CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NC_004703	Bacteroides thetaiotaomicron VPI-5482 plasmid p5482, complete sequence	0 crisprs	NA	0	0	0	0
NC_004663	Bacteroides thetaiotaomicron VPI-5482, complete sequence	1 crisprs	PrimPol,csa3,cas3,DEDDh,WYL,PD-DExK,RT	0	0	2	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_004663_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_004663_1

38726-38798

Orphan

Consensus_repeat	Method
GAAAAAATACAGTTTCGCTCTCA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_004663_1

>merge|NC_004663|1|38726-38798|CRISPRCasFinder
GAAAAAATACAGTTTCGCTCTCATCCTCTCCAAGGTGACAACCGCCGGAGAGAAAAATACAGTTTCGCTCTCA

>NC_004663|1|1|38726-38798|CRISPRCasFinder
GAAAAAATACAGTTTCGCTCTCA	TCCTCTCCAAGGTGACAACCGCCGGAG
AGAAAAATACAGTTTCGCTCTCA

Protein	Signature genes	Signature genes Name	Protein_function
NC_004663.1\|WP_009039967.1\|35265_35703_+\|hypothetical-protein	unknown	unknown	unknown
NC_004663.1\|WP_113760756.1\|34122_35142_+\|transcriptional-regulator	unknown	unknown	unknown
NC_004663.1\|WP_011107070.1\|29679_29970_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224951
NC_004663.1\|WP_055235382.1\|40583_41537_+\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|366154
NC_004663.1\|WP_011107077.1\|44646_45582_+\|SP_1767-family-glycosyltransferase	unknown	unknown	gnl\|CDD\|163440
NC_004663.1\|WP_011107072.1\|40405_40582_+\|glycosyltransferase	unknown	unknown	gnl\|CDD\|133027
NC_004663.1\|WP_009039966.1\|35988_36417_+\|hypothetical-protein	unknown	unknown	unknown
NC_004663.1\|WP_009039963.1\|39214_40375_+\|polysaccharide-pyruvyl-transferase-family-protein	unknown	unknown	gnl\|CDD\|377253
NC_004663.1\|WP_011107074.1\|42723_43656_+\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|366154
NC_004663.1\|WP_011107068.1\|26181_28011_+\|RagB/SusD-family-nutrient-uptake-outer-membrane-protein	unknown	unknown	gnl\|CDD\|369630
NC_004663.1\|WP_011107075.1\|43670_44066_+\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|366154
NC_004663.1\|WP_009039957.1\|45593_46565_+\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|366154
NC_004663.1\|WP_009039960.1\|41533_42700_+\|acyltransferase	unknown	unknown	gnl\|CDD\|376607
NC_004663.1\|WP_009039969.1\|32314_33526_+\|site-specific-integrase	unknown	unknown	gnl\|CDD\|271185
NC_004663.1\|WP_009039956.1\|46564_47545_+\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|366154
NC_004663.1\|WP_011107076.1\|44161_44638_+\|hypothetical-protein	unknown	unknown	unknown
NC_004663.1\|WP_009039976.1\|22551_22830_+\|alkaline-phosphatase	unknown	unknown	gnl\|CDD\|293736
NC_004663.1\|WP_162303141.1\|28037_29195_+\|histidinol-phosphatase	unknown	unknown	gnl\|CDD\|213996
NC_004663.1\|WP_009039975.1\|22905_26169_+\|TonB-dependent-receptor	unknown	unknown	gnl\|CDD\|274948
NC_004663.1\|WP_009039965.1\|36477_38019_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|240533

Protein	Function_ID	Function_description	E-value
NC_004663.1\|WP_055235382.1\|40583_41537_+\|glycosyltransferase-family-2-protein	gnl\|CDD\|366154	pfam00535, Glycos_transf_2, Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.	1.18498e-37
NC_004663.1\|WP_011107077.1\|44646_45582_+\|SP_1767-family-glycosyltransferase	gnl\|CDD\|163440	TIGR03728, glyco_access_1, glycosyltransferase, SP_1767 family. Members of this protein family are putative glycosyltransferases. Some members are found close to genes for the accessory secretory (SecA2) system, and are suggested by Partial Phylogenetic Profiling to correlate with SecA2 systems. Glycosylation, therefore, may occur in the cytosol prior to secretion.	2.29258e-147
NC_004663.1\|WP_011107072.1\|40405_40582_+\|glycosyltransferase	gnl\|CDD\|133027	cd04184, GT2_RfbC_Mx_like, Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.	5.10462e-07
NC_004663.1\|WP_011107068.1\|26181_28011_+\|RagB/SusD-family-nutrient-uptake-outer-membrane-protein	gnl\|CDD\|369630	pfam07980, SusD_RagB, SusD family. This domain is found in bacterial cell surface proteins such SusD and SusD-like proteins, as as well RagB, outer membrane surface receptor antigen. Bacteroidetes, one of the two dominant bacterial phyla in the human gut, are Gram-negative saccharolytic microorganisms that utilize a diverse array of glycans. Hence, they express starch-utilization system (Sus) for glycan uptake. SusD has 551 amino acids, and is almost entirely alpha-helical, with 22 alpha-helices, eight of which form 4 tetra-trico peptide repeats (TPRs: helix-turn-helix motifs involved in protein-protein interactions). The four TPRs pack together to create a right-handed super-helix. This is predicted to mediate the formation of SusD and SusC porin complex at the cell surface. The interaction between SusC and TPR1/TPR2 region of SusD is predicted to be of functional importance since it allows SusD to be in position for oligosaccharide capture from other Sus lipoproteins and delivery of these glycans to the SusC porin. The non-TPR containing portion of SusD is where starch binding occurs. The binding site is a shallow surface cavity located on top of TPR1. SusD homologs such as SusD-like proteins have a critical role in carbohydrate acquisition. Both SusD and its homologs, contain about 15-20 residues at the N-terminus that might be a flexible linker region, anchoring the protein to the membrane and the glycan-binding domain. Other homologs to SusD have been examined in Porphyromonas gingivalis such as RagB, an immunodominant outer-membrane surface receptor antigen. Structural characterization of RagB shows substantial similarity with Bacteroides thetaiotaomicron SusD (i.e alpha-helices and TPR regions). Based on this structural similarity, functional studies suggest that, RagB binding of glycans occurs at pockets on the molecular surface that are distinct from those of SusD.	1.08856e-32
NC_004663.1\|WP_009039963.1\|39214_40375_+\|polysaccharide-pyruvyl-transferase-family-protein	gnl\|CDD\|377253	pfam04230, PS_pyruv_trans, Polysaccharide pyruvyl transferase. Pyruvyl-transferases involved in peptidoglycan-associated polymer biosynthesis. CsaB in Bacillus anthracis is necessary for the non-covalent anchoring of proteins containing an SLH (S-layer homology) domain to peptidoglycan-associated pyruvylated polysaccharides. WcaK and AmsJ are involved in the biosynthesis of colanic acid in Escherichia coli and of amylovoran in Erwinia amylovora.	3.60857e-31
NC_004663.1\|WP_011107074.1\|42723_43656_+\|glycosyltransferase-family-2-protein	gnl\|CDD\|366154	pfam00535, Glycos_transf_2, Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.	3.90169e-38
NC_004663.1\|WP_011107075.1\|43670_44066_+\|glycosyltransferase-family-2-protein	gnl\|CDD\|366154	pfam00535, Glycos_transf_2, Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.	5.85153e-19
NC_004663.1\|WP_009039957.1\|45593_46565_+\|glycosyltransferase-family-2-protein	gnl\|CDD\|366154	pfam00535, Glycos_transf_2, Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.	5.74382e-37
NC_004663.1\|WP_009039976.1\|22551_22830_+\|alkaline-phosphatase	gnl\|CDD\|293736	cd16012, ALP, Alkaline Phosphatase. Alkaline phosphatases are non-specific membrane-bound phosphomonoesterases that catalyze the hydrolysis reaction via a phosphoseryl intermediate to produce inorganic phosphate and the corresponding alcohol, optimally at high pH. Alkaline phosphatase exists as a dimer, each monomer binding 2 zinc atoms and one magnesium atom, which are essential for enzymatic activity. Mammalian alkaline phosphatase is divided into four isozymes depending upon the site of tissue expression. They are Intestinal ALP, Placental ALP, Germ cell ALP and tissue nonspecific alkaline phosphatase or liver/bone/kidney (L/B/K) ALP.	1.09477e-25
NC_004663.1\|WP_009039969.1\|32314_33526_+\|site-specific-integrase	gnl\|CDD\|271185	cd01185, INTN1_C_like, Integrase IntN1 of Bacteroides mobilizable transposon NBU1 and similar proteins, C-terminal catalytic domain. IntN1 is a tyrosine recombinase for the integration and excision of Bacteroides mobilizable transposon NBU1 from the host chromosome. IntN1 does not require strict homology between the recombining sites seen with other tyrosine recombinases. This family belongs to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	6.04185e-31
NC_004663.1\|WP_009039956.1\|46564_47545_+\|glycosyltransferase-family-2-protein	gnl\|CDD\|366154	pfam00535, Glycos_transf_2, Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.	1.15635e-34
NC_004663.1\|WP_162303141.1\|28037_29195_+\|histidinol-phosphatase	gnl\|CDD\|213996	cd12112, PHP_HisPPase_Chlorobi_like, Polymerase and Histidinol Phosphatase domain of Chlorobi like. The PHP (also called histidinol phosphatase-2/HIS2) domain is associated with several types of DNA polymerases, such as PolIIIA and family X DNA polymerases, stand alone histidinol phosphate phosphatases (HisPPases), and a number of uncharacterized protein families. Chlorobi PHP is uncharacterized protein. HisPPase catalyzes the eighth step of histidine biosynthesis, in which L-histidinol phosphate undergoes dephosphorylation to produce histidinol. The HisPPase can be classified into two types: the bifunctional Hisppase found in proteobacteria that belongs to the DDDD superfamily and the monofunctional Bacillus subtilis type that is a member of the PHP family. The PHP domain has four conserved sequence motifs and contains an invariant histidine that is involved in metal ion coordination. The PHP domain of HisPPase is structurally homologous to other members of the PHP family that have a distorted (beta/alpha)7 barrel fold with a trinuclear metal site on the C-terminal side of the barrel.	3.98467e-117
NC_004663.1\|WP_009039960.1\|41533_42700_+\|acyltransferase	gnl\|CDD\|376607	pfam01757, Acyl_transf_3, Acyltransferase family. This family includes a range of acyltransferase enzymes. This domain is found in many as yet uncharacterized C. elegans proteins and it is approximately 300 amino acids long.	1.72809e-06
NC_004663.1\|WP_011107070.1\|29679_29970_+\|hypothetical-protein	gnl\|CDD\|224951	COG2040, MHT1, Homocysteine/selenocysteine methylase (S-methylmethionine-dependent) [Amino acid transport and metabolism].	0.00749721
NC_004663.1\|WP_009039975.1\|22905_26169_+\|TonB-dependent-receptor	gnl\|CDD\|274948	TIGR04056, OMP_RagA_SusC, TonB-linked outer membrane protein, SusC/RagA family. This model describes a distinctive clade among the TonB-linked outer membrane proteins (OMP). Members of this family are restricted to the Bacteriodetes lineage (except for Gemmatimonas aurantiaca T-27 from the novel phylum Gemmatimonadetes) and occur in high copy numbers, with over 100 members from Bacteroides thetaiotaomicron VPI-5482 alone. Published descriptions of members of this family are available for RagA from Porphyromonas gingivalis, SusC from Bacteroides thetaiotaomicron, and OmpW from Bacteroides caccae. Members form pairs with members of the SusD/RagB family (pfam07980). Transporter complexes including these outer membrane proteins are likely to import large degradation products of proteins (e.g. RagA) or carbohydrates (e.g. SusC) as nutrients, rather than siderophores. [Transport and binding proteins, Unknown substrate].	0
NC_004663.1\|WP_009039965.1\|36477_38019_+\|hypothetical-protein	gnl\|CDD\|240533	cd13128, MATE_Wzx_like, Wzx, a subfamily of the multidrug and toxic compound extrusion (MATE)-like proteins. Escherichia coli Wzx and related proteins from other gram-negative bacteria are thought to act as flippases, assisting in the membrane translocation of lipopolysaccharides including those containing O-antigens. Proteins from the MATE family are involved in exporting metabolites across the cell membrane and are often responsible for multidrug resistance (MDR).	6.47502e-15

>NC_004663.1|WP_009039965.1|36477_38019_+|hypothetical-protein
MTTQSENTRRIAKNTLMLYVRMLFSMLVSLYTSRVVLNALGVEDYGIYNVVGGFVAMFSLVSSSLSSAVSRFLTFELGRKNVERLKLMFFTSLSIHIILALAVVLAAETVGLWFLNTQMTIPADRLHAANWVFQASVCSFALGLCSTPFNASIVSHEHMGTFAKAGIMDVMLRLLVVLFIACPSWHFDRLIIYSLLLVLVSISLQCFYLYYCGRHFEECRWRFSFDRPCWKEMSSFAVWNFIGCTAGLLKGQGVNVLLNIFVGPVLNAARGIADQVNAAICSFSGNFMIALNPQITKSYASDNREYTMSLVERGSRFSFYIMFILALPVLLETDFILNLWLKQYPDHTVNFVRLVLLLSLSDILSNTLITLQNANGNIRNYQIAVGGMLMMNFPLSYCCLKAGFPPESTLVVALFVSVCCLILRLLFLRRMVRLSVRRYIRNVCLNTFTVAVTASCLPILLSRQMEDGWIRFIVVCVASVCCVGVSSYFIGCGSSERAFIVQTLHGVKTKLLK
>NC_004663.1|WP_009039966.1|35988_36417_+|hypothetical-protein
MRIAIDFDGTIVEHRYPRIGKEIPFAIATLKQLQTERHLLVLWTVREGKLLDEAVDFCRKRGLEFYAVNANHPEEEVRNDMTSPCRKVVADLYIDDLNVGKLPDWGAIYEMIHNRWSYERYLNEIHGFEKQKKISIWKRIFR
>NC_004663.1|WP_009039967.1|35265_35703_+|hypothetical-protein
MKNDSFLDKVIGSLLSQNFQVDSNAYTYGLVKGKNDSFSGKVIDGIDVAKSILAIAQIFGSPIDSDCADFKTIFNGEGFKKDLKALYSMTDAVLYKFILGQPLIVGVVKADSLTHNEIYDITDKFDKAILGFRKYTARMKWTKCR
>NC_004663.1|WP_113760756.1|34122_35142_+|transcriptional-regulator
MGGKAENGPETISDPEVKKYTGNKEITSWCYLFIHHAKVETVSKKLQTEQYRIFVHKSIVYKRGNKRIKKEEQATISGLVFIQGDANRIQKFLKENFFNLYLVKDCSTGEIAAIPDSVMQPFMRVSEVIPTRIRFMPHSFDYYSVGNPLVRITSGILSGLEGYRIRISRDKCLVTSIGGMTVAIGGIYKESFENLDEYVRLRRKQLEKIRQSSYVTFTPLQKEIDGCFFTPQNQLDIMGMAENLTPWVTRMKSDMVKKNFDEAVEIAFFLLEETGSYFRSIYYDSHIGDMKDMMIICEKADQILVSVINCMDISVDLKEIVETGRESLAIRYPFLPIEL
>NC_004663.1|WP_009039969.1|32314_33526_+|site-specific-integrase
MATVKIKFRPSSVDGKEGTVYYQVIHVRVARQISTSYRLFPAEWDKRRARIVAAPSDEGRRQHLSLLEGKIMEDTDRLEGIITTLERRRGAFTADDVVSAFNGGHYSLSFPVFMREVINGLKRLGKIRTSETYTSTLNSFIRFMEGRDVLPDDMDSDLMVAYEAWLESGGVSMNTISFYMRNLRAVYNRAVEKGLTVQRFPFKHVYTGVEKTTKRAVPLHVIKRLKSLDLSFEPAKAYARDMLLFSFYTRGMSMVDMAFLKKKDLNNGILSYRRKKTGQQLLIKWEPCMQEIVDRYNIPGSPYLLSVIDRPGTDERKQYINASHRINRHLKVLGKELGMSVPLTHYVARHSWASAARSKNIPISVISEGMGHDSETTTRIYLASLDTATIDRANKLILKSLQI
>NC_004663.1|WP_011107070.1|29679_29970_+|hypothetical-protein
MIISDKFSLEAMCATTITDVKAGDEIILYGQKLTDENSCVTIKTDRVDIISSGNFIKYPNSTDIYDFDNKIDEWSFIIVEGVVNGNTIELNDKSTF
>NC_004663.1|WP_162303141.1|28037_29195_+|histidinol-phosphatase
MKQLIIITFIFLVGQVKASGQTYYTEATNSDMLHQANRTGASTRVEFILPDSIEGYIPLKADLHLHTYFSDGHLSPSARVREAWLDGLDAISVTDHIEYHPADTDMIGYLGATLPDGIEAHNVNKKTNVKPKQDLNKSVELTKKAAVSYGLLIIPGIEITREPKGIGHYNALFTTDNNGIYDPDPLTAIRNAKAQGALVMHNHPGWRRESIQHPDFELKAYGEGLIDGIEANNGTAFCPGTIDRAKEDNLFVASTTDLHDTSFEEYIGRGLRRDMTIILAKDRSLDAMRDALENRRTIGYGAGGTLMGQEYLLRQLFMSCVSISPVNGHNIQLKNPTSLRFIIHPDGKNPIVLPEFSSIILSDKDRGFSVDNAWTGADSFLRISL
>NC_004663.1|WP_011107068.1|26181_28011_+|RagB/SusD-family-nutrient-uptake-outer-membrane-protein
MKIIKYLVFTVAVTLMCGCNDDLDLLPKDRMSSEEYFRTASDLELFTNPLYNNILPKVQYKDQSDIYVCQSLSNELMGGSYRTVPASGGGWSWTDLRRINTLLGNIDKCEDSDAAEKYSAVARFFRAYFYADKIERFGDVPWYDTELSDTDPELYKPRDSRELVMQKMLEDLDFAIEHLPSRNNEAEAPYKVTKGAALAFKSRVCLFEGTYRKYHNLRIEGHDADYYLAQSADAAGKLIDSGEYSLYSTGSPSTDYNILFAEDDANPNEYILAISYRYAIFNNSHGSNAHMLLSNQGRPGYTRKMVCMYLNSDGTRFTDRPGWETMGFNEETVNRDPRLAQSIRTPGYTRIGKKEILAPDLGVAITGYQPIKFVQDPTAAGGNTDRASYSVNDLPVIRYAEVLLNYAEAKAELGTLTQSDLDRSVNLLRGRVGMLGIDMGMSNAIPDPYLCDPKTGFPNVNGANKGVILEIRRERTVELVQEGFRWSDLMRWKAGYAINDSDDKSFSPFMGMYIAGAGEYDLSGDGKVDVIFYNQGTPKPNAGVGVQVYALGKDILLSNNDHGYIYYHRSVPRVNFNEQRDYLYPIPIHERSLNNSLTQNPGWDDGLGF
>NC_004663.1|WP_009039975.1|22905_26169_+|TonB-dependent-receptor
MSALTRKLILLLVVCITAIGAAAQTRTLSGEVVEKSGDPLVGVSVFNREYKIGTTTDIDGKFEITLPSGVKKLTFSYIGFQPLEIDLKPDENKITVTMTEDAQALDEVVVVGYGTQKKVNLTGAVSVITDKELSDRPSQSLTSMLQGTTPGLNITTGSGLPNKSPSINVRGTTSVNATNPLVLVDGVESDLSQVNPSDVKSISVIKDASAAAIYGARAAFGVILVTTKAGESDDATGKRARTTVRYSGRFGWEANTNSTDYEDRGYWAVYTANLFARAKDGKNIIDYTDKDMAELLARVNDRTEHPDRPWIVEDVRNGKKQWVYYGNYDHYHMNFSDNRPKMQHNISLSGGIGDVNYFVSGAYEYRKGILKVNPDTYNKYNLRSKIEFPVTKWARFSNNTSLYSTSYKSQGNGSIEDTFGYSANGAFACYPNKNPDGTWIYSVPYQSTKMANGRHIMIGEGSHRNLERNMSFINTSRFIVTPIKQLSITGDFSYKFDQDRNYWRSNHLNFRMYPDSEMDFYGIGAGQNKLTEQVYTSNYISVNAYANYNQSWNDKHNLAATFGFNYEHWHKKNLSAVGYELSSDDLDDLNLATTMFSMGGGQNEYKLAGWFGRVNYDYDGRYFAEISGRYDGTSRFASNNRWGCFPSGSVGWRISEEKFMEWARPSLSNLKFRVSYGSLGNQNVSSFYTFLRMITLSDFDTFNFGSDTKAKYSSIGAPIAQNLTWETARQWNIGADLAMFNNRLNFTGDIYVRNTVNMLTDGIELPGVYGATPPQMNTADLRTKGYELSATWHDNLKIFGHNLSYSVSANLSNYDARITRYDNPEKVFAKSYYPGMKLGEIWGYHVDGLFASDEEAAQYSSQVDLGVVAKNLPQGTWRAGDLKFADLDGDGKISVGEDSALNPGDMKIIGNELPTLQYGFSGSLNYMGFDIYAFFQGTGNHYWYPNGYNYQFWGSFSDPVAGYIPRNFIDQCWSKDNPGAYFPRPLGQSAKNGQLSFVNDRYLQNIRYMRFKNLTIGYSIPGKILSKVSIQQLRVYFTAENLCYWSPIKKHSKYIDPEAAFSRSSNQLNAMYYPWAKTYMFGIDITL
>NC_004663.1|WP_009039976.1|22551_22830_+|alkaline-phosphatase
MLKRIIIALTIACFALAETKATPKYIFLFIGDSMGLGHIMATEEYLRTNEFELLLMFGFPNVGIMATFSASSPITDSAAAGTALACGHKANR
>NC_004663.1|WP_009039963.1|39214_40375_+|polysaccharide-pyruvyl-transferase-family-protein
MKIGILTQPLSNNYGGILQALALQTVLRSMGHETVILSREYDYPPFRLCLMRILSVLKCIVRKYILRDNRAIIANPFLHFYATDKTQVYDDNEIQAFIRKNLKCSVRLQSTWILKIYVRLHHFDAFLVGSDQVWRESFSPCITNFFLDFLSQKCRAKRIAYGASFGVEQNPISVASLNQCVELAKRFDAISVREQSGVKIMKETFHLSACQVLDPTLLLPVDFYRSFMQKSDMDSSGLVSYLLDGNEEKRNIIAVAREQLQLSQTELLLFPSRYKDEVPRFSSVSSWLSAFANADFVVTDSFHGCVFSIIFRKPFVVISNSGRGNERFFSLLDTFGLNDRLVFSYEEFVDKEEILLIEQDYTEVERKYENLKVKSLEFLFQALNEN
>NC_004663.1|WP_011107072.1|40405_40582_+|glycosyltransferase
MLFPFVLPAYKATYLKEVILSILWQTYTNLELVIVNDASPKYLDSIVNEFDNDRILKE
>NC_004663.1|WP_055235382.1|40583_41537_+|glycosyltransferase-family-2-protein
MNLMPQITIIVPVYNAERTLERCVRSIQAQTVVNWELLLIDDGSEDYSSKLCDEYAIQDSRIRVFHQVNGGASSARNVGLEYTKGEWVVFCDSDDWVDSNWLELFKNQIDNGTELIVQGFIPHGNLWQSRTGINFHGNVKTGILKLQEENILGFMCTKMYKREIIEQCGLRFDTELVLREDELFMLQYAEYISTIQCMEEGAYHYDMPDFSTKYGNIDLFNMFLKIYVVLKRIFSGEDNLLLQNYENDLTQSLFHSFVMRHDDRCKKLENYRKEVGKRVLGVKSLSQFSKYILAYVPSFQVAYLLLEAKAKIVKSMQ
>NC_004663.1|WP_009039960.1|41533_42700_+|acyltransferase
MNQRWPDYNSIAHKDFQFLCMDYVRFVLALLVVLFHAFALSSISAFSDIEYPLIGLVSRVLDAFLAHTIVPVYSFISGYLFFLVKEWNKKVYFDKIKKRIHTLLIPYLLWNGIGIILVAIKQLSCFDTFISVSGTCIDFSFQNILSCFYMYNGKLSVPSAITDYAQLVQTQYYPINTALWYVRDLMVVVVCTPVLYFLLKKIKAYLIIVLGILYLLFGFYHIDWHLYQLASVFLFFSYGALIGLQRMNLVDVFKKFFKISIILYPLCSLCYLFVQGYYSNVAVLIRTVNMFAFIAFAFNVTSWMLHCVPQWLTFKNIGASGVFIYMAHCLVLSRMLKILFFIITPDTGMGMANCYICAALFTIILLIGTYFLLRKYMVSVLNILIGRV
>NC_004663.1|WP_011107074.1|42723_43656_+|glycosyltransferase-family-2-protein
MRKISIVIPVYNTEKYLKLSVDSVLSQSYQDWELILVDDGSKDGSGAICDKYASEDSRIKVYHTVNQGVTAARGYGVEQSTGEWICFLDADDTLADDALQVMLGKSADCDIVIGNKRIVSGNDVTEEWMNQDDRQLQAVEFLDGLIRNKISQYITGRIFRRILFDNGTICIPRELIMAEDFIMNVQLGNKAKKIAVIRDMVYGYHVYGESVSHTFRTNLEYESRFCDCLFSALKTGGYYEEVKEAFTFQKVRALKSAFMAQQGRVNLRHPFLQEVRKEAKSIGLSRGWKLFLYLLPLKYIGYIFFRSLNK
>NC_004663.1|WP_011107075.1|43670_44066_+|glycosyltransferase-family-2-protein
MPFVSVVLPAYKATCLKEAVHSILSQTYRDFELIIVNDASPENVKEVVAKFQDERLAYYENEYNVGGKDLVKQWNDYCLPKTSGEWVVMASDDDMYAPTYLEEMVKLTEKYSQYDLFHCRVNKINIFFWGG
>NC_004663.1|WP_011107076.1|44161_44638_+|hypothetical-protein
MFRRKAMISTGGFVAFPLAFFTDDATWSKLSGNGVACSMQPLFMFRFSGINISSNKETSDRMLLKLKACFLYADWMKTYLKRIECKNEQEKAFMQNILMGLKYKQLEWINWTTCRTNFKDFMKVYRNKEYRNICGTARWFVLLLRNINERFFVRKDYY
>NC_004663.1|WP_011107077.1|44646_45582_+|SP_1767-family-glycosyltransferase
MTSVLNSFWLGIKVPLRKAVYWLQYNLLKRKRNAFNILMAEETIDYIVKHECSVCRYGDGEIDMITCLKEGFDESRKSDFQTYDEKLAWRLKQILGNGSDEELNLIVCIPYVWKSHRSLSFTARRFIERSFVNNREMIFASIHPTRLYGDSYFTRFYIDARNKKKKGSYIQHCRQIWQGRDLCIIEGEQSRLGVGNDLFDNAQSIERILCPALDAFAKYDEIMKAACTVNKAKLVLIALGHTATVLAYDLAEVGYQAIDIGHIDIEYEWFLMRAPKKVPVPHKYVNEVPEGRQFSEERNKEYLSQIIYSVK
>NC_004663.1|WP_009039957.1|45593_46565_+|glycosyltransferase-family-2-protein
MLQGKVSVIVPAYNAARLLERCVRSITGQTYPALEVIVVDDGSKDDTGKIADQLAAEDSRIRVVHKTNGGVSAARNDALKLVEGEWITFVDSDDYLEPDFLRSLLDGEVADLVIGGYHTVGANEIPSANYPTDTAHSPEAIKRALEARLTDMTFLCPWGKLFRTSLVRSLRLIFNTEMKVGEDVVFVWSYLAHCSSLAFKQGQGYDYYTEPGADFKYALDETVSLQTIERILGVLDGLKRNFGMDTEHARCHVLNYYIWLFKLYVNRNYLLRDLARMKNFFYYPLILDYYKTYRRTSKDKLLVYLLLKLRLSGVLYLMIKLYY
>NC_004663.1|WP_009039956.1|46564_47545_+|glycosyltransferase-family-2-protein
MVVSIITPLYKVEDFIARCADSLFRQSYTEIEYIFVDDCSSDRSVEVLLQVAERYPQLQQQIRILHHESNRGVAAARETGLAAATGEYVYWVDADDWIEPDAIEKMVVRSEQGQKDIIACGWYLCFRQNERRMPMPCYADAETALRGMLSGTMRWNLWLYMIKRDLYLMNDIHFMEGENVGEDMLVLIKLFSHAKSIGFVKDAFYHYVKQNENSLTRLSPEQQMKRQMRNLQAATDYLVTHFIGKYEKEINFFKLNAKMPLLISNDKNSYRTWTACFPEANKYIMANKRQTLRMRLVQLMAAKRQFWLVELYYQLVFKFVYGILYK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

2343851 : 2419854

Burkholderia_virus(22.22%)

integrase,transposase,tail

attL 2337004:2337019|attR 2424492:2424507

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2337004:2337019	attL	NA	NA	NA	NA
WP_008762762.1\|2343851_2344463_-\|tail	tail fiber domain-containing protein	A0A1J0MHQ1	Klebsiella_phage	1.1e-10	39.8
WP_008762761.1\|2344524_2344737_-	hypothetical protein	NA	NA	NA	NA
WP_008764104.1\|2344912_2345278_-	DUF3244 domain-containing protein	NA	NA	NA	NA
WP_011108027.1\|2345566_2347219_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_008763908.1\|2347595_2347979_+\|transposase	transposase	NA	NA	NA	NA
WP_105100201.1\|2347933_2348872_+\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	1.8e-17	35.0
WP_011108029.1\|2349871_2351860_-	glycoside hydrolase family 97 protein	NA	NA	NA	NA
WP_011108030.1\|2351892_2354172_-	beta-glucosidase BglX	NA	NA	NA	NA
WP_011108031.1\|2354365_2355349_-	family 43 glycosylhydrolase	NA	NA	NA	NA
WP_011108032.1\|2355407_2357366_-	RagB/SusD family nutrient uptake outer membrane protein	NA	NA	NA	NA
WP_011108033.1\|2357377_2360737_-	TonB-dependent receptor	NA	NA	NA	NA
WP_008765463.1\|2361008_2362022_-	DUF4974 domain-containing protein	NA	NA	NA	NA
WP_008765464.1\|2362092_2362683_-	RNA polymerase sigma-70 factor	NA	NA	NA	NA
WP_072067209.1\|2362809_2365002_-	GH92 family glycosyl hydrolase	NA	NA	NA	NA
WP_008765466.1\|2365260_2367039_+	signal peptide peptidase SppA	A0A2I7QTH6	Vibrio_phage	5.4e-07	27.5
WP_008765467.1\|2367049_2368192_+	tetraacyldisaccharide 4'-kinase	NA	NA	NA	NA
WP_008761225.1\|2368130_2368940_+	purine-nucleoside phosphorylase	Q5YBA4	Grouper_iridovirus	3.8e-56	41.3
WP_008761224.1\|2368955_2369990_+	thiamine-phosphate kinase	NA	NA	NA	NA
WP_011108035.1\|2370305_2371532_-	glycoside hydrolase family 76 protein	NA	NA	NA	NA
WP_008765470.1\|2371808_2372267_-	cold shock domain-containing protein	NA	NA	NA	NA
WP_011108036.1\|2372321_2373446_-	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	1.5e-47	31.5
WP_016269667.1\|2373540_2374614_-	nitronate monooxygenase	NA	NA	NA	NA
WP_008761179.1\|2374977_2375280_-	RNA-binding protein	NA	NA	NA	NA
WP_008765472.1\|2375599_2376376_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_008765473.1\|2376376_2376961_-	hypothetical protein	NA	NA	NA	NA
WP_011108037.1\|2377102_2379163_+	UvrD-helicase domain-containing protein	NA	NA	NA	NA
WP_008765457.1\|2379301_2379664_+	hypothetical protein	NA	NA	NA	NA
WP_105100199.1\|2379660_2380590_+\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	4.1e-22	31.2
WP_011108038.1\|2380886_2382080_-\|transposase	ISAs1-like element ISBthe4 family transposase	NA	NA	NA	NA
WP_008761175.1\|2382839_2384495_+	hypothetical protein	NA	NA	NA	NA
WP_016269651.1\|2384657_2385062_+	hypothetical protein	NA	NA	NA	NA
WP_048694876.1\|2385074_2386361_+	leucine-rich repeat protein	NA	NA	NA	NA
WP_008761174.1\|2386606_2387158_+	LemA family protein	NA	NA	NA	NA
WP_008761173.1\|2387173_2388106_+	DUF3137 domain-containing protein	NA	NA	NA	NA
WP_008761172.1\|2388188_2388896_-	TIGR02757 family protein	NA	NA	NA	NA
WP_011108042.1\|2388908_2390231_-	MATE family efflux transporter	NA	NA	NA	NA
WP_011108043.1\|2390669_2391980_+	lysine-sensitive aspartokinase III	NA	NA	NA	NA
WP_011108044.1\|2392013_2392814_+	NAD(P)-binding domain-containing protein	A0A1X9I6T5	Streptococcus_phage	1.9e-23	29.3
WP_055220199.1\|2393067_2393292_-	winged helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_011108046.1\|2393604_2394462_+	AraC family transcriptional regulator	NA	NA	NA	NA
WP_011108047.1\|2394583_2394949_-	VOC family protein	NA	NA	NA	NA
WP_105100227.1\|2395043_2395847_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_011108049.1\|2396057_2397275_+	RNA polymerase sigma factor RpoS	NA	NA	NA	NA
WP_011108050.1\|2397326_2398196_-	hypothetical protein	NA	NA	NA	NA
WP_011108052.1\|2398725_2399664_+	DUF1848 domain-containing protein	NA	NA	NA	NA
WP_008766263.1\|2400047_2400827_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_008766265.1\|2401759_2402929_+	nicotinate phosphoribosyltransferase	A0A2L0UZQ6	Agrobacterium_phage	2.7e-31	29.3
WP_008761158.1\|2403141_2403465_-	thioredoxin family protein	NA	NA	NA	NA
WP_008761157.1\|2403997_2405509_+	acetyl-CoA carboxylase biotin carboxylase subunit	NA	NA	NA	NA
WP_008766266.1\|2405529_2406039_+	acetyl-CoA carboxylase biotin carboxyl carrier protein subunit	NA	NA	NA	NA
WP_008766267.1\|2406059_2407595_+	acyl-CoA carboxylase subunit beta	NA	NA	NA	NA
WP_008766268.1\|2407758_2409261_+	arylsulfatase	A0A1V0SA98	Catovirus	1.1e-13	23.9
WP_008766269.1\|2409424_2410459_-	YeiH family putative sulfate export transporter	NA	NA	NA	NA
WP_008761151.1\|2412201_2413482_+	O-acetylhomoserine aminocarboxypropyltransferase/cysteine synthase	NA	NA	NA	NA
WP_008766271.1\|2413695_2414463_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_008766273.1\|2415367_2416234_-	hypothetical protein	NA	NA	NA	NA
WP_008766274.1\|2416260_2419083_-	hypothetical protein	NA	NA	NA	NA
WP_081342048.1\|2419479_2419854_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
2424492:2424507	attR	NA	NA	NA	NA

DBSCAN-SWA_2

3037822 : 3112698

unidentified_phage(50.0%)

integrase,transposase

attL 3108152:3108166|attR 3114739:3114753

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105100199.1\|3037822_3038752_-\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	4.1e-22	31.2
WP_008765457.1\|3038748_3039111_-	hypothetical protein	NA	NA	NA	NA
WP_011108293.1\|3039511_3040036_-	hypothetical protein	NA	NA	NA	NA
WP_011108294.1\|3040197_3041406_+	hexokinase	NA	NA	NA	NA
WP_070750407.1\|3041559_3043089_+	hypothetical protein	NA	NA	NA	NA
WP_011108296.1\|3043151_3046085_-	discoidin domain-containing protein	NA	NA	NA	NA
WP_008763641.1\|3046174_3047515_-	sigma-54-dependent Fis family transcriptional regulator	NA	NA	NA	NA
WP_011108297.1\|3047642_3050123_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_008765135.1\|3050153_3050522_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_062695986.1\|3050619_3051924_-	aminopeptidase	NA	NA	NA	NA
WP_008763637.1\|3052057_3052690_+	DUF4136 domain-containing protein	NA	NA	NA	NA
WP_008763636.1\|3052705_3053332_+	porin family protein	NA	NA	NA	NA
WP_011108299.1\|3053403_3056409_-	serine hydrolase	NA	NA	NA	NA
WP_008763634.1\|3056405_3057293_-	metallophosphoesterase	NA	NA	NA	NA
WP_008763633.1\|3057328_3058132_-	5'-nucleotidase C-terminal domain-containing protein	NA	NA	NA	NA
WP_008763632.1\|3058606_3059701_-	OmpA family protein	NA	NA	NA	NA
WP_008765140.1\|3063081_3063501_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_005681479.1\|3063565_3064795_+\|integrase	site-specific integrase	H7BUI8	unidentified_phage	1.1e-22	32.1
WP_005681480.1\|3064814_3066026_+\|integrase	site-specific integrase	H7BUI8	unidentified_phage	4.8e-15	26.8
WP_005681481.1\|3066110_3066404_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_032839158.1\|3066415_3066619_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_005681483.1\|3068094_3068934_+	hypothetical protein	NA	NA	NA	NA
WP_005681485.1\|3068966_3070247_+	C10 family peptidase	NA	NA	NA	NA
WP_005681487.1\|3070252_3070648_+	hypothetical protein	NA	NA	NA	NA
WP_011108304.1\|3070656_3070863_+	hypothetical protein	NA	NA	NA	NA
WP_008765141.1\|3071355_3072045_-	reverse transcriptase	NA	NA	NA	NA
WP_005681490.1\|3072047_3072536_-	reverse transcriptase	NA	NA	NA	NA
WP_005681491.1\|3073420_3074590_-	metallophosphoesterase	NA	NA	NA	NA
WP_005681492.1\|3074681_3076550_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_105100200.1\|3076577_3078545_-	family 20 glycosylhydrolase	A0A2H4UUW7	Bodo_saltans_virus	1.4e-11	32.0
WP_005681494.1\|3078617_3080336_-	RagB/SusD family nutrient uptake outer membrane protein	NA	NA	NA	NA
WP_008765142.1\|3080347_3083752_-	TonB-dependent receptor	NA	NA	NA	NA
WP_005681496.1\|3083912_3084881_-	FecR domain-containing protein	NA	NA	NA	NA
WP_005681497.1\|3084950_3085520_-	RNA polymerase sigma-70 factor	NA	NA	NA	NA
WP_005681499.1\|3086872_3087787_+	amidoligase family protein	NA	NA	NA	NA
WP_172461641.1\|3087818_3088082_-	hypothetical protein	NA	NA	NA	NA
WP_005681500.1\|3088069_3088333_-	hypothetical protein	NA	NA	NA	NA
WP_005681501.1\|3088512_3088923_+	DUF3408 domain-containing protein	NA	NA	NA	NA
WP_005681504.1\|3089191_3089389_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_005681506.1\|3089404_3089698_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_005681507.1\|3089856_3090150_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_005680417.1\|3091318_3091492_-	histone H1	NA	NA	NA	NA
WP_005680416.1\|3092095_3094216_-	fimbrillin family protein	NA	NA	NA	NA
WP_005680415.1\|3094267_3096328_-	cytochrome c biogenesis protein CcsA	NA	NA	NA	NA
WP_005680414.1\|3096314_3097469_-	hypothetical protein	NA	NA	NA	NA
WP_005680413.1\|3097481_3098216_-	hypothetical protein	NA	NA	NA	NA
WP_007748002.1\|3098235_3099447_-	porin	NA	NA	NA	NA
WP_005680411.1\|3099492_3100926_-	thiol oxidoreductase	NA	NA	NA	NA
WP_005680409.1\|3101054_3102173_-	peptidase M75	NA	NA	NA	NA
WP_011108309.1\|3102213_3103584_-	hypothetical protein	NA	NA	NA	NA
WP_008765144.1\|3103698_3104073_-	hypothetical protein	NA	NA	NA	NA
WP_005680405.1\|3104115_3104505_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_157459905.1\|3105342_3105435_-	Abi family protein	NA	NA	NA	NA
WP_113748138.1\|3105424_3105586_-	Abi family protein	NA	NA	NA	NA
WP_008765146.1\|3107146_3108241_-	OmpA family protein	NA	NA	NA	NA
3108152:3108166	attL	NA	NA	NA	NA
WP_008765147.1\|3108331_3111382_-	hypothetical protein	NA	NA	NA	NA
WP_008765148.1\|3111750_3112698_-\|integrase	site-specific integrase	NA	NA	NA	NA
3114739:3114753	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage