CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number
NC_002679	Mesorhizobium japonicum MAFF 303099 plasmid pMLa, complete sequence	0 crisprs	NA	0	0	2
NC_002682	Mesorhizobium japonicum MAFF 303099 plasmid pMLb, complete sequence	0 crisprs	NA	0	0	0
NC_002678	Mesorhizobium japonicum MAFF 303099, complete genome	4 crisprs	cas3,csa3,WYL,DEDDh	3	2	6

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

2137 : 64325

Bacillus_phage(14.29%)

transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010915919.1\|2137_3256_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_010915779.1\|3880_4138_-	hypothetical protein	NA	NA	NA	NA
WP_010916048.1\|4624_6148_-	GMC family oxidoreductase	NA	NA	NA	NA
WP_080512153.1\|6157_6532_-	hypothetical protein	NA	NA	NA	NA
WP_010915920.1\|6533_6887_-	multidrug efflux SMR transporter	NA	NA	NA	NA
WP_162034383.1\|6883_7930_-	NAD-dependent epimerase/dehydratase family protein	A0A2C9DTC1	Eastern_grey_kangaroopox_virus	2.6e-09	30.1
WP_044552075.1\|8744_9230_-	hypothetical protein	NA	NA	NA	NA
WP_157866219.1\|9608_10412_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_010916045.1\|10504_11878_-	MmgE/PrpD family protein	NA	NA	NA	NA
WP_010915918.1\|12306_13443_+	aminopeptidase P family protein	NA	NA	NA	NA
WP_010915917.1\|13483_14587_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_010915916.1\|14668_15748_+	ABC transporter ATP-binding protein	A0A285PWH2	Cedratvirus	8.7e-16	30.8
WP_010915915.1\|15744_16638_+	ABC transporter permease	NA	NA	NA	NA
WP_010915914.1\|16634_17471_+	ABC transporter permease	NA	NA	NA	NA
WP_010915913.1\|17494_18895_+	amidase	NA	NA	NA	NA
WP_010915912.1\|19048_20047_+	dihydroxyacetone kinase subunit DhaK	NA	NA	NA	NA
WP_157866221.1\|20046_20694_+	DAK2 domain-containing protein	NA	NA	NA	NA
WP_010915911.1\|20690_22040_+	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_044552083.1\|22842_25752_+\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	5.1e-63	24.5
WP_010915909.1\|25896_26766_+	recombinase family protein	E5FFF9	Burkholderia_phage	2.0e-26	40.9
WP_010916042.1\|28359_29049_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_010915908.1\|29216_31226_+	hydantoinase/oxoprolinase family protein	NA	NA	NA	NA
WP_010915907.1\|31222_32980_+	hydantoinase B/oxoprolinase family protein	NA	NA	NA	NA
WP_010915906.1\|32976_33867_+	3-keto-5-aminohexanoate cleavage protein	A0A1V0SL81	Klosneuvirus	1.2e-18	28.1
WP_010915905.1\|33863_34640_+	SDR family oxidoreductase	W8CYX9	Bacillus_phage	1.1e-09	40.2
WP_010915904.1\|34675_35938_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_048894848.1\|36005_36869_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_010915902.1\|36865_37801_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_010915901.1\|37793_38552_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	6.7e-07	22.7
WP_010915900.1\|38544_39249_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	7.9e-10	26.9
WP_157866222.1\|39290_39755_+	thioesterase family protein	NA	NA	NA	NA
WP_080512154.1\|40568_41420_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_080512155.1\|42721_43477_+	4'-phosphopantetheinyl transferase superfamily protein	NA	NA	NA	NA
WP_010916041.1\|43630_44833_-\|transposase	IS110 family transposase	A0A1B1P7S0	Bacillus_phage	1.1e-08	25.3
WP_157866223.1\|45237_45963_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_162034381.1\|46565_48380_+	amino acid adenylation domain-containing protein	A0A2K9KZV5	Tupanvirus	2.1e-46	27.9
WP_010915895.1\|48468_53811_+	type I polyketide synthase	D0R7J2	Paenibacillus_phage	5.7e-52	37.5
WP_044552088.1\|55096_56821_-	restriction endonuclease	A0A2L1IZ21	Streptomyces_phage	9.0e-124	44.0
WP_157866225.1\|57013_57406_+	hypothetical protein	NA	NA	NA	NA
WP_044549035.1\|57450_57741_+	hypothetical protein	NA	NA	NA	NA
WP_157866062.1\|57803_58569_+\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	2.5e-25	48.6
WP_010915757.1\|58721_58916_+	hypothetical protein	NA	NA	NA	NA
WP_010915894.1\|58912_59260_+	hypothetical protein	NA	NA	NA	NA
WP_044552315.1\|61823_62387_+	hypothetical protein	NA	NA	NA	NA
WP_010916038.1\|63623_64325_-\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	7.1e-43	43.1

DBSCAN-SWA_2

283343 : 290776

uncultured_Mediterranean_phage(50.0%)

transposase,integrase

attL 274148:274163|attR 297558:297573

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
274148:274163	attL	NA	NA	NA	NA
WP_010915803.1\|283343_284594_+\|integrase	tyrosine-type recombinase/integrase	A0A1B1IQT7	uncultured_Mediterranean_phage	4.1e-09	23.0
WP_010915802.1\|284593_285544_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_010915801.1\|285533_286544_+\|integrase	site-specific integrase	A0A0K2CP59	Brevibacillus_phage	5.1e-18	26.8
WP_010915951.1\|287396_288581_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_044552253.1\|288611_289493_-\|integrase	site-specific integrase	W8EHC2	Mycobacterium_phage	2.1e-12	29.9
WP_162034380.1\|289458_289713_+	hypothetical protein	NA	NA	NA	NA
WP_010915949.1\|289759_290776_-\|integrase	site-specific integrase	A0A1B1IQT7	uncultured_Mediterranean_phage	7.1e-12	25.7
297558:297573	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NC_002678

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_002678_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_002678_1

1462824-1463044

Orphan

Consensus_repeat	Method
GCGCTGGCGCTGTTGGAGCCGCCGACATTGGCACCGGCCCCGGCGTTGCTGCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_002678_1

>merge|NC_002678|1|1462824-1463044|CRISPRCasFinder
GCGCTAGTGCTGTTGGAGCCCCCGACATTGACACCGGCTCCGGTATTGATGCCCCCGCTGCCACCGACAGAGGCGCCGAGCCCGGCGCTGGCGCTGTTGGAGCCGCCGACATTGGCACCGGCCCCGGCGTTGCTGCCCCCGCCGCCACCGATAGAGGCGCCGAGCCCAGCGCTGGCGCTGTTGGAGCCGCCGACATTGGCACCGGCCCCGGCGTTGCTGCC

>NC_002678|1|1|1462824-1463044|CRISPRCasFinder
GCGCTAGTGCTGTTGGAGCCCCCGACATTGACACCGGCTCCGGTATTGATGCC	CCCGCTGCCACCGACAGAGGCGCCGAGCCCGGCGCTGGCGCTGTTGGAGCCGCCGACATTGGCACCGGCCCCGGCGTTGCTGCCCCCGCCGCCACCGATAGAGGCGCCGAGCCCA
GCGCTGGCGCTGTTGGAGCCGCCGACATTGGCACCGGCCCCGGCGTTGCTGCC

Protein	Signature genes	Signature genes Name	Protein_function
NC_002678.2\|WP_010910401.1\|1459745_1460003_+\|hypothetical-protein	unknown	unknown	unknown
NC_002678.2\|WP_010910398.1\|1456869_1457847_-\|ribokinase	unknown	unknown	gnl\|CDD\|238919
NC_002678.2\|WP_010910410.1\|1467460_1468282_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223673
NC_002678.2\|WP_010910395.1\|1454043_1454832_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224098
NC_002678.2\|WP_044548112.1\|1460138_1460426_+\|hypothetical-protein	unknown	unknown	unknown
NC_002678.2\|WP_010910408.1\|1465687_1466704_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|378117
NC_002678.2\|WP_010910412.1\|1469241_1469760_-\|peptide-methionine-(S)-S-oxide-reductase-MsrA	unknown	unknown	gnl\|CDD\|237597
NC_002678.2\|WP_010910397.1\|1455768_1456830_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270306
NC_002678.2\|WP_010910399.1\|1457843_1458878_-\|ADP-ribosylglycohydrolase-family-protein	unknown	unknown	gnl\|CDD\|224315
NC_002678.2\|WP_044548111.1\|1458881_1459607_-\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225099
NC_002678.2\|WP_080512043.1\|1466696_1467464_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224041
NC_002678.2\|WP_064987425.1\|1462089_1462254_-\|DUF3309-family-protein	unknown	unknown	unknown
NC_002678.2\|WP_010910414.1\|1471680_1472388_+\|hypothetical-protein	unknown	unknown	unknown
NC_002678.2\|WP_010910396.1\|1454831_1455701_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224097
NC_002678.2\|WP_032930909.1\|1463721_1464417_-\|isoprenylcysteine-carboxylmethyltransferase-family-protein	unknown	unknown	gnl\|CDD\|224931
NC_002678.2\|WP_010910413.1\|1469935_1471522_-\|glycosyltransferase-family-39-protein	unknown	unknown	gnl\|CDD\|224720
NC_002678.2\|WP_010910403.1\|1460610_1461681_+\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|226434
NC_002678.2\|WP_010910415.1\|1472479_1472950_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NC_002678.2\|WP_010910407.1\|1464775_1465555_+\|hypothetical-protein	unknown	unknown	unknown
NC_002678.2\|WP_044548116.1\|1468317_1468926_-\|Ykof-family-thiamine-binding-protein	unknown	unknown	gnl\|CDD\|284933

Protein	Function_ID	Function_description	E-value
NC_002678.2\|WP_010910398.1\|1456869_1457847_-\|ribokinase	gnl\|CDD\|238919	cd01944, YegV_kinase_like, YegV-like sugar kinase. Found only in bacteria, YegV-like kinase is part of the ribokinase/pfkB sugar kinase superfamily. Its oligomerization state is unknown at this time.	5.96684e-139
NC_002678.2\|WP_010910395.1\|1454043_1454832_-\|ABC-transporter-permease	gnl\|CDD\|224098	COG1177, PotC, ABC-type spermidine/putrescine transport system, permease component II [Amino acid transport and metabolism].	8.57859e-88
NC_002678.2\|WP_010910408.1\|1465687_1466704_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|378117	pfam09084, NMT1, NMT1/THI5 like. This family contains the NMT1 and THI5 proteins. These proteins are proposed to be required for the biosynthesis of the pyrimidine moiety of thiamine. They are regulated by thiamine. The protein adopts a fold related to the periplasmic binding protein (PBP) family. Both pyridoxal-5'-phosphate (PLP) and an iron atom are bound to the protein suggesting numerous residues of the active site necessary for HMP-P biosynthesis. The yeast protein is a dimer and, although exceptionally using PLP as a substrate, has notable similarities with enzymes dependent on this molecule as a cofactor.	3.12262e-75
NC_002678.2\|WP_010910397.1\|1455768_1456830_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|270306	cd13588, PBP2_polyamine_1, The periplasmic-binding component of an uncharacterized ABC transporter involved in uptake of polyamines; contains the type 2 periplasmic binding fold. This group represents the periplasmic binding domain that functions as the primary high-affinity receptor of an uncharactertized ABC-type polyamine transport system. Polyamine transport plays an essential role in the regulation of intracellular polyamine levels which are known to be elevated in rapidly proliferating cells and tumors. Natural polyamines are putrescine, spermindine, and spermine. They are polycations that play multiple roles in cell growth, survival and proliferation, and plant stress and disease resistance. They can interact with negatively charged molecules, such as nucleic acids, to modulate their functions. Members of this family belong to the type 2 periplasmic-binding fold superfamily. PBP2 is comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	4.99704e-107
NC_002678.2\|WP_010910399.1\|1457843_1458878_-\|ADP-ribosylglycohydrolase-family-protein	gnl\|CDD\|224315	COG1397, DraG, ADP-ribosylglycohydrolase [Posttranslational modification, protein turnover, chaperones].	3.78923e-110
NC_002678.2\|WP_044548111.1\|1458881_1459607_-\|GntR-family-transcriptional-regulator	gnl\|CDD\|225099	COG2188, PhnF, Transcriptional regulators [Transcription].	1.82507e-52
NC_002678.2\|WP_080512043.1\|1466696_1467464_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224041	COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism].	1.07251e-113
NC_002678.2\|WP_044548116.1\|1468317_1468926_-\|Ykof-family-thiamine-binding-protein	gnl\|CDD\|284933	pfam07615, Ykof, YKOF-related Family.	2.81886e-38
NC_002678.2\|WP_010910396.1\|1454831_1455701_-\|ABC-transporter-permease	gnl\|CDD\|224097	COG1176, PotB, ABC-type spermidine/putrescine transport system, permease component I [Amino acid transport and metabolism].	4.67177e-78
NC_002678.2\|WP_032930909.1\|1463721_1464417_-\|isoprenylcysteine-carboxylmethyltransferase-family-protein	gnl\|CDD\|224931	COG2020, STE14, Putative protein-S-isoprenylcysteine methyltransferase [Posttranslational modification, protein turnover, chaperones].	6.86667e-25
NC_002678.2\|WP_010910413.1\|1469935_1471522_-\|glycosyltransferase-family-39-protein	gnl\|CDD\|224720	COG1807, ArnT, 4-amino-4-deoxy-L-arabinose transferase and related glycosyltransferases of PMT family [Cell envelope biogenesis, outer membrane].	2.78071e-52
NC_002678.2\|WP_010910403.1\|1460610_1461681_+\|ATP-binding-protein	gnl\|CDD\|226434	COG3920, COG3920, Signal transduction histidine kinase [Signal transduction mechanisms].	2.63815e-50
NC_002678.2\|WP_010910415.1\|1472479_1472950_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	6.56805e-15
NC_002678.2\|WP_010910410.1\|1467460_1468282_-\|ABC-transporter-permease	gnl\|CDD\|223673	COG0600, TauC, ABC-type nitrate/sulfonate/bicarbonate transport system, permease component [Inorganic ion transport and metabolism].	3.84957e-60
NC_002678.2\|WP_010910412.1\|1469241_1469760_-\|peptide-methionine-(S)-S-oxide-reductase-MsrA	gnl\|CDD\|237597	PRK14054, PRK14054, peptide-methionine (S)-S-oxide reductase.	6.41731e-117

>NC_002678.2|WP_064987425.1|1462089_1462254_-|DUF3309-family-protein
MSLGTILIIILVIALLGGFSGLGGGPFYGTGYYGGGGLGLVLLIIIILVVLGRL
>NC_002678.2|WP_010910403.1|1460610_1461681_+|ATP-binding-protein
MFQPIANIEDAQTLAQAIVNTITEPFLVLDEKFRVLAASRSFYKTFEVDPAQTQGTLLYALGDGQWDIPALRLLLETIIPEKTAMDGFEVEHDFPRIGRRTMLLNARKVLYDHSSAITILLAFNDITARRVIEREKEELLKRTEDLLNQKDVLLREMEHRVANSLQIIASILLLKARSVTSEETRQHLKDAHQRVLSVAEVQRHLHTSVGIDEIDVGSYLSKLCGSLATSMVGEAQPIEVTVTTEGGRMDSQKAVSLGLIVTELLLNAIKYAFPEEKDGARIQVSYETAGSDWKLTVSDNGVGKVINDVPATGLGTAIVEALVKQLEAKVEVIGDNDGTSISVTRATFTSRVPRAA
>NC_002678.2|WP_044548112.1|1460138_1460426_+|hypothetical-protein
MNFKMLSMGAMALAMMTGSALAATHTSALDDPAKMAPFYTDSGMKTMKSEKEFKAAWMAMKDEDRASMTKDCGDNVIGKSHDNFCKMTKQLGGAN
>NC_002678.2|WP_010910401.1|1459745_1460003_+|hypothetical-protein
MSQSTQHKNPKLIVVVAFDRGEDGELFPAFGPADQQSEDRAIRTARALAAKHVGVIAWSRDADPTLGDYGPPTTLFVSGDVPDME
>NC_002678.2|WP_044548111.1|1458881_1459607_-|GntR-family-transcriptional-regulator
MKRRTVQLSPGTGKPERIATVLEHEIRSGVLGFGDRLQSENELVQRFSVSRNTVRKGLKELSSRGLITTKVGIGSFVTFDGKPVDDAIGWSRALANAGANAETRTLRLEVIEDADLAALLEIESPFFIAVDRVRTNASDGHAISIERSRLPLSPELEDVPLRGLREGSLHQTLRAAGLIPDHGEEWVGIEMLNAEDAAILGCPQGTPFLRGRRLTRAADDRPIEYVTSLLNPAHFALHMRF
>NC_002678.2|WP_010910399.1|1457843_1458878_-|ADP-ribosylglycohydrolase-family-protein
MADNTILDRAMGALVGGALGDALGMPTQLLSPARIAELYGHVDDFVAPFADHPVSKGLLAGTITDDTEQALLLGRILVESGHRFDHARWVNALLDWEREVKARGSYDLLGPSTKRAIDAINNGVPAEEAGRSGDTNGAAMRIAPVGIMMPPEPLDAFVAKVAETCRATHNTSIAIASAAAVAAAVSRGVAGGDWRAASDSAVAAARRGATLGHWVTGGDIAARIVWAQDLVRGKVTGDAIRLITDLVGTGVASQESVPAAFAVLEVAGGDPWQAAVISANLGGDTDTIGAIAAGMAGACTGFSLLPQQHIARLVGIDMSKVRALAADLVAARVKKTGSGKDAAA
>NC_002678.2|WP_010910398.1|1456869_1457847_-|ribokinase
MSARLVHIGSAVVDYVYRIDALPAPGTEKTASSFAQVAGGGFNMMVAASRTGMTVVFGGQLGSGPNGDFLRAAFAAEGIETLTPPSPAMDSGNCVAMISSDAERTFVSWPGAESILTLDMMAALSVAPDDWVFTSGYTLSYAGSRDALADWIEALPAQTPFVFDPTPIISDIPRPILSRVLARATWLSCNATEAAEIAGPGDVEALAARLLDDHCPQATGVVIRSAAKGCHVRLADGTAQTIPGFKVSAVDTNGAGDTHIGAFVSALARGVHPFEAGRYANAAAAISVTRHGGSSAPTDAEIQTFLSQAAATGTPGQNQKAHQTA
>NC_002678.2|WP_010910397.1|1455768_1456830_-|ABC-transporter-substrate-binding-protein
MRMPRLTALLTATAVFTTALTLAASAAEVHVLNWKGYGADEPWAVAAFEKATGNKVVNDFFNSEQEMLTKIRTNPGLYDVVMINAAFNDQAMAEKLIQPIDTSKLPNYADISKDKAGSPMLDHDGKVYGVPWVWGLTALAINEKSFDKPPTSIAEMWDPKHKGRVVIRDDAVEAVQFGAIATGQNINDIKDMDAVKTKLTSLMPQIKTFWSSENDWNQMVASNQIDIGTYWSGSADRAKTHFKLPVSLVIPQEGAVAWLDAFSIPVGSKNVEGAQAFINWMIDPKFYVEWVTKVGAPVSANTKAVEALPQDAFNRKVMGDPEVAKRIQFQAPITDAQREAYLALWQQLKVDVK
>NC_002678.2|WP_010910396.1|1454831_1455701_-|ABC-transporter-permease
MAAQSATASRSGLRSALPLLAPAYLWLTVAIFLPLSAMVFFSFMTDLPLSGKPWAFTLGNYAAFFSQSLYLTLLLASLRLGLEVTLWCVVIGYPAAYVLAKVLKGRSREAIFLLVILPFWSNGLVRIFSWAMVLREGGILDTALNAVLPFKINIDLMYSYPAVIIGLVHSYVPYMVLTCYLTLQAIDDSLIEAGRSLGASRLQVLKRVIIPLSMPGLVAGAALIFVPVVGSFMEPRILGGRTGTFYGTVIEDQFVAVFNWPLGAALSFILLAVVLVILAIASPVLRRAA
>NC_002678.2|WP_010910395.1|1454043_1454832_-|ABC-transporter-permease
MATTRILEGLGRLYILLLLAFLYLPIIIMALMSFNVSPFYQLPFEWTTEWYASLWQNDQLIAATWNSLEIAIITTIISVALGSAASLALYRYEFRGKKVLQALLFPPIAIPWLITGTAMLIFFFGVGIGRGLFAILLGHVALALPYVIVVVSARLQTFAPELEEAARSLGANQWQVTMRVTLPWIMPGVIAGGLFAFAVSFDQFVVSYFLSTPGQTTLPVEIYAAIRKGFTPEINAVSTIIIVVSMALMLLTARFFKFGGEK
>NC_002678.2|WP_032930909.1|1463721_1464417_-|isoprenylcysteine-carboxylmethyltransferase-family-protein
MFALLTSKSEAFSHSNEGGFFSAARRRDILVDLREGFFRLCALACAGLFVYRGVSQVMEDPTRLNAALVAISEILTFTWLLLSRRPVTRDWNPLTVVVSVTASFGVALISLQPGIALVPVYFAAPLQFVALLFVIWGKISLGRSFAILPGNRGVMTGGAYRIVRHPIYAGYLAGHVLYLLSAFSFHNLAVYAVITYMQLYRILREEALLAAEPEYRAYMERVRYRLFYRLF
>NC_002678.2|WP_010910407.1|1464775_1465555_+|hypothetical-protein
MTRWKGVGVAAIAALSFVALKVLPWALGFAGGKYLYQTVAGSPDPQMLTTAQVSEQIESQGSQIFKAIKQEFPEDYDAVVEKITAVARLGNVDQVRNTSRVAVADLRQRYASLLSSAPDSKAAEALRAQLDMLNHVMARETAATCDNYLRQGPGALSTPDQDFLGDMDKIGATLFHAFGAAKKGGLPAASASDEDWSLLADAFIKAGGTPVEMNAIANVSLEFEGLCPAVAKLYTSALSLQGEPGRHIKTTLLYEIARN
>NC_002678.2|WP_010910408.1|1465687_1466704_-|ABC-transporter-substrate-binding-protein
MTDLTRRQALLLTLASGLPLIAGSSRVFAATPKVTVALDWTVNTNHIGLFVARDKGFYREAGLEVDILPYSDTGAGTLVANRVADFGINGTISLFTQKTAGADLKAVYAVVQSETGRVVFNAERGEIKSPKDLDGLTYGGFGSAWENALISTIIRHDGGKGNFETVTLGTSAYEALANGSVDFTLEVSTWEGVEAELKGIKQRSFVYADYGVPDEHTTLISSSEAYLQANPALASAFIQATRRGYQFTVDHPAEAAALLIAANKDALTNPALIEASLKALIDGHYLRAENGAIGTMDPAKMEAIGDFLFKAGILRDADGKILTQRPDFTKYFSNSTLG
>NC_002678.2|WP_080512043.1|1466696_1467464_-|ABC-transporter-ATP-binding-protein
MSRLELRHVRKAFGGLDVLADISLSVGAGEFVSILGPSGAGKSTLFQLLTGAEHGEGEMLFDGMPLDDHGRHFAFMPQRDALMPWRRILDNTTLGLEVQGIRRKAARARVAPLFAEFGLAGFERHFPAQLSGGMRQRAALLRTVVQARDMLLLDEPFGALDALTRAAMQRWLEQMWRHHRWTALLITHDVREAVYLSDRIYVLSARPARVLREIRVPLPRPRDPAGAAAQQAGALEAEILDILLNPQPSKGYDHD
>NC_002678.2|WP_010910410.1|1467460_1468282_-|ABC-transporter-permease
MPVVSSSVAPRPLAASLAKAAPAVISVGLLLMAWELYATYSGIKPTILPAPSRVFEQAMLNRDALIDNAIPTIRATLIGFACSLGAAFTLSMLVDFFQPLRRALFPVFIVSQTLPLVAIAPLVVLWFGFGLTPKIMLVALVTFFPMLVALVQGYEATEVEIGQMLRAMGAGRWRVFVLARLPSALPYFFAGLRISITYAVVGAIFAEYAGAAKGLGIYMLNAKNNFRPDLVLAAVGVSVALTLILFGLTVLLQRLAMPWERADPQSAGKGPWR
>NC_002678.2|WP_044548116.1|1468317_1468926_-|Ykof-family-thiamine-binding-protein
MFSGAQISLYPMADDFVGVILGALSALDPYRDRLRIETDDISTLLVGPPEVLFPALRDLFVAAAQSGKHCVLSAAISRGCPGEPDDPICRSDAFGGPVGPLGPRKQAAITAVRNAAATGQPAAAQFSLYVMGIGDHMDEIYGCIDFLKQSGVYDRSKNFCTKLRGDTGAIFSALNEAFCRFGPGAGHVTLDVTVSANSPSAV
>NC_002678.2|WP_010910412.1|1469241_1469760_-|peptide-methionine-(S)-S-oxide-reductase-MsrA
MATSTERAVLAGGCFWGMQDLIRRYPGVISTRVGYSGGDVANATYRNHGTHAEAIEINFDPAVISYRTLLERFFQIHDPTTRNRQGNDVGMSYRSAIYYTSDEQKRVAEDTIADVDASGLWPGKVVTEVAPAGAFWEAEPEHQDYLEKYPNGYTCHFVRPGWKLPVREKAVS
>NC_002678.2|WP_010910413.1|1469935_1471522_-|glycosyltransferase-family-39-protein
MWFKRRMVGIDDSMDGWAPAGLTAAGLEPSSVWPGLLRHPWYLLALLCLVQILCWTVVPALIDPAPPGDVVEGFMWGREWVLLTYKHPQLPGWLLETSHLLTGSFRWPQYMLAQLTISSTFILVYLLARDMLGQSRALAAVLLMPSVYFFGWPTPQFNHDYAQMPFWAAICWLLWRAGRGGGPGWWLALGLVSGVGLYAKFSTGLLLAFGALWLLYDARARIRLATPWPWLGLAVFLAVAAPLAIALYRIDFLPLTYFAARDQWVTENRVRLYYIGVQMAGLSGFLLVLTISGLLRRSPAPEVPVERGILVYLVWMGLGPATLIMVASLFTGTGESWGAPMYNLVGVTVLAFLGHRLGAIEMRRLAICAFLCILTMSSAYAALRWTGCNVRGRLDAVCWPAQPIADEAEAVWHAAAPGRLDIVGGDTQVAMLAGLNAYDKPSIFTDLDTRFAPWITSQRLRDHGMLMVWPGHDVPPQLRTWLGNFPVKTVLFNWSRTAPPVAISFAAIPPGTLYPPLAVDSQTLHPGN
>NC_002678.2|WP_010910414.1|1471680_1472388_+|hypothetical-protein
MRHQHAVIHHRAFDFWLARAAVLVIICLQLLVINDLSFGPRWLAPALEAALLVPLSVATAWTQVASQKAVEEEHWYLVGRFRVVIRRTALAMTGVVSVMNCGSLVFLVRALLAGHAGSSGQTLLIDALNIWVTNVIVFALWFWSTDRGGPPTCGLVNRAHSDFLFPQMTLNDREIRDWLPGFVDYFFLAFTNATAFSPTDTLPLSQRAKLLMMAEAMISLLTIALVAARAVNILA
>NC_002678.2|WP_010910415.1|1472479_1472950_-|GNAT-family-N-acetyltransferase
MQIERYDGDREILLPLFALADDSPTQVSSYIDEGEVLVARDGNRIIGHVQLIETGEGGVFELKSLAVRPARQSEGLGRALVAAAITRCRERHGRRLIVSTAAADIGNLRFYQRQGFRMWRIVQDAFGPSTGYPEGSAVNGIPLRDQVVFERDLGAD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_002678_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_002678_2

2393114-2393201

Orphan

Consensus_repeat	Method
CAAAACCGCCGCGCACTTTTGGGTGACACGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_002678_2

>merge|NC_002678|2|2393114-2393201|CRISPRCasFinder
CAAAACCGCCGCGCACTTTTGGGTGACACGCTTTGGGGTTCGCGCGTGTCACTGTCCCAAAACCGCTGCGCACTTTTGGGTGACACGC

>NC_002678|2|2|2393114-2393201|CRISPRCasFinder
CAAAACCGCCGCGCACTTTTGGGTGACACGC	TTTGGGGTTCGCGCGTGTCACTGTCC
CAAAACCGCTGCGCACTTTTGGGTGACACGC

Protein	Signature genes	Signature genes Name	Protein_function
NC_002678.2\|WP_010911326.1\|2395195_2396173_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187549
NC_002678.2\|WP_010911327.1\|2396185_2396398_-\|hypothetical-protein	unknown	unknown	unknown
NC_002678.2\|WP_010911316.1\|2386286_2386916_+\|rod-binding-protein	unknown	unknown	gnl\|CDD\|378407
NC_002678.2\|WP_044548302.1\|2396480_2397464_-\|cation-transporter	unknown	unknown	gnl\|CDD\|224151
NC_002678.2\|WP_044548300.1\|2384988_2386029_-\|aminopeptidase	unknown	unknown	gnl\|CDD\|226774
NC_002678.2\|WP_010911321.1\|2389300_2390434_-\|type-III-PLP-dependent-enzyme	unknown	unknown	gnl\|CDD\|143482
NC_002678.2\|WP_010911325.1\|2393941_2395153_+\|nickel/cobalt-transporter	unknown	unknown	gnl\|CDD\|225125
NC_002678.2\|WP_157866167.1\|2384415_2384970_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|379112
NC_002678.2\|WP_010911318.1\|2387485_2388022_+\|hypothetical-protein	unknown	unknown	unknown
NC_002678.2\|WP_032931544.1\|2393276_2393945_+\|DUF1007-family-protein	unknown	unknown	gnl\|CDD\|226208
NC_002678.2\|WP_044548303.1\|2400762_2400942_-\|hypothetical-protein	unknown	unknown	unknown
NC_002678.2\|WP_010911331.1\|2399602_2399977_+\|YciI-family-protein	unknown	unknown	gnl\|CDD\|226318
NC_002678.2\|WP_010911323.1\|2392176_2393076_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NC_002678.2\|WP_010911317.1\|2386929_2387355_+\|hypothetical-protein	unknown	unknown	unknown
NC_002678.2\|WP_010911329.1\|2397496_2398183_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|224584
NC_002678.2\|WP_010911322.1\|2390976_2392173_+\|amidase	unknown	unknown	gnl\|CDD\|181375
NC_002678.2\|WP_010911332.1\|2400010_2400766_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|212491
NC_002678.2\|WP_010911330.1\|2398266_2399451_+\|pyridoxal-phosphate-dependent-aminotransferase	unknown	unknown	gnl\|CDD\|235596
NC_002678.2\|WP_044548301.1\|2388578_2389148_-\|N-acetyltransferase	unknown	unknown	gnl\|CDD\|225695
NC_002678.2\|WP_010911319.1\|2388203_2388488_+\|SCP2-sterol-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|225794

Protein	Function_ID	Function_description	E-value
NC_002678.2\|WP_010911326.1\|2395195_2396173_-\|SDR-family-oxidoreductase	gnl\|CDD\|187549	cd05238, Gne_like_SDR_e, Escherichia coli Gne (a nucleoside-diphosphate-sugar 4-epimerase)-like, extended (e) SDRs. Nucleoside-diphosphate-sugar 4-epimerase has the characteristic active site tetrad and NAD-binding motif of the extended SDR, and is related to more specifically defined epimerases such as UDP-glucose 4 epimerase (aka UDP-galactose-4-epimerase), which catalyzes the NAD-dependent conversion of UDP-galactose to UDP-glucose, the final step in Leloir galactose synthesis. This subgroup includes Escherichia coli 055:H7 Gne, a UDP-GlcNAc 4-epimerase, essential for O55 antigen synthesis. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	1.24379e-151
NC_002678.2\|WP_010911330.1\|2398266_2399451_+\|pyridoxal-phosphate-dependent-aminotransferase	gnl\|CDD\|235596	PRK05764, PRK05764, aspartate aminotransferase; Provisional.	1.25818e-159
NC_002678.2\|WP_010911316.1\|2386286_2386916_+\|rod-binding-protein	gnl\|CDD\|378407	pfam10135, Rod-binding, Rod binding protein. Members of this family are involved in the assembly of the prokaryotic flagellar rod.	3.38739e-05
NC_002678.2\|WP_044548302.1\|2396480_2397464_-\|cation-transporter	gnl\|CDD\|224151	COG1230, CzcD, Co/Zn/Cd efflux system component [Inorganic ion transport and metabolism].	2.32912e-107
NC_002678.2\|WP_044548300.1\|2384988_2386029_-\|aminopeptidase	gnl\|CDD\|226774	COG4324, COG4324, Predicted aminopeptidase [General function prediction only].	0
NC_002678.2\|WP_010911321.1\|2389300_2390434_-\|type-III-PLP-dependent-enzyme	gnl\|CDD\|143482	cd00622, PLPDE_III_ODC, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Ornithine Decarboxylase. This subfamily is composed mainly of eukaryotic ornithine decarboxylases (ODC, EC 4.1.1.17) and ODC-like enzymes from prokaryotes represented by Vibrio vulnificus LysineOrnithine decarboxylase. These are fold type III PLP-dependent enzymes that differ from most bacterial ODCs which are fold type I PLP-dependent enzymes. ODC participates in the formation of putrescine by catalyzing the decarboxylation of ornithine, the first step in polyamine biosynthesis. Members of this subfamily contain an N-terminal PLP-binding TIM-barrel domain and a C-terminal beta-sandwich domain, similar to bacterial alanine racemases. They exist as homodimers with active sites that lie at the interface between the TIM barrel domain of one subunit and the beta-sandwich domain of the other subunit. Homodimer formation and the presence of the PLP cofactor are required for catalytic activity. Also members of this subfamily are proteins with homology to ODC but do not possess any catalytic activity, the Antizyme inhibitor (AZI) and ODC-paralogue (ODC-p). AZI binds to the regulatory protein Antizyme with a higher affinity than ODC and prevents ODC degradation. ODC-p is a novel ODC-like protein, present only in mammals, that is specifically exressed in the brain and testes. ODC-p may function as a tissue-specific antizyme inhibitory protein.	3.95227e-179
NC_002678.2\|WP_010911325.1\|2393941_2395153_+\|nickel/cobalt-transporter	gnl\|CDD\|225125	COG2215, COG2215, ABC-type uncharacterized transport system, permease component [General function prediction only].	6.13404e-104
NC_002678.2\|WP_157866167.1\|2384415_2384970_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|379112	pfam13302, Acetyltransf_3, Acetyltransferase (GNAT) domain. This domain catalyzes N-acetyltransferase reactions.	1.87779e-28
NC_002678.2\|WP_032931544.1\|2393276_2393945_+\|DUF1007-family-protein	gnl\|CDD\|226208	COG3683, COG3683, ABC-type uncharacterized transport system, periplasmic component [General function prediction only].	2.07163e-86
NC_002678.2\|WP_010911331.1\|2399602_2399977_+\|YciI-family-protein	gnl\|CDD\|226318	COG3795, COG3795, Uncharacterized protein conserved in bacteria [Function unknown].	1.03308e-49
NC_002678.2\|WP_010911323.1\|2392176_2393076_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	6.43531e-82
NC_002678.2\|WP_010911329.1\|2397496_2398183_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|224584	COG1670, RimL, Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis].	6.31462e-29
NC_002678.2\|WP_010911332.1\|2400010_2400766_-\|SDR-family-oxidoreductase	gnl\|CDD\|212491	cd05233, SDR_c, classical (c) SDRs. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human prostaglandin dehydrogenase (PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, PGDH numbering) and/or an Asn (Asn-107, PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	1.5523e-56
NC_002678.2\|WP_010911322.1\|2390976_2392173_+\|amidase	gnl\|CDD\|181375	PRK08310, PRK08310, amidase; Provisional.	0
NC_002678.2\|WP_044548301.1\|2388578_2389148_-\|N-acetyltransferase	gnl\|CDD\|225695	COG3153, COG3153, Predicted acetyltransferase [General function prediction only].	3.53637e-54
NC_002678.2\|WP_010911319.1\|2388203_2388488_+\|SCP2-sterol-binding-domain-containing-protein	gnl\|CDD\|225794	COG3255, COG3255, Putative sterol carrier protein [Lipid metabolism].	7.49817e-24

>NC_002678.2|WP_010911323.1|2392176_2393076_+|LysR-family-transcriptional-regulator
MDTLTRMRAFIDVVEAEGFSAAARKIGRSKALLSKYVRELEDELGALLLNRTTRQFSMTEAGHTYYRRASEIVREVDSLADAVRESSGDVRGRIKLSAPRTFADAPIGQSLIDFAKQHPDIVLDIQLDDRFVDLVEEGFDLAVRISRLENSSLIARRLAPFSVKLCASPELIAKHGMPTRPQDLGHMPCIVDTNGRGLNNWAFKGDNNDQLSVAVAGPIEVNSPMAARAAALSGLGFCILPDFIASPDLKSGQLVTALDDRILSGGGIFAVYPHRRYLPAKVRVFVDFLVQWFRTREVA
>NC_002678.2|WP_010911322.1|2390976_2392173_+|amidase
MTGTHGPYNAFLDLRQMPVAHAELGPLAGLRLAVKDIYDVAGYRTGCGNSRKFTESNAASRTAPAVQTILDAGARFVGKTQTDELAFALFGQNAHFPFPVNPAAPDRVTGGSSSGSASAVAGRLADIATGSDTGGSIRAPASFCGLIGLRTTHGRIALDGTMKLAPSFDTFGWFADDIETYETVGKLLLGRDPHQHSLDRPISLTWLDEMVARPALGEYAAMKALAGAVFGMPATSTTRFSSSPDELYWCFRRLQAREAWGVHGEWITSGERDLGPGVEERFGFGRAVDDRTAQAENVRRLTFRGELSALLGQDGFLVLPTVPGPAPYVDSTPEQFQAYRERALHLLCLAGLSGFPQITLPIGSVAGAPFGLSLLGPSGSDIALIRLGRKLLDAAQRA
>NC_002678.2|WP_010911321.1|2389300_2390434_-|type-III-PLP-dependent-enzyme
MATQRILDFLATRRPSGPCLVVDLDVVRDNFRAFEKALPDSKIYYAVKANPAPEILRLLAAMGSSFDTASVAEVEMAMDAGAPADRISFGNTIKKERDIARAYQLGIRLFAVDCVEEVEKIARVAPGARVFCRVLTDGEGAEWPLSRKFGCVPAMAVDVLRHAKGLGLDAYGVSFHVGSQQTDLTAWDRALADAKKVFATLAEEGIVLKMVNMGGGFPTRYLRDVPAAQAYGQAIFSALRKHFGNAIPETIIEPGRGMVGNAGVIKSEVVLISKKADNDNVRWVFLDIGKFGGLAETMDEAIRYPLVTRHDGSETAPCVLAGPTCDSADVMYEKTPYPLPLSLTIGDEVLIEGTGAYTTTYSAVAFNGFEPLRSYVI
>NC_002678.2|WP_044548301.1|2388578_2389148_-|N-acetyltransferase
MEMSVEIVAHAPAFSMVAETVADVAAREALLDRAMGPMRRKKSSEKLRRGRRPSEGLAFVARDASGGVAGTVRLWDVRLGEGGPAALLLGPLAVDPSLKNVGIGSALMRHAVTEAARLGHAAILLVGDAPYYGRFGFSADKTGRLAMPGPYERHRLLALELVEGALDGVHGTLKACGRKLKAQAPTLAA
>NC_002678.2|WP_010911319.1|2388203_2388488_+|SCP2-sterol-binding-domain-containing-protein
MSVQEIAEKIKSRVASSGFDRSVKFDTGGDGVIVIDGATVSTTDAPTDCTIKLSLDDLDSLIAGDLNPTMAFMTGKIKVEGDMTVAMALSQLIG
>NC_002678.2|WP_010911318.1|2387485_2388022_+|hypothetical-protein
MIKIIAIAVWVCAATLGAVFYSFQAAGERGVGEKPKPMLGGLDYVKTDVISVPLIRDSKIGGYFLAKLVYTVEPEQIKKLSIPAEALITDQVYSYLYANPQIDFTKKATIDLDAFRAAIRDTVNTRVGANLVHEVLVDQVNFLSKDEIRDNWLRRRQDSDTAAAGTAKPAEADAPPAH
>NC_002678.2|WP_010911317.1|2386929_2387355_+|hypothetical-protein
MADSSEFTANLPARTAASEAPIPFARPGNLAAIIGRIEEVVEEETAGIRSDTSYDLKASNARKSRYLYELTRAMKGGSEAEFLEQHREGLTRLRQKLAKNEAAILAHLSAVNEVAGLLRSAIQRAETDGTYSAGEFGRMKG
>NC_002678.2|WP_010911316.1|2386286_2386916_+|rod-binding-protein
MVWLRKTGKRRTFLAISPPSDIVMDVARAADPMDIEAARAALTKRAGAAAGAFSVDTAGSLDTAASVDPGSILSRATADKAAATADPAKKFKKFEAMVLQTFIQNMLPKDTEGVYGTGLAGDMWKSQLAERVADVMAERGGIGIAKSLVADHYMDGKRKVPIGPVSNGPEKTEIDQQTRLSTSLVQELQRKAARSMTGDETTIKTDIKI
>NC_002678.2|WP_044548300.1|2384988_2386029_-|aminopeptidase
MLAAVIVASGLAGCTSISYYAQSVEGHVQIMAARKNVGRLIRDPSTPEALRAKLTSASAIRRFATEELALPDNSSYRSYVDIGRADVTLAVFAAPRFSLTPITWCFPVFGCVPYRGYFSRKSAAESAAELQRQGLDVYVSGVTAYSTLGWFSDPLLSTMLRQDDTYIASLIFHELAHQKIYVNNDSAFNEAFAVAVETSGVRKWLRATGDRAGLRRYETNRKRQADFLGLIAETRDELRQVYGSPRAPEQMAVAKAATIDRLRMRYRQMRDRRWAGYRGYDAWFDAPINNAKLAATAVYGEQVPAFLHLFNLCSGDYPRFYASVRRIADLHEPSRAEALKAADTCG
>NC_002678.2|WP_157866167.1|2384415_2384970_+|GNAT-family-N-acetyltransferase
MSKATTPRLVLRSPSERDIPAWFARATDVESASLAGDPVPDDIRAGERWLARSRRRFADGKAIQWSIDQAGVSDAIGTITLSFDATGAKAAALGFVLARAHWGHGLGSEAAREVLRYAFETLALEQVTAEAATRNLASLRIMAKLGFKHIESFIDDTDGERCERFALDADIGSSLLASNAMPGC
>NC_002678.2|WP_032931544.1|2393276_2393945_+|DUF1007-family-protein
MQLKRHAIILASALAATLAATRPAYVHPHVFAEARLDVILSPDHQSVKALRHLWRFDDLFSSTVMMEFDKNSDLKLDDKELKEVADTVHASLAEFNYFQLVTQNGKDVTMVPPPHLMANFDNDQLIILFESEPKVPIKLTGTIDIGVYDPTFYTAIDFTEDSNITVAGLPSNCTSKVIRPDPDEAIKENQKTLTDAFFNDPTGTDMSKIFATKLELTCQPEG
>NC_002678.2|WP_010911325.1|2393941_2395153_+|nickel/cobalt-transporter
MKPVTKPSLRLAFGLLALTFAAMHFANAAHAQSSLGIGVNDGMAPTTGPFAHILMWINLRQQEFYRALATAMKAMRQDNSKLWVLIGLSFAYGIFHAAGPGHGKAVISSYMVANEVALKRGILLSFVSALLQGLTAIAVMLVAYFVLRGTTISMTDAAWFMEIMSFALVTLFGAWLLWRKLGPSILRLFGRAPAYSLSAAHAGHSHGGHATHSHAGHSHAAHSLSAHAHSHAVHGHDDHDHDHSHNHHDHAAHDHHHDHGTHAHHDHAHHDHAAGEVCETCGHSHAPDPALLSGDRFDWRTAWSAVAAVGIRPCSGALIVLSFALLNGLWLGGLLSVLAMSLGTAITVSALATLAVTAKNWAVYFAGDGRMGNRIHSIVEIGGAAFVFLFGLLLLSASLTGSV
>NC_002678.2|WP_010911326.1|2395195_2396173_-|SDR-family-oxidoreductase
MRILITGAAGMVGRKLIARLAKDGTLRGKAITALDLHDIVSPQAPAMEGVSISTHTGDLAEAGAAESLAASRPDVVFHLAGIVSGEAEANFELGYRVNLDGTRALFDAIRLAGYAPRVVFTSSIAVFGAPFPDVIPDDFHPTPLTSYGTQKQMSEALLADYSRRGFFDGIGIRLPTICVRPGKPNKAASGFFSGIIREPLSGQEAILPVPRSVAHTHASPRSAVNFLIHAAGIDGGVVGPRRNLTMPGVAVTVGEQIEALERIAGPKVVKLIREVPDETIWAIVKGWPTRFEANRSRELGFSAEKSFDEIIRAHIEDELDGQLPG
>NC_002678.2|WP_010911327.1|2396185_2396398_-|hypothetical-protein
MMDRDTRNAAVAALWIMLLFGIAAFYLPTVMLALGSLSTVLAGIFGIVFVLAFFLVFWLRARSQRKNQGK
>NC_002678.2|WP_044548302.1|2396480_2397464_-|cation-transporter
MAHTHSHDHSGHDHEGAGHVHGATDKKRVLIAACLTAGFMVAEALGGLFTGSLALLADAGHMLADAIALGLAWYAFHLAGRPATGQLTYGFGRVKTLVAYTNGIAIFVIALWIVYEAWQRLLTPAPVLGGPMLVVAILGLLVNIGSFLVLHGGDRESLNMRGAILHVLGDLLGSAAAIVAAVVILVTGWTPIDPILSVLVSLLILSTAWSLMRAAAHVLLEGVPPSLDRDLIATDLETTIQGVREVHHMHVWSIDGSSNMATLHACLDEGVDAHRAVSAIKKRLASEHGISHATVEPEFGQCADEAGDHEHEHEHEHDAAAHHSHHH
>NC_002678.2|WP_010911329.1|2397496_2398183_-|GNAT-family-N-acetyltransferase
MSENLRDWQARPRPERKAIDGRYVRLEPLSAAKHGDGLYEASSVSDVDGRFAWLPDYPPETRPAFQPWLDKVEASEDPLFFAVIDKASGKVAGRQTLMRIDPAYGVIEIGNIYWGPLISRKPGATEAQFLFMKYIFDELGYRRYEWKCNNRNEPSKRAAERFGFKFEGIFRQHLIVKGENRDTAWYSIIDKEWPALRKAYEAWLDPANFDGAGQQKRRLEDCRAEFGA
>NC_002678.2|WP_010911330.1|2398266_2399451_+|pyridoxal-phosphate-dependent-aminotransferase
MLHTISAFDRLGEENAFAVLARATALAQQGRDIVNLGIGQPDFKTPQHIVEAAIKALRDGHHGYTPANGLLATREAVVRRTLTTTGVEVSPEAVMILPGGKPTMFAAILMFGEPGAEILYPDPGFPIYRSMIEFTGAAPIPVPMREENGFAFSAEETLALITSKTRLLILNSPANPTGGVTPRAEIEKLVKGLEKHPDVAILSDEIYDAMTYDGETHCSLLGYPEIRDRLIVLNGWSKTWAMTGWRMGWSIWPNGDRGAHLYDKVRKLAVNCWSCVNAPSQFAGIAAIDGPQDDVDTMMRAFDRRRKVVVEGLNALPNISCITPKGAFYAFPNVSKTGWKAKKLASALLDDAGVALIGGPDFGILGEGYVRLSYANSEENILRALERIGAFLSK
>NC_002678.2|WP_010911331.1|2399602_2399977_+|YciI-family-protein
MFYAILAYHMEDAIKALTPQEDAALMADLLKINTRLREEGTLGPSARLGATQDAFTLRGPGDGVVIDGPFAETKEQLLGLYVVDCATRDKAIAIARDLRRVNSTAVYEIRPILLFKPGAPLAGK
>NC_002678.2|WP_010911332.1|2400010_2400766_-|SDR-family-oxidoreductase
MTEERTAIVTGAGTGIGKSVATALLKAGWNTVFCGRRKAVLDAAIVEAGRTEAKALAVACDISKAGEVDDLFETVAEAFGRVDLLFNNAGMGYKSTPIDEIPVEVWNDIVGVNLTGSFLCARAAFGAMRKQRPMGGRIINNGSVSAYAPRPGSVPYTATKHAITGLTKTLALDGRPYDIACGQIDIGNALTDMAQPMTVGVPQANGSIAAEAVMDVQHVADAVVHMASLPLEANVLFMTVMATKMPFVGRG
>NC_002678.2|WP_044548303.1|2400762_2400942_-|hypothetical-protein
MTALFVGPRWAFSENRAPFFEDMPMQVRLPSLPSFAIPSAEPNPEDQSGTLGAAGGHQP

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_002678_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_002678_3

3630121-3630402

Orphan

Consensus_repeat	Method
GGCAACGGCGGCGGCAAN	CRT

6 spacers

The CRISPR arrays of NC_002678_3

>merge|NC_002678|3|3630121-3630402|CRT
GGCAATGGCGGCGGTAACGGCGGCGGCAATGGCGGTGGCAACGGCGGCGGCAATGGCGGCGGCAATGGCGGTGGCAACGGCGGCGGCAATGGCGGCGGCAATGGCGGTGGCAACGGCGGCGGCAACGGCGGCGGCAATGGCGGTGGCAATAGCGGCGGCAACGGCGGCGGCGATAGCGGCGGCAACAGCGGTGGCAACGGCGGCGGCAATGGCGGCGGCAACAGTGATGGCAATGGCGGCGGCGATAGCGGCGGCAACAGCGGTGGCAACGGCGGCGGCAAC

>NC_002678|3|1|3630121-3630402|CRT
GGCAATGGCGGCGGTAAC	GGCGGCGGCAATGGCGGT
GGCAACGGCGGCGGCAAT	GGCGGCGGCAATGGCGGT
GGCAACGGCGGCGGCAAT	GGCGGCGGCAATGGCGGT
GGCAACGGCGGCGGCAAC	GGCGGCGGCAATGGCGGTGGCAATAGCGGC
GGCAACGGCGGCGGCGAT	AGCGGCGGCAACAGCGGT
GGCAACGGCGGCGGCAAT	GGCGGCGGCAACAGTGATGGCAATGGCGGCGGCGATAGCGGCGGCAACAGCGGT
GGCAACGGCGGCGGCAAC

Protein	Signature genes	Signature genes Name	Protein_function
NC_002678.2\|WP_010912543.1\|3636523_3637246_-\|haloacid-dehalogenase-type-II	unknown	unknown	gnl\|CDD\|130495
NC_002678.2\|WP_010912529.1\|3623487_3624441_-\|sulfonate-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270275
NC_002678.2\|WP_010912545.1\|3638461_3639352_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223656
NC_002678.2\|WP_010912546.1\|3639383_3640010_-\|DNA-3-methyladenine-glycosylase	unknown	unknown	gnl\|CDD\|376746
NC_002678.2\|WP_010912528.1\|3622239_3623397_-\|FMNH2-dependent-alkanesulfonate-monooxygenase	unknown	unknown	gnl\|CDD\|274652
NC_002678.2\|WP_044548542.1\|3627700_3629704_-\|PhoX-family-phosphatase	unknown	unknown	gnl\|CDD\|225752
NC_002678.2\|WP_010912541.1\|3634357_3634636_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
NC_002678.2\|WP_010912525.1\|3620283_3620460_+\|hypothetical-protein	unknown	unknown	unknown
NC_002678.2\|WP_010912536.1\|3630762_3631425_-\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|225107
NC_002678.2\|WP_010912544.1\|3637329_3638256_-\|DMT-family-transporter	unknown	unknown	gnl\|CDD\|223769
NC_002678.2\|WP_010912538.1\|3632984_3633323_+\|hypothetical-protein	unknown	unknown	unknown
NC_002678.2\|WP_044548549.1\|3631421_3632813_-\|sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|226951
NC_002678.2\|WP_010912530.1\|3624680_3625718_-\|DUF2156-domain-containing-protein	unknown	unknown	gnl\|CDD\|225451
NC_002678.2\|WP_080511887.1\|3634702_3636451_+\|SulP-family-inorganic-anion-transporter	unknown	unknown	gnl\|CDD\|223732
NC_002678.2\|WP_010912532.1\|3626160_3627330_+\|NAD(P)/FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|224983
NC_002678.2\|WP_010912539.1\|3633351_3634062_+\|phosphatase-PAP2-family-protein	unknown	unknown	gnl\|CDD\|239486
NC_002678.2\|WP_010912533.1\|3627342_3627567_-\|hypothetical-protein	unknown	unknown	unknown
NC_002678.2\|WP_010912527.1\|3621466_3622243_-\|ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|183100
NC_002678.2\|WP_010912526.1\|3620661_3621459_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|183055
NC_002678.2\|WP_010912524.1\|3619605_3619974_-\|septal-ring-lytic-transglycosylase-RlpA-family-protein	unknown	unknown	gnl\|CDD\|223868

Protein	Function_ID	Function_description	E-value
NC_002678.2\|WP_010912543.1\|3636523_3637246_-\|haloacid-dehalogenase-type-II	gnl\|CDD\|130495	TIGR01428, Haloacetate_dehalogenase, 2-haloalkanoic acid dehalogenase, type II. Catalyzes the hydrolytic dehalogenation of small L-2-haloalkanoic acids to yield the corresponding D-2-hydroxyalkanoic acids. Belongs to the Haloacid Dehalogenase (HAD) superfamily of aspartate-nucleophile hydrolases (pfam00702), class (subfamily) I. Note that the Type I HAD enzymes have not yet been fully characterized, but clearly utilize a substantially different catalytic mechanism and are thus unlikely to be related.	2.2589e-65
NC_002678.2\|WP_010912529.1\|3623487_3624441_-\|sulfonate-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270275	cd13557, PBP2_SsuA, Substrate binding domain of sulfonate binding protein, a member of the type 2 periplasmic binding fold superfamily. This subfamily includes the sulfonate binding domains SsuA found in eubacterial SsuA proteins that serve as initial receptors in the ABC transport of bicarbonate, nitrate, taurine, or a wide range of aliphatic sulfonates, while other closest homologs are involved in thiamine (vitamin B1) biosynthetic pathway and desulfurization (DszB). After binding the ligand, SsuA interacts with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. The SsuA proteins belong to the PBPII superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. They have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	8.96119e-138
NC_002678.2\|WP_010912546.1\|3639383_3640010_-\|DNA-3-methyladenine-glycosylase	gnl\|CDD\|376746	pfam02245, Pur_DNA_glyco, Methylpurine-DNA glycosylase (MPG). Methylpurine-DNA glycosylase is a base excision-repair protein. It is responsible for the hydrolysis of the deoxyribose N-glycosidic bond, excising 3-methyladenine and 3-methylguanine from damaged DNA.	2.736e-82
NC_002678.2\|WP_010912528.1\|3622239_3623397_-\|FMNH2-dependent-alkanesulfonate-monooxygenase	gnl\|CDD\|274652	TIGR03565, alk_sulf_monoox, alkanesulfonate monooxygenase, FMNH(2)-dependent. Members of this protein family are monooxygenases that catalyze desulfonation of aliphatic sulfonates such as methane sulfonate. This enzyme uses reduced FMN, although various others members of the same luciferase-like monooxygenase family (pfam00296) are F420-dependent enzymes. [Central intermediary metabolism, Sulfur metabolism].	0
NC_002678.2\|WP_044548542.1\|3627700_3629704_-\|PhoX-family-phosphatase	gnl\|CDD\|225752	COG3211, PhoX, Predicted phosphatase [General function prediction only].	0
NC_002678.2\|WP_010912541.1\|3634357_3634636_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	2.87688e-05
NC_002678.2\|WP_010912544.1\|3637329_3638256_-\|DMT-family-transporter	gnl\|CDD\|223769	COG0697, RhaT, Permeases of the drug/metabolite transporter (DMT) superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / General function prediction only].	7.93688e-13
NC_002678.2\|WP_010912536.1\|3630762_3631425_-\|response-regulator-transcription-factor	gnl\|CDD\|225107	COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription].	5.86898e-66
NC_002678.2\|WP_010912545.1\|3638461_3639352_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|223656	COG0583, LysR, Transcriptional regulator [Transcription].	1.00436e-39
NC_002678.2\|WP_044548549.1\|3631421_3632813_-\|sensor-histidine-kinase	gnl\|CDD\|226951	COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms].	1.03226e-63
NC_002678.2\|WP_010912530.1\|3624680_3625718_-\|DUF2156-domain-containing-protein	gnl\|CDD\|225451	COG2898, COG2898, Uncharacterized conserved protein [Function unknown].	3.18599e-106
NC_002678.2\|WP_080511887.1\|3634702_3636451_+\|SulP-family-inorganic-anion-transporter	gnl\|CDD\|223732	COG0659, SUL1, Sulfate permease and related transporters (MFS superfamily) [Inorganic ion transport and metabolism].	5.88144e-164
NC_002678.2\|WP_010912532.1\|3626160_3627330_+\|NAD(P)/FAD-dependent-oxidoreductase	gnl\|CDD\|224983	COG2072, TrkA, Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism].	1.19177e-72
NC_002678.2\|WP_010912539.1\|3633351_3634062_+\|phosphatase-PAP2-family-protein	gnl\|CDD\|239486	cd03392, PAP2_like_2, PAP2_like_2 proteins. PAP2 is a super-family of phosphatases and haloperoxidases. This subgroup, which is specific to bacteria, lacks functional characterization and may act as a membrane-associated lipid phosphatase.	9.47945e-50
NC_002678.2\|WP_010912527.1\|3621466_3622243_-\|ABC-transporter-permease-subunit	gnl\|CDD\|183100	PRK11365, ssuC, aliphatic sulfonate ABC transporter permease SsuC.	5.55039e-101
NC_002678.2\|WP_010912526.1\|3620661_3621459_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|183055	PRK11247, ssuB, aliphatic sulfonates transport ATP-binding subunit; Provisional.	2.12837e-108
NC_002678.2\|WP_010912524.1\|3619605_3619974_-\|septal-ring-lytic-transglycosylase-RlpA-family-protein	gnl\|CDD\|223868	COG0797, RlpA, Lipoproteins [Cell envelope biogenesis, outer membrane].	4.84816e-48

>NC_002678.2|WP_044548542.1|3627700_3629704_-|PhoX-family-phosphatase
MTDHRSPDTRFRTSLLEENDSPAINPTDNRTMGDIIAARFSRRGFLKGSLAVSAIAATVGPLAMIAADDARAAEGSAFKFDELEAGIDDKHHVAPGYDADVLLRWGDPLFADSPEFDPTKQSAEAQARQFGYNNDYVGYIAIDGSAEHGLLVVNHEYTNPHLMFPGIVSIVEKDGKKKAEVAPLSKEQVDVEMAAHGGTIVEIRKEGGKWQVVRDGKRNRRITSTTEMALSGPVAGHDRVKTNADPSGTKVFGTFNNCAGGVTPWGTYVMAEENIHGYFSGELPEGHKEAANYKRLGIPEGAYEWGAHYDRFNLAKEPNEPNRFGWIVEVDVNDPNSTPRKRTAMGRFKHEGAESIVAKDGRVVFYLGDDERFDYVYKFVTKGAFNANDHAANKDLLDEGTLHVAKFAEDGTVDWLPIVFGQGPLTAENGFGSQADVLIETRRAADLLGATKMDRPEDIQPNGVNGKVYVMLTNNSKRKADQVDAANPRAENAFGHIIEITETNGDFTATKGKWEVLLKCGDPAVADVGATFSTATTANGWFGMPDNCAVDSAGRLWVATDGQGPKATGRTDGLWAVDTEGAARATSKLFFRVPIGAEMCGPLFAPDDQTAFVAVQHPGDGGEDWEGFGRPSYYEDLSTRWPDFKPEMPVRPSVVAITKQGGGKIAV
>NC_002678.2|WP_010912533.1|3627342_3627567_-|hypothetical-protein
MSKSVYDRGLLKPADIARLQRVFDEACLRREARPESPEAREIALNLLALHNAGMVDEEMLMEAVGFRRLEPKSA
>NC_002678.2|WP_010912532.1|3626160_3627330_+|NAD(P)/FAD-dependent-oxidoreductase
MADTTTRPGVEQVAAVEPAIVIGAGAAGLAVAQALIKAGVPVAILEKESRLAEPWHRRHQQLHLNTHRDLSALPGLSYPGGTPAFPPKSVVIRHMNDFREANQLPVEFGVAVETLVFRGDHWAVRTSAGSRLARHVVVATGRDKEPFTPQWQGMQAFTGRIIHSADFGDAQSYAGKKVLVVGAGNSGFDALNHLAGVDTASLWLSARNGPALLPKRIGKIAVHRLSPLMARLPLRVADAVMAATQRLVFGDLTKFGMPPAPSGGASRLTSDYTAIAADDGAVDAIKSGKITVVPAIREFTRDGVILANGSLVDPDIVIAATGYRTGLERMVGNLGVLDGKGVPLFNGGQADPKLPGLWFTGMRPSIRGCFANAAILGKAIARRIAGAGR
>NC_002678.2|WP_010912530.1|3624680_3625718_-|DUF2156-domain-containing-protein
MPSLRIYFDKILERASPKVERQALTHVERLAMVRRHGDFSLAYSTAVQQKLSYFGDADGYIAFGTKMKHHFALGDPVAAPARRPDFIKRFVETAGDPWFVQISEETARVLAGLGYKVNRLGIDTSLVLSEHDFSGKRNETVRYSERWLLKKGFSFEEDKRTVFLDEIARLSENWRGDRIVKRWEMGFLNRPFYDQLGTDMRRFVLHGPDGELIALLDFDPLFRDGKVIGYTTAFKRKHIDASPHAEIGLTKFAVDRFREEGISVVTLGLSPLVDVTPSGFAESDFWRNTFQRAYASPWVNRRRFNLQGQAAFKRRFHGKEEPVYIAFRKGTYVEMLGLLRLVKAI
>NC_002678.2|WP_010912529.1|3623487_3624441_-|sulfonate-ABC-transporter-substrate-binding-protein
MFNLTRRVFGIGLLAASIGLSFGAAAQELKQLNIGYQKTGLPVIARQQQVIEKALSDKGVAVKWVEFTAGPPLVEALNVGAIDAGWTGDAPPIFGQSAGANIVYAAALPSNGDGEAIFVKPASPVQSVADLKGKRVGVGKGTSAHNLLVAALEKAGVPFDQVTPVYLSPADAAAAFASDQIDAWAVWDPFFAIAETRYQPRVLARSSEVLKVNTYFLANKDFAKAHPEIITTTIAALGEAAKWADQNRDKVAEALHEVTGVPLDAQTLAANRSKFGIFPITDEIVASQQATADRFYKLGLIPKAVRISDAVWTAPGN
>NC_002678.2|WP_010912528.1|3622239_3623397_-|FMNH2-dependent-alkanesulfonate-monooxygenase
MTSPPSPLDFFWFIPTHGDGSYLGSEEQQRPPEFGYFKQIAQAVDRLGFPGVLLPTGQNCEDSWITATGLATLTEKLKFLVALRPGVTLPTFAARQTAALDRLSNGRLLLNVVVGGNPTELAGDGVFLPHDERYAQAHEFLTIWRGLVSGERVNFDGKYYRVENGRLDLLPSQERPPLYFGGSSDAGQDLAADLVDMYLTWGEPPALVAEKLASARKKAALRGRKLRFGIRLHFIVRETEDEAWRAADRLISHVTDAQIENAQARFLNQMDSVGQRRMAELHGGRRDRLVVSPNLWAGVGLVRGGAGTALVGTPEQVTERIREYQAIGIDTIIGSGYPHLEEAYRVAELLFPRLGLGTRRQQAHRDIANEFSVGFHGAARLQASS
>NC_002678.2|WP_010912527.1|3621466_3622243_-|ABC-transporter-permease-subunit
MSFSARLHANAIGWVLPVLVIAGWEAASRAGLVPANVLPAPSAVAEAFWRLTLSGELIRNIGVSTARALAGFGIGGSIGFALGLANGLSRLSRGLTDTTLQMVRNIPHLALIPLVILWFGIDEEAKLFLVALGVFFPIYVNTLLGIQSVDPQLVEMGRVYGMDRRALFFRVILPGALPAIFVGLRYALGIMWLTLIVAETISASSGLGYMAMQAREFLLIDVVVLSILIYALLGKLADSLARLLERLSLGWHPAFQNG
>NC_002678.2|WP_010912526.1|3620661_3621459_-|ATP-binding-cassette-domain-containing-protein
MPAASLTSVRSFVAAPVPTRPAISVEGRRAFAFKGVEKRFGDKIVLDGIDLDVPAGQFVAVIGKSGCGKSTLLRLLAGLDRPTSGSLTLGAEEEGHSRTRFMFQEPRLLPWASVVKNVEIGLTGIAAGQDARQRALDILGEVGLADRADEWPSVLSGGQKQRVALARALVGHPQILALDEPLGALDALTRIEMQQLLERIWLAQKFTAVLVTHDVAEAVTLADRVVVISAGRIALDLEVPVARPRRRGSAELARLEGTILDRLFG
>NC_002678.2|WP_010912525.1|3620283_3620460_+|hypothetical-protein
MRLTKNLLALIVLAVGAVWALQGIGVIGGSFMTGQSQWLYIGLVAMLLGLAGLVWANR
>NC_002678.2|WP_010912524.1|3619605_3619974_-|septal-ring-lytic-transglycosylase-RlpA-family-protein
MKTLNQTALVAVTIAAGLMVGASATSATAAAGQCGRASWYALHSRTASGERMNPSALTAAHRTLPFGTKLRVTNQNNGRSVIVRINDRGPFIRGRVLDLSKGAAGQLGFIGSGHTSVCMARV
>NC_002678.2|WP_010912536.1|3630762_3631425_-|response-regulator-transcription-factor
MIGTIRIAIVDDHPLFREGVTRSLSEIGGFEIVGEGATAQDAERIASTMQPDILLLDISMPGGGLSAVASILAVHPAQRIVMLTVSETNADVTTALNAGVQGYILKGVGSRALAEILRNVAAGESYLSPTLSARLLSDLQSPQSANGAADRLRQLTERQTEILRLVAEGLSNKEVALRLELQEKTVKHHMTGVLSKLNVRNRTEAALMMREFRERDRNRP
>NC_002678.2|WP_044548549.1|3631421_3632813_-|sensor-histidine-kinase
MIRILQNLARRWSELSLALQFLVAGGFGLLAVMLVVGAWVTSQIRDGVIRNSAATTALYVDSVIAPLLPDLRKSETLSESVKQALDETLGQGALGKRLASFRLWRRDGTVLYAKDPTLIGRRFELTDDLRSAFQGNVTAQFDTFDETEGKEQTVGVPLLEIYNPVREPWSGEVVAVTEFFEIATDFKATLASALLSSWLIVAGTTLTAFLLLSSIVLRASRTIDDQRGALRRQVSELQGLVTQNSALRQRVQRASRRATALNERYLRRIGADLHDGPAQLVALAALRMDSPVFSGEGHWGENRSTEVAMIRKTLEDAMREIRGICTGLVLPQIETAAATDILRLAVDEHERRTGTSVTLTLPRHLPELGPSEKISIYRFVQEGLNNAYRHGRAKDQAVRAGMKNGRLFVEVSDGGPGFDPARVDGLGLAGLRERVESIGGQFETVTGAQGTRLVISLSVEEQA
>NC_002678.2|WP_010912538.1|3632984_3633323_+|hypothetical-protein
MSFSGLLQLGFSTVIFLLAATAAKQWGLAPSLGKILLTLALYSLGNLIMLRLIREFGMSVSFSLSAVIQLVSVNVVALVFFGERVNALQATGIMLAIAAVALITLGPYLQGR
>NC_002678.2|WP_010912539.1|3633351_3634062_+|phosphatase-PAP2-family-protein
MRDTASTLLNRIEFPVLLAGLVIAGGLWGFVELTEVARATAPHAFDTEILLAFRQVGQPGIPIGPSWLEGAMRDITSLGSASVLVLITTATILYLLLIRRPGTALLIFVAVAGGQVLSSLLKVGVDRPRPELVSHLVGVTSLSFPSGHAMLSAVTYLTLGSLAARFLHGRATKIYVLSLAVLTTVLVGVSRIYLGVHWPSDVLAGWCAGFAWAMLCWLVARLLQRRKVVSDDADGA
>NC_002678.2|WP_010912541.1|3634357_3634636_+|helix-turn-helix-transcriptional-regulator
MITAAQMRAARALAGIDQKTLAERAGVSLPTIQRMEASDGVVRGVVDTLMKVIQALDEAGVELIGENQASERGGRGVRLKPAVPPDPRAEPA
>NC_002678.2|WP_080511887.1|3634702_3636451_+|SulP-family-inorganic-anion-transporter
MDQTRQAVHQSTRKSAHGSAQGSAHGSAKPTFSELFMPKLVTVWREGYHLPQFKADVMAGLTVAIVALPLSMAIAIASGVSPERGLYTSIVGGFIISAFGGSRFQIGGPAGAFIVLVAATVARVGVDGLLLATMMSGVFLLAIGYLRLGTYIKFIPYPVTVGFTAGIAVIIFSGQIVELFGLTLPGKEPGPFVPKLIALGEAAGTINPAATFVAALTIATIAFLKRWRPKWPAMLVAIGLASLVVALFALPAETIGTRYGGIPRSLQWPALPPVSLDRMIEVLPDAVAFALLGAIESLLSAVVADGMTGRRHRSNCELVAQGFANIASALFGGLCATGTIARTATNVRAGAHGPVSGMVHSVILLVLMLAAAPLASYIPLAALAGVLAVVCWNMFEKQAFATLLRASRGDALVLMATFLIVVFRDLTEGIVVGFALGSILFIDRMAKSVAVEADLVQDDIADTVNAAGAYDPSEASDADTIVYRISGAFFFGAASTVGSVLDRIADQRKNFILDCSAVPLFDSTAANVIESAAHKARRAGVRFIIAGAAPPIRRMLINHGVKRPLVTYAASISDARAQLVGK
>NC_002678.2|WP_010912543.1|3636523_3637246_-|haloacid-dehalogenase-type-II
MKLTDFKALTFDCYGTLIDWESGMIDGLKPLTGRAARTLGRNDILEAHARHESSQQNWTPGKHYRDLLAIVYKRLAEEWSVIVTPEECVAYGESVKDWPAFADSAEALQYLKKHYKLIILSNVDNKSFSFSNKKLGVDFDAIYTAEDIGSYKPSDRNFDYMLEKLGTIGIEKREILHTAESMFHDHAPANRLGLTSCWIYRRHADQGFGATMNPGEVPAVDFRFDSMADLVKAHAEELRG
>NC_002678.2|WP_010912544.1|3637329_3638256_-|DMT-family-transporter
MTLLHAKAHRLVWPMMATALVVSWSSGFVGIRYASENADVMQVLFWRTLMSGLILLPFALLIGPRISARALVQQMVFGVAMMFLYLGGFALAIGQRVPTGLVALISDLVPLAIAALSQPVLGHRLTGRQWIGTALGVTGVLIVSLDSLSLGTAPAWAYLLTVASMMVLALATLVQKRMGTINMPIYQSLCIQCLTAAVLFAACAEWNGGLMPPLDARFGFGIAWLVLFSTFFCYSTYYASLRLYTASQVSSVIYLSPPVTMLWGWSMFGEPLSKAMLAGLAVTLFGVWFTSPGSAASKDFQLSQQQIG
>NC_002678.2|WP_010912545.1|3638461_3639352_+|LysR-family-transcriptional-regulator
MAGVMSRRLDVDALRALVAIERHGGVTRAAEILGLSQSAVSHKIRRLETSLDCEILTRKANAPMFTTAGQDLLGYARRILGIHDEAVLSLSKSPLQGKIALGMTEDTTCTDLSRILGRFRRLYPEVSVRTQVRMSLVLQEQLSQGALDAAIIQVFQHEVRPADILLFRETLHWVKSRDLVLSAGKPVPFLSFDENCFYRRWGIDVGQDEDTVLETVFECSSAAGIIAGVTAGLGVALLSQRYLQPAMEIVDDKFPKPPDLAYVIRRARVPRNPALETLVREIEAEVKRYGTLQIAV
>NC_002678.2|WP_010912546.1|3639383_3640010_-|DNA-3-methyladenine-glycosylase
MGRAHTVSRGEDHPPIARSELPDDTAALARYLIGKLVVRDLPEGMVSGRIVETEAYVVGDAAGHGFRGMTPRNRSLFLERGHAYVYLAYGVSMMLNVSSEVPGIGTGVLIRALEPLDGIEIMRRNRGVERLRDLARGPGRLAAALRIDRSLDGLDLCRKGPLWLAKDNQKPGEIGQSTRIGITKDAARLLRFYVRGSLFVSGPRSLQE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_002678_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_002678_4

6963994-6964083

Orphan

Consensus_repeat	Method
GACCAGAAAAGCCGGGCTTGCCCGGCTTTTCA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_002678_4

>merge|NC_002678|4|6963994-6964083|CRISPRCasFinder
GACCAGAAAAGCCGGGCTTGCCCGGCTTTTCATTTTTGTCCCCGACACCGGTACACACGACCAGAAAAGCCGGGCTTGCCCGGCTTTTCA

>NC_002678|4|3|6963994-6964083|CRISPRCasFinder
GACCAGAAAAGCCGGGCTTGCCCGGCTTTTCA	TTTTTGTCCCCGACACCGGTACACAC
GACCAGAAAAGCCGGGCTTGCCCGGCTTTTCA

Protein	Signature genes	Signature genes Name	Protein_function
NC_002678.2\|WP_010915653.1\|6964302_6964509_+\|hypothetical-protein	unknown	unknown	unknown
NC_002678.2\|WP_010915649.1\|6957702_6958293_-\|hypothetical-protein	unknown	unknown	unknown
NC_002678.2\|WP_157866131.1\|6954148_6955108_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|378150
NC_002678.2\|WP_010915651.1\|6959544_6960819_+\|ATP-dependent-Clp-protease-ATP-binding-subunit-ClpX	unknown	unknown	gnl\|CDD\|235422
NC_002678.2\|WP_010915645.1\|6953803_6954148_+\|cupin-domain-containing-protein	unknown	unknown	gnl\|CDD\|225981
NC_002678.2\|WP_010915650.1\|6958619_6959249_+\|ATP-dependent-Clp-endopeptidase-proteolytic-subunit-ClpP	unknown	unknown	gnl\|CDD\|178955
NC_002678.2\|WP_027046751.1\|6961093_6963505_+\|endopeptidase-La	unknown	unknown	gnl\|CDD\|223542
NC_002678.2\|WP_010915656.1\|6966495_6967239_+\|creatininase-family-protein	unknown	unknown	gnl\|CDD\|224320
NC_002678.2\|WP_010915647.1\|6955247_6956498_-\|cytochrome-P450	unknown	unknown	gnl\|CDD\|225035
NC_002678.2\|WP_032933358.1\|6968452_6969574_-\|ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|224096
NC_002678.2\|WP_010915660.1\|6971623_6972679_+\|sn-glycerol-3-phosphate-ABC-transporter-ATP-binding-protein-UgpC	unknown	unknown	gnl\|CDD\|236947
NC_002678.2\|WP_010915662.1\|6973162_6974092_+\|ribokinase	unknown	unknown	gnl\|CDD\|238579
NC_002678.2\|WP_032929955.1\|6969672_6971340_-\|sugar-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270303
NC_002678.2\|WP_010915644.1\|6952516_6953797_+\|O-acetylhomoserine-aminocarboxypropyltransferase	unknown	unknown	gnl\|CDD\|180344
NC_002678.2\|WP_010915657.1\|6967523_6968441_-\|carbohydrate-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223472
NC_002678.2\|WP_010915654.1\|6964737_6965760_-\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381387
NC_002678.2\|WP_010915661.1\|6972705_6973158_+\|RbsD/FucU-family-protein	unknown	unknown	gnl\|CDD\|226632
NC_002678.2\|WP_010915655.1\|6965925_6966492_+\|SIS-domain-containing-protein	unknown	unknown	gnl\|CDD\|240138
NC_002678.2\|WP_010915648.1\|6956602_6957706_+\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|236887
NC_002678.2\|WP_006201846.1\|6963702_6963975_+\|HU-family-DNA-binding-protein	unknown	unknown	gnl\|CDD\|223847

Protein	Function_ID	Function_description	E-value
NC_002678.2\|WP_157866131.1\|6954148_6955108_-\|hypothetical-protein	gnl\|CDD\|378150	pfam09338, Gly_reductase, Glycine/sarcosine/betaine reductase component B subunits. This is a family of glycine reductase, sarcosine reductase and betaine reductases. These enzymes catalyze the following reactions. sarcosine reductase: Acetyl phosphate + methylamine + thioredoxin disulphide = N-methylglycine + phosphate + thioredoxin Acetyl phosphate + NH(3) + thioredoxin disulphide = glycine + phosphate + thioredoxin. betaine reductase: Acetyl phosphate + trimethylamine + thioredoxin disulphide = N,N,N-trimethylglycine + phosphate + thioredoxin.	0.00287523
NC_002678.2\|WP_010915651.1\|6959544_6960819_+\|ATP-dependent-Clp-protease-ATP-binding-subunit-ClpX	gnl\|CDD\|235422	PRK05342, clpX, ATP-dependent Clp protease ATP-binding subunit ClpX.	0
NC_002678.2\|WP_010915645.1\|6953803_6954148_+\|cupin-domain-containing-protein	gnl\|CDD\|225981	COG3450, COG3450, Predicted enzyme of the cupin superfamily [General function prediction only].	4.03215e-49
NC_002678.2\|WP_010915650.1\|6958619_6959249_+\|ATP-dependent-Clp-endopeptidase-proteolytic-subunit-ClpP	gnl\|CDD\|178955	PRK00277, clpP, ATP-dependent Clp protease proteolytic subunit; Reviewed.	4.62457e-148
NC_002678.2\|WP_010915654.1\|6964737_6965760_-\|aldo/keto-reductase	gnl\|CDD\|381387	cd19161, AKR_AKR15A1, Microbacterium luteolum pyridoxal 4-dehydrogenase (PLD) and similar proteins. Microbacterium luteolum PLD (EC1.1.1.107) is a founding member of aldo-keto reductase family 15 member A1 (AKR15A1). It catalyzes irreversible oxidation of pyridoxal.	3.63071e-137
NC_002678.2\|WP_010915656.1\|6966495_6967239_+\|creatininase-family-protein	gnl\|CDD\|224320	COG1402, COG1402, Uncharacterized protein, putative amidase [General function prediction only].	4.17445e-69
NC_002678.2\|WP_010915647.1\|6955247_6956498_-\|cytochrome-P450	gnl\|CDD\|225035	COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism].	2.25914e-100
NC_002678.2\|WP_032933358.1\|6968452_6969574_-\|ABC-transporter-permease-subunit	gnl\|CDD\|224096	COG1175, UgpA, ABC-type sugar transport systems, permease components [Carbohydrate transport and metabolism].	6.1392e-72
NC_002678.2\|WP_010915660.1\|6971623_6972679_+\|sn-glycerol-3-phosphate-ABC-transporter-ATP-binding-protein-UgpC	gnl\|CDD\|236947	PRK11650, ugpC, sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC.	0
NC_002678.2\|WP_010915662.1\|6973162_6974092_+\|ribokinase	gnl\|CDD\|238579	cd01174, ribokinase, Ribokinase catalyses the phosphorylation of ribose to ribose-5-phosphate using ATP. This reaction is the first step in the ribose metabolism. It traps ribose within the cell after uptake and also prepares the sugar for use in the synthesis of nucleotides and histidine, and for entry into the pentose phosphate pathway. Ribokinase is dimeric in solution.	2.03089e-123
NC_002678.2\|WP_032929955.1\|6969672_6971340_-\|sugar-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270303	cd13585, PBP2_TMBP_like, The periplasmic-binding component of ABC transport systems specific for trehalose/maltose and similar oligosaccharides; possess type 2 periplasmic binding fold. This family includes the periplasmic trehalose/maltose-binding component of an ABC transport system and related proteins from archaea and bacteria. Members of this group belong to the type 2 periplasmic-binding fold superfamily. PBP2 is comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. The majority of PBP2 proteins function in the uptake of small soluble substrates in eubacteria and archaea. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.20363e-23
NC_002678.2\|WP_010915644.1\|6952516_6953797_+\|O-acetylhomoserine-aminocarboxypropyltransferase	gnl\|CDD\|180344	PRK05994, PRK05994, O-acetylhomoserine aminocarboxypropyltransferase; Validated.	0
NC_002678.2\|WP_010915657.1\|6967523_6968441_-\|carbohydrate-ABC-transporter-permease	gnl\|CDD\|223472	COG0395, UgpE, ABC-type sugar transport system, permease component [Carbohydrate transport and metabolism].	1.4509e-73
NC_002678.2\|WP_027046751.1\|6961093_6963505_+\|endopeptidase-La	gnl\|CDD\|223542	COG0466, Lon, ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones].	0
NC_002678.2\|WP_010915661.1\|6972705_6973158_+\|RbsD/FucU-family-protein	gnl\|CDD\|226632	COG4154, FucU, Fucose dissimilation pathway protein FucU [Carbohydrate transport and metabolism].	6.66165e-79
NC_002678.2\|WP_010915655.1\|6965925_6966492_+\|SIS-domain-containing-protein	gnl\|CDD\|240138	cd05005, SIS_PHI, Hexulose-6-phosphate isomerase (PHI). PHI is a member of the SIS (Sugar ISomerase domain) superfamily. In the ribulose monophosphate pathway of formaldehyde fixation, hexulose-6-phosphate synthase catalyzes the condensation of ribulose-5-phosphate with formadelhyde to become hexulose-6-phosphate, which is then isomerized to fructose-6-phosphate by PHI.	1.36115e-69
NC_002678.2\|WP_010915648.1\|6956602_6957706_+\|FAD-dependent-oxidoreductase	gnl\|CDD\|236887	PRK11259, solA, N-methyl-L-tryptophan oxidase.	4.26203e-41
NC_002678.2\|WP_006201846.1\|6963702_6963975_+\|HU-family-DNA-binding-protein	gnl\|CDD\|223847	COG0776, HimA, Bacterial nucleoid DNA-binding protein [DNA replication, recombination, and repair].	7.53611e-41

>NC_002678.2|WP_006201846.1|6963702_6963975_+|HU-family-DNA-binding-protein
MNKNELVSAVADAASISKGDAQSAVDAVFSVITGELKKGGDVRLVGFGNFTVSKRAASTGRNPQTGAEVKIPARTVPKFSAGKGLKDAVN
>NC_002678.2|WP_027046751.1|6961093_6963505_+|endopeptidase-La
MAKISKAPSDGVFAVLPLRDIVVFPHMIVPLFVGREKSIKALEEVMGQEKQILLATQMNAADDDPEPDAIFDIGTLANVLQLLKLPDGTVKVLVEGASRAKIVSFTDRPDFHEARATALVEPEEEEVEVEALARSVVTDFENYVKLNKKISPEVVGAASQIDDYSKLADTVASHLAIKIPEKQEMLATLSVKERLEKAMGFMEAEISVLQVEKRIRSRVKRQMEKTQREYYLNEQMKAIQKELGEGEDGRDEAAEIEARIKKTKLSKEAREKAEAELKKLRTMSPMSAESTVVRNYLDWLLSIPWGKNSKVKQDLAYAQNVLDTDHFGLDKVKDRIVEYLAVQSRQKKLKGPILCLVGPPGVGKTSLGKSIAKATGREFIRMALGGVRDEAEIRGHRRTYIGSMPGKVIQSMKKAKKSNPLFLLDEIDKMGQDFRGDPSSALLEVLDPEQNSTFMDHYLEVEYDLSSVMFVTTANTLNIPAPLMDRMEIIRIAGYTEDEKIEIAKRHLMPKVIRDHALQPKEFSVGEDAIRAIIQTYTREAGVRSLERELMKLGRKAVTEILKTKKKTVSITAANLADYLGVQRYRFGQVEADDQVGVVTGLAWTEVGGELLTVEGVMMPGKGRMTVTGNLRDVMKESISAAASYVRSRALDFGIEPPLFDKRDIHVHLPEGATPKDGPSAGAAMATAIVSVLTGIPVRADVAMTGEITLRGRILPIGGLKEKLLAALRGGIKKVLIPEDNAKDLAEIPDNVKNGMEIIPVSRVGEVLRHALVRMPEPIEWVEPVNPPATTDSADDAGKSLAH
>NC_002678.2|WP_010915651.1|6959544_6960819_+|ATP-dependent-Clp-protease-ATP-binding-subunit-ClpX
MSKVGNNSGDSKNTLYCSFCGKSQHEVRKLIAGPTVFICDECVELCMDIIREENKTSMVKSREGVPTPQEILKVLDDYVIGQPYAKRVLSVAVHNHYKRLAHAGKNNDVELAKSNILLIGPTGCGKTLLAQTLARIIDVPFTMADATTLTEAGYVGEDVENIILKLLQSADYNVERAQRGIVYIDEIDKISRKSDNPSITRDVSGEGVQQALLKIMEGTVASVPPQGGRKHPQQEFLQVDTANILFICGGAFAGLDKIISDRGRKTSIGFGATVASPEDRRTGDIFRQVEPEDLLKFGLIPEFVGRLPVLATLEDLDEPALIQILTEPKNALVKQYQRLFEMENVDLTFHENALSAIAKRAIERKTGARGLRSIMEAILLDTMFELPALEGVREVVISEEVVTGSARPLYIYSEQKEKKGNVSA
>NC_002678.2|WP_010915650.1|6958619_6959249_+|ATP-dependent-Clp-endopeptidase-proteolytic-subunit-ClpP
MKNPVETYMNLVPMVVEQTNRGERAYDIFSRLLKERIIFITGPVEDGMATLVCAQLLFLEAENPKKEINLYINSPGGVVTSGMAIYDTMQFIKPAVSTLCIGQAASMGSLLLTAGHKDMRFATPNARIMVHQPSGGFQGQASDIERHAMDIVKLKRRLNEVYVKHTGKSYEEIERTLDRDHFMTADEAKDFGLIDKVISSREPAESAVA
>NC_002678.2|WP_010915649.1|6957702_6958293_-|hypothetical-protein
MFRKTACFTIAGLTVLGTISATAAGGHAVECYEPIRTPDVYDTVYEDVMVSPPGQQVDYTPPIYGTRERVVMTVPAQVTYEVVPAITRTVYHTVRVDGGGYAWEWRVIHGRKVLCKIWHKARYERVAETVVIQPERSRRVVTPAQYDSIAEEVLVQPEQRRIIDVPASYRTVTRRVLVREGSSGWRRVHIPRHCQD
>NC_002678.2|WP_010915648.1|6956602_6957706_+|FAD-dependent-oxidoreductase
MNVIVVGAGIAGLSTAWSLVKAGHSVSIVEQGPIPNPLAASSDHHRIIRRAYRAGTGYGSLITEAYEAWDEMWADLGESHLDARGFVCISREPGDEAEEYLEGLEEGNFPFELLEPDAAVERWPFLQAGTFRYAYYSPEGGALHCRKIASGLAAWLRANGANVYERSKATAIDSETGRIVLESGETMQADRIVVAAGAWVLKLFPELDGELKTYRTALAYVEPPADLKAAWKAAPVVLDIGGAVDGYVIPPSGGAGMKFGSGLHRVPTSDADWNRQPVPGEGEAIRNLFSPPIARIQEYEVTEVVTCAYTFTVDEKFMAHAKGKCLVVSACSGHGYKFGAAVGRRVAAALGDSDIAGLKRWLRAEVA
>NC_002678.2|WP_010915647.1|6955247_6956498_-|cytochrome-P450
MTNSTLPYLAFDPATRRLRLDPHEPAFFLNPYEAYGFLHDVSNAFFWEEFGFWCFGGFDDVNRLLRDRRFGRQNPAGIPDSRGVGQDRSHLRAFDGIEANSMLELEPPVHTRLRTLVNRAFVSRQVERLRPRVEALANELIDRFDPTGPVDLLPAFASPLPITIIAEMLGVPVEMGPQLLDWSHQMVAMYIHGRTRETEETANRAASEFADFLRGYVAERRRNPGDDLLSLLISAQEDGERLSEDEMVSSAILLLNAGHEATVHQTGNAVRSILAQGGDPSRFFTSAEATAATVEECLRFDAPLHMFMRYAYQEIEIAPGIVVRPGQTIGLLLGMANHDPRAFAEPQAFRPDRADQKNVSFGAGIHFCIGAPLARLELQVSLKTLFERHPRLHLAEQSRFRDTYHFHGLETLAVGF
>NC_002678.2|WP_157866131.1|6954148_6955108_-|hypothetical-protein
MAIAQKMAMGLLERQTGSKGLPLASFAIEVDLNLDGLPEIFAYRYAPGCDGVNCGNYLFVLEGDSYQEVLGDIPGARLVPQDKIALSPFKRNGFFDIQSDTMTIGWDGKRYVDASTFPASSLDGAVFVSACQKNKLSQESSQSETEQVSAACQCQFNRFQTVGFTQADLDAYTASLLGEDFDYPIGDKEDAWLILSKSAQDVATGCDVASGKSQWPPAYFDHGDQPQQKLNFNGFLDACPAQDFILTNHKTGSPDRALALCGCVAREIPTYGVSQQGLDLLAQYYRDEISDADIEAQDADLLTAHDKASEACLSQFPAK
>NC_002678.2|WP_010915645.1|6953803_6954148_+|cupin-domain-containing-protein
MAAFLSVDTKGVEPESGAPAPDRLISGDPKFRTWNVEERDGGLYAGIWESTPGKWRIVYDEWEFCHILFGVSVIAEDEGEARTVKAGDSFVLRPGFKGSWEVLETTRKEYVIKL
>NC_002678.2|WP_010915644.1|6952516_6953797_+|O-acetylhomoserine-aminocarboxypropyltransferase
MTRTPGFNTLAVHAGAKPDPATGARATPIYQTTSFVFDDADHAASLFGLKAFGNIYTRIMNPTQAVLEERVAALEGGTAALAVASGHAAQVIVFHNLMQPGDNFVAATRLYGGSINQFGHAFKNYGWEVRWADTNDLSTFESQIDDRTKAIFIESLANPGGTFVDIEKIGDIARKHGLPLIVDNTLASPYLIRPIEHGADIVVHSLTKFIGGHGNSIGGVIVDGGTFDWSKSGKYPMLSEPRPEYGGLVLHETFGNFAFAIAARVLGLRDLGPAISPFNAFLILTGLETLPLRMQRHCDNAVTVAGWLSNHPKVAWVNYPGLPSDKNNALQKKYSPLGAGAVFTFGLKGGYEAGVKFVEALELFSHLANVGDTKSLVIHPASTTHRQLSDEQKVKAGAGPDTVRLSIGIEDVTDIVADLEQALAKV
>NC_002678.2|WP_010915653.1|6964302_6964509_+|hypothetical-protein
MNLLIGKLGGLVFIVLGFLLAASGYRAASTGYMAAGIVLLAIGVALVVRKVLREIKTINGDGRQGVEG
>NC_002678.2|WP_010915654.1|6964737_6965760_-|aldo/keto-reductase
MKTRHFDRIGNGGLTFTELGFGTAPLGNLYRAVSDEDAKATLDAAWATGCRYYDTAPLYGLGLSETRLNPFLRGKKRDDYVLSSKVGRLMRACPPEQRTGIGKFFDTPSRQEVYDYSYDGVMRSFEASLERLGVDRIDILFVHDVDIFTHGSKQASDLRIEEFMRSGYYGLLSLRDQSAIKAFGGGINEWQVAQTLAERGDFDLFLLAGRYTLLEQEALTSFLPLCQKRGIGIVLGGPYNSGILATGPKPGAYYNYSEAPKDILERVARIEAVCKRHGVRLIEAALQFPLLHPSVVSVIPGGQRPSEVESNRSLLDAKLPAALWADLKQEGLMRADAPNG
>NC_002678.2|WP_010915655.1|6965925_6966492_+|SIS-domain-containing-protein
MSDRNENLFKTALDELSGVLARVDDSQIDAACKLLAEARQIVVYGCGREALQVKGFAMRLYHLGLPVSVVGDMTAPPLGPGDVFLASSGPGETSTVLTLMRVAREAGATNLLLTAQAGGSAAKRADTTLLIPAQTMANDQGPQKTSVLPMGSVFEGALFLLFEVMVLKLKSLIGASPEAMRARHTNME
>NC_002678.2|WP_010915656.1|6966495_6967239_+|creatininase-family-protein
MRYELMLPHQIRQAIAENWPVALPLGVLEYHGEHMAVGMDTLAVTKTLELFEKERDVVILPPFYYGAASYAVAPPEGTGSVQVGGNQLALFGEELFYSLLRIGFRNIHAIIHHQTENFAAGMPTDLAFKTAGRQAIFRFLEKQRGEGWWGSKDMADYYAGHAAGENFFNWVQVHPLMPAAMNGKYPFDHAGIGETSLMLALCPEAVDAARFADNTGWYTASAKDASAELGNKGVAMIMDHLRAILRA
>NC_002678.2|WP_010915657.1|6967523_6968441_-|carbohydrate-ABC-transporter-permease
MSVQTTEYTVSEIRSPASFITSRVFIYGALVFWALICLFPIYWTITTSFKSAVDVTQGHLIPFVDFQPDWKGWRSLGLSPDSIFQTSTVRDEFFKRFMNSVITSVGASSLAIVIGSLAAYGLTRYRYKFAWFKNEDISFFFLSQLILPPVVLALPFLVLYREVGLLDTRIGLVLLYTLMVLPIVIWIMRDQFNSIPVELEEAALVDGLSIWGAFFRIVMPIALPGMVAAFILAMVLCWNEYFFAALLTSTDAKTIPVMVASQTGSQGINWWSMAALATAAIAPLAVIGIALERYLIMGMTAGAVK
>NC_002678.2|WP_032933358.1|6968452_6969574_-|ABC-transporter-permease-subunit
MADQILPTNDWPANAVPSDLIPPGRKRLGWAVMAAATLGLLATILVQILYKSEVDTIGFETWRPVVYAYVLWGVALGIGQVLTRGEDGQRALFLLPALLFTIAMVIFPTLFGFYIALTDWNLSSFSGRRFNGLDNFWQMLGDPYYRNALFNMVLYVLAVLVEYVIAFGLALLLNAQIRARKFFRVVFLMPLMLSPVAVSWMIGKSLMEYRFGPAATLARHLGWDNPAFFSDPIIARISIMILDAWTFIPFMMIMLLAGLQAMSREVLEAARVDGATAWQTFWQVTFPLMLPVSVTAVILRIIFKLKLADIIITVTSGGPGGATDSVSSFIYREYRDRSNVGYGTMLAMAYLVIIVVFVTWLLKLANRFVRNVN
>NC_002678.2|WP_032929955.1|6969672_6971340_-|sugar-ABC-transporter-substrate-binding-protein
MRTGLYDRLVRAGATRRDVLKGAASMAAIAAASGAGLGALTRPASAASELRSKILQIPGVGKGQPTDADFQKVGELCLEATKANVKEGEFAGVELTFMGLNNQNLHNVLFRGFLKPWEAYTGAKISWIDLAQADYNARLQQSIATGTVDFDIIEMGAPFEGDVCGKGLTSEMPDWVKKQIDFDDLVNYLKPPVGTWDGKQYRVTIDGDTHNFNYRTDVFADADLAKQWKDGGGEGEWGVPKTWQQVQAVTKFLKGKKFKGQDVYGYLDAPKPWGGFGFYFLGSRATAYAKHPDDKAWLFDADTMKPRINNPAWVRAIQDVIDALPSEPADQINADPNTTGFQQFLAGTGSMIPWWGDIGSNVKTNDSSVIGDVTGFSILPGSDDVYNSKTGKWEKLASGPNYSPNCAYLGWGVYVMARVDKDEKKKKAAWSAAAHLGGKDLSIWTAMYPSGFQPYRNSHFDIPEWVAAGYDEAFITSYLKSEGDSYNHPNAAIEPRIPGIFQYYSAAEDILANTFAGKMKAQEGADAIAAAWEKLTDQIGREKQIKLYKASLGLA
>NC_002678.2|WP_010915660.1|6971623_6972679_+|sn-glycerol-3-phosphate-ABC-transporter-ATP-binding-protein-UgpC
MAQVAISKVAKAFGTVKVLHEVSVDIADGQFVVLVGPSGCGKSTLLRMVAGLETVSGGTIAIGDRVVNHLPPAKRDIAMVFQNYALYPHKTVEQNMAFALKLRKTDPAVVAERVKRAADILDLNPYLKRYPRQLSGGQRQRVAMGRAIVRNPQVFLFDEPLSNLDAKLRVQMRTEIKELHQRLKTTTIYVTHDQIEAMTMADKIVVMRDGRIEQVGAPLELFDRPANLFVAGFIGSPSMNLLKGVVRKGDKPGVDISGTLFPIADNAAQDGQAVVYGVRPEHLEIHPDGVPAKISVVEPTGSETLVFLRFGDREMVALFRERHDFKPGDTLTLKPRLDQIHLFDAETGKRL
>NC_002678.2|WP_010915661.1|6972705_6973158_+|RbsD/FucU-family-protein
MLKGINPLLNADVLQALRAMGHGDDLIIADTNFPSDSVARQTALGRLLRIDASAAEVVKAVLSLYPLDTFVDDAAARMEIVGKPDEIPSVQKEVQKEIDAAEGKSWPMLPVERYAFYERAKQAYCVIQTGERRFYGCFAFRKGVIPPDAE
>NC_002678.2|WP_010915662.1|6973162_6974092_+|ribokinase
MAAGKPVVILGVFVADTAYRADRQPRMGETILGNSFKLGPGGKGSNQAVAAGKLGADTTFLTRLGVDAFADMAKRTWQDAGVKSAVIDTPDSYTGAAYIFVEEGSGNNAIIVSPGAAMLISPTDIEANAALIRGAGVFVTQLEQPIDAAMRALEIARGAGVTTILNPAPAAKLPDRVYTLCDYLTPNETETEELTGLKVSSVDEARTASGKLLEKGVGTVIVTLGDKGALLHSKGRSEHVPAISAGPVVETTGAGDAFNGGFAAALSRGVEPLQAVRFACAVAGISVTRPGTAPSMPTLQEVEALLAKG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NC_002678_3	3.1\|3630139\|18\|NC_002678\|CRT	3630139-3630156	18	NC_002678.2	767801-767818	1	0.944
NC_002678_3	3.1\|3630139\|18\|NC_002678\|CRT	3630139-3630156	18	NC_002678.2	770357-770374	1	0.944
NC_002678_3	3.1\|3630139\|18\|NC_002678\|CRT	3630139-3630156	18	NC_002678.2	3616723-3616740	1	0.944
NC_002678_3	3.2\|3630175\|18\|NC_002678\|CRT	3630175-3630192	18	NC_002678.2	767801-767818	1	0.944
NC_002678_3	3.2\|3630175\|18\|NC_002678\|CRT	3630175-3630192	18	NC_002678.2	770357-770374	1	0.944
NC_002678_3	3.2\|3630175\|18\|NC_002678\|CRT	3630175-3630192	18	NC_002678.2	3616723-3616740	1	0.944
NC_002678_3	3.3\|3630211\|18\|NC_002678\|CRT	3630211-3630228	18	NC_002678.2	767801-767818	1	0.944
NC_002678_3	3.3\|3630211\|18\|NC_002678\|CRT	3630211-3630228	18	NC_002678.2	770357-770374	1	0.944
NC_002678_3	3.3\|3630211\|18\|NC_002678\|CRT	3630211-3630228	18	NC_002678.2	3616723-3616740	1	0.944

1. spacer 3.1|3630139|18|NC_002678|CRT matches to position: 767801-767818, mismatch: 1, identity: 0.944

ggcggcggcaatggcggt	CRISPR spacer
ggtggcggcaatggcggt	Protospacer
**.***************

2. spacer 3.1|3630139|18|NC_002678|CRT matches to position: 770357-770374, mismatch: 1, identity: 0.944

ggcggcggcaatggcggt	CRISPR spacer
ggcggtggcaatggcggt	Protospacer
*****.************

3. spacer 3.1|3630139|18|NC_002678|CRT matches to position: 3616723-3616740, mismatch: 1, identity: 0.944

ggcggcggcaatggcggt	CRISPR spacer
ggcggcggcaatggccgt	Protospacer
*************** **

4. spacer 3.2|3630175|18|NC_002678|CRT matches to position: 767801-767818, mismatch: 1, identity: 0.944

ggcggcggcaatggcggt	CRISPR spacer
ggtggcggcaatggcggt	Protospacer
**.***************

5. spacer 3.2|3630175|18|NC_002678|CRT matches to position: 770357-770374, mismatch: 1, identity: 0.944

ggcggcggcaatggcggt	CRISPR spacer
ggcggtggcaatggcggt	Protospacer
*****.************

6. spacer 3.2|3630175|18|NC_002678|CRT matches to position: 3616723-3616740, mismatch: 1, identity: 0.944

ggcggcggcaatggcggt	CRISPR spacer
ggcggcggcaatggccgt	Protospacer
*************** **

7. spacer 3.3|3630211|18|NC_002678|CRT matches to position: 767801-767818, mismatch: 1, identity: 0.944

ggcggcggcaatggcggt	CRISPR spacer
ggtggcggcaatggcggt	Protospacer
**.***************

8. spacer 3.3|3630211|18|NC_002678|CRT matches to position: 770357-770374, mismatch: 1, identity: 0.944

ggcggcggcaatggcggt	CRISPR spacer
ggcggtggcaatggcggt	Protospacer
*****.************

9. spacer 3.3|3630211|18|NC_002678|CRT matches to position: 3616723-3616740, mismatch: 1, identity: 0.944

ggcggcggcaatggcggt	CRISPR spacer
ggcggcggcaatggccgt	Protospacer
*************** **

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	NZ_CP049249	Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence	1017211-1017240	2	0.933
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	NZ_CP049249	Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence	1017175-1017204	2	0.933
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	NZ_AP014579	Burkholderia sp. RPE67 plasmid p1, complete sequence	390818-390847	2	0.933
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	NZ_AP014579	Burkholderia sp. RPE67 plasmid p1, complete sequence	390830-390859	3	0.9
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	601022-601051	3	0.9
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	446200-446229	3	0.9
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	NZ_CP017105	Rhizobium gallicum strain IE4872 plasmid pRgalIE4872d, complete sequence	1051619-1051648	4	0.867
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	NZ_AP014579	Burkholderia sp. RPE67 plasmid p1, complete sequence	390911-390940	5	0.833
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	NZ_CP024310	Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3c, complete sequence	390704-390733	5	0.833
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	NZ_CP017244	Rhizobium etli 8C-3 plasmid pRsp8C3c, complete sequence	1145442-1145471	5	0.833
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	NC_041916	Vibrio phage pTD1 DNA, complete genome	130779-130808	5	0.833
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	NZ_CP029452	Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence	484851-484880	5	0.833
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	NZ_CP023071	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence	382495-382524	5	0.833
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	NZ_CP030127	Indioceanicola profundi strain SCSIO 08040 plasmid unnamed1, complete sequence	47464-47493	5	0.833
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	NZ_CP013110	Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence	2016048-2016077	5	0.833
NC_002678_4	4.1\|6964026\|26\|NC_002678\|CRISPRCasFinder	6964026-6964051	26	NZ_CP015038	Burkholderia cenocepacia strain 895 plasmid pBcp895-1, complete sequence	107953-107978	5	0.808
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	NZ_AP014579	Burkholderia sp. RPE67 plasmid p1, complete sequence	390794-390823	6	0.8
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	NZ_AP014579	Burkholderia sp. RPE67 plasmid p1, complete sequence	391190-391219	6	0.8
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	NZ_AP014579	Burkholderia sp. RPE67 plasmid p1, complete sequence	391253-391282	6	0.8
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	NZ_CP032686	Rhizobium sp. CCGE531 plasmid pRCCGE531c, complete sequence	247287-247316	6	0.8
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	NZ_CP032691	Rhizobium sp. CCGE532 plasmid pRCCGE532c, complete sequence	242249-242278	6	0.8
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	NZ_CP029452	Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence	484839-484868	6	0.8
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	NZ_CP023071	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence	382483-382512	6	0.8
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	KY555147	Caulobacter phage Ccr34, complete genome	38913-38942	6	0.8
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	KY555146	Caulobacter phage Ccr32, complete genome	38913-38942	6	0.8
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	1589408-1589437	6	0.8
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	NC_015178	Acidiphilium multivorum AIU301 plasmid pACMV1, complete sequence	67828-67857	6	0.8
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	JX163858	Caulobacter phage phiCbK, complete genome	168915-168944	6	0.8
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	NZ_CP022192	Yangia pacifica strain YSBP01 plasmid unnamed2, complete sequence	119994-120023	6	0.8
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	NC_011366	Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG202, complete sequence	236892-236921	6	0.8
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	NZ_CP032695	Rhizobium jaguaris strain CCGE525 plasmid pRCCGE525c, complete sequence	1386378-1386407	6	0.8
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	NZ_CP039924	Agrobacterium tumefaciens strain CFBP7129 plasmid pAtCFBP7129a, complete sequence	433274-433303	6	0.8
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	MN734439	Sphingomonas phage Kharn, complete genome	27460-27489	6	0.8
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	KX683423	Mycobacterium phage BabyRay, complete genome	33234-33263	6	0.8
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	MN734438	Sphingomonas phage Lucius, complete genome	26820-26849	6	0.8
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	NZ_CP024310	Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3c, complete sequence	388011-388040	7	0.767
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	NZ_CP013054	Sinorhizobium americanum CCGM7 plasmid C, complete sequence	451434-451463	7	0.767
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	NC_019849	Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence	298643-298672	7	0.767
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	NC_017326	Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence	298158-298187	7	0.767
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	NC_017323	Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence	1535063-1535092	7	0.767
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	NZ_CP009146	Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence	293669-293698	7	0.767
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	NC_018701	Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence	293402-293431	7	0.767
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	NZ_CP021802	Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence	910547-910576	7	0.767
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	NZ_CP021820	Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence	639434-639463	7	0.767
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	NZ_CP021831	Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence	543401-543430	7	0.767
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	NZ_CP021810	Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence	1082196-1082225	7	0.767
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	NZ_CP021218	Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence	446723-446752	7	0.767
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	NZ_CP026527	Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence	297316-297345	7	0.767
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	NC_003078	Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence	1442726-1442755	7	0.767
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	NZ_CP013110	Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence	2016036-2016065	7	0.767
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	NZ_CP021799	Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence	1508948-1508977	7	0.767
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	NZ_CP021823	Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence	1130865-1130894	7	0.767
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	NZ_CP021795	Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence	669623-669652	7	0.767
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	NZ_CP021806	Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence	721993-722022	7	0.767
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	NZ_CP019484	Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence	1560249-1560278	7	0.767
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	NZ_CP019487	Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence	1336601-1336630	7	0.767
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	NC_020560	Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence	1442732-1442761	7	0.767
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	NZ_CP022363	Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence	17423-17452	7	0.767
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	NZ_CP054615	Azospirillum oryzae strain KACC 14407 plasmid unnamed1, complete sequence	255115-255144	7	0.767
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	NZ_CP039696	Novosphingobium sp. ABRDHK2 plasmid pABRDHK21, complete sequence	69243-69272	7	0.767
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	NZ_CP017759	Cupriavidus necator strain NH9 plasmid pENH92, complete sequence	232840-232869	7	0.767
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	NZ_CP038636	Cupriavidus oxalaticus strain X32 plasmid unnamed1, complete sequence	118625-118654	7	0.767
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	NC_019410	Caulobacter phage CcrKarma, complete genome	38988-39017	7	0.767
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	NC_019407	Caulobacter phage CcrMagneto, complete genome	38179-38208	7	0.767
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	NC_019411	Caulobacter phage CcrSwift, complete genome	38141-38170	7	0.767
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	NZ_LR723679	Arsenite-oxidising bacterium NT-25 plasmid 3	15114-15143	7	0.767
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	AP018399	Xanthomonas phage XacN1 DNA, complete genome	284974-285003	7	0.767
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	MT028491	Ochrobactrum phage vB_OspM_OC, complete genome	5729-5758	8	0.733
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	NZ_CP032685	Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence	91741-91770	8	0.733
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	NZ_CP032690	Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence	91741-91770	8	0.733
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	MH837626	Escherichia phage vB_vPM_PD112, complete genome	62124-62153	8	0.733
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	KY290975	Escherichia phage YUEEL01, complete genome	159494-159523	8	0.733
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	KM606997	Enterobacteria phage RB7, complete genome	159012-159041	8	0.733
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	KU255730	Escherichia phage phiE142, complete genome	4238-4267	8	0.733
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	MK327937	Escherichia phage vB_EcoM_G10400, complete genome	160792-160821	8	0.733
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	LR597657	Escherichia phage T4_ev240 genome assembly, chromosome: 1	157787-157816	8	0.733
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	KM606996	Enterobacteria phage RB6, complete genome	159011-159040	8	0.733
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	NC_025448	Enterobacteria phage RB27, complete genome	155796-155825	8	0.733
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	KM606995	Enterobacteria phage RB5, complete genome	159011-159040	8	0.733
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	AF075710	Bacteriophage RB27 large tail fiber subunit gp37 and tail fiber adhesin gp38 genes, partial cds	1289-1318	8	0.733
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	MT179807	Escherichia phage vB_EcoM_IME537, complete genome	66950-66979	8	0.733
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	MK327944	Escherichia phage vB_EcoM_G2540-3, complete genome	158539-158568	8	0.733
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	KM606994	Enterobacteria phage RB3, complete genome	159019-159048	8	0.733
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	AF060870	Bacteriophage Ac3 distal tail fiber small subunit gp36 (gene 36) gene, partial cds; and distal tail fiber large subunit gp37 (gene 37) and tail fiber adhesin gp38 (gene 38) genes, complete cds	4006-4035	8	0.733
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	MH243439	Escherichia phage vB_EcoM_NBG2, complete genome	155979-156008	8	0.733
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	MG867727	Escherichia phage vB_EcoM-G28, complete genome	160506-160535	8	0.733
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	LR597660	Escherichia phage T4_ev151 genome assembly, chromosome: 1	157662-157691	8	0.733
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	MT932213	Escherichia phage VEc74, complete genome	156501-156530	8	0.733
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	KM606999	Enterobacteria phage RB10, complete genome	159018-159047	8	0.733
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	KM606998	Enterobacteria phage RB9, complete genome	159012-159041	8	0.733
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	NZ_CP032828	Sphingomonas sp. YZ-8 plasmid unnamed1, complete sequence	561587-561616	8	0.733
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	KY608967	UNVERIFIED: Escherichia phage CF2, complete genome	99-128	8	0.733
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	MT682709	Escherichia phage vB_EcoM_SP1, complete genome	12191-12220	8	0.733
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	MH834622	Arthrobacter phage Noely, complete genome	4245-4274	8	0.733
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	LR746311	Shigella phage vB_SsoM_113 genome assembly, chromosome: 1	79438-79467	8	0.733
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	MH051916	Enterobacteria phage vB_EcoM_IME340, complete genome	11532-11561	8	0.733
NC_002678_3	3.4\|3630247\|30\|NC_002678\|CRT	3630247-3630276	30	NZ_CP015232	Epibacterium mobile F1926 plasmid unnamed2, complete sequence	74317-74346	9	0.7

1. spacer 3.4|3630247|30|NC_002678|CRT matches to NZ_CP049249 (Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence) position: , mismatch: 2, identity: 0.933

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
ggcggcggcaatggcggtggcaatggcggt	Protospacer
************************.****.

2. spacer 3.4|3630247|30|NC_002678|CRT matches to NZ_CP049249 (Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence) position: , mismatch: 2, identity: 0.933

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
ggcggcggcaatggcggcggcaatggcggc	Protospacer
*****************.******.*****

3. spacer 3.4|3630247|30|NC_002678|CRT matches to NZ_AP014579 (Burkholderia sp. RPE67 plasmid p1, complete sequence) position: , mismatch: 2, identity: 0.933

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
ggcggcggcaatggcggtgggaatggcggc	Protospacer
******************** ***.*****

4. spacer 3.4|3630247|30|NC_002678|CRT matches to NZ_AP014579 (Burkholderia sp. RPE67 plasmid p1, complete sequence) position: , mismatch: 3, identity: 0.9

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
ggcggcggcaatggcggcggcaatggcggt	Protospacer
*****************.******.****.

5. spacer 3.4|3630247|30|NC_002678|CRT matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 3, identity: 0.9

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
ggcggcggcaatggcggcggcaatggcggg	Protospacer
*****************.******.****

6. spacer 3.4|3630247|30|NC_002678|CRT matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 3, identity: 0.9

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
ggcggcggcaatggcggcggcaatggcggg	Protospacer
*****************.******.****

7. spacer 3.4|3630247|30|NC_002678|CRT matches to NZ_CP017105 (Rhizobium gallicum strain IE4872 plasmid pRgalIE4872d, complete sequence) position: , mismatch: 4, identity: 0.867

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
ggcggcggcaatggcggcggcaatggcaac	Protospacer
*****************.******.**..*

8. spacer 3.4|3630247|30|NC_002678|CRT matches to NZ_AP014579 (Burkholderia sp. RPE67 plasmid p1, complete sequence) position: , mismatch: 5, identity: 0.833

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
ggcggcggcaatggcggcggcaacggtggt	Protospacer
*****************.*****..*.**.

9. spacer 3.4|3630247|30|NC_002678|CRT matches to NZ_CP024310 (Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3c, complete sequence) position: , mismatch: 5, identity: 0.833

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
aagggcggcaatggcggcggcaatggcggc	Protospacer
.. **************.******.*****

10. spacer 3.4|3630247|30|NC_002678|CRT matches to NZ_CP017244 (Rhizobium etli 8C-3 plasmid pRsp8C3c, complete sequence) position: , mismatch: 5, identity: 0.833

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
ggcggcggcaatggcggcggcaatggcaat	Protospacer
*****************.******.**...

11. spacer 3.4|3630247|30|NC_002678|CRT matches to NC_041916 (Vibrio phage pTD1 DNA, complete genome) position: , mismatch: 5, identity: 0.833

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
aacggcggcaatggcggcggcaatggcggt	Protospacer
..***************.******.****.

12. spacer 3.4|3630247|30|NC_002678|CRT matches to NZ_CP029452 (Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence) position: , mismatch: 5, identity: 0.833

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
ggcggcggcaatggcggcggcaacggtggt	Protospacer
*****************.*****..*.**.

13. spacer 3.4|3630247|30|NC_002678|CRT matches to NZ_CP023071 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence) position: , mismatch: 5, identity: 0.833

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
ggcggcggcaatggcggcggcaacggtggt	Protospacer
*****************.*****..*.**.

14. spacer 3.4|3630247|30|NC_002678|CRT matches to NZ_CP030127 (Indioceanicola profundi strain SCSIO 08040 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
accagcggcaatggcggcggcaataccggc	Protospacer
. *.*************.******* ****

15. spacer 3.4|3630247|30|NC_002678|CRT matches to NZ_CP013110 (Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence) position: , mismatch: 5, identity: 0.833

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
ggcaatggcaatggcggcggcaatggcggc	Protospacer
***...***********.******.*****

16. spacer 4.1|6964026|26|NC_002678|CRISPRCasFinder matches to NZ_CP015038 (Burkholderia cenocepacia strain 895 plasmid pBcp895-1, complete sequence) position: , mismatch: 5, identity: 0.808

tttttgtccccgacaccggtacacac	CRISPR spacer
gtgatgtccgcgacaccggtacacaa	Protospacer
 *  ***** ***************

17. spacer 3.4|3630247|30|NC_002678|CRT matches to NZ_AP014579 (Burkholderia sp. RPE67 plasmid p1, complete sequence) position: , mismatch: 6, identity: 0.8

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
ggcggcggcaacggcggcggcaacggcaac	Protospacer
***********.*****.*****..**..*

18. spacer 3.4|3630247|30|NC_002678|CRT matches to NZ_AP014579 (Burkholderia sp. RPE67 plasmid p1, complete sequence) position: , mismatch: 6, identity: 0.8

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
ggcggcggcaacggcggcggcaacggtggt	Protospacer
***********.*****.*****..*.**.

19. spacer 3.4|3630247|30|NC_002678|CRT matches to NZ_AP014579 (Burkholderia sp. RPE67 plasmid p1, complete sequence) position: , mismatch: 6, identity: 0.8

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
ggcggcggcaacggcggcggcaacggtggt	Protospacer
***********.*****.*****..*.**.

20. spacer 3.4|3630247|30|NC_002678|CRT matches to NZ_CP032686 (Rhizobium sp. CCGE531 plasmid pRCCGE531c, complete sequence) position: , mismatch: 6, identity: 0.8

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
gggaacggcaatggcggtggcaatggtggt	Protospacer
** ..*******************.*.**.

21. spacer 3.4|3630247|30|NC_002678|CRT matches to NZ_CP032691 (Rhizobium sp. CCGE532 plasmid pRCCGE532c, complete sequence) position: , mismatch: 6, identity: 0.8

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
gggaacggcaatggcggtggcaatggtggt	Protospacer
** ..*******************.*.**.

22. spacer 3.4|3630247|30|NC_002678|CRT matches to NZ_CP029452 (Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence) position: , mismatch: 6, identity: 0.8

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
aaaagcggcaatggcggcggcaatggcggc	Protospacer
.. .*************.******.*****

23. spacer 3.4|3630247|30|NC_002678|CRT matches to NZ_CP023071 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence) position: , mismatch: 6, identity: 0.8

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
aaaagcggcaatggcggcggcaatggcggc	Protospacer
.. .*************.******.*****

24. spacer 3.4|3630247|30|NC_002678|CRT matches to KY555147 (Caulobacter phage Ccr34, complete genome) position: , mismatch: 6, identity: 0.8

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
aacggcggcaatggcggtggcaagtggggg	Protospacer
..*********************  * **

25. spacer 3.4|3630247|30|NC_002678|CRT matches to KY555146 (Caulobacter phage Ccr32, complete genome) position: , mismatch: 6, identity: 0.8

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
aacggcggcaatggcggtggcaagtggggg	Protospacer
..*********************  * **

26. spacer 3.4|3630247|30|NC_002678|CRT matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 6, identity: 0.8

ggcggcggcaatggcggtg--gcaatagcggc	CRISPR spacer
ggcggcggcaatggcggtggcgcgctggtg--	Protospacer
*******************  **. *.*.*

27. spacer 3.4|3630247|30|NC_002678|CRT matches to NC_015178 (Acidiphilium multivorum AIU301 plasmid pACMV1, complete sequence) position: , mismatch: 6, identity: 0.8

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
ggcggcggcaatggcggtggcgcttggagt	Protospacer
*********************. * * .*.

28. spacer 3.4|3630247|30|NC_002678|CRT matches to JX163858 (Caulobacter phage phiCbK, complete genome) position: , mismatch: 6, identity: 0.8

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
aacggcggcaatggcggtggcaagtggggg	Protospacer
..*********************  * **

29. spacer 3.4|3630247|30|NC_002678|CRT matches to NZ_CP022192 (Yangia pacifica strain YSBP01 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.8

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
ggcggcggcaatggcgatggcgatgaccac	Protospacer
****************.****.**..* .*

30. spacer 3.4|3630247|30|NC_002678|CRT matches to NC_011366 (Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG202, complete sequence) position: , mismatch: 6, identity: 0.8

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
gcccgcggcaatggcggtggccatcgccgt	Protospacer
* * ***************** ** ** *.

31. spacer 3.4|3630247|30|NC_002678|CRT matches to NZ_CP032695 (Rhizobium jaguaris strain CCGE525 plasmid pRCCGE525c, complete sequence) position: , mismatch: 6, identity: 0.8

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
ggcaatggtaacggcggtggcaatagcgga	Protospacer
***...**.**.*****************

32. spacer 3.4|3630247|30|NC_002678|CRT matches to NZ_CP039924 (Agrobacterium tumefaciens strain CFBP7129 plasmid pAtCFBP7129a, complete sequence) position: , mismatch: 6, identity: 0.8

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
ggcggcggcaacggtggtggcaacggggga	Protospacer
***********.**.********..* **

33. spacer 3.4|3630247|30|NC_002678|CRT matches to MN734439 (Sphingomonas phage Kharn, complete genome) position: , mismatch: 6, identity: 0.8

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
ggcggcggcaatgccggtggcggcttcggc	Protospacer
************* *******...  ****

34. spacer 3.4|3630247|30|NC_002678|CRT matches to KX683423 (Mycobacterium phage BabyRay, complete genome) position: , mismatch: 6, identity: 0.8

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
ggcggcggtaacggcggtggcaacggtggt	Protospacer
********.**.***********..*.**.

35. spacer 3.4|3630247|30|NC_002678|CRT matches to MN734438 (Sphingomonas phage Lucius, complete genome) position: , mismatch: 6, identity: 0.8

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
ggcggcggcaatgccggtggcggcttcggc	Protospacer
************* *******...  ****

36. spacer 3.4|3630247|30|NC_002678|CRT matches to NZ_CP024310 (Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3c, complete sequence) position: , mismatch: 7, identity: 0.767

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
ggtggcggcaatggcggcggcaacggcaat	Protospacer
**.**************.*****..**...

37. spacer 3.4|3630247|30|NC_002678|CRT matches to NZ_CP013054 (Sinorhizobium americanum CCGM7 plasmid C, complete sequence) position: , mismatch: 7, identity: 0.767

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
ggcggcggcaatggcggcggtaacggcaat	Protospacer
*****************.**.**..**...

38. spacer 3.4|3630247|30|NC_002678|CRT matches to NC_019849 (Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence) position: , mismatch: 7, identity: 0.767

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
ggcggcggcaatggcggcggccacggcaag	Protospacer
*****************.*** *..**..

39. spacer 3.4|3630247|30|NC_002678|CRT matches to NC_017326 (Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence) position: , mismatch: 7, identity: 0.767

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
ggcggcggcaatggcggcggccacggcaag	Protospacer
*****************.*** *..**..

40. spacer 3.4|3630247|30|NC_002678|CRT matches to NC_017323 (Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence) position: , mismatch: 7, identity: 0.767

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
ggcggcggcaatggcggcggccacggcaag	Protospacer
*****************.*** *..**..

41. spacer 3.4|3630247|30|NC_002678|CRT matches to NZ_CP009146 (Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence) position: , mismatch: 7, identity: 0.767

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
ggcggcggcaatggcggcggccacggcaag	Protospacer
*****************.*** *..**..

42. spacer 3.4|3630247|30|NC_002678|CRT matches to NC_018701 (Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence) position: , mismatch: 7, identity: 0.767

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
ggcggcggcaatggcggcggccacggcaag	Protospacer
*****************.*** *..**..

43. spacer 3.4|3630247|30|NC_002678|CRT matches to NZ_CP021802 (Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.767

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
ggcggcggcaatggcggcggccacggcaag	Protospacer
*****************.*** *..**..

44. spacer 3.4|3630247|30|NC_002678|CRT matches to NZ_CP021820 (Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.767

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
ggcggcggcaatggcggcggccacggcaag	Protospacer
*****************.*** *..**..

45. spacer 3.4|3630247|30|NC_002678|CRT matches to NZ_CP021831 (Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.767

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
ggcggcggcaatggcggcggccacggcaag	Protospacer
*****************.*** *..**..

46. spacer 3.4|3630247|30|NC_002678|CRT matches to NZ_CP021810 (Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.767

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
ggcggcggcaatggcggcggccacggcaag	Protospacer
*****************.*** *..**..

47. spacer 3.4|3630247|30|NC_002678|CRT matches to NZ_CP021218 (Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence) position: , mismatch: 7, identity: 0.767

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
ggcggcggcaatggcggcggccacggcaag	Protospacer
*****************.*** *..**..

48. spacer 3.4|3630247|30|NC_002678|CRT matches to NZ_CP026527 (Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence) position: , mismatch: 7, identity: 0.767

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
ggcggcggcaatggcggcggccacggcaag	Protospacer
*****************.*** *..**..

49. spacer 3.4|3630247|30|NC_002678|CRT matches to NC_003078 (Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence) position: , mismatch: 7, identity: 0.767

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
ggcggcggcaatggcggcggccacggcaag	Protospacer
*****************.*** *..**..

50. spacer 3.4|3630247|30|NC_002678|CRT matches to NZ_CP013110 (Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence) position: , mismatch: 7, identity: 0.767

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
ggcggcggcaatggcggcggtaacggcaat	Protospacer
*****************.**.**..**...

51. spacer 3.4|3630247|30|NC_002678|CRT matches to NZ_CP021799 (Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.767

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
ggcggcggcaatggcggcggccacggcaag	Protospacer
*****************.*** *..**..

52. spacer 3.4|3630247|30|NC_002678|CRT matches to NZ_CP021823 (Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.767

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
ggcggcggcaatggcggcggccacggcaag	Protospacer
*****************.*** *..**..

53. spacer 3.4|3630247|30|NC_002678|CRT matches to NZ_CP021795 (Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.767

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
ggcggcggcaatggcggcggccacggcaag	Protospacer
*****************.*** *..**..

54. spacer 3.4|3630247|30|NC_002678|CRT matches to NZ_CP021806 (Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.767

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
ggcggcggcaatggcggcggccacggcaag	Protospacer
*****************.*** *..**..

55. spacer 3.4|3630247|30|NC_002678|CRT matches to NZ_CP019484 (Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence) position: , mismatch: 7, identity: 0.767

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
ggcggcggcaatggcggcggccacggcaag	Protospacer
*****************.*** *..**..

56. spacer 3.4|3630247|30|NC_002678|CRT matches to NZ_CP019487 (Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence) position: , mismatch: 7, identity: 0.767

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
ggcggcggcaatggcggcggccacggcaag	Protospacer
*****************.*** *..**..

57. spacer 3.4|3630247|30|NC_002678|CRT matches to NC_020560 (Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence) position: , mismatch: 7, identity: 0.767

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
ggcggcggcaatggcggcggccacggcaag	Protospacer
*****************.*** *..**..

58. spacer 3.4|3630247|30|NC_002678|CRT matches to NZ_CP022363 (Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence) position: , mismatch: 7, identity: 0.767

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
cgcggcggcgatggcggtggcgatctcgtt	Protospacer
 ********.***********.**  ** .

59. spacer 3.4|3630247|30|NC_002678|CRT matches to NZ_CP054615 (Azospirillum oryzae strain KACC 14407 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
ggcggcggcaatggtggtggcgatttcact	Protospacer
**************.******.**  *. .

60. spacer 3.4|3630247|30|NC_002678|CRT matches to NZ_CP039696 (Novosphingobium sp. ABRDHK2 plasmid pABRDHK21, complete sequence) position: , mismatch: 7, identity: 0.767

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
ggcggcggcaacggcggtggcgggggaggg	Protospacer
***********.*********.. .* **

61. spacer 3.4|3630247|30|NC_002678|CRT matches to NZ_CP017759 (Cupriavidus necator strain NH9 plasmid pENH92, complete sequence) position: , mismatch: 7, identity: 0.767

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
ggcggcggcgatggcggtggccgaggtgtc	Protospacer
*********.*********** . .*.* *

62. spacer 3.4|3630247|30|NC_002678|CRT matches to NZ_CP038636 (Cupriavidus oxalaticus strain X32 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
ggcggcggcgatggcggtggccgaggtgtc	Protospacer
*********.*********** . .*.* *

63. spacer 3.4|3630247|30|NC_002678|CRT matches to NC_019410 (Caulobacter phage CcrKarma, complete genome) position: , mismatch: 7, identity: 0.767

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
aacggcggcaatggcgggggcaagtggggt	Protospacer
..*************** *****  * **.

64. spacer 3.4|3630247|30|NC_002678|CRT matches to NC_019407 (Caulobacter phage CcrMagneto, complete genome) position: , mismatch: 7, identity: 0.767

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
aacggcggcaatggcgggggcaagtggggt	Protospacer
..*************** *****  * **.

65. spacer 3.4|3630247|30|NC_002678|CRT matches to NC_019411 (Caulobacter phage CcrSwift, complete genome) position: , mismatch: 7, identity: 0.767

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
aacggcggcaatggcgggggcaagtggggt	Protospacer
..*************** *****  * **.

66. spacer 3.4|3630247|30|NC_002678|CRT matches to NZ_LR723679 (Arsenite-oxidising bacterium NT-25 plasmid 3) position: , mismatch: 7, identity: 0.767

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
gggggcgggaatggcggtggcaacgggaac	Protospacer
** ***** **************..* ..*

67. spacer 3.4|3630247|30|NC_002678|CRT matches to AP018399 (Xanthomonas phage XacN1 DNA, complete genome) position: , mismatch: 7, identity: 0.767

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
ggcggcggcaatggcggttgcggtgttggt	Protospacer
****************** **..*. .**.

68. spacer 3.4|3630247|30|NC_002678|CRT matches to MT028491 (Ochrobactrum phage vB_OspM_OC, complete genome) position: , mismatch: 8, identity: 0.733

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
aatcccggcaatggcggtggtaataccggt	Protospacer
...  ***************.**** ***.

69. spacer 3.4|3630247|30|NC_002678|CRT matches to NZ_CP032685 (Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence) position: , mismatch: 8, identity: 0.733

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
gccggcggcaatggcggtcgcaagcttgct	Protospacer
* **************** ****   .* .

70. spacer 3.4|3630247|30|NC_002678|CRT matches to NZ_CP032690 (Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence) position: , mismatch: 8, identity: 0.733

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
gccggcggcaatggcggtcgcaagcttgct	Protospacer
* **************** ****   .* .

71. spacer 3.4|3630247|30|NC_002678|CRT matches to MH837626 (Escherichia phage vB_vPM_PD112, complete genome) position: , mismatch: 8, identity: 0.733

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
cgtggcggtaatggcggtagcaatagtcct	Protospacer
 *.*****.*********.*******.  .

72. spacer 3.4|3630247|30|NC_002678|CRT matches to KY290975 (Escherichia phage YUEEL01, complete genome) position: , mismatch: 8, identity: 0.733

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
cgtggcggtaatggcggtagcaatagtcct	Protospacer
 *.*****.*********.*******.  .

73. spacer 3.4|3630247|30|NC_002678|CRT matches to KM606997 (Enterobacteria phage RB7, complete genome) position: , mismatch: 8, identity: 0.733

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
cgtggcggtaatggcggtagcaatagtcct	Protospacer
 *.*****.*********.*******.  .

74. spacer 3.4|3630247|30|NC_002678|CRT matches to KU255730 (Escherichia phage phiE142, complete genome) position: , mismatch: 8, identity: 0.733

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
cgtggcggtaatggcggtagcaatagtcct	Protospacer
 *.*****.*********.*******.  .

75. spacer 3.4|3630247|30|NC_002678|CRT matches to MK327937 (Escherichia phage vB_EcoM_G10400, complete genome) position: , mismatch: 8, identity: 0.733

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
cgtggcggtaatggcggtagcaatagtcct	Protospacer
 *.*****.*********.*******.  .

76. spacer 3.4|3630247|30|NC_002678|CRT matches to LR597657 (Escherichia phage T4_ev240 genome assembly, chromosome: 1) position: , mismatch: 8, identity: 0.733

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
cgtggcggtaatggcggtagcaatagtcct	Protospacer
 *.*****.*********.*******.  .

77. spacer 3.4|3630247|30|NC_002678|CRT matches to KM606996 (Enterobacteria phage RB6, complete genome) position: , mismatch: 8, identity: 0.733

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
cgtggcggtaatggcggtagcaatagtcct	Protospacer
 *.*****.*********.*******.  .

78. spacer 3.4|3630247|30|NC_002678|CRT matches to NC_025448 (Enterobacteria phage RB27, complete genome) position: , mismatch: 8, identity: 0.733

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
cgtggcggtaatggcggtagcaatagtcct	Protospacer
 *.*****.*********.*******.  .

79. spacer 3.4|3630247|30|NC_002678|CRT matches to KM606995 (Enterobacteria phage RB5, complete genome) position: , mismatch: 8, identity: 0.733

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
cgtggcggtaatggcggtagcaatagtcct	Protospacer
 *.*****.*********.*******.  .

80. spacer 3.4|3630247|30|NC_002678|CRT matches to AF075710 (Bacteriophage RB27 large tail fiber subunit gp37 and tail fiber adhesin gp38 genes, partial cds) position: , mismatch: 8, identity: 0.733

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
cgtggcggtaatggcggtagcaatagtcct	Protospacer
 *.*****.*********.*******.  .

81. spacer 3.4|3630247|30|NC_002678|CRT matches to MT179807 (Escherichia phage vB_EcoM_IME537, complete genome) position: , mismatch: 8, identity: 0.733

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
cgtggcggtaatggcggtagcaatagtcct	Protospacer
 *.*****.*********.*******.  .

82. spacer 3.4|3630247|30|NC_002678|CRT matches to MK327944 (Escherichia phage vB_EcoM_G2540-3, complete genome) position: , mismatch: 8, identity: 0.733

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
cgtggcggtaatggcggtagcaatagtcct	Protospacer
 *.*****.*********.*******.  .

83. spacer 3.4|3630247|30|NC_002678|CRT matches to KM606994 (Enterobacteria phage RB3, complete genome) position: , mismatch: 8, identity: 0.733

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
cgtggcggtaatggcggtagcaatagtcct	Protospacer
 *.*****.*********.*******.  .

84. spacer 3.4|3630247|30|NC_002678|CRT matches to AF060870 (Bacteriophage Ac3 distal tail fiber small subunit gp36 (gene 36) gene, partial cds; and distal tail fiber large subunit gp37 (gene 37) and tail fiber adhesin gp38 (gene 38) genes, complete cds) position: , mismatch: 8, identity: 0.733

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
cgtggcggtaatggcggtagcaatagtcct	Protospacer
 *.*****.*********.*******.  .

85. spacer 3.4|3630247|30|NC_002678|CRT matches to MH243439 (Escherichia phage vB_EcoM_NBG2, complete genome) position: , mismatch: 8, identity: 0.733

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
cgtggcggtaatggcggtagcaatagtcct	Protospacer
 *.*****.*********.*******.  .

86. spacer 3.4|3630247|30|NC_002678|CRT matches to MG867727 (Escherichia phage vB_EcoM-G28, complete genome) position: , mismatch: 8, identity: 0.733

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
cgtggcggtaatggcggtagcaatagtcct	Protospacer
 *.*****.*********.*******.  .

87. spacer 3.4|3630247|30|NC_002678|CRT matches to LR597660 (Escherichia phage T4_ev151 genome assembly, chromosome: 1) position: , mismatch: 8, identity: 0.733

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
cgtggcggtaatggcggtagcaatagtcct	Protospacer
 *.*****.*********.*******.  .

88. spacer 3.4|3630247|30|NC_002678|CRT matches to MT932213 (Escherichia phage VEc74, complete genome) position: , mismatch: 8, identity: 0.733

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
cgtggcgggaatggcggtagcaatagtcct	Protospacer
 *.***** *********.*******.  .

89. spacer 3.4|3630247|30|NC_002678|CRT matches to KM606999 (Enterobacteria phage RB10, complete genome) position: , mismatch: 8, identity: 0.733

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
cgtggcggtaatggcggtagcaatagtcct	Protospacer
 *.*****.*********.*******.  .

90. spacer 3.4|3630247|30|NC_002678|CRT matches to KM606998 (Enterobacteria phage RB9, complete genome) position: , mismatch: 8, identity: 0.733

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
cgtggcggtaatggcggtagcaatagtcct	Protospacer
 *.*****.*********.*******.  .

91. spacer 3.4|3630247|30|NC_002678|CRT matches to NZ_CP032828 (Sphingomonas sp. YZ-8 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
ggtggccgcaatggcggtggcaaccggaca	Protospacer
**.*** ****************. * .

92. spacer 3.4|3630247|30|NC_002678|CRT matches to KY608967 (UNVERIFIED: Escherichia phage CF2, complete genome) position: , mismatch: 8, identity: 0.733

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
cgtggcggtaatggcggtagcaatagtcct	Protospacer
 *.*****.*********.*******.  .

93. spacer 3.4|3630247|30|NC_002678|CRT matches to MT682709 (Escherichia phage vB_EcoM_SP1, complete genome) position: , mismatch: 8, identity: 0.733

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
cgtggcgggaatggcggtagcaatagtcct	Protospacer
 *.***** *********.*******.  .

94. spacer 3.4|3630247|30|NC_002678|CRT matches to MH834622 (Arthrobacter phage Noely, complete genome) position: , mismatch: 8, identity: 0.733

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
ggcggcggcaatggcggcggcggcgtcctc	Protospacer
*****************.***.... *  *

95. spacer 3.4|3630247|30|NC_002678|CRT matches to LR746311 (Shigella phage vB_SsoM_113 genome assembly, chromosome: 1) position: , mismatch: 8, identity: 0.733

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
cgtggcgggaatggcggtagcaatagtcct	Protospacer
 *.***** *********.*******.  .

96. spacer 3.4|3630247|30|NC_002678|CRT matches to MH051916 (Enterobacteria phage vB_EcoM_IME340, complete genome) position: , mismatch: 8, identity: 0.733

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
cgtggcggtaatggcggtagcaatagtcct	Protospacer
 *.*****.*********.*******.  .

97. spacer 3.4|3630247|30|NC_002678|CRT matches to NZ_CP015232 (Epibacterium mobile F1926 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.7

ggcggcggcaatggcggtggcaatagcggc	CRISPR spacer
ggtggcggcaatggcggtggctgccccaag	Protospacer
**.****************** ..  *..

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

323684 : 332449

Sulfitobacter_phage(33.33%)

capsid

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010909385.1\|323684_326231_-	hypothetical protein	A0A2L0V0Z1	Agrobacterium_phage	5.4e-08	35.4
WP_044547584.1\|326234_327248_-	hypothetical protein	M4NM77	Sulfitobacter_phage	1.4e-76	51.0
WP_044547586.1\|327234_327681_-	GNAT family N-acetyltransferase	X2CY06	Brucella_phage	2.9e-26	49.1
WP_010909388.1\|327677_329264_-	hypothetical protein	A0A088F6U1	Sulfitobacter_phage	4.9e-116	44.8
WP_010909389.1\|329260_329962_-	hypothetical protein	NA	NA	NA	NA
WP_010909390.1\|329968_330796_-	hypothetical protein	NA	NA	NA	NA
WP_010909391.1\|330877_331420_-	hypothetical protein	Q94MS0	Myxococcus_phage	1.6e-18	47.2
WP_010909392.1\|331432_332449_-\|capsid	phage major capsid protein	A0A0H4IR21	Brucella_phage	5.2e-55	37.4

DBSCAN-SWA_2

901410 : 909578

uncultured_Mediterranean_phage(85.71%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010909886.1\|901410_902958_-	peptidoglycan DD-metalloendopeptidase family protein	A0A2K9VGT1	Pontimonas_phage	1.6e-10	37.4
WP_010909887.1\|903135_903789_-	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	9.5e-18	39.5
WP_010909888.1\|903785_904544_-	5'/3'-nucleotidase SurE	NA	NA	NA	NA
WP_010909889.1\|904543_905848_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	1.4e-100	56.6
WP_010909890.1\|905952_906828_-	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	6.7e-51	46.3
WP_044547812.1\|906824_907580_-	twin-arginine translocase subunit TatB	NA	NA	NA	NA
WP_010909892.1\|907611_907833_-	twin-arginine translocase TatA/TatE family subunit	A0A1B1IVR9	uncultured_Mediterranean_phage	5.1e-08	65.9
WP_010909893.1\|908013_908778_-	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	9.4e-41	46.2
WP_044550554.1\|908774_909578_-	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	8.4e-32	33.1

DBSCAN-SWA_3

4753634 : 4907165

101

Paenibacillus_phage(10.53%)

tRNA,transposase,integrase,holin

attL 4766923:4766939|attR 4902433:4902449

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010913590.1\|4753634_4754453_+\|holin	phosphocholine cytidylyltransferase family protein	NA	NA	NA	NA
WP_010913591.1\|4754449_4755049_+\|holin	phosphatidylcholine/phosphatidylserine synthase	NA	NA	NA	NA
WP_010913592.1\|4755079_4755994_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_010913593.1\|4756026_4757919_+	asparagine synthase (glutamine-hydrolyzing)	A0A1V0SCP4	Indivirus	9.8e-23	26.4
WP_157866185.1\|4757957_4759172_-	alkaline phosphatase family protein	NA	NA	NA	NA
WP_044548997.1\|4759431_4761138_+	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_010913596.1\|4761192_4761984_+	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	1.6e-22	29.6
WP_010913597.1\|4762174_4763737_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_010913598.1\|4763742_4764774_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.9e-16	31.6
WP_010913599.1\|4764770_4765730_+	ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_010913600.1\|4765729_4766671_+	ABC transporter permease	NA	NA	NA	NA
WP_010913601.1\|4766667_4767528_+	ABC transporter permease	NA	NA	NA	NA
4766923:4766939	attL	NA	NA	NA	NA
WP_044549000.1\|4767572_4767959_-	ATP-binding domain-containing protein	NA	NA	NA	NA
4766923:4766939	attL	NA	NA	NA	NA
WP_044551219.1\|4769046_4769640_-	hypothetical protein	NA	NA	NA	NA
WP_010913605.1\|4770104_4770404_+	hypothetical protein	NA	NA	NA	NA
WP_010913606.1\|4770400_4770790_+	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_193363996.1\|4770791_4770935_-	hypothetical protein	NA	NA	NA	NA
WP_010913608.1\|4771736_4772630_+	nitrogenase iron protein	NA	NA	NA	NA
WP_010913609.1\|4772735_4774241_+	nitrogenase molybdenum-iron protein alpha chain	NA	NA	NA	NA
WP_010913610.1\|4774372_4775914_+	nitrogenase molybdenum-iron protein subunit beta	NA	NA	NA	NA
WP_010913611.1\|4775973_4777464_+	nitrogenase iron-molybdenum cofactor biosynthesis protein NifE	NA	NA	NA	NA
WP_010913612.1\|4777473_4778856_+	nitrogenase iron-molybdenum cofactor biosynthesis protein NifN	NA	NA	NA	NA
WP_010913613.1\|4778821_4779319_+	nitrogen fixation protein NifX	NA	NA	NA	NA
WP_010913614.1\|4779335_4779815_+	NifX-associated nitrogen fixation protein	NA	NA	NA	NA
WP_027056524.1\|4779839_4780625_+	response regulator transcription factor	NA	NA	NA	NA
WP_010913616.1\|4780723_4781611_+	universal stress protein	NA	NA	NA	NA
WP_010913618.1\|4783452_4784049_-	orotate phosphoribosyltransferase	E3SNS3	Prochlorococcus_phage	1.5e-17	35.4
WP_010913619.1\|4785118_4785862_-	acetoacetate decarboxylase	NA	NA	NA	NA
WP_157866186.1\|4787320_4787914_+	hypothetical protein	NA	NA	NA	NA
WP_044551223.1\|4789386_4790691_+	lysine N(6)-hydroxylase/L-ornithine N(5)-oxygenase family protein	NA	NA	NA	NA
WP_010913624.1\|4791456_4792236_+	phytanoyl-CoA dioxygenase family protein	NA	NA	NA	NA
WP_044551225.1\|4792556_4794557_+\|tRNA	class I tRNA ligase family protein	NA	NA	NA	NA
WP_010913626.1\|4796118_4796322_+	hypothetical protein	NA	NA	NA	NA
WP_010913627.1\|4796318_4796636_+	ferredoxin III, nif-specific	NA	NA	NA	NA
WP_044549016.1\|4796673_4796994_+	exopolysaccharide production repressor protein	NA	NA	NA	NA
WP_010913628.1\|4798303_4799317_+	1-aminocyclopropane-1-carboxylate deaminase	NA	NA	NA	NA
WP_157866060.1\|4802511_4802967_+	hypothetical protein	NA	NA	NA	NA
WP_010913630.1\|4803421_4804159_-	7-cyano-7-deazaguanine synthase QueC	M1PKZ7	Cellulophaga_phage	8.8e-44	42.7
WP_010913631.1\|4804163_4804517_-	6-carboxytetrahydropterin synthase QueD	NA	NA	NA	NA
WP_010913632.1\|4804513_4805149_-	7-carboxy-7-deazaguanine synthase	R4TAH8	Halovirus	2.4e-05	32.4
WP_010913633.1\|4805385_4805847_-	iron-sulfur cluster assembly scaffold protein	A0A218MKD1	uncultured_virus	5.2e-10	43.6
WP_010913634.1\|4805873_4806194_-	iron-sulfur cluster assembly accessory protein	NA	NA	NA	NA
WP_010913635.1\|4807199_4808459_+	diaminobutyrate--2-oxoglutarate transaminase	NA	NA	NA	NA
WP_044549029.1\|4808448_4809291_+	hypothetical protein	NA	NA	NA	NA
WP_044551228.1\|4809406_4809910_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_157866062.1\|4810683_4811450_-\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	2.5e-25	48.6
WP_044549035.1\|4811512_4811803_-	hypothetical protein	NA	NA	NA	NA
WP_010913644.1\|4812606_4813353_-	LuxR family transcriptional regulator	A0A1I9KF49	Aeromonas_phage	5.4e-17	29.3
WP_010913646.1\|4814972_4815971_-\|integrase	tyrosine-type recombinase/integrase	A0A2D2W391	Mycobacterium_phage	3.3e-09	27.3
WP_010913647.1\|4815967_4816906_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_010913648.1\|4816902_4818126_-\|integrase	tyrosine-type recombinase/integrase	A0A2H4JAA2	uncultured_Caudovirales_phage	3.5e-05	27.1
WP_010913650.1\|4819666_4821232_-\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_010913652.1\|4822310_4823537_-	ATP-grasp domain-containing protein	NA	NA	NA	NA
WP_010913653.1\|4824281_4825448_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_044551230.1\|4825767_4826808_+\|transposase	IS110-like element ISMlo2 family transposase	A0A1S7J231	Thermus_phage	7.6e-09	27.9
WP_010913660.1\|4829690_4830860_-	aminopeptidase P family protein	NA	NA	NA	NA
WP_010913662.1\|4832440_4833724_+	KamA family radical SAM protein	NA	NA	NA	NA
4831344:4831360	attR	NA	NA	NA	NA
WP_027052994.1\|4834003_4834294_+\|transposase	IS3 family transposase	NA	NA	NA	NA
4831344:4831360	attR	NA	NA	NA	NA
WP_157866188.1\|4837700_4838873_+\|transposase	IS701 family transposase	NA	NA	NA	NA
WP_010913671.1\|4839300_4840341_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_010913673.1\|4840558_4841587_+\|transposase	IS110-like element ISMlo3 family transposase	NA	NA	NA	NA
WP_157866064.1\|4842269_4842791_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_157866066.1\|4843095_4843281_+	hypothetical protein	NA	NA	NA	NA
WP_010913677.1\|4843916_4845293_+	aminotransferase class III-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_044551235.1\|4845315_4846806_+	M81 family metallopeptidase	NA	NA	NA	NA
WP_048894799.1\|4846823_4847711_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_010913680.1\|4847712_4849035_+	aspartate aminotransferase family protein	A0A1V0SKB7	Klosneuvirus	6.0e-11	21.9
WP_010913681.1\|4849392_4849560_+	hypothetical protein	NA	NA	NA	NA
WP_010913682.1\|4849644_4849905_+\|transposase	transposase	NA	NA	NA	NA
WP_010913688.1\|4851863_4852751_-	TauD/TfdA family dioxygenase	NA	NA	NA	NA
WP_010913692.1\|4854823_4855459_-	ATP-dependent dethiobiotin synthetase BioD	NA	NA	NA	NA
WP_010913695.1\|4857785_4858655_-	CoA ester lyase	NA	NA	NA	NA
WP_010913696.1\|4859110_4861072_-	acetyl/propionyl/methylcrotonyl-CoA carboxylase subunit alpha	NA	NA	NA	NA
WP_010913697.1\|4861074_4862658_-	methylcrotonoyl-CoA carboxylase	A0A1B2ITV7	Pike_perch_iridovirus	1.6e-18	66.7
WP_157866189.1\|4862684_4863491_-	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_010913699.1\|4863472_4865161_-	AMP-binding protein	A0A2H4PQU7	Staphylococcus_phage	2.0e-67	36.0
WP_010913700.1\|4865425_4866886_-	dipeptidase	NA	NA	NA	NA
WP_193363997.1\|4866921_4867203_-	hypothetical protein	NA	NA	NA	NA
WP_044549052.1\|4867226_4867436_-	hypothetical protein	NA	NA	NA	NA
WP_052292097.1\|4868198_4869527_+	aspartate aminotransferase family protein	NA	NA	NA	NA
WP_010913706.1\|4869541_4870672_+	phosphotransferase enzyme family protein	NA	NA	NA	NA
WP_044549054.1\|4870948_4872106_+	aminopeptidase P family protein	NA	NA	NA	NA
WP_044549035.1\|4872404_4872695_+	hypothetical protein	NA	NA	NA	NA
WP_157866068.1\|4872757_4873553_+\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	2.6e-25	48.6
WP_010913709.1\|4873598_4874606_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_010913710.1\|4875015_4876230_-\|transposase	IS701 family transposase	NA	NA	NA	NA
WP_010913717.1\|4880023_4880245_-\|integrase	integrase	NA	NA	NA	NA
WP_010913646.1\|4880342_4881341_-\|integrase	tyrosine-type recombinase/integrase	A0A2D2W391	Mycobacterium_phage	3.3e-09	27.3
WP_010913647.1\|4881337_4882276_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_010913648.1\|4882272_4883496_-\|integrase	tyrosine-type recombinase/integrase	A0A2H4JAA2	uncultured_Caudovirales_phage	3.5e-05	27.1
WP_080511929.1\|4883606_4884428_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_048894801.1\|4887105_4887393_+	hypothetical protein	NA	NA	NA	NA
WP_010913721.1\|4887560_4888040_+	helix-turn-helix domain containing protein	NA	NA	NA	NA
WP_010913722.1\|4888298_4890377_+	recombinase family protein	NA	NA	NA	NA
WP_044549064.1\|4892813_4893518_+	hypothetical protein	NA	NA	NA	NA
WP_193364022.1\|4894583_4894733_+	hypothetical protein	NA	NA	NA	NA
WP_010913730.1\|4898797_4899223_-	M81 family metallopeptidase	NA	NA	NA	NA
WP_080511931.1\|4899351_4899789_-	M81 family metallopeptidase	NA	NA	NA	NA
WP_010913734.1\|4900275_4901505_-	ATP-grasp domain-containing protein	NA	NA	NA	NA
WP_044551230.1\|4901951_4902992_+\|transposase	IS110-like element ISMlo2 family transposase	A0A1S7J231	Thermus_phage	7.6e-09	27.9
WP_010913671.1\|4906124_4907165_+\|transposase	IS110 family transposase	NA	NA	NA	NA

DBSCAN-SWA_4

4975092 : 5049504

uncultured_Mediterranean_phage(33.33%)

transposase,integrase

attL 5042126:5042140|attR 5050823:5050837

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_157866075.1\|4975092_4976239_+\|transposase	IS3-like element ISMlo4 family transposase	U5P429	Shigella_phage	2.2e-65	47.9
WP_010913814.1\|4978427_4979390_+	ArdC family protein	A0A1B1IRD0	uncultured_Mediterranean_phage	1.2e-48	41.6
WP_044551266.1\|4979596_4980016_+	DUF2958 domain-containing protein	NA	NA	NA	NA
WP_044549133.1\|4980094_4981825_+	ParB/RepB/Spo0J family partition protein	A0A1C9EHW0	Gordonia_phage	5.3e-07	50.8
WP_010913817.1\|4982069_4983044_+	hypothetical protein	NA	NA	NA	NA
WP_010913818.1\|4983460_4984642_+	5-demethoxyubiquinol-8 5-hydroxylase UbiM	NA	NA	NA	NA
WP_010913819.1\|4985014_4985620_+	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_044549143.1\|4986869_4987463_+	NodA family N-acyltransferase	NA	NA	NA	NA
WP_010913821.1\|4987590_4988865_+	chitooligosaccharide synthase NodC	NA	NA	NA	NA
WP_010913822.1\|4988914_4989937_+	nodulation factor ABC transporter ATP-binding protein NodI	W6JKT0	Anomala_cuprea_entomopoxvirus	1.1e-25	27.4
WP_010913823.1\|4989940_4990729_+	ABC transporter permease	NA	NA	NA	NA
WP_010913824.1\|4991032_4993054_+	carbamoyltransferase	A0A1B1IVF2	uncultured_Mediterranean_phage	1.2e-50	31.0
WP_010913825.1\|4993171_4993282_+	hypothetical protein	NA	NA	NA	NA
WP_010913827.1\|4993980_4995450_+	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_010913829.1\|4995962_4996622_+	chitooligosaccharide deacetylase NodB	NA	NA	NA	NA
WP_010913831.1\|4997111_4997735_+	FMN-binding negative transcriptional regulator	NA	NA	NA	NA
WP_010913832.1\|4997762_4998413_+	LysE family translocator	NA	NA	NA	NA
WP_162034361.1\|4998676_4999489_+	TIM barrel protein	NA	NA	NA	NA
WP_010913834.1\|4999503_5000448_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_010913835.1\|5001164_5002286_+	acyltransferase family protein	NA	NA	NA	NA
WP_096453860.1\|5002321_5002609_-	hypothetical protein	NA	NA	NA	NA
WP_010913836.1\|5002520_5003426_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_044549158.1\|5004174_5005401_-	MFS transporter	NA	NA	NA	NA
WP_006328923.1\|5007530_5007854_+	DUF736 domain-containing protein	NA	NA	NA	NA
WP_006328932.1\|5008016_5008286_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_010913839.1\|5008282_5008831_+	S26 family signal peptidase	NA	NA	NA	NA
WP_010913840.1\|5008818_5009502_+	lytic transglycosylase domain-containing protein	A0A0H3V0Q1	Geobacillus_virus	6.9e-11	37.9
WP_044549164.1\|5009684_5010773_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_010913842.1\|5011307_5013278_+	relaxase/mobilization nuclease and DUF3363 domain-containing protein	NA	NA	NA	NA
WP_010913843.1\|5013327_5014887_-	E2 ligase fold family C protein	NA	NA	NA	NA
WP_044549167.1\|5014890_5015379_-	Mov34/MPN/PAD-1 family protein	NA	NA	NA	NA
WP_010913845.1\|5015375_5015993_-	hypothetical protein	NA	NA	NA	NA
WP_044549170.1\|5015985_5016270_-	DUF2604 domain-containing protein	NA	NA	NA	NA
WP_010913847.1\|5016993_5017953_+	DUF1403 family protein	NA	NA	NA	NA
WP_010913848.1\|5017955_5018678_+	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	6.2e-18	29.3
WP_010913849.1\|5018755_5019340_+	hypothetical protein	NA	NA	NA	NA
WP_044551271.1\|5020121_5021447_+	DUF4365 domain-containing protein	NA	NA	NA	NA
WP_044549173.1\|5021443_5022898_+	hypothetical protein	NA	NA	NA	NA
WP_157866195.1\|5025175_5026438_-	MATE family efflux transporter	NA	NA	NA	NA
WP_010913856.1\|5027870_5028980_+	histidine decarboxylase	M1HEU9	Acanthocystis_turfacea_Chlorella_virus	8.0e-49	34.5
WP_010913857.1\|5029164_5030562_+	type III glutamate--ammonia ligase	NA	NA	NA	NA
WP_010913858.1\|5030900_5032094_-	alanine racemase	NA	NA	NA	NA
WP_157866076.1\|5032954_5033227_-	hypothetical protein	NA	NA	NA	NA
WP_010913862.1\|5034194_5035535_+	MmgE/PrpD family protein	NA	NA	NA	NA
WP_157866196.1\|5035636_5036770_+	M24 family metallopeptidase	NA	NA	NA	NA
WP_010913867.1\|5038630_5040736_-	recombinase family protein	NA	NA	NA	NA
WP_193363998.1\|5041899_5043384_-\|transposase	IS21 family transposase	NA	NA	NA	NA
5042126:5042140	attL	NA	NA	NA	NA
WP_010913871.1\|5044982_5045759_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_010913873.1\|5046732_5047761_-\|integrase	site-specific integrase	A0A2D2W4Z2	Ralstonia_phage	9.8e-09	23.9
WP_010913874.1\|5047757_5048735_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_157866197.1\|5048727_5049504_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
5050823:5050837	attR	NA	NA	NA	NA

DBSCAN-SWA_5

5088717 : 5186645

Streptococcus_phage(50.0%)

transposase,integrase

attL 5088026:5088040|attR 5102919:5102933

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
5088026:5088040	attL	NA	NA	NA	NA
WP_010913914.1\|5088717_5090325_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_010913915.1\|5090331_5091210_+	TniB family NTP-binding protein	NA	NA	NA	NA
WP_010913916.1\|5091206_5092088_+	TniQ family protein	NA	NA	NA	NA
WP_157866078.1\|5093317_5094751_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_010913921.1\|5094662_5095214_-	hypothetical protein	NA	NA	NA	NA
WP_044551312.1\|5096083_5098708_+	AMP-binding protein	A0A2K9L3I8	Tupanvirus	1.8e-30	23.9
WP_010913924.1\|5098761_5099604_+	L-proline cis-4-hydroxylase	NA	NA	NA	NA
WP_010913925.1\|5099682_5101329_-	MFS transporter	NA	NA	NA	NA
WP_044549195.1\|5101500_5102745_-	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_010913927.1\|5102882_5103899_+	membrane dipeptidase	NA	NA	NA	NA
5102919:5102933	attR	NA	NA	NA	NA
WP_010913928.1\|5103952_5105803_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.4e-21	33.5
WP_010913929.1\|5105840_5107436_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_010913930.1\|5107465_5108410_+	ABC transporter permease	NA	NA	NA	NA
WP_010913931.1\|5108421_5109264_+	ABC transporter permease	NA	NA	NA	NA
WP_010913932.1\|5109371_5110070_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_010913933.1\|5110243_5111152_+	dihydrodipicolinate synthase family protein	NA	NA	NA	NA
WP_010913934.1\|5111255_5112833_+	M81 family metallopeptidase	NA	NA	NA	NA
WP_010913935.1\|5113563_5114787_+	ATP-grasp domain-containing protein	NA	NA	NA	NA
WP_010913936.1\|5114951_5115806_+	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	2.5e-42	39.3
WP_010913937.1\|5115991_5116666_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_044549200.1\|5116737_5117439_+\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	3.5e-42	43.1
WP_010913939.1\|5117464_5117647_-	hypothetical protein	NA	NA	NA	NA
WP_010913940.1\|5117970_5118849_-	DUF3800 domain-containing protein	NA	NA	NA	NA
WP_010913943.1\|5120456_5121077_+	poly-gamma-glutamate hydrolase family protein	O64134	Bacillus_phage	3.1e-18	38.7
WP_044549202.1\|5120983_5121889_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_010913945.1\|5121911_5122748_+	S1/P1 nuclease	NA	NA	NA	NA
WP_010913946.1\|5122820_5124650_+	nuclease	NA	NA	NA	NA
WP_157866200.1\|5125809_5131020_+	hypothetical protein	NA	NA	NA	NA
WP_157866080.1\|5135469_5135856_+	hypothetical protein	NA	NA	NA	NA
WP_010913956.1\|5135925_5136405_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_157866201.1\|5140042_5146678_+	hypothetical protein	NA	NA	NA	NA
WP_010913962.1\|5148328_5149000_+	response regulator transcription factor	NA	NA	NA	NA
WP_044551336.1\|5149044_5150487_+	type II and III secretion system protein family protein	NA	NA	NA	NA
WP_010913964.1\|5150495_5151056_+	CpaD family pilus assembly lipoprotein	NA	NA	NA	NA
WP_010913965.1\|5151846_5153751_-	nodulation protein NOLX	NA	NA	NA	NA
WP_063825847.1\|5153948_5154650_-	hypothetical protein	NA	NA	NA	NA
WP_010913967.1\|5154833_5155337_+	nodulation protein NolB	NA	NA	NA	NA
WP_044549206.1\|5155346_5156210_+	type III secretion inner membrane ring lipoprotein SctJ	NA	NA	NA	NA
WP_010913969.1\|5156211_5156850_+	hypothetical protein	NA	NA	NA	NA
WP_010913970.1\|5156846_5157470_+	type III secretion system stator protein SctL	NA	NA	NA	NA
WP_010913971.1\|5157466_5158825_+	type III secretion system ATPase SctN	NA	NA	NA	NA
WP_010913972.1\|5158800_5159334_+	hypothetical protein	NA	NA	NA	NA
WP_010913973.1\|5159361_5160426_+	type III secretion system cytoplasmic ring protein SctQ	NA	NA	NA	NA
WP_010913974.1\|5160418_5161084_+	type III secretion system export apparatus subunit SctR	NA	NA	NA	NA
WP_044551339.1\|5161086_5161362_+	EscS/YscS/HrcS family type III secretion system export apparatus protein	NA	NA	NA	NA
WP_010913976.1\|5161370_5162189_+	type III secretion system export apparatus subunit SctT	NA	NA	NA	NA
WP_010913977.1\|5162185_5163223_+	EscU/YscU/HrcU family type III secretion system export apparatus switch protein	NA	NA	NA	NA
WP_044551341.1\|5164198_5164519_+	hypothetical protein	NA	NA	NA	NA
WP_010913978.1\|5164911_5165802_+	hypothetical protein	NA	NA	NA	NA
WP_010913979.1\|5166040_5168086_+	type III secretion system export apparatus subunit SctV	NA	NA	NA	NA
WP_010913980.1\|5168146_5168644_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_157866082.1\|5169377_5170094_-\|transposase	IS6 family transposase	A0A1X9I6E7	Streptococcus_phage	7.0e-22	34.1
WP_044551343.1\|5173227_5175279_+	hypothetical protein	NA	NA	NA	NA
WP_157866083.1\|5175629_5176346_-\|transposase	IS6 family transposase	A0A1X9I6E7	Streptococcus_phage	2.4e-22	34.1
WP_010913990.1\|5176730_5185901_+	shikimate kinase	NA	NA	NA	NA
WP_157866082.1\|5185928_5186645_-\|transposase	IS6 family transposase	A0A1X9I6E7	Streptococcus_phage	7.0e-22	34.1

DBSCAN-SWA_6

6959544 : 7006652

Sinorhizobium_phage(29.63%)

terminase,protease,capsid,portal,integrase

attL 6950819:6950834|attR 6993727:6993742

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
6950819:6950834	attL	NA	NA	NA	NA
WP_010915651.1\|6959544_6960819_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	2.9e-135	58.8
WP_027046751.1\|6961093_6963505_+	endopeptidase La	A0A0R6PGP8	Moraxella_phage	9.1e-207	50.4
WP_006201846.1\|6963702_6963975_+	HU family DNA-binding protein	A0A172Q061	Acinetobacter_phage	1.0e-05	35.2
WP_010915653.1\|6964302_6964509_+	hypothetical protein	NA	NA	NA	NA
WP_010915654.1\|6964737_6965760_-	aldo/keto reductase	NA	NA	NA	NA
WP_010915655.1\|6965925_6966492_+	SIS domain-containing protein	NA	NA	NA	NA
WP_010915656.1\|6966495_6967239_+	creatininase family protein	NA	NA	NA	NA
WP_010915657.1\|6967523_6968441_-	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_032933358.1\|6968452_6969574_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_032929955.1\|6969672_6971340_-	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_010915660.1\|6971623_6972679_+	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	G3M9Y6	Bacillus_virus	7.6e-25	32.7
WP_010915661.1\|6972705_6973158_+	RbsD/FucU family protein	NA	NA	NA	NA
WP_010915662.1\|6973162_6974092_+	ribokinase	NA	NA	NA	NA
WP_044550271.1\|6974257_6974728_-	hypothetical protein	A0A2K9L9B3	Tupanvirus	3.2e-07	49.1
WP_010915664.1\|6974829_6975111_+	hypothetical protein	NA	NA	NA	NA
WP_010915665.1\|6975630_6976710_-\|integrase	site-specific integrase	A0A240F4W2	Ochrobactrum_phage	1.7e-56	37.7
WP_010915666.1\|6976903_6977128_-	hypothetical protein	NA	NA	NA	NA
WP_010915667.1\|6977124_6977367_-	hypothetical protein	NA	NA	NA	NA
WP_157866132.1\|6977372_6977603_-	hypothetical protein	NA	NA	NA	NA
WP_157866133.1\|6978085_6978790_-	helix-turn-helix domain-containing protein	A0A141GF24	Brucella_phage	9.0e-14	57.0
WP_044550281.1\|6978864_6979089_+	hypothetical protein	A0A141GF25	Brucella_phage	1.1e-13	52.7
WP_044550284.1\|6979085_6979586_+	hypothetical protein	NA	NA	NA	NA
WP_044550287.1\|6979711_6980197_+	hypothetical protein	A0A291AUJ7	Sinorhizobium_phage	2.5e-23	40.8
WP_141700999.1\|6980286_6980553_+	HNH endonuclease	C4NTC3	Sulfitobacter_phage	6.2e-24	74.3
WP_010915672.1\|6980549_6981731_+	hypothetical protein	A0A068C9F4	Rhizobium_phage	8.9e-115	59.2
WP_157866135.1\|6981733_6982417_-	hypothetical protein	NA	NA	NA	NA
WP_044550295.1\|6982467_6982740_+	hypothetical protein	NA	NA	NA	NA
WP_010915675.1\|6982732_6983029_+	hypothetical protein	NA	NA	NA	NA
WP_010915676.1\|6983025_6983316_+	hypothetical protein	NA	NA	NA	NA
WP_010915677.1\|6983312_6983612_+	hypothetical protein	NA	NA	NA	NA
WP_010915678.1\|6983608_6984169_+	hypothetical protein	A0A291AUJ2	Sinorhizobium_phage	2.9e-23	39.5
WP_044550298.1\|6984165_6986121_+	DNA cytosine methyltransferase	A0A223W0A9	Agrobacterium_phage	1.2e-185	57.6
WP_044551721.1\|6986255_6987248_+	hypothetical protein	A0A291AUK7	Sinorhizobium_phage	6.9e-36	36.1
WP_044551723.1\|6987219_6987903_+	transcriptional antiterminator NusG	NA	NA	NA	NA
WP_048894845.1\|6988015_6988375_+	HNH endonuclease	NA	NA	NA	NA
WP_157866216.1\|6988425_6988932_+	hypothetical protein	NA	NA	NA	NA
WP_010915684.1\|6988936_6990733_+\|terminase	terminase large subunit	Q3HQS7	Burkholderia_phage	9.2e-172	52.6
WP_157866217.1\|6990735_6992040_+\|portal	phage portal protein	Q6JIM9	Burkholderia_virus	8.8e-55	36.2
WP_010915686.1\|6992036_6992882_+\|protease	Clp protease ClpP	A0A141GEW1	Brucella_phage	2.5e-63	48.1
WP_044551730.1\|6993028_6994300_+\|capsid	phage major capsid protein	A0A2D1GNH4	Pseudomonas_phage	2.0e-72	37.8
6993727:6993742	attR	NA	NA	NA	NA
WP_044550303.1\|6994385_6994823_+	hypothetical protein	NA	NA	NA	NA
WP_157866136.1\|6994885_6995170_+	hypothetical protein	NA	NA	NA	NA
WP_010915690.1\|6995181_6995835_+	hypothetical protein	F8TVA2	EBPR_siphovirus	4.1e-29	36.0
WP_157866137.1\|6995944_6996232_+	hypothetical protein	NA	NA	NA	NA
WP_010915692.1\|6996231_6996873_+	hypothetical protein	F8TVA4	EBPR_siphovirus	5.3e-21	32.7
WP_010915693.1\|6996872_6997313_+	hypothetical protein	NA	NA	NA	NA
WP_010915694.1\|6997357_6998299_+	hypothetical protein	K4JUH2	Caulobacter_phage	1.2e-10	26.0
WP_010915695.1\|6998298_6998523_+	hypothetical protein	NA	NA	NA	NA
WP_010915696.1\|6998605_6999040_+	hypothetical protein	F8TVA8	EBPR_siphovirus	4.2e-22	38.2
WP_157866138.1\|6999036_6999339_-	hypothetical protein	NA	NA	NA	NA
WP_010915698.1\|6999405_7002363_+	hypothetical protein	A0A076G7H2	Sinorhizobium_phage	2.4e-60	29.2
WP_010915699.1\|7002366_7003122_+	hypothetical protein	A0A076GD29	Sinorhizobium_phage	1.2e-72	53.4
WP_193364020.1\|7003158_7003758_+	hypothetical protein	A0A076G707	Sinorhizobium_phage	1.9e-68	61.3
WP_157866139.1\|7003751_7003943_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_010915702.1\|7003977_7004385_+	hypothetical protein	A0A076G6J4	Sinorhizobium_phage	6.8e-22	40.7
WP_157866140.1\|7004354_7006652_+	hypothetical protein	A0A076G8H4	Sinorhizobium_phage	4.5e-195	51.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_002679

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NC_002678

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection