggaggtgccgccaccggctgat	CRISPR spacer
gctgctggcggtgccgcgaccggagacg	Protospacer
******** ******** *****  .

48. spacer 2.5|1148798|28|NC_008380|CRT matches to MH697592 (Mycobacterium phage Rando14, complete genome) position: , mismatch: 7, identity: 0.75

gctgctcgcagttccgccgccggccgac	CRISPR spacer
tcgagtcgcagttccgacgccggccgtt	Protospacer
 * . *********** ********* .

49. spacer 2.5|1148798|28|NC_008380|CRT matches to NZ_CP024609 (Massilia violaceinigra strain B2 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.75

gctgctcgcagttccgccgccggccgac	CRISPR spacer
caggctcgcgattccgccgccggccgcg	Protospacer
   ******..***************

50. spacer 3.1|2416784|32|NC_008380|CRISPRCasFinder matches to NZ_CP025014 (Rhizobium leguminosarum strain Norway plasmid pRLN2, complete sequence) position: , mismatch: 7, identity: 0.781

cggtttttcgtccggaattgcgcagaaacaag	CRISPR spacer
gcggttcgcgtccggaattgcgcggaaacaaa	Protospacer
  * **. ***************.*******.

51. spacer 3.1|2416784|32|NC_008380|CRISPRCasFinder matches to NC_003078 (Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence) position: , mismatch: 7, identity: 0.781

cggtttttcgtccggaattgcgcagaaacaag	CRISPR spacer
cggttttccgtccggaagtgcgccatttcaag	Protospacer
*******.********* ***** .   ****

52. spacer 3.1|2416784|32|NC_008380|CRISPRCasFinder matches to NZ_CP021799 (Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.781

cggtttttcgtccggaattgcgcagaaacaag	CRISPR spacer
cggttttccgtccggaagtgcgccatttcaag	Protospacer
*******.********* ***** .   ****

53. spacer 3.1|2416784|32|NC_008380|CRISPRCasFinder matches to NZ_CP021823 (Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.781

cggtttttcgtccggaattgcgcagaaacaag	CRISPR spacer
cggttttccgtccggaagtgcgccatttcaag	Protospacer
*******.********* ***** .   ****

54. spacer 3.1|2416784|32|NC_008380|CRISPRCasFinder matches to NZ_CP021814 (Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.781

cggtttttcgtccggaattgcgcagaaacaag	CRISPR spacer
cggttttccgtccggaagtgcgcgatttcaag	Protospacer
*******.********* *****..   ****

55. spacer 3.1|2416784|32|NC_008380|CRISPRCasFinder matches to NZ_CP026527 (Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence) position: , mismatch: 7, identity: 0.781

cggtttttcgtccggaattgcgcagaaacaag	CRISPR spacer
cggttttccgtccggaagtgcgccatttcaag	Protospacer
*******.********* ***** .   ****

56. spacer 3.1|2416784|32|NC_008380|CRISPRCasFinder matches to NZ_CP019484 (Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence) position: , mismatch: 7, identity: 0.781

cggtttttcgtccggaattgcgcagaaacaag	CRISPR spacer
cggttttccgtccggaagtgcgccatttcaag	Protospacer
*******.********* ***** .   ****

57. spacer 3.1|2416784|32|NC_008380|CRISPRCasFinder matches to NZ_CP019487 (Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence) position: , mismatch: 7, identity: 0.781

cggtttttcgtccggaattgcgcagaaacaag	CRISPR spacer
cggttttccgtccggaagtgcgccatttcaag	Protospacer
*******.********* ***** .   ****

58. spacer 3.1|2416784|32|NC_008380|CRISPRCasFinder matches to NC_020560 (Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence) position: , mismatch: 7, identity: 0.781

cggtttttcgtccggaattgcgcagaaacaag	CRISPR spacer
cggttttccgtccggaagtgcgccatttcaag	Protospacer
*******.********* ***** .   ****

59. spacer 3.1|2416784|32|NC_008380|CRISPRCasFinder matches to NZ_CP050082 (Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b4, complete sequence) position: , mismatch: 7, identity: 0.781

cggtttttcgtccggaattgcgcagaaacaag	CRISPR spacer
gggttttgcgtccggaattgcgtagagcaaac	Protospacer
 ****** **************.***.  **

60. spacer 3.1|2416784|32|NC_008380|CRISPRCasFinder matches to NZ_CP049732 (Rhizobium leguminosarum strain A1 plasmid pRL11, complete sequence) position: , mismatch: 7, identity: 0.781

cggtttttcgtccggaattgcgcagaaacaag	CRISPR spacer
gggttttgcgtccggaattgcgtagagcaaac	Protospacer
 ****** **************.***.  **

61. spacer 3.1|2416784|32|NC_008380|CRISPRCasFinder matches to NC_017323 (Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence) position: , mismatch: 7, identity: 0.781

cggtttttcgtccggaattgcgcagaaacaag	CRISPR spacer
cggttttccgtccggaagtgcgccatttcaag	Protospacer
*******.********* ***** .   ****

62. spacer 3.1|2416784|32|NC_008380|CRISPRCasFinder matches to NZ_CP009146 (Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence) position: , mismatch: 7, identity: 0.781

cggtttttcgtccggaattgcgcagaaacaag	CRISPR spacer
cggttttccgtccggaagtgcgccatttcaag	Protospacer
*******.********* ***** .   ****

63. spacer 3.1|2416784|32|NC_008380|CRISPRCasFinder matches to NC_018701 (Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence) position: , mismatch: 7, identity: 0.781

cggtttttcgtccggaattgcgcagaaacaag	CRISPR spacer
cggttttccgtccggaagtgcgccatttcaag	Protospacer
*******.********* ***** .   ****

64. spacer 3.1|2416784|32|NC_008380|CRISPRCasFinder matches to NZ_CP021828 (Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.781

cggtttttcgtccggaattgcgcagaaacaag	CRISPR spacer
cggttttccgtccggaagtgcgccatttcaag	Protospacer
*******.********* ***** .   ****

65. spacer 3.1|2416784|32|NC_008380|CRISPRCasFinder matches to NZ_CP021802 (Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.781

cggtttttcgtccggaattgcgcagaaacaag	CRISPR spacer
cggttttccgtccggaagtgcgccatttcaag	Protospacer
*******.********* ***** .   ****

66. spacer 3.1|2416784|32|NC_008380|CRISPRCasFinder matches to NZ_CP021810 (Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.781

cggtttttcgtccggaattgcgcagaaacaag	CRISPR spacer
cggttttccgtccggaagtgcgccatttcaag	Protospacer
*******.********* ***** .   ****

67. spacer 3.1|2416784|32|NC_008380|CRISPRCasFinder matches to NC_019849 (Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence) position: , mismatch: 7, identity: 0.781

cggtttttcgtccggaattgcgcagaaacaag	CRISPR spacer
cggttttccgtccggaagtgcgccatttcaag	Protospacer
*******.********* ***** .   ****

68. spacer 3.1|2416784|32|NC_008380|CRISPRCasFinder matches to NZ_CP019586 (Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence) position: , mismatch: 7, identity: 0.781

cggtttttcgtccggaattgcgcagaaacaag	CRISPR spacer
cggttttccgtccggaagtgcgccatttcaag	Protospacer
*******.********* ***** .   ****

69. spacer 3.1|2416784|32|NC_008380|CRISPRCasFinder matches to NZ_CP021831 (Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.781

cggtttttcgtccggaattgcgcagaaacaag	CRISPR spacer
cggttttccgtccggaagtgcgccatttcaag	Protospacer
*******.********* ***** .   ****

70. spacer 3.1|2416784|32|NC_008380|CRISPRCasFinder matches to NZ_CP021806 (Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.781

cggtttttcgtccggaattgcgcagaaacaag	CRISPR spacer
cggttttccgtccggaagtgcgccatttcaag	Protospacer
*******.********* ***** .   ****

71. spacer 3.1|2416784|32|NC_008380|CRISPRCasFinder matches to NC_017326 (Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence) position: , mismatch: 7, identity: 0.781

cggtttttcgtccggaattgcgcagaaacaag	CRISPR spacer
cggttttccgtccggaagtgcgccatttcaag	Protospacer
*******.********* ***** .   ****

72. spacer 3.1|2416784|32|NC_008380|CRISPRCasFinder matches to NZ_CP021820 (Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.781

cggtttttcgtccggaattgcgcagaaacaag	CRISPR spacer
cggttttccgtccggaagtgcgccatttcaag	Protospacer
*******.********* ***** .   ****

73. spacer 3.1|2416784|32|NC_008380|CRISPRCasFinder matches to NZ_CP021795 (Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.781

cggtttttcgtccggaattgcgcagaaacaag	CRISPR spacer
cggttttccgtccggaagtgcgccatttcaag	Protospacer
*******.********* ***** .   ****

74. spacer 3.1|2416784|32|NC_008380|CRISPRCasFinder matches to NZ_HG938354 (Neorhizobium galegae bv. orientalis str. HAMBI 540 plasmid pHAMBI540a, complete sequence) position: , mismatch: 7, identity: 0.781

cggtttttcgtccggaattgcgcagaaacaag	CRISPR spacer
cggttttccgttcggaattgcgcagcgcaaaa	Protospacer
*******.***.************* .  **.

75. spacer 3.1|2416784|32|NC_008380|CRISPRCasFinder matches to NZ_HG938356 (Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141 plasmid pHAMBI1141a, complete sequence) position: , mismatch: 7, identity: 0.781

cggtttttcgtccggaattgcgcagaaacaag	CRISPR spacer
cggttttccgttcggaattgcgcagcgcaaaa	Protospacer
*******.***.************* .  **.

76. spacer 3.1|2416784|32|NC_008380|CRISPRCasFinder matches to NZ_CP021218 (Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence) position: , mismatch: 7, identity: 0.781

cggtttttcgtccggaattgcgcagaaacaag	CRISPR spacer
cggttttccgtccggaagtgcgcgatttcaag	Protospacer
*******.********* *****..   ****

77. spacer 3.1|2416784|32|NC_008380|CRISPRCasFinder matches to NZ_CP053208 (Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1B, complete sequence) position: , mismatch: 7, identity: 0.781

cggtttttcgtccggaattgcgcagaaacaag	CRISPR spacer
gggttttgcgtccggaattgcgtagagcaaac	Protospacer
 ****** **************.***.  **

78. spacer 3.1|2416784|32|NC_008380|CRISPRCasFinder matches to NZ_CP023068 (Ensifer sojae CCBAU 05684 plasmid pSJ05684b, complete sequence) position: , mismatch: 7, identity: 0.781

cggtttttcgtccggaattgcgcagaaacaag	CRISPR spacer
gggttttccgtccggaattgcggagtttcaaa	Protospacer
 ******.************** **   ***.

79. spacer 3.1|2416784|32|NC_008380|CRISPRCasFinder matches to NZ_CP015881 (Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence) position: , mismatch: 7, identity: 0.781

cggtttttcgtccggaattgcgcagaaacaag	CRISPR spacer
cggttttccgtccggaattgtgctcagaaaat	Protospacer
*******.************.**  *.* **

80. spacer 3.1|2416784|32|NC_008380|CRISPRCasFinder matches to NZ_CP030263 (Ensifer adhaerens strain Corn53 plasmid AA, complete sequence) position: , mismatch: 7, identity: 0.781

cggtttttcgtccggaattgcgcagaaacaag	CRISPR spacer
cggttttccgtccggaattgtgctcagaaaat	Protospacer
*******.************.**  *.* **

81. spacer 3.1|2416784|32|NC_008380|CRISPRCasFinder matches to NZ_CP015232 (Epibacterium mobile F1926 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

cggtttttcgtccggaattgcgcagaaacaag	CRISPR spacer
cggttctgcgtccggaattgcgcggtcagatc	Protospacer
*****.* ***************.*  * *

82. spacer 3.1|2416784|32|NC_008380|CRISPRCasFinder matches to NZ_LR027555 (Epibacterium mobile isolate EPIB1 plasmid 3, complete sequence) position: , mismatch: 8, identity: 0.75

cggtttttcgtccggaattgcgcagaaacaag	CRISPR spacer
cggttctgcgtccggaattgcgcggtcagatc	Protospacer
*****.* ***************.*  * *

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1693674 : 1702942

Escherichia_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011651299.1\|1693674_1694973_+	serine hydroxymethyltransferase	A0A219Y950	Aeromonas_phage	2.2e-98	51.3
WP_003547190.1\|1694982_1695459_+	transcriptional repressor NrdR	NA	NA	NA	NA
WP_011651300.1\|1695462_1696809_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A1V0SE20	Indivirus	8.8e-34	40.5
WP_026158618.1\|1696808_1697420_+	riboflavin synthase	A0A2I2L4R9	Orpheovirus	2.6e-17	35.4
WP_028741432.1\|1697541_1698411_-	glucose-1-phosphate thymidylyltransferase RfbA	K7QKA7	Escherichia_phage	1.2e-95	59.2
WP_011651303.1\|1698421_1699309_-	dTDP-4-dehydrorhamnose reductase	A0A1D7XFA3	Escherichia_phage	2.7e-31	38.8
WP_011651304.1\|1699312_1700368_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	6.3e-96	52.2
WP_011651305.1\|1700374_1700953_-	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A218MN57	uncultured_virus	5.5e-33	44.9
WP_011651306.1\|1700977_1702942_-	hypothetical protein	F2Y0P4	Organic_Lake_phycodnavirus	2.3e-06	37.7

DBSCAN-SWA_2

1766445 : 1777277

Bacillus_phage(16.67%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011651360.1\|1766445_1767861_-	diguanylate cyclase	A0A127AWB9	Bacillus_phage	7.6e-12	33.5
WP_003547334.1\|1768135_1768765_+	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	9.4e-63	59.2
WP_003547337.1\|1769068_1770346_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	7.9e-133	58.6
WP_003547341.1\|1770749_1773167_+	endopeptidase La	A0A0R6PGP8	Moraxella_phage	2.5e-204	49.4
WP_011651361.1\|1773373_1773649_+	HU family DNA-binding protein	A0A172Q061	Acinetobacter_phage	7.1e-07	33.3
WP_086935544.1\|1774083_1774983_+	DMT family transporter	NA	NA	NA	NA
WP_173364434.1\|1775066_1777277_+	esterase-like activity of phytase family protein	M4SLV1	Cyanophage	2.4e-81	43.4

DBSCAN-SWA_3

2157012 : 2170512

uncultured_Mediterranean_phage(90.91%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011651653.1\|2157012_2158026_+	beta-N-acetylhexosaminidase	A0A1B1IVS3	uncultured_Mediterranean_phage	5.6e-25	42.6
WP_028742082.1\|2158044_2158902_+	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	5.6e-34	38.5
WP_011651655.1\|2158898_2159615_+	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	1.7e-39	47.8
WP_003538990.1\|2159798_2159990_+	twin-arginine translocase TatA/TatE family subunit	A0A1B1IVR9	uncultured_Mediterranean_phage	8.9e-09	72.1
WP_011651656.1\|2160040_2160652_+	twin-arginine translocase subunit TatB	NA	NA	NA	NA
WP_011651657.1\|2160648_2161476_+	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	2.8e-54	46.5
WP_011651658.1\|2161676_2162960_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	4.1e-97	45.3
WP_011651659.1\|2162964_2163738_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	2.4e-23	30.2
WP_011651660.1\|2163734_2164388_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	7.6e-15	33.5
WP_028742081.1\|2164629_2166231_+	peptidoglycan DD-metalloendopeptidase family protein	I3PV24	Clostridium_phage	8.6e-12	29.2
WP_011651662.1\|2166395_2167268_-	ATP-binding protein	NA	NA	NA	NA
WP_003539006.1\|2167578_2167926_+	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	1.4e-12	39.1
WP_011651663.1\|2167971_2170512_+	protein translocase subunit SecDF	A0A1B1IVP7	uncultured_Mediterranean_phage	1.1e-56	48.6

DBSCAN-SWA_4

2524790 : 2535308

uncultured_Mediterranean_phage(83.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011651966.1\|2524790_2527712_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	0.0e+00	62.1
WP_011651967.1\|2527974_2528484_+	single-stranded DNA-binding protein	R9TP78	Rhizobium_phage	1.2e-44	73.7
WP_011651968.1\|2528608_2529256_-	MarC family protein	NA	NA	NA	NA
WP_129557794.1\|2529317_2529500_+	hypothetical protein	NA	NA	NA	NA
WP_011651969.1\|2529492_2532330_+	DNA gyrase subunit A	A0A1B1IVS2	uncultured_Mediterranean_phage	3.0e-76	42.2
WP_003539654.1\|2532684_2532840_-	hypothetical protein	NA	NA	NA	NA
WP_028744078.1\|2532974_2533253_-	hypothetical protein	NA	NA	NA	NA
WP_011651971.1\|2533659_2534154_+	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	6.1e-25	37.2
WP_011651972.1\|2534196_2534769_+	peptidylprolyl isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	5.7e-43	53.2
WP_003539661.1\|2534798_2535308_+	peptidylprolyl isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	2.5e-45	59.4

DBSCAN-SWA_5

3568479 : 3582013

Vibrio_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011652885.1\|3568479_3570537_-	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	1.7e-36	33.6
WP_011652886.1\|3571005_3571353_-	GFA family protein	NA	NA	NA	NA
WP_011652887.1\|3571362_3572400_-	L-threonine 3-dehydrogenase	R9TPW0	Vibrio_phage	7.1e-15	68.6
WP_011652888.1\|3572589_3573777_-	glycine C-acetyltransferase	D2TEZ5	Emiliania_huxleyi_virus	3.2e-35	27.5
WP_011652889.1\|3573842_3574571_-	class I SAM-dependent methyltransferase	A0A1X9I6N4	Streptococcus_phage	5.2e-49	43.2
WP_011652890.1\|3574640_3576509_-	DNA helicase RecQ	L7RCS0	Acanthamoeba_polyphaga_moumouvirus	9.3e-74	35.1
WP_011652891.1\|3576508_3578518_-	DNA primase	A0A0K1LMQ9	Caulobacter_phage	2.7e-87	41.5
WP_011652892.1\|3579188_3580079_+	hypothetical protein	NA	NA	NA	NA
WP_011652893.1\|3580082_3580538_-	GatB/YqeY domain-containing protein	A0A292GL36	Xanthomonas_phage	5.3e-15	38.7
WP_011652894.1\|3580807_3582013_+	glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit	R4TGJ8	Halovirus	1.6e-39	32.6

DBSCAN-SWA_6

4167928 : 4180509

Sinorhizobium_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011653372.1\|4167928_4168402_-	hypothetical protein	F8TUR4	EBPR_podovirus	2.9e-32	56.3
WP_086935562.1\|4168337_4168517_-	hypothetical protein	NA	NA	NA	NA
WP_018449515.1\|4168517_4168754_-	hypothetical protein	NA	NA	NA	NA
WP_041936451.1\|4168875_4169127_+	hypothetical protein	NA	NA	NA	NA
WP_086935563.1\|4169290_4169479_+	DUF2158 domain-containing protein	NA	NA	NA	NA
WP_041936452.1\|4169491_4169719_+	hypothetical protein	NA	NA	NA	NA
WP_129557802.1\|4169868_4170558_-	hypothetical protein	A0A076G6H3	Sinorhizobium_phage	6.5e-17	41.6
WP_129557803.1\|4170650_4171307_+	hypothetical protein	NA	NA	NA	NA
WP_162039369.1\|4171327_4172932_-	AAA family ATPase	A0A1X9SGS1	Bradyrhizobium_phage	2.3e-89	38.5
WP_011653379.1\|4173124_4173898_-	DUF1376 domain-containing protein	A9YWY6	Burkholderia_phage	1.3e-05	33.3
WP_011653380.1\|4173887_4174130_-	hypothetical protein	NA	NA	NA	NA
WP_011653381.1\|4174126_4174396_-	hypothetical protein	NA	NA	NA	NA
WP_011653382.1\|4174488_4175268_+	helix-turn-helix transcriptional regulator	A0A291AUR9	Sinorhizobium_phage	2.2e-08	24.8
WP_011653383.1\|4175345_4176083_+	Rha family transcriptional regulator	A0A1W6JTB2	Pseudomonas_phage	1.8e-36	39.8
WP_086935586.1\|4176303_4176768_-	Arc family DNA-binding protein	H6WRU6	Salmonella_phage	8.3e-08	68.1
WP_086935565.1\|4176914_4177064_+	Arc family DNA-binding protein	NA	NA	NA	NA
WP_011653385.1\|4177083_4177494_+	hypothetical protein	NA	NA	NA	NA
WP_011653386.1\|4177549_4177858_+	hypothetical protein	NA	NA	NA	NA
WP_011653387.1\|4177854_4178124_+	hypothetical protein	NA	NA	NA	NA
WP_011653388.1\|4178116_4178779_+	hypothetical protein	NA	NA	NA	NA
WP_011653389.1\|4178907_4180509_+	recombinase family protein	R9TP69	Rhizobium_phage	4.2e-99	38.5

DBSCAN-SWA_7

4511298 : 4521429

Mycobacterium_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011653649.1\|4511298_4512009_+	7-cyano-7-deazaguanine synthase QueC	A0A2P1JXV3	Rhodococcus_phage	2.1e-50	49.6
WP_026238688.1\|4512008_4512365_+	6-carboxytetrahydropterin synthase QueD	NA	NA	NA	NA
WP_011653651.1\|4512361_4513105_+	7-carboxy-7-deazaguanine synthase QueE	A0A1U9WRB6	Streptococcus_virus	5.0e-39	37.2
WP_028744157.1\|4513123_4514347_-	adenylate/guanylate cyclase domain-containing protein	M1HLN3	Pelagibacter_phage	1.2e-13	28.8
WP_011653653.1\|4514451_4515426_-	class 1b ribonucleoside-diphosphate reductase subunit beta	R4TBI6	Mycobacterium_phage	1.6e-138	74.1
WP_028744155.1\|4515661_4517866_-	class 1b ribonucleoside-diphosphate reductase subunit alpha	V9VI16	Lactococcus_phage	3.9e-212	52.1
WP_011653655.1\|4517844_4518252_-	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	A0A142F1R4	Bacillus_phage	3.3e-16	42.7
WP_011653656.1\|4518266_4518488_-	glutaredoxin-like protein NrdH	V5UN81	Mycobacterium_phage	8.7e-16	50.7
WP_011653657.1\|4519158_4521429_-	cadmium-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	4.5e-123	40.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NC_008382

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

23646 : 68739

Escherichia_phage(27.27%)

transposase,integrase

attL 12825:12842|attR 68329:68346

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
12825:12842	attL	NA	NA	NA	NA
WP_041936623.1\|23646_24399_-\|transposase	IS6-like element ISRle6 family transposase	A0A077SL39	Escherichia_phage	1.3e-42	46.2
WP_162039381.1\|24349_24502_-	hypothetical protein	NA	NA	NA	NA
WP_011654519.1\|24966_26607_+	hypothetical protein	NA	NA	NA	NA
WP_011654520.1\|26705_28331_+	effector protein	NA	NA	NA	NA
WP_041936626.1\|28920_29100_-	hypothetical protein	NA	NA	NA	NA
WP_122330883.1\|29120_30310_-\|transposase	IS3-like element ISRle4 family transposase	S5WIU1	Leptospira_phage	3.7e-52	44.0
WP_011654523.1\|30802_31381_+	winged helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_011654524.1\|32855_33614_+	ATP-binding protein	A0A059NT77	Lactococcus_phage	2.7e-40	39.7
WP_011654526.1\|34406_35597_+	plasmid partitioning protein RepA	A0A240F4U1	Ochrobactrum_phage	1.7e-76	47.1
WP_011654527.1\|35586_36801_+	replication initiation protein RepC	L7TKN6	Rhizobium_phage	8.3e-15	26.5
WP_011654529.1\|37061_37442_+	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_011654530.1\|37564_37996_+	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_041936627.1\|38943_39858_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_122330884.1\|39851_40652_-\|integrase	tyrosine-type recombinase/integrase	A0A0K2CP59	Brevibacillus_phage	3.4e-09	23.4
WP_086935589.1\|40923_41478_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_157865229.1\|41405_41834_-	winged helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_011654535.1\|41906_42293_+	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_011654536.1\|42289_42634_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_011654537.1\|42708_44301_+\|transposase	IS66-like element ISRle3 family transposase	A0A218MNE7	uncultured_virus	1.2e-53	33.1
WP_041936629.1\|44288_44492_-	hypothetical protein	NA	NA	NA	NA
WP_086935590.1\|45432_46221_-	hypothetical protein	NA	NA	NA	NA
WP_157865232.1\|46572_46824_+	hypothetical protein	NA	NA	NA	NA
WP_011654541.1\|46774_47527_+\|transposase	IS6-like element ISRle7 family transposase	A0A077SL39	Escherichia_phage	1.3e-39	43.3
WP_011654541.1\|50613_51366_-\|transposase	IS6-like element ISRle7 family transposase	A0A077SL39	Escherichia_phage	1.3e-39	43.3
WP_049778425.1\|54983_55649_+\|transposase	IS6 family transposase	NA	NA	NA	NA
WP_011654551.1\|56322_56460_+	hypothetical protein	NA	NA	NA	NA
WP_011654552.1\|56588_58643_+	type IV secretion system ATPase VirD4	NA	NA	NA	NA
WP_122330894.1\|60319_61156_+	two-component sensor histidine kinase	W8CYF6	Bacillus_phage	6.5e-11	26.2
WP_011654554.1\|61349_62072_+	response regulator	NA	NA	NA	NA
WP_011653555.1\|63335_64670_+\|transposase	ISNCY-like element ISRle10 family transposase	NA	NA	NA	NA
WP_011654558.1\|66006_67203_-\|integrase	tyrosine-type recombinase/integrase	A0A1P8DJ76	Virus_Rctr85	3.4e-05	44.3
WP_049778427.1\|67673_68003_+	response regulator	NA	NA	NA	NA
WP_011654560.1\|68034_68739_-\|transposase	IS6 family transposase	NA	NA	NA	NA
68329:68346	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NC_008381

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

5130 : 56093

Acidianus_tailed_spindle_virus(25.0%)

integrase,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011654075.1\|5130_6273_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_011654076.1\|6269_6599_-	hypothetical protein	NA	NA	NA	NA
WP_011654077.1\|6610_6988_-	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_011654078.1\|6984_7275_-	type II toxin-antitoxin system prevent-host-death family antitoxin	NA	NA	NA	NA
WP_011654080.1\|7982_8258_+	type II toxin-antitoxin system ParD family antitoxin	NA	NA	NA	NA
WP_173364459.1\|8238_8589_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_011654082.1\|8594_9749_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_041936846.1\|9873_10824_+	DUF1403 family protein	NA	NA	NA	NA
WP_041936814.1\|10826_11516_+	SMC-Scp complex subunit ScpB	NA	NA	NA	NA
WP_011654085.1\|11535_12582_-	TniQ family protein	NA	NA	NA	NA
WP_041936815.1\|12578_13460_-	TniB family NTP-binding protein	NA	NA	NA	NA
WP_011654087.1\|13462_15115_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_049778462.1\|15302_15665_+	hypothetical protein	NA	NA	NA	NA
WP_011654089.1\|16774_17290_+	DUF1269 domain-containing protein	NA	NA	NA	NA
WP_011654090.1\|17422_18271_+	bile acid:sodium symporter	NA	NA	NA	NA
WP_011654091.1\|18603_19677_+	DUF1612 and helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_028743875.1\|19709_20651_+	DUF4238 domain-containing protein	NA	NA	NA	NA
WP_011654093.1\|20764_21328_+	hypothetical protein	NA	NA	NA	NA
WP_011654094.1\|21372_22086_+	hypothetical protein	NA	NA	NA	NA
WP_157865245.1\|22099_23455_-	N-6 DNA methylase	NA	NA	NA	NA
WP_122330917.1\|23796_24411_-	hypothetical protein	NA	NA	NA	NA
WP_011654097.1\|24626_26879_-	hypothetical protein	NA	NA	NA	NA
WP_011654098.1\|26882_31109_-	helicase	NA	NA	NA	NA
WP_122330910.1\|31111_33127_-	hypothetical protein	NA	NA	NA	NA
WP_032993442.1\|34042_35032_+	hypothetical protein	NA	NA	NA	NA
WP_011654101.1\|36332_38795_-	S8 family peptidase	NA	NA	NA	NA
WP_011654102.1\|38810_39794_-	ATP-binding protein	A0A125SJ49	Acidianus_tailed_spindle_virus	1.1e-14	30.5
WP_028743871.1\|40001_40259_-	hypothetical protein	NA	NA	NA	NA
WP_011654104.1\|40676_42401_+	hypothetical protein	NA	NA	NA	NA
WP_028743870.1\|42467_43550_-	DNA polymerase IV	NA	NA	NA	NA
WP_011654106.1\|43627_44305_-	SOS response-associated peptidase	A0A291AUP1	Sinorhizobium_phage	1.3e-49	44.5
WP_011654107.1\|44382_44643_-	hypothetical protein	NA	NA	NA	NA
WP_011654108.1\|44847_45603_+	hypothetical protein	NA	NA	NA	NA
WP_011652217.1\|50622_51819_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_011652218.1\|51825_52704_-\|integrase	tyrosine-type recombinase/integrase	S5W9T9	Leptospira_phage	3.5e-31	31.7
WP_028743868.1\|54180_55101_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_011654112.1\|55097_56093_+\|integrase	site-specific integrase	A0A1B1IQT7	uncultured_Mediterranean_phage	2.7e-11	27.0

DBSCAN-SWA_2

90822 : 168191

Staphylococcus_phage(21.43%)

integrase,transposase

attL 150634:150693|attR 168486:170028

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_028744323.1\|90822_91113_+\|transposase	IS6 family transposase	NA	NA	NA	NA
WP_011654150.1\|92765_94715_-	RiPP maturation radical SAM protein 1	NA	NA	NA	NA
WP_011654151.1\|94711_96202_-	radical SAM family RiPP maturation amino acid epimerase	NA	NA	NA	NA
WP_011654152.1\|96239_96650_-	hypothetical protein	NA	NA	NA	NA
WP_155251706.1\|96777_96927_-	hypothetical protein	NA	NA	NA	NA
WP_155251706.1\|98350_98500_+	hypothetical protein	NA	NA	NA	NA
WP_077979378.1\|99269_100493_+	hypothetical protein	A0A0P0YLY7	Yellowstone_lake_phycodnavirus	1.0e-12	24.2
WP_011654153.1\|100550_101723_+	iron-containing alcohol dehydrogenase	NA	NA	NA	NA
WP_011654154.1\|101719_102418_+	hypothetical protein	NA	NA	NA	NA
WP_011654155.1\|102421_103528_+	class III poly(R)-hydroxyalkanoic acid synthase subunit PhaC	NA	NA	NA	NA
WP_032993738.1\|104047_104851_+	hypothetical protein	NA	NA	NA	NA
WP_011654158.1\|104931_105141_+	hypothetical protein	NA	NA	NA	NA
WP_011654159.1\|105520_106768_+	plasmid partitioning protein RepA	A0A240F4U1	Ochrobactrum_phage	2.2e-63	39.4
WP_028744274.1\|107668_108514_-	hypothetical protein	A0A291LAE0	Escherichia_phage	1.7e-54	42.6
WP_011654162.1\|108500_109142_-	HAD family hydrolase	K4JW67	Caulobacter_phage	3.3e-15	30.0
WP_011654164.1\|110362_110620_+	hypothetical protein	NA	NA	NA	NA
WP_011654165.1\|113852_115526_+	acyl CoA:acetate/3-ketoacid CoA transferase	NA	NA	NA	NA
WP_011654167.1\|116097_118062_+	acetate--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	3.7e-81	36.7
WP_011654168.1\|118168_118783_+	adenylate kinase	NA	NA	NA	NA
WP_011654169.1\|119498_119996_+	hypothetical protein	R9U4A9	Rhizobium_phage	8.9e-24	49.6
WP_011654171.1\|121680_122034_-	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	3.6e-19	45.2
WP_162039391.1\|122014_122461_-\|transposase	transposase	A0A0P0ZBP6	Stx2-converting_phage	5.7e-06	46.8
WP_028744160.1\|122495_122705_+	hypothetical protein	A0A0F6WBX9	Sinorhizobium_phage	7.8e-06	54.3
WP_028744161.1\|123217_123862_-	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	3.2e-10	26.1
WP_011654175.1\|123854_124631_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	5.5e-12	25.6
WP_032993640.1\|124627_125584_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_028744162.1\|125583_126480_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_011654178.1\|126619_127894_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_122330914.1\|128476_129307_-	IclR family transcriptional regulator	NA	NA	NA	NA
WP_011654181.1\|129384_130836_+	NAD-dependent succinate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_028744164.1\|130861_132022_+	iron-containing alcohol dehydrogenase	NA	NA	NA	NA
WP_011654183.1\|132070_132862_+	N-acyl homoserine lactonase family protein	NA	NA	NA	NA
WP_011654184.1\|133029_134205_+	homoserine O-acetyltransferase	NA	NA	NA	NA
WP_122330919.1\|134672_135209_+	MerR family transcriptional regulator	NA	NA	NA	NA
WP_011654186.1\|135432_137496_-	recombinase family protein	A0A1B2LRQ3	Wolbachia_phage	2.2e-07	23.4
WP_028744172.1\|141052_141415_+	hypothetical protein	NA	NA	NA	NA
WP_011654188.1\|141785_142037_+	acyl carrier protein	NA	NA	NA	NA
WP_011654189.1\|142036_143218_+	acyl-CoA/acyl-ACP dehydrogenase	NA	NA	NA	NA
WP_011654190.1\|144144_144819_+	transcriptional regulator	NA	NA	NA	NA
WP_011654191.1\|144948_145503_+	hypothetical protein	NA	NA	NA	NA
WP_026264770.1\|147198_147909_-	hypothetical protein	NA	NA	NA	NA
WP_011654195.1\|149868_150102_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
150634:150693	attL	NA	NA	NA	NA
WP_011654196.1\|150987_152163_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_011654197.1\|152176_153037_-\|integrase	tyrosine-type recombinase/integrase	S5W9T9	Leptospira_phage	1.4e-32	34.1
WP_011654198.1\|153183_153549_-	hypothetical protein	NA	NA	NA	NA
WP_011654200.1\|154962_155286_-	ferredoxin III, nif-specific	NA	NA	NA	NA
WP_011654201.1\|155640_156978_-	nitrogenase iron-molybdenum cofactor biosynthesis protein NifN	NA	NA	NA	NA
WP_011654202.1\|157032_158454_-	nitrogenase iron-molybdenum cofactor biosynthesis protein NifE	NA	NA	NA	NA
WP_011654203.1\|158507_160049_-	nitrogenase molybdenum-iron protein subunit beta	NA	NA	NA	NA
WP_011654204.1\|160139_161645_-	nitrogenase molybdenum-iron protein alpha chain	NA	NA	NA	NA
WP_011654205.1\|161747_162641_-	nitrogenase iron protein	NA	NA	NA	NA
WP_020048084.1\|164895_165054_-	hypothetical protein	NA	NA	NA	NA
WP_011654208.1\|165376_165928_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_011654197.1\|166141_167002_+\|integrase	tyrosine-type recombinase/integrase	S5W9T9	Leptospira_phage	1.4e-32	34.1
WP_011654196.1\|167015_168191_+\|transposase	IS91 family transposase	NA	NA	NA	NA
168486:170028	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_008384

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NC_008380

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NC_008382

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. NC_008381

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection