CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
NC_008313	Cupriavidus necator H16 chromosome 1, complete sequence	1 crisprs	RT,csa3,c2c9_V-U4,DinG,DEDDh,WYL,cas3	3
NC_008314	Cupriavidus necator H16 chromosome 2, complete sequence	1 crisprs	DEDDh,csa3,DinG	0
NC_005241	Cupriavidus necator H16 megaplasmid pHG1, complete sequence	0 crisprs	NA	2

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_008313_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_008313_1

3494181-3494289

Orphan

Consensus_repeat	Method
GTAGCCGCCGCGCTCTTCGGCCAGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_008313_1

>merge|NC_008313|1|3494181-3494289|CRISPRCasFinder
GTAGCCGCCGCGCTCTTCGGCCAGCAGCTTGAGCGAGTCTTGCGGCAGGATGCCACGGTCCCACAGCGAACCTTCATAGCTGCTGTAGCGGCCGCGCTCTTCGGCCAGC

>NC_008313|1|1|3494181-3494289|CRISPRCasFinder
GTAGCCGCCGCGCTCTTCGGCCAGC	AGCTTGAGCGAGTCTTGCGGCAGGATGCCACGGTCCCACAGCGAACCTTCATAGCTGCT
GTAGCGGCCGCGCTCTTCGGCCAGC

Protein	Signature genes	Signature genes Name	Protein_function
NC_008313.1\|WP_010814736.1\|3501583_3502522_-\|cytochrome-c-biogenesis-protein-CcsA	unknown	unknown	gnl\|CDD\|226621
NC_008313.1\|WP_136227794.1\|3482653_3483415_+\|PAAR-domain-containing-protein	unknown	unknown	gnl\|CDD\|269829
NC_008313.1\|WP_011616075.1\|3504114_3504657_+\|hypoxanthine-guanine-phosphoribosyltransferase	unknown	unknown	gnl\|CDD\|181675
NC_008313.1\|WP_081225777.1\|3486318_3486534_+\|type-I-addiction-module-toxin,-SymE-family	unknown	unknown	gnl\|CDD\|370150
NC_008313.1\|WP_011616076.1\|3505454_3506348_-\|2OG-Fe(II)-oxygenase	unknown	unknown	gnl\|CDD\|177683
NC_008313.1\|WP_011616064.1\|3483417_3483981_+\|hypothetical-protein	unknown	unknown	unknown
NC_008313.1\|WP_011616077.1\|3506344_3507088_-\|lytic-transglycosylase-domain-containing-protein	unknown	unknown	gnl\|CDD\|381594
NC_008313.1\|WP_010814735.1\|3501274_3501577_-\|hypothetical-protein	unknown	unknown	unknown
NC_008313.1\|WP_136227793.1\|3479975_3481694_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224055
NC_008313.1\|WP_051398498.1\|3481877_3482123_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|366102
NC_008313.1\|WP_051398499.1\|3482156_3482453_+\|TetR/AcrR-family-transcriptional-regulator-C-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|379522
NC_008313.1\|WP_193385846.1\|3497521_3499147_-\|sigma-54-dependent-Fis-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225114
NC_008313.1\|WP_010814734.1\|3499172_3501278_-\|PAS-domain-containing-protein	unknown	unknown	gnl\|CDD\|223715
NC_008313.1\|WP_011616071.1\|3492020_3493208_-\|ribonucleotide-diphosphate-reductase-subunit-beta	unknown	unknown	gnl\|CDD\|235968
NC_008313.1\|WP_157886289.1\|3487047_3489408_+\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|276809
NC_008313.1\|WP_011616066.1\|3484542_3485340_+\|NYN-domain-containing-protein	unknown	unknown	gnl\|CDD\|350237
NC_008313.1\|WP_010814739.1\|3504703_3505318_-\|LysE-family-translocator	unknown	unknown	gnl\|CDD\|224199
NC_008313.1\|WP_011616070.1\|3490486_3491521_-\|DGQHR-domain-containing-protein	unknown	unknown	gnl\|CDD\|274476
NC_008313.1\|WP_010814737.1\|3502663_3504058_+\|signal-recognition-particle-protein	unknown	unknown	gnl\|CDD\|236780
NC_008313.1\|WP_011616073.1\|3496907_3497525_-\|1,6-anhydro-N-acetylmuramyl-L-alanine-amidase-AmpD	unknown	unknown	gnl\|CDD\|236984

Protein	Function_ID	Function_description	E-value
NC_008313.1\|WP_010814736.1\|3501583_3502522_-\|cytochrome-c-biogenesis-protein-CcsA	gnl\|CDD\|226621	COG4137, COG4137, ABC-type uncharacterized transport system, permease component [General function prediction only].	2.65082e-70
NC_008313.1\|WP_136227794.1\|3482653_3483415_+\|PAAR-domain-containing-protein	gnl\|CDD\|269829	cd14744, PAAR_CT_2, proline-alanine-alanine-arginine (PAAR) domain with uncharacterized C-terminal extension. This domain is found in the PAAR (proline-alanine-alanine-arginine) repeat family of mostly beta- and gamma-proteobacteria, and forms a sharp conical extension on the VgrG spike, a trimeric protein complex of the bacterial type VI secretion system (T6SS). Most members contain C-terminal domain extensions corresponding to several uncharacterized domains such as S-type pyocin, DUF2235, DUF2345 and cytotoxic proteins. However, these terminal domains are exposed to solution, and do not distort the binding site of VgrG. The pointed tip of the PAAR domain is stabilized by a zinc atom positioned close to the cone's vertex and is likely to be important for its integrity during penetration of the target cell envelope. VgrG proteins are orthologous to the central baseplate spikes of bacteriophages with contractile tails, and genes encoding proteins with PAAR motifs have been frequently found immediately downstream from vgrG-like genes.	2.45024e-18
NC_008313.1\|WP_011616075.1\|3504114_3504657_+\|hypoxanthine-guanine-phosphoribosyltransferase	gnl\|CDD\|181675	PRK09162, PRK09162, hypoxanthine-guanine phosphoribosyltransferase; Provisional.	1.58358e-114
NC_008313.1\|WP_081225777.1\|3486318_3486534_+\|type-I-addiction-module-toxin,-SymE-family	gnl\|CDD\|370150	pfam08845, SymE_toxin, Toxin SymE, type I toxin-antitoxin system. SymE (SOS-induced yjiW gene with similarity to MazE ) is an SOS-induced toxin. It inhibits cell growth, decreases protein synthesis and increases RNA degradation. It may play a role in the recycling of RNAs damaged under SOS response-inducing conditions. It is predicted to have an AbrB fold, similar to that of the antitoxin MazE. Its translation is repressed by the antisense RNA SymR, which acts as an antitoxin.	1.22601e-09
NC_008313.1\|WP_011616076.1\|3505454_3506348_-\|2OG-Fe(II)-oxygenase	gnl\|CDD\|177683	PLN00052, PLN00052, prolyl 4-hydroxylase; Provisional.	5.60758e-45
NC_008313.1\|WP_011616077.1\|3506344_3507088_-\|lytic-transglycosylase-domain-containing-protein	gnl\|CDD\|381594	cd00254, LT-like, lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.	6.51948e-27
NC_008313.1\|WP_136227793.1\|3479975_3481694_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	7.40942e-69
NC_008313.1\|WP_051398498.1\|3481877_3482123_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|366102	pfam00440, TetR_N, Bacterial regulatory proteins, tetR family.	1.45891e-11
NC_008313.1\|WP_051398499.1\|3482156_3482453_+\|TetR/AcrR-family-transcriptional-regulator-C-terminal-domain-containing-protein	gnl\|CDD\|379522	pfam14246, TetR_C_7, AefR-like transcriptional repressor, C-terminal region. This family comprises the C-terminal domain of transcriptional regulators of the TetR family. It includes the AefR transcriptional regulator from P. syringae. It is found in association with pfam00440.	0.00191494
NC_008313.1\|WP_193385846.1\|3497521_3499147_-\|sigma-54-dependent-Fis-family-transcriptional-regulator	gnl\|CDD\|225114	COG2204, AtoC, Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms].	9.91435e-169
NC_008313.1\|WP_010814734.1\|3499172_3501278_-\|PAS-domain-containing-protein	gnl\|CDD\|223715	COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms].	1.3419e-24
NC_008313.1\|WP_011616071.1\|3492020_3493208_-\|ribonucleotide-diphosphate-reductase-subunit-beta	gnl\|CDD\|235968	PRK07209, PRK07209, ribonucleotide-diphosphate reductase subunit beta; Validated.	0
NC_008313.1\|WP_157886289.1\|3487047_3489408_+\|AAA-family-ATPase	gnl\|CDD\|276809	sd00006, TPR, Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.	3.14398e-06
NC_008313.1\|WP_011616066.1\|3484542_3485340_+\|NYN-domain-containing-protein	gnl\|CDD\|350237	cd11297, PIN_LabA-like_N_1, uncharacterized subfamily of N-terminal LabA-like PIN domains. This N-terminal LabA-like PIN domain is found in a well conserved group of mainly bacterial proteins with no defined function, which contain a C-terminal LabA_like_C domain. LabA from Synechococcus elongatus PCC 7942, (which does not contain this C-terminal domain), has been shown to play a role in cyanobacterial circadian timing. The LabA-like C-terminal domains characteristic of this subfamily may be related to the LOTUS domain family (which also co-occurs with LabA-like N-terminal domains). The function of the N-terminal domain is unknown. The LabA-like PIN domain family also includes the N-terminal domain of limkain b1, a human autoantigen localized to a subset of ABCD3 and PXF marked peroxisomes. Other members are the LabA-like PIN domains of human ZNF451, uncharacterized Bacillus subtilis YqxD and Escherichia coli YaiI. Curiously, a gene labeled NicB from Pseudomonas putida S16, which is described as a putative NADH-dependent hydroxylase involved in the microbial degradation of nicotine also falls into the LabA-like PIN family. The PIN (PilT N terminus) domain belongs to a large nuclease superfamily. The structural properties of the PIN domain indicate its active center, consisting of three highly conserved catalytic residues which coordinate metal ions; in some members, additional metal coordinating residues can be found while some others lack several of these key catalytic residues. The PIN active site is geometrically similar in the active center of structure-specific 5' nucleases, PIN-domain ribonucleases of eukaryotic rRNA editing proteins, and bacterial toxins of toxin-antitoxin (TA) operons.	3.91739e-47
NC_008313.1\|WP_010814739.1\|3504703_3505318_-\|LysE-family-translocator	gnl\|CDD\|224199	COG1280, RhtB, Putative threonine efflux protein [Amino acid transport and metabolism].	2.22062e-27
NC_008313.1\|WP_011616070.1\|3490486_3491521_-\|DGQHR-domain-containing-protein	gnl\|CDD\|274476	TIGR03187, hypothetical_protein, DGQHR domain. This highly divergent, uncharacterized domain has several absolutely conserved residues, including a QR pair and FxxxN motif. Its most striking feature, however, is a near invariant pentapeptide motif DGQHR. Several different subfamilies occur specifically as a part of DNA phosphorothioation systems, previously called DND (DNA instability during electrophoresis), while others (e.g. CPS_2936) occur in other contexts suggestive of lateral gene transfer (sporadic distribution of helicase-containing cassettes). The region described by this model is about 280 amino acids in length; additional sequences show local sequence similarity.	2.81835e-61
NC_008313.1\|WP_010814737.1\|3502663_3504058_+\|signal-recognition-particle-protein	gnl\|CDD\|236780	PRK10867, PRK10867, signal recognition particle protein; Provisional.	0
NC_008313.1\|WP_011616073.1\|3496907_3497525_-\|1,6-anhydro-N-acetylmuramyl-L-alanine-amidase-AmpD	gnl\|CDD\|236984	PRK11789, PRK11789, 1,6-anhydro-N-acetylmuramyl-L-alanine amidase AmpD.	2.24477e-123

>NC_008313.1|WP_011616071.1|3492020_3493208_-|ribonucleotide-diphosphate-reductase-subunit-beta
MLSWDDDVQATPQAAPQPALQPAAVAATADQQGVLPPAATQPGILGDNPNAAAAQSNRRVNAADKRVINGSTDVNQLVPFKYKWAWEKYLAGCANHWMPQEINMSRDIALWKDPNGLTEDERRIIKRNLGFFVTADSLAANNIVLGTYRQITAPECRQYLLRQAFEEAIHTHAYQYIVESLGLNEAEIFNAYHEVQSIRDKDEFLIPFIDTLTDPSFKTGTPENDQKLLKSLIVFACIMEGLFFYVGFTQILAMGRQNKMTGAAEQYQYILRDESLHCNFGIDLINQIKLENPHLWTAEFKAEITELFKKAVDLEYRYAEDTMPRGVLGLNAPMFKSYLRFICNRRCQQIGLDQLFPNEENPFPWMSEMIDLKKERNFFETRVIEYQTGGALSWD
>NC_008313.1|WP_011616070.1|3490486_3491521_-|DGQHR-domain-containing-protein
MTAAKKVIPRKRTTTPVSRRISESNSNRLRFSASLIQQGDKQFYSVTMPTDILAAHCFVTTRHEDVQNGFQRVLDKKRAEDIARYIDSGEGTIPGSIILSAQEDADLKVLQGKTLEFSAVPRAFLVLDGQHRVYGFRMATTAFRVPVVIYSGLTPVEEARLFIDINTKQRQVPNELLLDIKQLAQREDQRDTLLRQTFDLFSSDSASVMFGLMSPSSRQHNKISRVTFSLAMKPALAVFNAPTPLSVFQITNAYLAAFKDVLDKARVDASLTAPTTFRAVFDIFPEVARISAAQHGKNFSKQKFAAIINPIGDLLTRSKYEKASASVKTLGELFSSLIKKDFSI
>NC_008313.1|WP_157886289.1|3487047_3489408_+|AAA-family-ATPase
MSSSEQSDFDYLASRFHQPADGLPGELLDKATPLIRSFIYPDFLRGWYEATPNFGSPLISEIIEWVEFRNKVLAHGVTDQGDIRDWTPKAETLLKKALSIFSNSLPVYTEGSAELVLPNHFENLRISTPLVYNSKAVVISKITSKKGIWKLLGQQLCWENAAEFLVDLPRENVFSEQGFAKAGKFNCSTVICNGSPHTLFQNIPSRQTSIFEGRSKELEKLKAWINEPEESKSCLIYGDGGYGKTTLALEFLNQILDGRIELNAPPEIISYYTAKMTKWTDQGIVHFRGISGAMGDGIRELIYCLQDVLGKDWYKVEGTALIDKVQQQLKEQGYKRDDVLLVLDNTETLTSSTSDNEELEEFFNQVVRKIGRVIVTSRRRELLNATPIQVARLSDFESTALMRRLAKEYGAKPILQAGDNTLRKAGTQLMQKPLLIDALVRYIARTAVGIDEALTSILRKTNDQLLEFLYEDAWLRMTQGQRTVFLVLVAITCPADEFSIGHACQEVGIPHDEFILSLDETYFANQTKQGSTYELEIVELAKRFFSQKLAKLTSTDREEIMNYAAEVDRYAREREAIDREYKKDRVAEAFKGPYAKAAKIASEKGKISEAKEFYELAIQDDPLNSALHDRFAWFLLNKAHKLELAFIASAKAVELNDKNADALLTHGIILYHKNDIENGDKFISKANREGKSESVCLLRMGIGRYHYSKSINNRDAAIKIIEESIDLFDRSRHKLNSADKYYAKNSRDLQKYIALSQQLLHDIKMTKGILLSEVIKVTDLGGFDRA
>NC_008313.1|WP_081225777.1|3486318_3486534_+|type-I-addiction-module-toxin,-SymE-family
MRKISSTAHVRTFTTSYRHFRVKATEGNRYSGMRCVPWIRLGGVWLEQAGFKIGQALTVEVRNKVVVISSE
>NC_008313.1|WP_011616066.1|3484542_3485340_+|NYN-domain-containing-protein
MSAPPLVAESRVAVLVDCDNTTPEILDYALRVVAQFGRVVLRRGYGNQSTLGKTWQEALVRQAFTPCLQYQYAAGKNTADIALALDALEAMFDHRADKFCLVTSDSDFAYLCRKLRERGATVCIVGESKTPEALRNASDQFFEWTPAPTAVTEAVGGAPIQTKPTPPKQPQVKRRPRFVIEAISLLAANTSEGRVHLGALGQYLKRTDPSFSPASYGHSGLVDMLKTYDLLALKREAGGHYTVGLAEMGSSDTNAAAAPALATGN
>NC_008313.1|WP_011616064.1|3483417_3483981_+|hypothetical-protein
MTDTIISPNNKRMTKVTTRATTPINNDEPKSVYIKREYVEVFVFDSLPRPASAFGHVAIGIDGTVYSRAHERYYKGPLAEYLKSNTQRVKRDVVGLYLWVSPRERTIIRVELDRRVMADAEYSVLDNSCSSNVADVLEMIGIMAHDPRYLPMPVSPAELLAALEKSNRLVERRFYGKGYEGGASGNW
>NC_008313.1|WP_136227794.1|3482653_3483415_+|PAAR-domain-containing-protein
MQRLLNFLAVHSLRSMRTPGQAVAQRWGIEGGIFAVPFRLCLIAAITRVQFYPMVAICHDRWSFVHDKEKAMPDIRYALKNGDPTSTGGQLMAHTNHMIHHGVSVGVEGDIATCPACKSSGSVVNDCYPAFDLFGKQILVSGARVNCQCADKPFVFPTQNDFTIEVSRSGYDQTQTSSNAIHGGASEDRASVLAYDERFVIRDASSQEPVPSIAYAIRRGNGEIEHGTTDADGHTHLLSSVTQSEDVAIYVEG
>NC_008313.1|WP_051398499.1|3482156_3482453_+|TetR/AcrR-family-transcriptional-regulator-C-terminal-domain-containing-protein
MTIAEAPRFPQLARTVVDFAILGAARSFEPVFRTWAAGNPSDDEIAFVASPFLQSVAAEPFHRAVQGLDVAGLDAPRREKVRRAVRLFLRGFLQRGEG
>NC_008313.1|WP_051398498.1|3481877_3482123_+|helix-turn-helix-transcriptional-regulator
MDHATRLFIEHGYGATSVEAIAAAAGISKKTYYTRFAGKAEVFEAAVLRYVAQNLRTGQPAQADSEPLEERLVRMACELLE
>NC_008313.1|WP_136227793.1|3479975_3481694_+|ABC-transporter-ATP-binding-protein
MRFLMDLYKDWIFAYRITVREYPALPIHFCGATLFVTLVAALSTLVPYLLREATNALSVDATHSATGSPVLLAAAYGLAWTTARAFDWLKAMLSAAVLARCDAAFHNAIFARLIRVDYPRLTAEDPGKLVSVIARSRAAFSAITFAVFWAIVPTVLQLILSSIVLWQLTYRAFALGFAISMLLLFAATWFLADKSKSAHEEIFSGADMLSSHLVEKLGFMLDIKLNNAYAREDSALHRTLDVYIGKVTRGNTRLALLLAAQAICTGLLLTLFTVTTAYGVTRSAFRAGDFVMIVSYIVTLAMPFTALAGSLSDLRRNHLALRESFGLLELPIERSESSVHIDRTANEVCRIEHAVVTQGEKQLLQGVNITIRQGELVALTGPSGAGKSSLVHLMLGLARPAAGTVRLFGADVSKLSVSDIAREVAVAPQAPMILTGSLRANLTYGCDNPPSDHALHELIALLELDEIAAEGNGDILDRPLGIQGRALSGGERQRVALGRALARRPAVIILDEPTSSLDPEREARIFARVRQRVPTIIVITHRHALVQASDRVYRVANGSVQELAPSVADAAG
>NC_008313.1|WP_011616073.1|3496907_3497525_-|1,6-anhydro-N-acetylmuramyl-L-alanine-amidase-AmpD
MSKPEHRYLPEADGWVPAARRVPSPNFDERPAGMPVDLVVLHNISLPPGQFGSGDIEAFFQNRLDPNKHPYFATIHQVQVSAHFLVTREGELVQFVPCTQRAWHAGQSDFFGRARCNDFSIGIEIEGCDDLPFTLAQYDTVAALVPALLAAYPVRAIAGHSDIAPGRKTDPGPHFDWARFARQAGVAPGMLPYQCPGAAGQVTNP
>NC_008313.1|WP_193385846.1|3497521_3499147_-|sigma-54-dependent-Fis-family-transcriptional-regulator
MPPRMSRAPDPILVIDDEADLRELLDISIRRMGHDVVLAGSLAEAREKLAQRRYSLVLTDMRLGDGLGIEIVRQLSAAPERIPVAVITAYGSADNAVEALKAGAFDYIAKPVSLEQLRSLVLNALGRQQRDSTDAEAAAAEQAADRAAALLPGHSAAMLEVRRSLSRLARSMAPVVISGESGSGKERAARAIHATSGRAAHPFIAVNCGAIPENLMESEFFGHVKGAFTGADGERGGFFQAANGGTLLLDEVADLPLPMQVKLLRALQERRVRKIGASREDAVDVRVMCASHKDLAAMVSAGQFRQDLYYRLNVLALRMPTLRERGEDIPVLARAILDHLAVRYGDPRPKRLSPAALQRLVAYPFPGNVRELENLLERAYAFAESEEIELADLGPLDAGAERAGLMHAPAPAMAPTNYSAPWGAAGMWAPVPPAAAPAPAPAEPPPVVPAPASAPEPEPAGDPAERACRGIVFPIDLQARLEAVERELILQALAQTNFNRTAAAPLLGLNLRQLRYRIQQLGIREAMDAAERSTVEGEGTS
>NC_008313.1|WP_010814734.1|3499172_3501278_-|PAS-domain-containing-protein
MTEPASSGWQRLNAWRGLAQLWRQPEPPDFHWRLLRYFCWTRVAVGLLLVGFALMRRGEPASVTAITNAIPPVPFDLGGLGGIEHAAAMTIAVPYLGIAVAMLAGTLWRRHFHLRVRVQVLADLALLALVFSVLGRGGQAEGLAMIFLLPALEAGALTSLLFALFAASISALVVMSGPFMHTILLRQADAGLLGSGLFGLVFMIAALLMYMLANRQIAQERLALAREQELRLQQLVNRLMVNDMQDGVMLVRANGAVVAANPAAVVLLGVQPHERIYSRRLGGAAGQGGEAVLFDLRRIPRLQPLMEMLRDWLHSKDDVPRILQLLPMASGTALADGTMQHTRLRLRFVLPGLAGLRSTMAHGRTVPATLDTAAWSELSPEAAGRLRLAIAQNEAMAWSQEDEALLRNEMRDTVLVHIESWERIAEQVQQEKLAAMGRLVASIAHQIRNPLAAISQASELLGDSGRRDPAAQDHGGADVDIDARLLRIINDNVRRLDQVVSDVLQMSRRPRTGRSTVHLAQALPEIVERWRAEMRSRRPRAGETRPAGRADINANAIRLTVDVAQPVVFDASQLQQVLGNLLDNAWRYCSRLPGSIRLLAHALDQHHAELIVWNDGAEVAREHQRSLFEPFFTSNAQGTGLGLFMARELCGANDAQVRYGAIALPALLERTGMLAAAARDTLPAKAFVLTLRIESADAAAA
>NC_008313.1|WP_010814735.1|3501274_3501577_-|hypothetical-protein
MARILILLAVVLGVIWWLRARAEARLAEHRARQAREASERTAAAGPADATAEPMVQCAQCGVHLPQGEAIAWRGLHYCRRSHLPDESRAEGSDSSSGPRP
>NC_008313.1|WP_010814736.1|3501583_3502522_-|cytochrome-c-biogenesis-protein-CcsA
MVIVLYALTALLYCGLAFHGWATRHPRLATAAGPAGGATSAVLVAGGGPIPPAGGAHGEGRPAWWHVLMLAALASHGMLLHETIFPAERMMFGFAFALSAMLWLGVGIYWIESFFFSLAGLGLIVIPVALVASLMPLAFPGSQILGYAARPLFKLHFIIANVAYGLFTLAAFHAFLMLLAERRLHGFRHAPARPPEQQPSEWLGRWLDLLPPLLTLEKLLFRLIGAGFVLLTLTIGSGLLFSEDLFGRAFRLDHKTVFALISWAMFGGILAGRIFRGWRGKVALRWVIASFGILLLAYVGSRFVIEVVLHRL
>NC_008313.1|WP_010814737.1|3502663_3504058_+|signal-recognition-particle-protein
MLDNLTQRLARVVKTMRGEARLTEANTAEMLREVRLAMLEADVALPVVREFVARVKEKAMGEEVVSSLTPGQALVGVVQRELTAVIGGADAASGNNKEAELNLAVQPPAIILMAGLQGAGKTTTVGKLAKWLKENKKKKVLTVSCDVYRPAAIAQLKTVSEQVGADFFPSQPDQKPADIARAAVDWARKHYHDVLIVDTAGRLGIDELMMQEIAALHAELKPAETLFVVDAMLGQDAVNTAKAFNDTLPLTGVVLTKLDGDARGGAALSVRHITGRPIKFVGVGEKLDGLEPFYPDRMAQRILGMGDILALVEEAQRGVDMEAAEKLAKKIKKTGDFDLEDFKAQIGQMKKMGGLGSLVDKLPAQFAQQAQGANMDQAEKQVARMEGIINSMTPTERAKPELIKASRKRRIAAGAGVPVQEVNRLLNQFDQMQSMMKKLKGGGMMKMMRQMGAMKGGMKGLFNR
>NC_008313.1|WP_011616075.1|3504114_3504657_+|hypoxanthine-guanine-phosphoribosyltransferase
MMSAVQARELWANSEEIVSAAEVQASLDRMAAEITAKMGDAFPLVLSVMGGAVVFTGMLLPKLAFPLEFDYIHLSRYNNKTVGGEMQWRVAPRESVKDRVVLVLDDILDEGETMAAIRERIMDMGAKEFHAAVLCEKTLTKIKPMHPDFCGFAVPDRYVFGCGMDAKGYWRNLDSIRALV
>NC_008313.1|WP_010814739.1|3504703_3505318_-|LysE-family-translocator
MEVSQLAAGTGVFAAFAGFALVSSITPGPNNTMLLASGVNFGFVRTVPHLLGVSIGFALMVGLVGLGLGSMFHAFPWTWQVLRVVATVYLIWLAWKLATAGGVQDQQVKRPMGFWAAAAFQWVNPKAWVMAVGACSTYVLHGNLWLNVLLLAGIFGVVNLPSVAMWALCGSALRRWLARPRVLRAFNIGMAVLLLASLWPILGA
>NC_008313.1|WP_011616076.1|3505454_3506348_-|2OG-Fe(II)-oxygenase
MIREASVAGGKTGYTESSPDLEQWLARHIAQGFAADALVLSMLRSGYDDAFARQAVAAAFAQDAYGAAPARPAPARSAAAAGTPAVYAADGGDRQVPILFRLASPQVQLFQQLLTDDECDALVALSRGRLARSPVVNPDTGDENLIDARTSMGAMFQVAEHPLITRIEARIAAVTGVPAEHGEGLQILNYKPGGEYQPHFDYFNPQRPGEARQLSVGGQRIATLVIYLNTPEAGGATAFPRVGLEVAPVKGNAVYFSYLLPDGALDERTLHAGLPVAFGEKWIATKWLRERPYRSDA
>NC_008313.1|WP_011616077.1|3506344_3507088_-|lytic-transglycosylase-domain-containing-protein
MRAARGMTGAARRCAGGLLLAVAAMAAHAGAQKEEDLADSVRGALAAAIADDRPTRPVFASGGERLAYLKWLGEMSARLASRIPEPQVRVELIEVAYYEAKRAGLEPALVLGLVQVESNFRKYAISSAGARGLMQVMPFWVRAIGDSDPRKLFHLQSNLRYGCTILRYYLDREQGDLYLALGRYNGSRGRPEYPNAVLAAWKRWQYSEATVTVAGEPEVAPSRPRAPVSEPPARNPFSSQRVAANPS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

874757 : 883542

Bacillus_phage(16.67%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010812950.1\|874757_876140_+	UDP-glucose/GDP-mannose dehydrogenase family protein	A0A127AXI2	Bacillus_phage	1.7e-69	36.5
WP_010812949.1\|876220_877168_+	D-glycero-beta-D-manno-heptose-7-phosphate kinase	A0A2H4N7X4	Lake_Baikal_phage	3.2e-14	28.1
WP_010812948.1\|877196_878192_+	ADP-glyceromanno-heptose 6-epimerase	R9S880	Prochlorococcus_phage	4.1e-28	33.1
WP_010812947.1\|878347_878716_+	helix-hairpin-helix domain-containing protein	NA	NA	NA	NA
WP_011614702.1\|878953_880255_+	nitrate reductase	Q9KX94	Enterobacteria_phage	1.0e-143	64.8
WP_010812945.1\|880390_881293_+	cysteine synthase CysM	C3U2M1	Lactococcus_phage	9.7e-53	42.1
WP_010812944.1\|881362_882469_-	lytic murein transglycosylase B	NA	NA	NA	NA
WP_010812943.1\|882618_883542_+	histone deacetylase family protein	A0A2K9L2T7	Tupanvirus	1.3e-41	33.3

DBSCAN-SWA_2

3301721 : 3311033

Methanothermobacter_phage(16.67%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011615966.1\|3301721_3302972_+	bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC	Q9HH70	Methanothermobacter_phage	4.6e-37	30.6
WP_011615967.1\|3302994_3303495_+	dUTP diphosphatase	A0A289ZTC1	Serratia_phage	1.8e-40	54.2
WP_011615968.1\|3303549_3304398_-	VOC family protein	NA	NA	NA	NA
WP_010814996.1\|3304440_3305448_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_010814997.1\|3305624_3307919_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	1.1e-172	43.3
WP_010814998.1\|3307915_3308242_-\|protease	ATP-dependent Clp protease adapter ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	1.3e-12	46.9
WP_010814999.1\|3308755_3308962_+	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	1.9e-20	75.8
WP_011615969.1\|3309172_3309634_-	VOC family protein	NA	NA	NA	NA
WP_010815001.1\|3309782_3311033_-	NADP-dependent isocitrate dehydrogenase	Q77Z09	Phage_21	8.8e-12	64.8

DBSCAN-SWA_3

3847541 : 3853604

uncultured_Caudovirales_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010812127.1\|3847541_3848129_-	phosphoheptose isomerase	A0A067XQR2	Caulobacter_phage	1.8e-15	31.4
WP_010812128.1\|3848191_3848587_-	YraN family protein	NA	NA	NA	NA
WP_010812129.1\|3848605_3849514_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	7.0e-35	40.4
WP_011616201.1\|3849601_3850372_-	septal ring lytic transglycosylase RlpA family protein	H2BCY4	Synechococcus_phage	3.0e-18	52.1
WP_011616202.1\|3850653_3851304_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_041687562.1\|3851308_3851965_+	exonuclease	A0A2L0UZL4	Agrobacterium_phage	5.1e-35	40.4
WP_010812133.1\|3852172_3852400_+	hypothetical protein	NA	NA	NA	NA
WP_010812134.1\|3852488_3852848_-	arsenate reductase (glutaredoxin)	A0A2H4J8T1	uncultured_Caudovirales_phage	5.2e-18	43.6
WP_010812135.1\|3853022_3853604_+	N-acetyltransferase	A0A2H4J136	uncultured_Caudovirales_phage	3.1e-20	41.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NC_008314

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_008314_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_008314_1

203086-203188

Orphan

Consensus_repeat	Method
TGGTGACCGGCGCCAGCGGCGAACC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_008314_1

>merge|NC_008314|1|203086-203188|CRISPRCasFinder
TGGTGACCGGCGCCAGCGGCGAACCGGTGCTGCCGCCGGTGGCACTGCCAAGGCCGCCGGTGATGCTGCTGACCAGGCTGGTGACAGGCGCCAGCGGCGAACC

>NC_008314|1|1|203086-203188|CRISPRCasFinder
TGGTGACCGGCGCCAGCGGCGAACC	GGTGCTGCCGCCGGTGGCACTGCCAAGGCCGCCGGTGATGCTGCTGACCAGGC
TGGTGACAGGCGCCAGCGGCGAACC

Protein	Signature genes	Signature genes Name	Protein_function
NC_008314.1\|WP_010809819.1\|211418_212735_+\|CpaF-family-protein	unknown	unknown	gnl\|CDD\|227297
NC_008314.1\|WP_011616399.1\|208716_210129_+\|type-II-and-III-secretion-system-protein-family-protein	unknown	unknown	gnl\|CDD\|227299
NC_008314.1\|WP_011616391.1\|194751_194997_-\|hypothetical-protein	unknown	unknown	unknown
NC_008314.1\|WP_011616392.1\|195938_196397_+\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197670
NC_008314.1\|WP_037024323.1\|199669_200428_-\|phospholipase-D-family-protein	unknown	unknown	gnl\|CDD\|197267
NC_008314.1\|WP_010809818.1\|210175_211417_+\|pilus-assembly-protein	unknown	unknown	gnl\|CDD\|227298
NC_008314.1\|WP_011616390.1\|193717_194698_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NC_008314.1\|WP_010809809.1\|200611_200818_+\|dodecin-domain-containing-protein	unknown	unknown	gnl\|CDD\|377810
NC_008314.1\|WP_011616394.1\|200995_202663_-\|ShlB/FhaC/HecB-family-hemolysin-secretion/activation-protein	unknown	unknown	gnl\|CDD\|225387
NC_008314.1\|WP_011616396.1\|204989_206099_+\|collagen-like-triple-helix-repeat-containing-protein	unknown	unknown	gnl\|CDD\|374271
NC_008314.1\|WP_011616398.1\|207743_208697_+\|Flp-pilus-assembly-protein-CpaB	unknown	unknown	gnl\|CDD\|274472
NC_008314.1\|WP_011616400.1\|212727_213654_+\|type-II-secretion-system-F-family-protein	unknown	unknown	gnl\|CDD\|227300
NC_008314.1\|WP_010809815.1\|207216_207693_+\|pilus-assembly-protein	unknown	unknown	gnl\|CDD\|227296
NC_008314.1\|WP_010809806.1\|197197_198739_-\|acyl-CoA-synthetase	unknown	unknown	gnl\|CDD\|181381
NC_008314.1\|WP_010809813.1\|206469_206646_+\|Flp-family-type-IVb-pilin	unknown	unknown	gnl\|CDD\|226366
NC_008314.1\|WP_010809805.1\|196529_197201_+\|glycine-zipper-2TM-domain-containing-protein	unknown	unknown	gnl\|CDD\|183072
NC_008314.1\|WP_010809807.1\|198865_199576_-\|dienelactone-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|223489
NC_008314.1\|WP_010809803.1\|195137_195701_-\|YggT-family-protein	unknown	unknown	gnl\|CDD\|376765
NC_008314.1\|WP_011616401.1\|213685_214723_+\|type-II-secretion-system-F-family-protein	unknown	unknown	gnl\|CDD\|224975
NC_008314.1\|WP_041687902.1\|206667_207144_+\|prepilin-peptidase	unknown	unknown	gnl\|CDD\|227295

Protein	Function_ID	Function_description	E-value
NC_008314.1\|WP_010809819.1\|211418_212735_+\|CpaF-family-protein	gnl\|CDD\|227297	COG4962, CpaF, Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion].	9.07096e-161
NC_008314.1\|WP_011616399.1\|208716_210129_+\|type-II-and-III-secretion-system-protein-family-protein	gnl\|CDD\|227299	COG4964, CpaC, Flp pilus assembly protein, secretin CpaC [Intracellular trafficking and secretion].	4.83353e-105
NC_008314.1\|WP_011616392.1\|195938_196397_+\|MarR-family-transcriptional-regulator	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	2.56771e-10
NC_008314.1\|WP_037024323.1\|199669_200428_-\|phospholipase-D-family-protein	gnl\|CDD\|197267	cd09170, PLDc_Nuc, Catalytic domain of EDTA-resistant nuclease Nuc from Salmonella typhimurium and similar proteins. Catalytic domain of an EDTA-resistant nuclease Nuc from Salmonella typhimurium and similar proteins. Nuc is an endonuclease cleaving both single- and double-stranded DNA. It is the smallest known member of the phospholipase D (PLD, EC 3.1.4.4) superfamily that includes a diverse group of proteins with various catalytic functions. Most members of this superfamily have two copies of the conserved HKD motif (H-x-K-x(4)-D, where x represents any amino acid residue) in a single polypeptide chain and both are required for catalytic activity. However, Nuc only has one copy of the HKD motif per subunit but form a functionally active homodimer (it is most likely also active in solution as a multimeric protein), which has a single active site at the dimer interface containing the HKD motifs from both subunits. Due to the lack of a distinct domain for DNA binding, Nuc cuts DNA non-specifically. It utilizes a two-step mechanism to cleave phosphodiester bonds: Upon substrate binding, the bond is first attacked by a histidine residue from one HKD motif to form a covalent phosphohistidine intermediate, which is then hydrolyzed by water with the aid of a second histidine residue from the other HKD motif in the opposite subunit.	3.36566e-69
NC_008314.1\|WP_010809818.1\|210175_211417_+\|pilus-assembly-protein	gnl\|CDD\|227298	COG4963, CpaE, Flp pilus assembly protein, ATPase CpaE [Intracellular trafficking and secretion].	2.78679e-60
NC_008314.1\|WP_010809813.1\|206469_206646_+\|Flp-family-type-IVb-pilin	gnl\|CDD\|226366	COG3847, Flp, Flp pilus assembly protein, pilin Flp [Intracellular trafficking and secretion].	1.66482e-12
NC_008314.1\|WP_010809809.1\|200611_200818_+\|dodecin-domain-containing-protein	gnl\|CDD\|377810	pfam07311, Dodecin, Dodecin. Dodecin is a flavin-binding protein,found in several bacteria and few archaea and represents a stand-alone version of the SHS2 domain. It most closely resembles the SHS2 domains of FtsA and Rpb7p, and represents a single domain small-molecule binding form.	3.41097e-33
NC_008314.1\|WP_011616394.1\|200995_202663_-\|ShlB/FhaC/HecB-family-hemolysin-secretion/activation-protein	gnl\|CDD\|225387	COG2831, FhaC, Hemolysin activation/secretion protein [Intracellular trafficking and secretion].	1.51518e-82
NC_008314.1\|WP_011616396.1\|204989_206099_+\|collagen-like-triple-helix-repeat-containing-protein	gnl\|CDD\|374271	pfam15984, Collagen_mid, Bacterial collagen, middle region. Collagen_mid is the conserved central region of bacterial collagen triple helix repeat proteins.	2.17412e-50
NC_008314.1\|WP_011616398.1\|207743_208697_+\|Flp-pilus-assembly-protein-CpaB	gnl\|CDD\|274472	TIGR03177, pilus_cpaB, Flp pilus assembly protein CpaB. Members of this protein family are the CpaB protein of Flp-type pilus assembly. Similar proteins include the FlgA protein of bacterial flagellum biosynthesis.	1.59806e-39
NC_008314.1\|WP_011616400.1\|212727_213654_+\|type-II-secretion-system-F-family-protein	gnl\|CDD\|227300	COG4965, TadB, Flp pilus assembly protein TadB [Intracellular trafficking and secretion].	2.27607e-45
NC_008314.1\|WP_010809815.1\|207216_207693_+\|pilus-assembly-protein	gnl\|CDD\|227296	COG4961, TadG, Flp pilus assembly protein TadG [Intracellular trafficking and secretion].	1.57969e-10
NC_008314.1\|WP_010809806.1\|197197_198739_-\|acyl-CoA-synthetase	gnl\|CDD\|181381	PRK08316, PRK08316, acyl-CoA synthetase; Validated.	0
NC_008314.1\|WP_011616401.1\|213685_214723_+\|type-II-secretion-system-F-family-protein	gnl\|CDD\|224975	COG2064, TadC, Flp pilus assembly protein TadC [Cell motility and secretion / Intracellular trafficking and secretion].	1.71698e-17
NC_008314.1\|WP_010809805.1\|196529_197201_+\|glycine-zipper-2TM-domain-containing-protein	gnl\|CDD\|183072	PRK11280, PRK11280, hypothetical protein; Provisional.	4.75188e-12
NC_008314.1\|WP_010809807.1\|198865_199576_-\|dienelactone-hydrolase-family-protein	gnl\|CDD\|223489	COG0412, COG0412, Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism].	6.29731e-52
NC_008314.1\|WP_010809803.1\|195137_195701_-\|YggT-family-protein	gnl\|CDD\|376765	pfam02325, YGGT, YGGT family. This family consists of a repeat found in conserved hypothetical integral membrane proteins. The function of this region and the proteins which possess it is unknown.	2.74805e-09
NC_008314.1\|WP_011616390.1\|193717_194698_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	2.73571e-59
NC_008314.1\|WP_041687902.1\|206667_207144_+\|prepilin-peptidase	gnl\|CDD\|227295	COG4960, CpaA, Flp pilus assembly protein, protease CpaA [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion].	1.04221e-09

>NC_008314.1|WP_011616394.1|200995_202663_-|ShlB/FhaC/HecB-family-hemolysin-secretion/activation-protein
MRARHRVAALLVSVGAFHHGLVQADPRSPVQGDPTQTLPKIAPARPDSSVTVQVERPQAAMQDLLNTRLTPRRFRIEGAKTLPFEEVAAQFKPLANREITVAQLLEAANTVTQMYKDRGYPLSFAFVPAQDFANGDVLITVVEGYVAKVTVTGKAGPAEGRLRAIAEKLQQDRPLRQDRFEHYVNALALQPGLQVAATVQPPTTTDGACEMVLDVKRKPFTFGTGIEYMSPGLRAIATATTNSLTPLGEQISVSALFPKGRDNEEYYAASYAQPLGTEGMIARLNASHYRGVPQNATLEAIGFNPRYVNDTKRIGGSLSYPLLLSNAHTLTLTGGFYGADQFERYTHTATGTRVTLGTNVRVGTAELTYVQRGEGVSRNATLGLYKGFDALGASRQNNTNDLSFFRTRLLLSQSKDLPAGFGLTVAAAGQYSGDRLASGEQISFGGRFFGLGYPAGEVAGDKGWGASAEISRLFLPDMTYLRTIQPYVSADVARVFSNSVSLSHRSLSSVAIGARFSDRRYYTLDLSVAQPVGDKPTNASRRSPRINMTYSYQFD
>NC_008314.1|WP_010809809.1|200611_200818_+|dodecin-domain-containing-protein
MSNHTYKLVEIVGSSPDGCDQAIQSAIAKAGETIKNIDWFEVVETRGHITNGKIAHYQVTLKIGFRVS
>NC_008314.1|WP_037024323.1|199669_200428_-|phospholipase-D-family-protein
MRRAARACRHSPTQRSAVTYRFIRRAVLGLGLAAAVSAFTSFSPFALLAHARSASTFDQVTDTIANSISETFNEAVANHFPARTGKPAQPPDAKPVPAKPFADGSGYTLCFVPDGASCQALLINAIRSTRHRLLIQAYSFTSAPIAEAVAQAHRRGVDVRVILDKSQQSERYTSATYLKHAGVPVVIDNKPAIAHNKVMVFDDQAVFTGSFNFTKSAQERNAENGMLIRGDAAVVRAYTDNWNKRYQQSRAY
>NC_008314.1|WP_010809807.1|198865_199576_-|dienelactone-hydrolase-family-protein
MTAIPDSQWIRVDTAAGSFDAYLSLPPAGVQPGAPGIVLLQEIFGVNEHIRAVADQYAADGYAVLAPDVFWRQAPRVQLGYEGDDMARGMALRKAVDVTAALDDIAATVQVLRQHTGAGKVAAVGYCFGGLLSYLSAARGLVDAAVPYYGGGIQNQLQEAANIRVPVQFHYGALDAHIPPEAVQGVRDAMAGKPGSEIYVYQGADHGFNCWARGSYHQPSAALAHGRALVFLSEAL
>NC_008314.1|WP_010809806.1|197197_198739_-|acyl-CoA-synthetase
MQSEQQRALRNTIPDAIARAVRRSPGKTAIRFGERAWTYRQLDQAAARVAGALAQWGLRPGDRVAAFGKNSDAYVLLWLACLRSGLIHVPVNFSMTRAEAEYIVTQSGASAIFADPALADRVEGLPCKVSGTLHGGKVRDVLAAAASGPAAPVSDSLTDTTPAQILYTSGTTSAPKGAVLTHRALLAEYVSTIAACDIRESDYSLAALPLYHSAQMHVFLMPLLLCGGTTLIADSPEAGYCLRTIHAEGITSFFAPPTVWIALLRHADFDPARLGSLTKAYYGASIMPVPVLLELQQKLPALRFYNCYGQSEIGPLATVLGPDEHAGRPASAGRPVLNVETRIVDETMQDVPPGELGEIVHRSPQLLTEYWDKPELTAEAFTGGWFHSGDLGYMDAEGYLYVVDRIKDVINSGGVLVSSREVEECLYTHGAVAEAAVFALPHPKWVEAVAACVVRKRGHEDAAEEELIAHARQALAPFKVPKRIVFVADLPRNTAGKLLKRQLREDYAQLFGT
>NC_008314.1|WP_010809805.1|196529_197201_+|glycine-zipper-2TM-domain-containing-protein
MSIPLRSVVLAVLGAGALAGCATPYGYDNGYGGGYGGSYGGGYSSSGYGTSGYGGSTTISGYPAQQGYPQGYPQQGYPQQGYPQQGYPQQPYPQQSYPDGSYGNNYGNQAYGVRYGWVEAIEVVPGQPPSTSGAGAVVGGIVGGLLGHQVGGGRGNTVATIGGAVAGAVAGNEVEKRTGSSAAAYRVRVRTSDNAYLTLTQSNAYQMRIGDRVKVENGVAVPY
>NC_008314.1|WP_011616392.1|195938_196397_+|MarR-family-transcriptional-regulator
MPSKSAPSRKSTSLTKADFEALSDFRYQLRRFLRFSEDAARAEGLTVQQYLLLLHIRGCADKDWASIGELAERLQAKQHGVVALVNRCEAAGLVRRRLNPEDRRVVQVHLLAKGERYLNRLAMLHRTELESLRGAFRVARITQFNDDGAERA
>NC_008314.1|WP_010809803.1|195137_195701_-|YggT-family-protein
MFSEIALFLLDTVFTLFGMALLLRVWMQLTRLPTRNAVSQGVFQITDWLVRPLRRVIPGVGGIDWATVVGAWLTAMVFLVLVALLSGIDLLGFLPAMLLTALLYVLKWTISLVMWVTLLMAILSWVNPHSPITPAIDHLTAPVLRPIQRVVPRLGGFDVSPLVLFVIAQILLMVIARLGASIFGMHY
>NC_008314.1|WP_011616391.1|194751_194997_-|hypothetical-protein
MKTIAQRRSLALSLLCAVSLSFAAAAAHASEPVSDIARLDGSIAHAGKADPFLGGARLGKADPFTDGARTTDRRDAFTDGA
>NC_008314.1|WP_011616390.1|193717_194698_+|LysR-family-transcriptional-regulator
MNETIQWNDWEAFCCVVEQGTFTAAAEQLDCPKSRVSAAVARLETAIGAKLLERTTRRMRLTDAGKAVYRDVAPLFARLREIRQETLAREERVQGVLRIATPYEFGAQQLGGVICRTLAAHPALDVAVEITQGLVDPIRDGFDVAFVVVDTDLPDSGTVARRIYHVERGLFAAPALAASLPAQLRPEDLANMPTLTTPGDTVWEFTRDGQTVSVPIRPRMQTHNAELRLQGALAGLGIARLSVIYCEAEIAQGRLVRVLPDYPLPPLRVFALLPDRRLQPRKVRAFMEAIESMMVSELEPEAGLDGGMGAEAAASGQAEGAARTAG
>NC_008314.1|WP_011616396.1|204989_206099_+|collagen-like-triple-helix-repeat-containing-protein
MKIKHPSQHGMTSLAAAGVAALALLMAGCSSSGGGSGANPRPNSGNTDTPVNPAPSASSETTPTAKVTEGAGNTVVATGNAISDIGKTIQEAPLPLLPTTARESAGDVVIKAGKAVGSLGAGVRDGLGQMGSVDNPVGVTVASTGNVVHDVGEALISGGDLVSGLGTEKLAPLAPVTTPVGGLVRHVGIAVHDGSYKLKSVLSEGPVAQVTNSVSKVIVPLTSKGTDGTQTLGAATHLGEPANGLLYKVGNTVAAGGSMISNTHAPVVSPLGGVVTEAGKTVAAAGALLNGNGQGGGNPLGGLLGNLPLAKAGSNGEGGSAGGALGPVTALLAPVTGLVGGLKQGAHDSQGGSGDHKALQLPLVGGLLR
>NC_008314.1|WP_010809813.1|206469_206646_+|Flp-family-type-IVb-pilin
MKRLIARFIKDERGATAIEYGLIVGLVALAIAVGAGKLGTELNASFDRLSVTVSGWFK
>NC_008314.1|WP_041687902.1|206667_207144_+|prepilin-peptidase
MIAALLCAATLYTDFLHRRVPNALLAAAVLALGLSLLAGQGMELPLTTRLIGAGLGLAVTLPVYALGQMAAGDVKFLVVAGLFTGPQGLVLAWVVGNLLGLVHALLALALGGRAPATSQAIDHQDSGPIPTAQFSRARGIPYAAYLAVGVLAWMAAGH
>NC_008314.1|WP_010809815.1|207216_207693_+|pilus-assembly-protein
MLLHARVNRGINRRRHGAGSAAIEFAIVAPVLLAIVIGIVYYGVMLALQQVLTLAAEEGARAALRYPAGVSGSGLAATQGARVDAAAAMARGTLPTSIRNLLSTGNVAQAVPCASGSTDVCVQVTLNLPTTNILPAVPMVPVPATLSGSAMVQLSPDI
>NC_008314.1|WP_011616398.1|207743_208697_+|Flp-pilus-assembly-protein-CpaB
MTSKQIRLLAVVLLGLALLLALLAWQVGRQPAQAPAASTSAKPLHAVVVTTQAVEAGKPLAAEALKVEMLPIDPTGAYSEVARVTGQVPLVALGANVPVLESQLLAGLATQVREGERAVAVSVDEVIGVGNQVQPGDYVDVFLVLRRDQQEIPESQARMLLSRLRVLAYGVASVNRPQNAKPEQMMARQEGAKTAVLSVPLEQVSRLAMAQQSGRLLLALRNPQDEAMPSDGMFAEPPPALAARAGVPAEAPRAAPDKAMAGVMLSGLAAPAGASAPRAPVAAPAPRPLQVAAPPAPAQARQSAGVEVIRAGKREIE
>NC_008314.1|WP_011616399.1|208716_210129_+|type-II-and-III-secretion-system-protein-family-protein
MHIQKKPAHSTALRRRLMQLALAAMLATTAWCALAPRAQAQEAVNARQLRLLAGAQKEIRSAQPVERVAVGNPAVADALVLRTRGAPSVLLVAKQPGVTDVMVWTRGGAEPLTYNVQVDAIAPDADGAKLGYSAAGATITGQSPDAYAAARAQAAARAATTGKTDGKPGLVVDRSTVPLSGTVQVDVKVVEISKTVLKEVGINFFRNNSGFAFGTFSPSTLNKFTFTPGSGGAPGSFSADIASPMSNAFNLVAASLTHGIFANISLLEANGLARVLAEPSLVALSGQSASFLAGGEIPIPVPQALGTTTIQFKPFGIGLTVSPTVLSADRIALKVAPEASDLDPSRGISINGAVVPAIVTRRADTTVELGDGESFVIGGLVSRNTVSNVNKVPVLGDLPVIGAFFKNLNFHQEDRELMIVVTPRLVKPLAKGAPAAQAVGADGRTNGNPNVWGWYVLGEYADPTLPGFSK
>NC_008314.1|WP_010809818.1|210175_211417_+|pilus-assembly-protein
MDYFLLHATQDEVKDWLGKVLGGLGTLVAEGGAQEAFLERVAQLRPGLVFLHFSTELAGASARLGEQLLRLFPGLPLVAVGHADEPGIMLAALRVGVKDFIDLRDAPADAEAVVKRLAVPGEQVRQAESARQGKIVALLGARPGVGVTSLAVNLAAAARRHLPLNEKTDARAEVLLLDLGLPARDGALYLNLSPGFHFVEAVRNLRRFDQVFVQTALTRHGNGVCVLPLPAALGELRDISYSEAISLLERLRAFFDMQIIDLGGFGNAEFTAQIVKAADSVVLVADQSVGAIVSAAELVHELRAREVERDDLHLLVSRFDARLGVDAAQIAHRVGVQSVGTLPDSRAPLVLAMNRGAVLADDDPHDPYVRALADLLARLGYRAAQARETSLLARMKDKLPEALRAVRVARTGT
>NC_008314.1|WP_010809819.1|211418_212735_+|CpaF-family-protein
MTQAIEFSDNAPAPFPVSQEFQNIKEAAHEHLLTRIEELGAEFGRWSRTAIQRFVDLELESFTRLRRIPINEAELRQIAEALTKELAGFGPIEDLLNDPAVEDILVNGHLDVYVSRHGVLERIPVRFTDSGHLLRIVRRILAPIGRRLDESNPMVDARLPDGGRINVVIPPLALEGPVVSIRKFRKDPMTPADLQGLGTMSPEICDLLQAAVQARCNILVSGGTSSGKTSLLNALATFVPTTERVITIEDTAELALNHPHVVRLESRPGGFEGTGVVSIRDLLRNSLRMRPDRIIVGEVRGGEVLEMLQAMSTGHDGSMGTIHASSPRECLYRLEMLAGFAGFQGSEASLRRQIANAIDFIVQIARLSNGKRRIVSITEITGLGDNIISTQELYRHEPYVNPDGTETDRWLSLGLLPHSPKLARMRGPGFMLDDRFDV
>NC_008314.1|WP_011616400.1|212727_213654_+|type-II-secretion-system-F-family-protein
MSSATLLLAATALVITGLGLLLLASAQARARREQQQAFLQAQTEQVRLRYAQAPDPALQLPARDLRRRWDDFLRRADLAPTRRTAIVWITPVVLCTLAGAVAGQWLGAVSALIVALAVAAFAAWNRVRRLHKKLLSQLPGFLDGVVRLMTIGSSVPAAFQNSIANTEAPLRQCLVQAVHLQRAGKELDQAVLQVGRVYKVEELVLVASVLRLSVRYGGRADVVMERTAAFMRDREQAQRELMALSAETRLSAWILGLLPLVVAGGLFMLNAGYILMMWKDPTGKTMLLSALALEIAGAFMLYRLAKSI
>NC_008314.1|WP_011616401.1|213685_214723_+|type-II-secretion-system-F-family-protein
MDRLTLISLSLLAAACGVGVLTLPLLRDWRQRRLSARTIDGALARQRAAEAAQAAHAAVPAASGTQAAAKAGAAAPQGRGGAATAIGAQLGARVGERINAHWLDSRLGRAVVTPEDQQLLEQCGWYGPQSRMLFGVLRLGLPSALALAAMLWHVGAGAFAIVAWGFGTFALAYLAPKWHLRRRAAARLRMVDDELPVLIDMLRLLQGVGLSIDQSLQVIVAEFGSMLRVLGPELARANQQFASGRSREQTLLRIGRLFDSEDLKSLITLLTQVDKHGGAVQEPLRQFGLRMQEARKSRLKDEIGRLTVKMTAVMVVSLLPVLLILTAGPGFLGVIRMLAHMGGTR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NC_005241

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

33309 : 66718

Virus_Rctr85(25.0%)

protease,integrase,transposase

attL 46301:46319|attR 56800:56818

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011153959.1\|33309_34254_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_011153960.1\|34250_35249_+\|integrase	site-specific integrase	A0A1P8DJ76	Virus_Rctr85	2.0e-11	32.1
WP_082236114.1\|35313_35568_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_011153961.1\|35730_35931_-\|integrase	integrase	NA	NA	NA	NA
WP_011153962.1\|36085_37084_-\|integrase	site-specific integrase	A0A1P8DJ76	Virus_Rctr85	2.0e-11	30.8
WP_011153963.1\|37080_38025_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_011154055.1\|38021_39260_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_011153965.1\|39413_40640_+\|transposase	ISL3-like element ISAe1 family transposase	NA	NA	NA	NA
WP_011153966.1\|40645_41500_-\|integrase	site-specific integrase	A0A2K9VH72	Gordonia_phage	4.0e-08	28.8
WP_011153967.1\|41496_42429_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_011153968.1\|42425_43658_-\|integrase	tyrosine-type recombinase/integrase	A0A2D1G8E2	Mycobacterium_phage	1.1e-06	29.0
WP_136227927.1\|43768_44275_-	hypothetical protein	NA	NA	NA	NA
WP_011153970.1\|44268_45516_-\|integrase	tyrosine-type recombinase/integrase	W8EHC2	Mycobacterium_phage	3.0e-12	33.3
46301:46319	attL	NA	NA	NA	NA
WP_011153974.1\|47082_47445_-	hypothetical protein	NA	NA	NA	NA
WP_011153975.1\|47441_49322_-\|integrase	integrase	A0A2H4J185	uncultured_Caudovirales_phage	1.6e-33	27.1
WP_011153976.1\|49318_51199_-	hypothetical protein	A0A2H4J9J6	uncultured_Caudovirales_phage	2.2e-22	27.3
WP_011153978.1\|51475_52738_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_011153979.1\|52730_53714_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_011153980.1\|53710_54721_+\|integrase	tyrosine-type recombinase/integrase	S5MBZ0	Brevibacillus_phage	6.4e-05	24.3
WP_011153985.1\|58600_59635_-	HoxN/HupN/NixA family nickel/cobalt transporter	NA	NA	NA	NA
56800:56818	attR	NA	NA	NA	NA
WP_011153986.1\|59961_61017_+	hydrogenase expression protein HypE	NA	NA	NA	NA
WP_011153987.1\|61054_62866_+	nickel-dependent hydrogenase large subunit	NA	NA	NA	NA
WP_011153988.1\|62865_63444_+	NifU family protein	NA	NA	NA	NA
WP_011153989.1\|63440_64103_+	hypothetical protein	NA	NA	NA	NA
WP_011153990.1\|64095_64743_+	hypothetical protein	NA	NA	NA	NA
WP_011153991.1\|64739_66170_+	hypothetical protein	NA	NA	NA	NA
WP_011153992.1\|66166_66718_+\|protease	hydrogenase maturation protease	NA	NA	NA	NA

DBSCAN-SWA_2

84314 : 142703

Thermus_phage(25.0%)

protease,integrase,transposase

attL 128214:128273|attR 137748:137877

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011154014.1\|84314_84812_+\|protease	hydrogenase maturation protease	NA	NA	NA	NA
WP_011154015.1\|84834_85338_+	cyclic nucleotide-binding domain-containing protein	NA	NA	NA	NA
WP_011154016.1\|85448_85790_+	hydrogenase maturation nickel metallochaperone HypA	NA	NA	NA	NA
WP_011154017.1\|85835_86798_+	hydrogenase nickel incorporation protein HypB	NA	NA	NA	NA
WP_011154018.1\|86803_89227_+	carbamoyltransferase HypF	NA	NA	NA	NA
WP_011154019.1\|89390_90581_+	hypothetical protein	NA	NA	NA	NA
WP_011154020.1\|90939_91158_-	hypothetical protein	NA	NA	NA	NA
WP_041688635.1\|91517_92753_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_011153965.1\|93047_94274_-\|transposase	ISL3-like element ISAe1 family transposase	NA	NA	NA	NA
WP_051398622.1\|94360_96364_+	hypothetical protein	NA	NA	NA	NA
WP_011154024.1\|96367_97348_+	ATP-binding protein	NA	NA	NA	NA
WP_041688639.1\|97349_98792_+	hypothetical protein	NA	NA	NA	NA
WP_011154026.1\|99041_100253_+	DNA-binding protein	NA	NA	NA	NA
WP_011154027.1\|100236_100506_+	H-NS histone family protein	NA	NA	NA	NA
WP_011154028.1\|101128_102226_+	protein kinase	M1PWQ7	Moumouvirus	8.5e-11	27.7
WP_011154030.1\|103074_104100_+	ATP-binding protein	G8DDJ2	Micromonas_pusilla_virus	7.4e-17	30.8
WP_011154031.1\|104077_106576_+	S8 family peptidase	NA	NA	NA	NA
WP_011154032.1\|106904_107963_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_011154034.1\|110402_110738_-\|transposase	transposase	NA	NA	NA	NA
WP_011154035.1\|110970_111615_+	DUF1326 domain-containing protein	NA	NA	NA	NA
WP_011154036.1\|111611_112400_+	DUF2182 domain-containing protein	NA	NA	NA	NA
WP_011154037.1\|113702_115601_+	potassium transporter Kup	M1I6H8	Paramecium_bursaria_Chlorella_virus	8.0e-73	31.3
WP_011154038.1\|115786_116041_-	hypothetical protein	NA	NA	NA	NA
WP_011154041.1\|116160_116922_-	siderophore biosynthesis protein SbnG	NA	NA	NA	NA
WP_041688643.1\|116908_118153_-	type III PLP-dependent enzyme	A0A060D2X4	Bovine_gammaherpesvirus	1.5e-08	23.6
WP_041688645.1\|118149_119976_-	iron transporter	NA	NA	NA	NA
WP_011154044.1\|120022_121198_-	MFS transporter	NA	NA	NA	NA
WP_011154045.1\|121194_123012_-	siderophore biosynthesis protein	NA	NA	NA	NA
WP_011154046.1\|123008_124214_-	ATP-grasp domain-containing protein	NA	NA	NA	NA
WP_041688647.1\|124401_126525_-	TonB-dependent siderophore receptor	NA	NA	NA	NA
WP_011154048.1\|126955_127276_+	hypothetical protein	NA	NA	NA	NA
128214:128273	attL	NA	NA	NA	NA
WP_011154050.1\|128343_129576_+\|integrase	tyrosine-type recombinase/integrase	A0A1L4BKH1	Thermus_phage	1.7e-07	31.1
WP_011154051.1\|129572_130520_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_011154055.1\|131432_132671_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_011153963.1\|132667_133612_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_011153962.1\|133608_134607_+\|integrase	site-specific integrase	A0A1P8DJ76	Virus_Rctr85	2.0e-11	30.8
WP_011154051.1\|135500_136448_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_011154050.1\|136444_137677_-\|integrase	tyrosine-type recombinase/integrase	A0A1L4BKH1	Thermus_phage	1.7e-07	31.1
WP_011154057.1\|137741_139190_-\|transposase	IS66 family transposase	S5VLC8	Leptospira_phage	4.0e-40	33.1
137748:137877	attR	NA	NA	NA	NA
WP_011154059.1\|139221_139572_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_011154060.1\|139763_142703_+\|transposase	Tn3-like element IS882 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_008313

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NC_008314

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NC_005241

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection