CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number
NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	1 crisprs	DEDDh,cas14j,cas14k,RT,csa3	0	1	4
NC_007104	Bacillus cereus E33L plasmid pE33L5, complete sequence	0 crisprs	NA	0	0	0
NC_007107	Bacillus cereus E33L plasmid pE33L9, complete sequence	0 crisprs	NA	0	0	0
NC_006274	Bacillus cereus E33L, complete sequence	6 crisprs	cas3,c2c9_V-U4,csa3,WYL,cas14k,DinG,cas14j,DEDDh	16	9	6
NC_007105	Bacillus cereus E33L plasmid pE33L54, complete sequence	0 crisprs	NA	0	0	0
NC_007106	Bacillus cereus E33L plasmid pE33L8, complete sequence	0 crisprs	NA	0	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_007103_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_007103_1

80842-80926

TypeV

Consensus_repeat	Method
CCATCGGTTCCCAAATAATAATCGT	CRISPRCasFinder

1 spacers

cas14j

The CRISPR arrays of NC_007103_1

>merge|NC_007103|1|80842-80926|CRISPRCasFinder
CCATCGGTTCCCAAATAATAATCGTATCCATTTGTATGTACCCATCCAGTTTGCATAAAACCATCGGTTCCCAAATAATAACGTT

>NC_007103|1|1|80842-80926|CRISPRCasFinder
CCATCGGTTCCCAAATAATAATCGT	ATCCATTTGTATGTACCCATCCAGTTTGCATAAAA
CCATCGGTTCCCAAATAATAACGTT

Protein	Signature genes	Signature genes Name	Protein_function
NC_007103.1\|WP_001178743.1\|75192_76638_-\|DDE-type-integrase/transposase/recombinase	unknown	unknown	gnl\|CDD\|366234
NC_007103.1\|WP_000589779.1\|83214_83529_+\|hypothetical-protein	unknown	unknown	unknown
NC_007103.1\|WP_000479646.1\|85103_86135_+\|serine-hydrolase	unknown	unknown	gnl\|CDD\|365903
NC_007103.1\|WP_001208356.1\|68068_68707_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NC_007103.1\|WP_000790788.1\|86568_86949_+\|DUF4878-domain-containing-protein	unknown	unknown	gnl\|CDD\|372352
NC_007103.1\|WP_000726230.1\|83747_83975_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227945
NC_007103.1\|WP_001032577.1\|74387_75200_-\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|225398
NC_007103.1\|WP_000724493.1\|77567_78158_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|366102
NC_007103.1\|WP_000904909.1\|76657_77212_-\|recombinase-family-protein	unknown	unknown	gnl\|CDD\|239737
NC_007103.1\|WP_000661236.1\|93271_94663_+\|PLP-dependent-aminotransferase-family-protein	unknown	unknown	gnl\|CDD\|224089
NC_007103.1\|WP_001214170.1\|70224_73176_+\|Tn3-family-transposase	unknown	unknown	gnl\|CDD\|376561
NC_007103.1\|WP_041184995.1\|66738_68052_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340863
NC_007103.1\|WP_000018396.1\|86987_87440_-\|SMI1/KNR4-family-protein	unknown	unknown	gnl\|CDD\|379650
NC_007103.1\|WP_000845444.1\|78216_79431_+\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|235729
NC_007103.1\|WP_000229719.1\|88729_90121_-\|chitosanase	unknown	unknown	gnl\|CDD\|366548
NC_007103.1\|WP_000586195.1\|94906_96028_+\|IS200/IS605-family-element-transposase-accessory-protein-TnpB	cas14j	-	gnl\|CDD\|223747
NC_007103.1\|WP_000151803.1\|92256_93162_-\|DMT-family-transporter	unknown	unknown	gnl\|CDD\|273359
NC_007103.1\|WP_158319935.1\|69189_69477_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|183546
NC_007103.1\|WP_000576159.1\|69647_70193_+\|recombinase-family-protein	unknown	unknown	gnl\|CDD\|239737
NC_007103.1\|WP_000928761.1\|96263_97250_-\|DUF4046-domain-containing-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NC_007103.1\|WP_001178743.1\|75192_76638_-\|DDE-type-integrase/transposase/recombinase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	4.0454e-22
NC_007103.1\|WP_000479646.1\|85103_86135_+\|serine-hydrolase	gnl\|CDD\|365903	pfam00144, Beta-lactamase, Beta-lactamase. This family appears to be distantly related to pfam00905 and PF00768 D-alanyl-D-alanine carboxypeptidase.	1.53562e-37
NC_007103.1\|WP_001208356.1\|68068_68707_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	2.61846e-19
NC_007103.1\|WP_041184995.1\|66738_68052_-\|MFS-transporter	gnl\|CDD\|340863	cd06173, MFS_MefA_like, Macrolide efflux protein A and similar proteins of the Major Facilitator Superfamily of transporters. This family is composed of Streptococcus pyogenes macrolide efflux protein A (MefA) and similar transporters, many of which remain uncharacterized. Some members may be multidrug resistance (MDR) transporters, which are drug/H+ antiporters (DHAs) that mediate the efflux of a variety of drugs and toxic compounds, conferring resistance to these compounds. MefA confers resistance to 14-membered macrolides including erythromycin and to 15-membered macrolides. It functions as an efflux pump to regulate intracellular macrolide levels. The MefA-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	7.07801e-54
NC_007103.1\|WP_001032577.1\|74387_75200_-\|AAA-family-ATPase	gnl\|CDD\|225398	COG2842, COG2842, Uncharacterized ATPase, putative transposase [General function prediction only].	4.62088e-42
NC_007103.1\|WP_000724493.1\|77567_78158_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|366102	pfam00440, TetR_N, Bacterial regulatory proteins, tetR family.	2.39384e-17
NC_007103.1\|WP_000904909.1\|76657_77212_-\|recombinase-family-protein	gnl\|CDD\|239737	cd03768, SR_ResInv, Serine Recombinase (SR) family, Resolvase and Invertase subfamily, catalytic domain; members contain a C-terminal DNA binding domain. Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and the enzyme. They are functionally versatile and include resolvases, invertases, integrases, and transposases. Resolvases and invertases affect resolution or inversion and comprise a major phylogenic group. Resolvases (e.g. Tn3, gamma-delta, and Tn5044) normally recombine two sites in direct repeat causing deletion of the DNA between the sites. Invertases (e.g. Gin and Hin) recombine sites in inverted repeat to invert the DNA between the sites. Cointegrate resolution with gamma-delta resolvase requires the formation of a synaptosome of three resolvase dimers bound to each of two res sites on the DNA. Also included in this subfamily are some putative integrases including a sequence from bacteriophage phi-FC1.	1.90462e-58
NC_007103.1\|WP_000661236.1\|93271_94663_+\|PLP-dependent-aminotransferase-family-protein	gnl\|CDD\|224089	COG1167, ARO8, Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism].	3.2174e-138
NC_007103.1\|WP_001214170.1\|70224_73176_+\|Tn3-family-transposase	gnl\|CDD\|376561	pfam01526, DDE_Tnp_Tn3, Tn3 transposase DDE domain. This family includes transposases of Tn3, Tn21, Tn1721, Tn2501, Tn3926 transposons from E-coli. The specific binding of the Tn3 transposase to DNA has been demonstrated. Sequence analysis has suggested that the invariant triad of Asp689, Asp765, Glu895 (numbering as in Tn3) may correspond to the D-D-35-E motif previously implicated in the catalysis of numerous transposases.	0
NC_007103.1\|WP_000576159.1\|69647_70193_+\|recombinase-family-protein	gnl\|CDD\|239737	cd03768, SR_ResInv, Serine Recombinase (SR) family, Resolvase and Invertase subfamily, catalytic domain; members contain a C-terminal DNA binding domain. Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and the enzyme. They are functionally versatile and include resolvases, invertases, integrases, and transposases. Resolvases and invertases affect resolution or inversion and comprise a major phylogenic group. Resolvases (e.g. Tn3, gamma-delta, and Tn5044) normally recombine two sites in direct repeat causing deletion of the DNA between the sites. Invertases (e.g. Gin and Hin) recombine sites in inverted repeat to invert the DNA between the sites. Cointegrate resolution with gamma-delta resolvase requires the formation of a synaptosome of three resolvase dimers bound to each of two res sites on the DNA. Also included in this subfamily are some putative integrases including a sequence from bacteriophage phi-FC1.	5.47024e-57
NC_007103.1\|WP_000018396.1\|86987_87440_-\|SMI1/KNR4-family-protein	gnl\|CDD\|379650	pfam14568, SUKH_6, SMI1-KNR4 cell-wall. Members of this family are related to the SMI1/KNR4-like or SUKH superfamily of proteins.	8.35258e-23
NC_007103.1\|WP_000845444.1\|78216_79431_+\|FAD-dependent-oxidoreductase	gnl\|CDD\|235729	PRK06185, PRK06185, FAD-dependent oxidoreductase.	2.23367e-161
NC_007103.1\|WP_000229719.1\|88729_90121_-\|chitosanase	gnl\|CDD\|366548	pfam01270, Glyco_hydro_8, Glycosyl hydrolases family 8.	2.28506e-16
NC_007103.1\|WP_000586195.1\|94906_96028_+\|IS200/IS605-family-element-transposase-accessory-protein-TnpB	gnl\|CDD\|223747	COG0675, COG0675, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	1.553e-57
NC_007103.1\|WP_000151803.1\|92256_93162_-\|DMT-family-transporter	gnl\|CDD\|273359	TIGR00950, Uncharacterized_inner_membrane_transporter_YicL, Carboxylate/Amino Acid/Amine Transporter. [Transport and binding proteins, Amino acids, peptides and amines].	9.99584e-12
NC_007103.1\|WP_158319935.1\|69189_69477_+\|hypothetical-protein	gnl\|CDD\|183546	PRK12473, PRK12473, hypothetical protein; Provisional.	3.13185e-16
NC_007103.1\|WP_000726230.1\|83747_83975_+\|hypothetical-protein	gnl\|CDD\|227945	COG5658, COG5658, Predicted integral membrane protein [Function unknown].	0.00546697
NC_007103.1\|WP_000790788.1\|86568_86949_+\|DUF4878-domain-containing-protein	gnl\|CDD\|372352	pfam12870, DUF4878, Domain of unknown function (DUF4878). This is a family of putative lipoproteins from bacteria. The family is probably related to the NTF2-like transpeptidase family.	9.53906e-13

>NC_007103.1|WP_000845444.1|78216_79431_+|FAD-dependent-oxidoreductase
MKTDVVIVGAGPGGCFLSYLLARSGVKTVLLERHERLDREFRGYFFQPLVLKFFEQTGLLNDVLQIKHEKVDAFHFIDHGKTLFSVRFDELPKPYDYGLIMSQPLLLQFLIDQALQYDNFSYFSGTIAKEFIKEENKIAGIKAKQKKQEIIIESRLVVGADGRYSTIRKLAGIPLDKESHQFDFVWFDMPALEGKRYLPHIQIEDEGMLIYIPKGSGVVQVGWVIRKGTYPDLRKKGIEYFQKQLIAVDPELEQQLSVYLHDFKQCSVLDIQVATSNQWVQDGLMLIGDAAHIASPFSGQGNSLAIQDAVVAHDVIMKALPQVQSSLAMHLLKQYEDIRRPAVSQIQKIQRIQAELIGVKNPLLLHLRRAVIPMISKTFLLKKMRNKIAIGIQPLDIATFHFKN
>NC_007103.1|WP_000724493.1|77567_78158_+|TetR/AcrR-family-transcriptional-regulator
MKKITNRQLQALETKNNLIDAALVVFSKKGYAASTTKDIAKEAGVTDGLIYHYFKSKEDLLWAIIDKHTLNHELNKMIADVGSDEPLEVILFRIIDSLFDLLHAKAELIVMFFGEAQRNSAVQEHLSQLIQQGIDIFYRLLSKRIDKGTLYLEIAIRNLLSSLVMYFLTNDRFVNDVDQRKKYIKVTVEQFLKIFT
>NC_007103.1|WP_000904909.1|76657_77212_-|recombinase-family-protein
MLIGYARVSTGLQNLDLQTDALTQYGCKKIFHDKMSGTKKQRPGLEEAIHYAREGDTIVVWRLDRLGRNMQDLIQIVNNLNKRGIGFHSLQENLTMDKSNATGQLMFHLFAAFAEFERNLIEERSAAGRAAARARGRLGGRPEKFGLKDIEMMKSLIESGTPIKDVAEKWGVSRTTIYRYLERQ
>NC_007103.1|WP_001178743.1|75192_76638_-|DDE-type-integrase/transposase/recombinase
MQNEHPPLTAYSEEQRREAMVKYKIIAPYLTDEKTLTVIIEETGIAKRTLQYWIQDYKQFGLKGLIRKTRSDAGKTHLEPEVVVSIEQLILKYKRNSLTSIHRMICEQCQKKGWEKPSYYQVHKVSQSLSPSLKKLAHDGQKAYNNQYDLIHRREASYPNEIWQADHTPLDIIVLNEKGKPERPWLSIILDDYSRAVAGYFLTFENPSAIHTSLVLHQAIWKKSNPDWQICGIPEIFYTDHGSDFTSNHLEQVAVDLKINLVFSTIGVPRGRGKIERFFLTINQLFLQDLPGYLGNQTSTSLLTIKELDEKLSNFIISNYHHRVHSTTKKEPIQAWNNSGFLPNVPESLESLDLLLLNVAKPRKVHSDGIHFQGLRYIDTNLAAYIGETVIIRYDPRDIAEIRVFYQDKYLCTAISPEISNYTVDLKEIVSARNKIRRSLKKQLDSGKAIVEEIALSKKKDLEDKTNEPTKKSKLKRYFNE
>NC_007103.1|WP_001032577.1|74387_75200_-|AAA-family-ATPase
MNKGQKFIETKEYKRFAEFCDACIKYKYIGICYGLPGVGKTLSSRYYANWNSIEKQIAYKTANEIGQDADEKILEARTIFYTAPAVRATKMTDEIHTIGIRMNMVRTMYKVLTKGEEEKYSTDAYEDIDLIIVDEIDRLKVQNLEQLRDIYDRNNIAMILIGMPGIEKRLARYPQLYSRIGFAHEFDKLSKDETHHILEYKWGELGLSIKLEDFSDYEAITSIIKITGGNFRLIQRLFTQIERILEINKLESITTEVVEAARDSLVIGIK
>NC_007103.1|WP_001214170.1|70224_73176_+|Tn3-family-transposase
MRGKELLTPVQREELLHISVETEHELALHYTFSTEDLEIINQHRRDHNRLGFAVQLCILRYPGCTVTNMPTIPEGLLKFVAKQISVDHTVYEAYAKREPTRREHLEEIRKEYGYRNFTIRDYRRISKFLQPYALENGNTMYLIQTALQELRKEKIILPAIPTIERAVWEVRKRTEEKIFKVLTSSLTSSQQEKLDRLLHPMPNTSKTYLSWLREIPGQFSPDAFLKVIERLDYIRRLTLKLDTKGLHPNRIRQLSRIGARYEPFSFRRFHSTKKYAIMIAYLIDLTQDLVDQAFEIHDKQIMNLQLKGRKQQEEIQKQNGKSVNEKINHYANLGTALIKARQENLDPFLLLETVMPWDTFVASVEEAKKLSRPMNYDYLDLLESRYNYLRKYTPTLLRTLEFQSTKYANPVLLALDTIHELNEAGKRKVPEGAPLSFVSKRWERYVYDEDGSINRHFYELAAFTELRNYVRSGDISIVGSRQHKDFDEYLIPQQEWTKSKNIGTRLAVPIQVEEYIKERTETLLHRIQSFSKNVNSLEGVDLEKGILRIHRLERDVPEDAKKLSAKLYNMLPRIKLTDLLLEVSNWTNFEQQLIHASTNKAPKGDEIIISLAAMMAMGTNIGLTKMADATPGISYHQLAHASQWRMYDDAFQRAQSILVNFQHKIPLSSYWGDGTTSSSDGMRVQIGVSSLSASFNPHYGTGKGATIYRFVSDQFSSFYTKVINTNARDAVHVIDGLLHHESDLVIEEHYTDTAGYTDQVFGLAHLLGFRFAPRLRDLATSKLYTIGSPKEFSNIESLIRGQINMKLICDNYDDVLRLAHSIREGKVSSALIMGKLGSYTRQNKVAKALREIGRIEKTIFILDYLSDKTMRRRIQRGLNKGEAMNALARAIFFGKHGELRERALQDQLQRSSALNLLINAISVWNTVYLSEAINVLKRKEKFDEELLKHISPLGWEHINFLGEYRFSKKEIAPLDSLRPLQIT
>NC_007103.1|WP_000576159.1|69647_70193_+|recombinase-family-protein
MIFGYARVSTEEQNLDMQIDALQQYGVERLYQEKMTGIKKERPQLEELLKVLRKGDKIVVYKLDRISRSTKHLIELSEKFKELGVDFISIHDNIDTSNAMGKFFFRMMASIAELERDIISERTKTGLNAARARGKKGGRPQKHTDKVEMALKMYQSKEYSIKQITEATGLSKTTLYRYINK
>NC_007103.1|WP_158319935.1|69189_69477_+|hypothetical-protein
MFNYENEQQINRVIDLNKSGIKEKDTYKTNLVTLEGKNLFLIDKKSGGELAKKRFIKKVETDATKVIDKLTTVTANQGILELAFEHISVSFIRAQ
>NC_007103.1|WP_001208356.1|68068_68707_-|TetR/AcrR-family-transcriptional-regulator
MREKKTAEERKDEILDAADEFFGQKGFDGTSTNDILEKVGIARGTLYHHFRSKEDIMDALIERYTVRILGAAKGIAADKSITVNERIIRVVMALNISDGNGKEIIEHIHRPQNALMHQKIQKVIINGVPQILTEIIREGIEQGLFHTPYPYECMEMVVAYTNTVFDGDMVNLTNEELASRIQAFVFNVERLLGVESGSLMYMMKMFDNGNGG
>NC_007103.1|WP_041184995.1|66738_68052_-|MFS-transporter
MNNSGGSFGKFLLLWSGQFISAIGNGLTSFGLSIYVFEQTGRASLMALVTLLAFMPSLLLSPVAGVLADRYDRRLLMVLGDSLSMLGLIFILICMLGGEAQIWQICVGVTISSIFSSMLDPAYKATVTDLLTEEEYTKASGFVQVAGSAKYLISPIIAGFLLTVVDIKLLLVIDICTFFVTVASTLAVRKGLISKKNAQENSFTRELKEGWDAVSKKRGVLVLVMMSSVLTFFLGFIETLSVPMILAFADSAVVGTVETTVATGMLVSSVLIGFIPIKKGFIKVLFISLFCEGIFMAVFGLRENIVLLCISGFLFFAMMPFANTTLDFLVRTNIDNSVQGRAWSVIGLISQLGFIAAYTLSGVLADYVFTPLLVDGGLLADSMGEIIGTGSGRGMGLLIIIAGILLCVTSVFLYNLKSVKKLENRDGVVTCVLQNNP
>NC_007103.1|WP_000589779.1|83214_83529_+|hypothetical-protein
MIKHILSFILGTFVMILGSFWAIPYTLEAIDSNVSYITHDKKYFSKLYEYDINLWMIAMLIFCIFTVISILILKLPDYKKNKSTPIKNYSQTNRRKKAKRRRHK
>NC_007103.1|WP_000726230.1|83747_83975_+|hypothetical-protein
MKKKFIVLLCLLIFSLLIAYYFYQKNQNEEFVRWGDSIHTVDTEILKENDIEYKIENDKVYIPKSSLTKATFCCS
>NC_007103.1|WP_000479646.1|85103_86135_+|serine-hydrolase
MFLNYHSNKDFSPILNHVLNTFNQVICSGASTIVIHNDSIVLEEYIGKQSDKLNARIVQPDTQFHVASVRKSYIGFAVAYAVFYGYIKCIDDFVLTYLPELEESSWKGTTIRHLLTHTHGLNQKEEITYREYPVGENWTYKQVGIKTLTDIVKRTTNKTISDILHEQVFLPLGFFESNWYANKNEKLVDVILRYEGDKDWKTSDSTEGDKMNMYVSARELAMWGYLHLKEGNINGQQIVPKEIIHMVTSIQSPTSIGEDLPQNGFLWFVKDLSAKKTEIGVEVPRGSFQILGYTGVTLLVIPQENLVAVRMFNSFGSPEGYDYLSDVRSFGDTVMGCLEKVNS
>NC_007103.1|WP_000790788.1|86568_86949_+|DUF4878-domain-containing-protein
MKNKFMRMIMLMLVMIVSISALAACGNNRNPEEVATAYFEDAKEGNVKDFGELFTPEAKKIFAFVGGNADLMKSVSKDLKSYKIRKVEEKNEIATVTVDAVYKGNPKKVIVIELEKTDDGWKISKS
>NC_007103.1|WP_000018396.1|86987_87440_-|SMI1/KNR4-family-protein
MSHITWINANENKITNNQIKELEQYFNIKFPNDFIECVQKYDGGYPTPDTFNIPNQDENSLNNLLTLDSNKKYSILETYNNTKDRLPDKIYPFARDPFGNLLCFDYRNTSDSPSIVFWDHEEEDIEEAIYPVCSTFTELLASLRDFEEED
>NC_007103.1|WP_000229719.1|88729_90121_-|chitosanase
MVEKRTIFTVICACGIGFSSYTNCISAAALDNDTLINNGHKINSSIITNSSQVSAVAKEMKPFPQQVNYSGILKPNHVSQESLNNAVKNYYNDWKKKYLKNDLSSLPGGYYVKGEITGNPDGFRPLGTSEGQGYGMIITVLMAGHDSNAQTIYDGLFKTARAFKSSINPNLMGWVVADDKKAQGHFDSATDGDLDIAYSLLLAHKQWGSSGKINYLKEAQNMITKGIKTSNVTKNNSLNLGDWGDKSTFDTRPSDWMMSHLRAFYEFTGDKTWLNVIDNLYNTYTNFTNKYSPKTGLISDFVVKNPPQPAPKDFLGESKYTDSYYYNASRVPLRIVMDYAMYGEKRGKVISDKVATWIKGKTKGNPSKIVDGYKLDGTNIGDYPTAVYVSPFIAAGTTNSNNQEWVNSGWDWMKNKKESYFSDSYNLLTMLFLTGNWWKPIPDEKKIQSSINLEVQSELKEQD
>NC_007103.1|WP_000151803.1|92256_93162_-|DMT-family-transporter
MTIFMYIFCLIVWGLNFIAVKIQGTPVSLELSLTYRLVMTAFLFLMLVCFLRPSGIPTKKDIPFVIVFGICNFALSYLCLYYATILSSAAIVTLVFSLKVILTPVALRIFLKEKLHSRVLVGGILGVLGVCILIYPKLNDFQGFNDLKGIMIALLGTVLTAIGDASSARNASHKVNPIYANAIGFTVGSLLMGVIVLFQGQEFTFPTSFSYVFMLLYLTLFASFVAWLFYLKLVEKIGGARSGYMVALFPVIGGIASVLIGESDPSLYLFVGCFSSCIGAAIALGFKTQKQDSKLTLKKVN
>NC_007103.1|WP_000661236.1|93271_94663_+|PLP-dependent-aminotransferase-family-protein
MKELIFNINRTSKNPMYHQVYQYIRAQILSGKLEKGTKLPSIRQLANQLEVSRNTTQVAYEQLQSEGYIRSENKKGFFVEAITSDETLHFEPIREQHHETNHPTMKTIDFKIGTVDQENFPLKKWRMITNKIIKDSSMFSYGEKQGDIKLRKALADYLFQSRGVTTSAEQIIIGSSTQHLLLLLSLMLKQDYHYLAVEDPGYNVARELFVLQSFSIDPIPVKKRGIQVDFLLKSPSRLLYVTPTHHFPYGVTIPVNERLKLIEWAKKVEGYIIEDDYDSEFRYIHQPIPSLQSLDSTDRVVYLGTFSKALLPSIRVSYMVLPRRLINKYKNILPLLEQTSSSIHQRTLATFMNEGYWYSHLRKMKALYKRKMNLLNKELSKYFKEYVKIKGGSSGIFVIIEVKTKMSEQMLIQRAHDHGIIVYPCSKYFSKYLPEYPHIQLGFGNLCEEEIIKGVSQLAKIWF
>NC_007103.1|WP_000586195.1|94906_96028_+|IS200/IS605-family-element-transposase-accessory-protein-TnpB
MIINKAYKFRIYPNQAQAILINKTIGCSRFVFNQFLSLWDHAYKETGKGLTYGTCSAKLPAMKKEFVWLKEVDSIAIQSSVRNLADAYTRFFKKQNSAPRFKSKKNNAQSYTTKQTNENIAVVGNKIKLPKLGLVRFAKSREVEGRIVNATVRRNPSGRYFVSLLVETEVQELPKTHSYIGIDVGLKDFAILSDGKPYENPKFFRSLEDKLAKAQRILSRRMKGSSGWNKQRVKVARIHEYISNARKDYLDKISTEIIKNHDVIGIEDLQVSNMLKNHKLAKAISEVSWSQFRTMLEYKAKWYGKQVIVVSKTFPSSQLCSCCGYQNKDVKNLNLREWDCPSCRTHHDRDINASINLKNEAIRLLTARTAGLA
>NC_007103.1|WP_000928761.1|96263_97250_-|DUF4046-domain-containing-protein
MLMKEVSIEDIYQEILDGKRNRFPPNTWKEDIDNKMARRVLTYLLNSILKWNKEDIRKKWNTKLLVKYRLRGLLKHRYENSPFKAINDLYPNQFKEWEFGMTPLNFWTKEKALTILKWIIEEKEGLSQEKLLELYGKKWLEKNKLGAPLAMYWNSSPYAMINDLYPRRFKEWEFGMTPNNFWTKEKALEALKWTIEEKEGLTPKQLLDVYNIKWLQTHRLASACQIIWGNSPFRMINDLYIDRFKEWEFRVTPVGYWSKRKALEALRWTIEEKEKLDEKQLLKVFNQKWLIKQKLWTPLKRYWKGSPYEMLIALYPNRFSKNMLKGYM

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_007103_1	1.1\|80867\|35\|NC_007103\|CRISPRCasFinder	80867-80901	35	NZ_CP017574	Bacillus thuringiensis strain SCG04-02 plasmid PSCG364, complete sequence	164236-164270	0	1.0
NC_007103_1	1.1\|80867\|35\|NC_007103\|CRISPRCasFinder	80867-80901	35	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	80867-80901	0	1.0
NC_007103_1	1.1\|80867\|35\|NC_007103\|CRISPRCasFinder	80867-80901	35	NZ_CP029455	Bacillus cereus strain FORC087 plasmid pFORC087.1, complete sequence	28195-28229	0	1.0
NC_007103_1	1.1\|80867\|35\|NC_007103\|CRISPRCasFinder	80867-80901	35	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	241272-241306	0	1.0
NC_007103_1	1.1\|80867\|35\|NC_007103\|CRISPRCasFinder	80867-80901	35	NC_018688	Bacillus thuringiensis MC28 plasmid pMC319, complete sequence	304027-304061	1	0.971
NC_007103_1	1.1\|80867\|35\|NC_007103\|CRISPRCasFinder	80867-80901	35	NC_022782	Bacillus toyonensis BCT-7112 plasmid pBCT77, complete sequence	11075-11109	1	0.971
NC_007103_1	1.1\|80867\|35\|NC_007103\|CRISPRCasFinder	80867-80901	35	NZ_CP016596	Bacillus cereus strain K8 plasmid pBCM301, complete sequence	121916-121950	2	0.943
NC_007103_1	1.1\|80867\|35\|NC_007103\|CRISPRCasFinder	80867-80901	35	CP046512	Bacillus cereus strain JHU plasmid p1, complete sequence	303952-303986	2	0.943
NC_007103_1	1.1\|80867\|35\|NC_007103\|CRISPRCasFinder	80867-80901	35	NZ_CP023246	Bacillus cereus strain HBL-AI plasmid unnamed1, complete sequence	315773-315807	2	0.943
NC_007103_1	1.1\|80867\|35\|NC_007103\|CRISPRCasFinder	80867-80901	35	NZ_CP053657	Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence	206985-207019	2	0.943
NC_007103_1	1.1\|80867\|35\|NC_007103\|CRISPRCasFinder	80867-80901	35	NZ_CP010112	Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-6, complete sequence	9032-9066	2	0.943
NC_007103_1	1.1\|80867\|35\|NC_007103\|CRISPRCasFinder	80867-80901	35	NZ_CP045608	Bacillus cereus strain SB1 plasmid p2, complete sequence	174616-174650	3	0.914
NC_007103_1	1.1\|80867\|35\|NC_007103\|CRISPRCasFinder	80867-80901	35	NZ_CP020744	Bacillus mycoides strain Gnyt1 plasmid unnamed1, complete sequence	277726-277760	3	0.914
NC_007103_1	1.1\|80867\|35\|NC_007103\|CRISPRCasFinder	80867-80901	35	NZ_CP042875	Bacillus cereus strain 09 plasmid unnamed1, complete sequence	145768-145802	4	0.886

1. spacer 1.1|80867|35|NC_007103|CRISPRCasFinder matches to NZ_CP017574 (Bacillus thuringiensis strain SCG04-02 plasmid PSCG364, complete sequence) position: , mismatch: 0, identity: 1.0

atccatttgtatgtacccatccagtttgcataaaa	CRISPR spacer
atccatttgtatgtacccatccagtttgcataaaa	Protospacer
***********************************

2. spacer 1.1|80867|35|NC_007103|CRISPRCasFinder matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 0, identity: 1.0

atccatttgtatgtacccatccagtttgcataaaa	CRISPR spacer
atccatttgtatgtacccatccagtttgcataaaa	Protospacer
***********************************

3. spacer 1.1|80867|35|NC_007103|CRISPRCasFinder matches to NZ_CP029455 (Bacillus cereus strain FORC087 plasmid pFORC087.1, complete sequence) position: , mismatch: 0, identity: 1.0

atccatttgtatgtacccatccagtttgcataaaa	CRISPR spacer
atccatttgtatgtacccatccagtttgcataaaa	Protospacer
***********************************

4. spacer 1.1|80867|35|NC_007103|CRISPRCasFinder matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 0, identity: 1.0

atccatttgtatgtacccatccagtttgcataaaa	CRISPR spacer
atccatttgtatgtacccatccagtttgcataaaa	Protospacer
***********************************

5. spacer 1.1|80867|35|NC_007103|CRISPRCasFinder matches to NC_018688 (Bacillus thuringiensis MC28 plasmid pMC319, complete sequence) position: , mismatch: 1, identity: 0.971

atccatttgtatgtacccatccagtttgcataaaa	CRISPR spacer
atccatttgtatgtacccatcccgtttgcataaaa	Protospacer
********************** ************

6. spacer 1.1|80867|35|NC_007103|CRISPRCasFinder matches to NC_022782 (Bacillus toyonensis BCT-7112 plasmid pBCT77, complete sequence) position: , mismatch: 1, identity: 0.971

atccatttgtatgtacccatccagtttgcataaaa	CRISPR spacer
atccatttgtatgtacccatcccgtttgcataaaa	Protospacer
********************** ************

7. spacer 1.1|80867|35|NC_007103|CRISPRCasFinder matches to NZ_CP016596 (Bacillus cereus strain K8 plasmid pBCM301, complete sequence) position: , mismatch: 2, identity: 0.943

atccatttgtatgtacccatccagtttgcataaaa	CRISPR spacer
atccatttgtatgtacccatccggtttgtataaaa	Protospacer
**********************.*****.******

8. spacer 1.1|80867|35|NC_007103|CRISPRCasFinder matches to CP046512 (Bacillus cereus strain JHU plasmid p1, complete sequence) position: , mismatch: 2, identity: 0.943

atccatttgtatgtacccatccagtttgcataaaa	CRISPR spacer
atccatttgtatgtaaccatcccgtttgcataaaa	Protospacer
*************** ****** ************

9. spacer 1.1|80867|35|NC_007103|CRISPRCasFinder matches to NZ_CP023246 (Bacillus cereus strain HBL-AI plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.943

atccatttgtatgtacccatccagtttgcataaaa	CRISPR spacer
atccatttgtatgtaaccatcccgtttgcataaaa	Protospacer
*************** ****** ************

10. spacer 1.1|80867|35|NC_007103|CRISPRCasFinder matches to NZ_CP053657 (Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence) position: , mismatch: 2, identity: 0.943

atccatttgtatgtacccatccagtttgcataaaa	CRISPR spacer
atccatttgtatgtacccatcccgtttgcatataa	Protospacer
********************** ********* **

11. spacer 1.1|80867|35|NC_007103|CRISPRCasFinder matches to NZ_CP010112 (Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-6, complete sequence) position: , mismatch: 2, identity: 0.943

atccatttgtatgtacccatccagtttgcataaaa	CRISPR spacer
atccatttgtatgtacccatccggtttgtataaaa	Protospacer
**********************.*****.******

12. spacer 1.1|80867|35|NC_007103|CRISPRCasFinder matches to NZ_CP045608 (Bacillus cereus strain SB1 plasmid p2, complete sequence) position: , mismatch: 3, identity: 0.914

atccatttgtatgtacccatccagtttgcataaaa	CRISPR spacer
atccatttgtatgtacccatcctgattgcataaac	Protospacer
********************** * *********

13. spacer 1.1|80867|35|NC_007103|CRISPRCasFinder matches to NZ_CP020744 (Bacillus mycoides strain Gnyt1 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.914

atccatttgtatgtacccatccagtttgcataaaa	CRISPR spacer
acccatttgtgtgtacccatcccgtttgcataaaa	Protospacer
*.********.*********** ************

14. spacer 1.1|80867|35|NC_007103|CRISPRCasFinder matches to NZ_CP042875 (Bacillus cereus strain 09 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.886

atccatttgtatgtacccatccagtttgcataaaa	CRISPR spacer
atccatttgtatgtacccatcctgattgcataacc	Protospacer
********************** * ********

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

35552 : 76638

Bacillus_phage(20.0%)

integrase,transposase

attL 61172:61188|attR 80160:80176

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000747906.1\|35552_36395_-\|integrase	tyrosine-type recombinase/integrase	S5M9V8	Brevibacillus_phage	3.0e-32	32.6
WP_144405432.1\|37032_37221_+	hypothetical protein	NA	NA	NA	NA
WP_000161501.1\|37283_38201_+	hypothetical protein	NA	NA	NA	NA
WP_000910070.1\|40092_41181_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	Q332I1	Clostridium_botulinum_C_phage	5.3e-122	60.2
WP_000591603.1\|43533_45132_+	BCCT family transporter	A0A2I7QNT1	Vibrio_phage	1.1e-22	24.8
WP_001145709.1\|45150_45633_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	1.6e-22	41.5
WP_001013016.1\|45697_46312_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_000855459.1\|46453_47146_+	DUF1295 domain-containing protein	NA	NA	NA	NA
WP_000391639.1\|47530_47848_+	hypothetical protein	NA	NA	NA	NA
WP_001003824.1\|51402_52395_-	hypothetical protein	NA	NA	NA	NA
WP_000369814.1\|53247_54420_-\|integrase	tyrosine-type recombinase/integrase	A0A142F1N9	Bacillus_phage	1.4e-06	25.0
WP_000189824.1\|54823_55825_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_000212603.1\|55979_56393_-	hypothetical protein	NA	NA	NA	NA
WP_000028472.1\|57827_59258_+\|transposase	IS4-like element ISBce5 family transposase	NA	NA	NA	NA
WP_000129108.1\|59985_60990_+	serine hydrolase	NA	NA	NA	NA
61172:61188	attL	NA	NA	NA	NA
WP_001053939.1\|61190_62621_+\|transposase	IS4-like element ISBce4 family transposase	NA	NA	NA	NA
WP_000720173.1\|63680_64439_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	8.5e-18	30.7
WP_000291799.1\|64442_66761_-	FtsX-like permease family protein	NA	NA	NA	NA
WP_041184995.1\|66738_68052_-	MFS transporter	NA	NA	NA	NA
WP_001208356.1\|68068_68707_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_158319935.1\|69189_69477_+	hypothetical protein	NA	NA	NA	NA
WP_000576159.1\|69647_70193_+	recombinase family protein	A0A0A7NPV4	Enterobacteria_phage	1.5e-37	46.6
WP_001214170.1\|70224_73176_+\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	9.4e-214	40.7
WP_001032577.1\|74387_75200_-	AAA family ATPase	A0A2D1GNS0	Pseudomonas_phage	8.8e-05	27.6
WP_001178743.1\|75192_76638_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	A0A2H4JGQ6	uncultured_Caudovirales_phage	8.0e-17	25.5
80160:80176	attR	NA	NA	NA	NA

DBSCAN-SWA_2

94906 : 151637

Bacillus_phage(55.56%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000586195.1\|94906_96028_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	S6AND0	Bacillus_phage	6.4e-163	77.2
WP_000928761.1\|96263_97250_-	DUF4046 domain-containing protein	NA	NA	NA	NA
WP_000413709.1\|97476_98970_+	peptide MFS transporter	A0A0P0IY73	Acinetobacter_phage	4.3e-82	40.4
WP_000104881.1\|100103_101636_-	prolyl oligopeptidase family serine peptidase	NA	NA	NA	NA
WP_000746038.1\|102153_102573_-	hypothetical protein	NA	NA	NA	NA
WP_000428156.1\|102911_104987_-	serine hydrolase	A0A1V0SLG8	Klosneuvirus	1.1e-06	25.7
WP_041185000.1\|105077_106247_-	serine hydrolase	A0A1D8EXR7	Mycobacterium_phage	4.2e-24	28.5
WP_000473811.1\|107993_108353_-	hypothetical protein	NA	NA	NA	NA
WP_000704700.1\|109232_109793_-	hypothetical protein	NA	NA	NA	NA
WP_000438868.1\|110331_110820_-	sigma-70 family RNA polymerase sigma factor	A0A0S2MVE1	Bacillus_phage	2.0e-68	79.5
WP_000438658.1\|110879_111251_-	zinc-finger domain-containing protein	A0A0S2MV86	Bacillus_phage	1.2e-20	46.2
WP_000540406.1\|111250_111781_-	Holliday junction resolvase RecU	A0A1C8E9C3	Bacillus_phage	1.1e-77	80.6
WP_079995860.1\|111738_111921_-	hypothetical protein	NA	NA	NA	NA
WP_000475644.1\|112198_112681_+	hypothetical protein	NA	NA	NA	NA
WP_158319930.1\|112750_112897_-	hypothetical protein	NA	NA	NA	NA
WP_000028472.1\|114408_115839_-\|transposase	IS4-like element ISBce5 family transposase	NA	NA	NA	NA
WP_000810182.1\|116202_116796_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_001294035.1\|116823_118074_+	MFS transporter	NA	NA	NA	NA
WP_000592342.1\|120093_120504_+	hypothetical protein	NA	NA	NA	NA
WP_001056969.1\|120978_122361_+\|transposase	IS4-like element ISBce9 family transposase	NA	NA	NA	NA
WP_041184975.1\|122933_123098_+	aspartyl-phosphate phosphatase Spo0E family protein	NA	NA	NA	NA
WP_000482675.1\|123142_123331_-	RNA chaperone Hfq	NA	NA	NA	NA
WP_000788512.1\|123357_123693_-	hypothetical protein	NA	NA	NA	NA
WP_000995741.1\|124072_124903_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_000736075.1\|125107_125290_-	hypothetical protein	NA	NA	NA	NA
WP_001102204.1\|125832_126141_-	hypothetical protein	NA	NA	NA	NA
WP_158319929.1\|126343_126502_-	hypothetical protein	NA	NA	NA	NA
WP_011270223.1\|126721_127360_-	DUF2953 domain-containing protein	NA	NA	NA	NA
WP_000746489.1\|127864_128008_-	hypothetical protein	NA	NA	NA	NA
WP_000620764.1\|128268_128886_+	DUF2238 domain-containing protein	NA	NA	NA	NA
WP_001023785.1\|129118_129427_+	hypothetical protein	NA	NA	NA	NA
WP_001125179.1\|129793_130591_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_000819587.1\|131042_131819_+	C39 family peptidase	NA	NA	NA	NA
WP_000564717.1\|132188_132914_+	DUF421 domain-containing protein	NA	NA	NA	NA
WP_000567185.1\|134456_134720_+	hypothetical protein	NA	NA	NA	NA
WP_041185005.1\|135503_136859_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A1L2BWW3	Bacteriophage	9.5e-44	31.8
WP_001180113.1\|137301_137598_-	hypothetical protein	NA	NA	NA	NA
WP_000861532.1\|137892_138318_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	S6AND0	Bacillus_phage	1.9e-59	80.9
WP_000270220.1\|139336_140779_-	GMC family oxidoreductase	NA	NA	NA	NA
WP_001156502.1\|140943_142035_-	endospore germination permease	NA	NA	NA	NA
WP_000572768.1\|142075_143173_-	endospore germination permease	NA	NA	NA	NA
WP_000871284.1\|143204_143429_-	hypothetical protein	NA	NA	NA	NA
WP_000176111.1\|143425_144637_-	Ger(x)C family spore germination protein	NA	NA	NA	NA
WP_000898925.1\|144670_146242_-	spore germination protein	NA	NA	NA	NA
WP_000927573.1\|149784_150051_+	hypothetical protein	NA	NA	NA	NA
WP_000071774.1\|150740_151637_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA

DBSCAN-SWA_3

358518 : 435170

Bacillus_phage(58.33%)

integrase,transposase

attL 399024:399060|attR 447036:447072

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001053945.1\|358518_359949_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_000418191.1\|360138_360564_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_000352025.1\|361133_362540_+	MFS transporter	NA	NA	NA	NA
WP_000472958.1\|363170_363614_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_001036751.1\|363905_364844_+	ring-cleaving dioxygenase	NA	NA	NA	NA
WP_000948662.1\|364866_365475_+	flavin reductase family protein	NA	NA	NA	NA
WP_000066253.1\|365512_366463_+	ring-cleaving dioxygenase	NA	NA	NA	NA
WP_000681320.1\|366459_367074_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_000286701.1\|368136_368922_+	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	1.3e-24	32.5
WP_185768395.1\|369214_369829_+	nitroreductase family protein	NA	NA	NA	NA
WP_000391546.1\|370400_371492_+	low temperature requirement protein A	NA	NA	NA	NA
WP_000761926.1\|373781_374594_+	C39 family peptidase	NA	NA	NA	NA
WP_000724500.1\|374620_375253_+	hypothetical protein	NA	NA	NA	NA
WP_000751604.1\|375586_376018_-	hypothetical protein	NA	NA	NA	NA
WP_079995878.1\|376360_376480_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_000754400.1\|377349_379020_+	peptidase M4 family protein	NA	NA	NA	NA
WP_001027484.1\|379170_379989_+	PAS domain S-box protein	A0A2H4J162	uncultured_Caudovirales_phage	6.0e-09	37.5
WP_001056151.1\|380882_381539_+	hypothetical protein	NA	NA	NA	NA
WP_000422009.1\|382839_384573_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	3.8e-13	54.3
WP_000791311.1\|385513_387220_+	M4 family metallopeptidase	NA	NA	NA	NA
WP_001039320.1\|388955_389849_+	3-keto-5-aminohexanoate cleavage protein	A0A1V0SL81	Klosneuvirus	3.7e-28	29.9
WP_000440492.1\|389832_390813_+	L-carnitine dehydrogenase	NA	NA	NA	NA
WP_000078107.1\|390831_391308_+	thioesterase family protein	NA	NA	NA	NA
WP_041185029.1\|392149_392821_-	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_000947401.1\|393986_394490_-	hypothetical protein	NA	NA	NA	NA
WP_079995870.1\|394593_394749_+	hypothetical protein	A0A1W6JQ19	Staphylococcus_phage	2.6e-06	51.0
WP_000216157.1\|396385_396589_-	DUF1657 domain-containing protein	NA	NA	NA	NA
WP_001023782.1\|396869_397175_-	hypothetical protein	NA	NA	NA	NA
WP_000801086.1\|397388_397988_+	hypothetical protein	NA	NA	NA	NA
WP_000698339.1\|398091_398943_-	metallophosphoesterase	NA	NA	NA	NA
399024:399060	attL	NA	NA	NA	NA
WP_000906727.1\|399209_400331_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	S6AND0	Bacillus_phage	2.0e-172	80.7
WP_000440805.1\|400500_401667_+	UDP-glucuronosyltransferase	NA	NA	NA	NA
WP_011270302.1\|401981_402320_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_049770100.1\|402354_402558_+	hypothetical protein	NA	NA	NA	NA
WP_000342412.1\|402690_403029_-	hypothetical protein	NA	NA	NA	NA
WP_001107050.1\|404598_405162_+	undecaprenyl-diphosphatase	NA	NA	NA	NA
WP_000973293.1\|407429_408551_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	S6AND0	Bacillus_phage	3.4e-172	80.2
WP_158319934.1\|409784_409970_+	hypothetical protein	NA	NA	NA	NA
WP_000125391.1\|412212_412419_+	DUF1657 domain-containing protein	NA	NA	NA	NA
WP_000018942.1\|413167_414037_+	DUF421 domain-containing protein	NA	NA	NA	NA
WP_000116705.1\|414759_416184_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_001035968.1\|417618_418191_+\|integrase	tyrosine-type recombinase/integrase	D2XR58	Bacillus_phage	3.9e-31	42.9
WP_001176156.1\|418592_419708_+	SagB/ThcOx family dehydrogenase	NA	NA	NA	NA
WP_079995879.1\|419806_420928_+	MFS transporter	NA	NA	NA	NA
WP_000158321.1\|421430_422216_+	PhzF family phenazine biosynthesis protein	NA	NA	NA	NA
WP_041185031.1\|423416_423770_+	hypothetical protein	NA	NA	NA	NA
WP_000565446.1\|424098_424731_-	glycerol-3-phosphate 1-O-acyltransferase PlsY	NA	NA	NA	NA
WP_000932263.1\|424938_425040_-	hypothetical protein	NA	NA	NA	NA
WP_001190823.1\|425186_426203_+	ketoacyl-ACP synthase III	NA	NA	NA	NA
WP_000277052.1\|427993_428524_+	DUF4352 domain-containing protein	A0A0S2MVG4	Bacillus_phage	2.1e-68	74.4
WP_000831281.1\|428547_428892_+	DUF4064 domain-containing protein	A0A0S2MVJ2	Bacillus_phage	7.0e-44	81.6
WP_000451520.1\|429026_429590_+	DUF4352 domain-containing protein	A0A0S2MVG4	Bacillus_phage	7.9e-37	49.3
WP_165375055.1\|429969_430134_-	hypothetical protein	A0A1B0T6B0	Bacillus_phage	1.2e-06	65.4
WP_000395492.1\|430471_431365_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_158319933.1\|431557_431713_-	hypothetical protein	NA	NA	NA	NA
WP_000038581.1\|431926_432433_+	hypothetical protein	NA	NA	NA	NA
WP_001128820.1\|432652_432853_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_000791549.1\|432842_433202_-	DUF3796 domain-containing protein	NA	NA	NA	NA
WP_000117003.1\|433739_435170_+\|transposase	IS4-like element ISBce5 family transposase	NA	NA	NA	NA
447036:447072	attR	NA	NA	NA	NA

DBSCAN-SWA_4

457644 : 464513

Bacillus_phage(75.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001101735.1\|457644_458145_+	hypothetical protein	A0A0A7AQW2	Bacillus_phage	6.1e-57	69.9
WP_185768396.1\|458116_458260_+	hypothetical protein	A0A0A7AQI1	Bacillus_phage	4.0e-06	52.9
WP_000706148.1\|458499_458967_+	hypothetical protein	A0A0A7AR00	Bacillus_phage	2.0e-38	51.6
WP_041185034.1\|459173_459452_+	hypothetical protein	A0A0S2MVD9	Bacillus_phage	5.3e-18	55.7
WP_144405433.1\|459725_460223_+	dUTP diphosphatase	A0A0S2MVD0	Bacillus_phage	7.9e-73	87.2
WP_000446239.1\|460224_460410_+	hypothetical protein	NA	NA	NA	NA
WP_000993188.1\|460448_460667_+	DUF3797 domain-containing protein	Q24LE0	Clostridium_phage	4.7e-06	45.1
WP_158319932.1\|460703_460862_+	hypothetical protein	NA	NA	NA	NA
WP_000503879.1\|461190_461616_+	hypothetical protein	H0USU9	Bacillus_phage	1.9e-46	85.7
WP_000108303.1\|462713_464513_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	7.9e-30	27.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NC_006274

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_006274_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_006274_1

1104939-1105032

Orphan

Consensus_repeat	Method
GGTTTAAATACGTTAAATAGCAAAA	CRISPRCasFinder

1 spacers

WYL

The CRISPR arrays of NC_006274_1

>merge|NC_006274|1|1104939-1105032|CRISPRCasFinder
GGTTTAAATACGTTAAATAGCAAAAGCGGTATAGGGAAATTACAAGATGGATCCGGAAAAGTAACAGACGGTTTAAATACGTTAAATAGTAAAA

>NC_006274|1|1|1104939-1105032|CRISPRCasFinder
GGTTTAAATACGTTAAATAGCAAAA	GCGGTATAGGGAAATTACAAGATGGATCCGGAAAAGTAACAGAC
GGTTTAAATACGTTAAATAGTAAAA

Protein	Signature genes	Signature genes Name	Protein_function
NC_006274.1\|WP_000963371.1\|1103422_1103995_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NC_006274.1\|WP_000713025.1\|1108217_1108718_-\|DinB-family-protein	unknown	unknown	gnl\|CDD\|378981
NC_006274.1\|WP_001082254.1\|1108802_1109744_-\|YafY-family-transcriptional-regulator	WYL	COG2378_WYL_CAS-I:CAS-III	gnl\|CDD\|225253
NC_006274.1\|WP_000784696.1\|1111302_1112037_+\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293802
NC_006274.1\|WP_011198620.1\|1106962_1107178_+\|hypothetical-protein	unknown	unknown	unknown
NC_006274.1\|WP_011198619.1\|1101310_1103209_+\|beta-lactam-sensor/signal-transducer	unknown	unknown	gnl\|CDD\|310280
NC_006274.1\|WP_001228080.1\|1093902_1095324_+\|protoporphyrinogen-oxidase	unknown	unknown	gnl\|CDD\|237009
NC_006274.1\|WP_000184502.1\|1100906_1101305_+\|BlaI/MecI/CopY-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|367747
NC_006274.1\|WP_000726790.1\|1092947_1093883_+\|ferrochelatase	unknown	unknown	gnl\|CDD\|183526
NC_006274.1\|WP_000567010.1\|1110994_1111123_-\|YhfH-family-protein	unknown	unknown	gnl\|CDD\|379490
NC_006274.1\|WP_001148849.1\|1099476_1099776_+\|hypothetical-protein	unknown	unknown	unknown
NC_006274.1\|WP_000132242.1\|1107214_1107520_+\|DUF2087-domain-containing-protein	unknown	unknown	gnl\|CDD\|226378
NC_006274.1\|WP_000279261.1\|1096956_1099323_+\|chitobiase/beta-hexosaminidase-C-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|225249
NC_006274.1\|WP_000620020.1\|1107591_1108101_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NC_006274.1\|WP_000832618.1\|1113290_1113719_+\|hypothetical-protein	unknown	unknown	unknown
NC_006274.1\|WP_000897258.1\|1112046_1113036_+\|lipoate--protein-ligase	unknown	unknown	gnl\|CDD\|161920
NC_006274.1\|WP_000252614.1\|1091886_1092933_+\|uroporphyrinogen-decarboxylase	unknown	unknown	gnl\|CDD\|234644
NC_006274.1\|WP_000984155.1\|1099830_1100676_-\|hypothetical-protein	unknown	unknown	unknown
NC_006274.1\|WP_000453708.1\|1095363_1096716_-\|DUF4026-domain-containing-protein	unknown	unknown	gnl\|CDD\|338635
NC_006274.1\|WP_000103718.1\|1109941_1110955_+\|LacI-family-DNA-binding-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224525

Protein	Function_ID	Function_description	E-value
NC_006274.1\|WP_000963371.1\|1103422_1103995_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	1.04975e-14
NC_006274.1\|WP_000713025.1\|1108217_1108718_-\|DinB-family-protein	gnl\|CDD\|378981	pfam12867, DinB_2, DinB superfamily. The DinB family are an uncharacterized family of potential enzymes. The structure of these proteins is composed of a four helix bundle.	2.40573e-07
NC_006274.1\|WP_000784696.1\|1111302_1112037_+\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293802	cd07716, RNaseZ_short-form-like_MBL-fold, uncharacterized bacterial subgroup of Ribonuclease Z, short form; MBL-fold metallo-hydrolase domain. The tRNA maturase RNase Z (also known as tRNase Z or 3' tRNase) catalyzes the endonucleolytic removal of the 3' extension of the majority of tRNA precursors. Two forms of RNase Z exist in eukaryotes, one long (ELAC2) and one short form (ELAC1), the former may have resulted from a duplication of the shorter enzyme. Only the short form exists in bacteria. Members of this bacterial subgroup belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions.	3.88614e-86
NC_006274.1\|WP_001082254.1\|1108802_1109744_-\|YafY-family-transcriptional-regulator	gnl\|CDD\|225253	COG2378, COG2378, Predicted transcriptional regulator [Transcription].	3.79646e-62
NC_006274.1\|WP_011198619.1\|1101310_1103209_+\|beta-lactam-sensor/signal-transducer	gnl\|CDD\|310280	pfam05569, Peptidase_M56, BlaR1 peptidase M56. Production of beta-Lactamase and penicillin-binding protein 2a (which mediate staphylococcal resistance to beta-lactam antibiotics) is regulated by a signal-transducing integral membrane protein and a transcriptional repressor. The signal transducer is a fusion protein with penicillin-binding and zinc metalloprotease domains. The signal for protein expression is transmitted by site-specific proteolytic cleavage of both the transducer, which auto-activates, and the repressor, which is inactivated, unblocking gene transcription. homologs to this peptidase domain, which corresponds to Merops family M56, are also found in a number of other bacterial genome sequences.	6.42277e-47
NC_006274.1\|WP_001228080.1\|1093902_1095324_+\|protoporphyrinogen-oxidase	gnl\|CDD\|237009	PRK11883, PRK11883, protoporphyrinogen oxidase; Reviewed.	0
NC_006274.1\|WP_000184502.1\|1100906_1101305_+\|BlaI/MecI/CopY-family-transcriptional-regulator	gnl\|CDD\|367747	pfam03965, Penicillinase_R, Penicillinase repressor. The penicillinase repressor negatively regulates expression of the penicillinase gene. The N-terminal region of this protein is involved in operator recognition, while the C-terminal is responsible for dimerization of the protein.	8.74949e-46
NC_006274.1\|WP_000726790.1\|1092947_1093883_+\|ferrochelatase	gnl\|CDD\|183526	PRK12435, PRK12435, ferrochelatase; Provisional.	0
NC_006274.1\|WP_000567010.1\|1110994_1111123_-\|YhfH-family-protein	gnl\|CDD\|379490	pfam14149, YhfH, YhfH-like protein. The YhfH-like protein family includes the B. subtilis YhfH protein, which is functionally uncharacterized. Its expression is repressed by the Spx paralogue MgsR, which regulates genes involved in stress response. This family of proteins is found in bacteria. Proteins in this family are typically between 42 and 53 amino acids in length.	3.52581e-13
NC_006274.1\|WP_000132242.1\|1107214_1107520_+\|DUF2087-domain-containing-protein	gnl\|CDD\|226378	COG3860, COG3860, Uncharacterized protein conserved in bacteria [Function unknown].	2.3198e-24
NC_006274.1\|WP_000279261.1\|1096956_1099323_+\|chitobiase/beta-hexosaminidase-C-terminal-domain-containing-protein	gnl\|CDD\|225249	COG2374, COG2374, Predicted extracellular nuclease [General function prediction only].	6.70527e-69
NC_006274.1\|WP_000620020.1\|1107591_1108101_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	3.10565e-15
NC_006274.1\|WP_000897258.1\|1112046_1113036_+\|lipoate--protein-ligase	gnl\|CDD\|161920	TIGR00545, Probable_lipoate-protein_ligase_A, lipoyltransferase and lipoate-protein ligase. One member of this group of proteins is bovine lipoyltransferase, which transfers the lipoyl group from lipoyl-AMP to the specific Lys of lipoate-dependent enzymes. However, it does not first activate lipoic acid with ATP to create lipoyl-AMP and pyrophosphate. Another member of this group, lipoate-protein ligase A from E. coli, catalyzes both the activation and the transfer of lipoate. Homology between the two is full-length, except for the bovine mitochondrial targeting signal, but is strongest toward the N-terminus. [Protein fate, Protein modification and repair].	3.53507e-137
NC_006274.1\|WP_000252614.1\|1091886_1092933_+\|uroporphyrinogen-decarboxylase	gnl\|CDD\|234644	PRK00115, hemE, uroporphyrinogen decarboxylase; Validated.	0
NC_006274.1\|WP_000453708.1\|1095363_1096716_-\|DUF4026-domain-containing-protein	gnl\|CDD\|338635	pfam13218, DUF4026, Protein of unknown function (DUF4026). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 450 amino acids in length. The family is found in association with pfam10077.	2.03387e-179
NC_006274.1\|WP_000103718.1\|1109941_1110955_+\|LacI-family-DNA-binding-transcriptional-regulator	gnl\|CDD\|224525	COG1609, PurR, Transcriptional regulators [Transcription].	1.15283e-113

>NC_006274.1|WP_000963371.1|1103422_1103995_+|TetR/AcrR-family-transcriptional-regulator
MAIDRKRSIIEAATKSFSAFGYKATTMDQVAKLANVGKGTIYTFFKNKEELFGEIISNLITEMKQVAENAIRSDVSFFENVHRALYSILEFRKEHQLMIKLIQEERDMGTKEVQEVMQQVDVEIVSFIQSYLKIAIDKGEISKCDPEITAFIMLRLYVSLIFDWEKNHEPLEKEKIAELFELYLLKGLSN
>NC_006274.1|WP_011198619.1|1101310_1103209_+|beta-lactam-sensor/signal-transducer
MIDMLIKVYLPHFFDWLIETSLMASILVGFILCIKILFRNKLTPRWQYMLWIVLMIRLLLPWSPDSSYSIYSLLSYRSSVSEVIPKNMPSTESMMNIESDHKVELESHAETVTKSGKPEVNVSTEQQTPFSLYKLAMYVWLVGVFLLAVITFITNRRLYSYIKKQPDITDEQVVTVFNRCKQSMKMKKAVSLRLAGKIASPTVFSFFRPKVLLSKKHMKVLNEQQLQYVFYHELAHIKRNDVAVNWIMYSLILLNWFNPILWYAYFCMREDQELACDAYALTFIDKEEQIAYGHTIITLLEHYSYQAPSLANLSRNKRTLKRRIVMIKRFQKKSYRLSLLGVIVIVAIASLSLFNARATEGKEKQEDKVEQSKDAFQNAVDMLYGTEENAKKEYHYSARVYEEKTDYLYLAEKALTKDEFQQYIKLSKKIINIQKKGAPRDSDYESTVFREERLSKADRDKLYALYDQAKPFDDKVYESLNYTVKEAQQHVDFQIKKPTYTIEGYNLKDENVGYFIKRRPELIIELEYTNGKGNYTIYQSQVFGESKDPFSHQFVVPENIEQYELEGNQIFYATDHSDSNLQGIKMIVPAKGKNSAYQVVIINHSLERQGEAVFDKNVNKEELEKIMISMLK
>NC_006274.1|WP_000184502.1|1100906_1101305_+|BlaI/MecI/CopY-family-transcriptional-regulator
MTNQLPKISEAELEIMKVLWSKSPQTANEIIEELEDAMDWKPKTIRTLINRLVQKEAVSYHQDKGRMYAYYPLVSQDNYLQVETKSLLKRFCGAAFKPLLVNFLKEEKLSSEDINELKRILDEKTEENKRKD
>NC_006274.1|WP_000984155.1|1099830_1100676_-|hypothetical-protein
MMRALRLNIKQAFCNRVSLIIMFSGFVLICIYHYYYVIRYLGDAASGPISTDIKWIGFRDNEMDVYLLLMPIIASLPFSTSYNSDKSDGFKQFVSKGINLFSYSITKYIVTFFCGGLLYTLPFILSLLFCKLTIPDGETPAGSGIINVNGMFANLYEASPIIYITVYIGINFLFAGLMALLGLAASAWSQKDYMSLLFPFAATSIPYVLLNTVFPTIGGAPIHLYDPKQPLDGMSPYILTVQCAFFLLISLLMYIQGVKRDRKKYRRRLQRRDRCRKSFQV
>NC_006274.1|WP_001148849.1|1099476_1099776_+|hypothetical-protein
MQAQLNGKLMNQLAIFFSIIVMLQFIADVTGLTQNLDITYNLIHTAASYITFSLAVIFTLIGARRELSKYAIISLCLVVGIKAIYFVGVVILWGLAGTP
>NC_006274.1|WP_000279261.1|1096956_1099323_+|chitobiase/beta-hexosaminidase-C-terminal-domain-containing-protein
MAVKKLLSVFLSFILLLSFTGTLVQAEETTSMSVEKAIQVFKQQGKTKGTVEGYIVGYTQSPSKYTRDPAKFDDTNVAIADSPNETNPDKIMPVQLPKGDVRAAVNVKDHPENIGKKVSLTGTLELYFSSPGLKSVTAHKFQGEEQNRVSDVVASPNGGEVAKGTAVTLTTNTEGATIYYTLDGSNPTNKSVRYNGQIIVNENSVMKAIAEKEGLISSAISTFSFVIVNNEPVRIHDIQGKSHLSPYNGKKVYNVEGVVTALDKNGFYIEDNQPDNDPATSEGMYVYKKDANVAVGDLIQVDGVVEEYVGPGYAERFDTDLTTTEIKASRVAVIAKDQPLPAPIVLGENGVKIPDQIIDNDAFGLFNPNEDAIDFYESIEGMRVTMPTPKIIAPQKNGNLYVTVKNGGNKVVTKYGTPVLDENQLNPERLSVKVPRDYVAKVGDTFTGDITGVVGYDYGAFRIAPITELPSVVDGGFKQVGANIQPRLDKLTVATYNIENFSANKKETTDEKVKALAYSIKYNLKMPDIIGVEEMQDNNGTINDGTTDASLSAKRIIDAVLEIRGPKYEYVEIAPHNNLDGGAPGANIRVGFFYNPSRVKLTAVPKLLDKNVVRIGDENPLFESTRKPLAAEFTFQGQNLVVVANHLNSKIGDATPFGKVQPLVLKSEEKRVQLAQEVNNFVQGIQKKNTNAPVVVLGDMNDFEFAKPLKTLEGTILKNMLNTVPKENRYTYIHEGNAQVLDHILVTNNIAPHTIVDPVHLNSNIMKEHGRVSDHDPVLAQIDLKKAS
>NC_006274.1|WP_000453708.1|1095363_1096716_-|DUF4026-domain-containing-protein
MEVQTETYRAAMNGTLERHFSDMIAVIPTRITIEQLKQRLENIATKVDELKIVYSDETSLIVELHMDNKVIPYELHIDETDDPEEYKLYNRQDSTIVDRNFEDAAFGTEIFTRTLFVGDVLDCFFQQLQFLWSLAPDLLFVIDSSAAMKVISRSYIEYHVENELLPDIPDLYVIHSVYEDDKEGEPTQYWFHTHGLLRAGVTEIELIIPNRISSYYGIGDLFQTFANNAVENGQVPMNEPIVIAHSQQGSIHTVAVPWEKGLSYIGHKTSMDQLSSIEDEEVKLQPINAQNTFLGGMDDRDEYHQSPSVLLFKFDTSEECIESFFKEHEEATGLMFYKTNSETARMAYNAKNTFGYFSNIFQIEQSNEEFRFLAKFGVSYEEGKSEHMWFEMQHITEEFIQGILINEPYFIEDMSEGNSYHLDFDDLTEWVIYAGDAVIKPNNLYMFIGE
>NC_006274.1|WP_001228080.1|1093902_1095324_+|protoporphyrinogen-oxidase
MRKKVVIIGGGITGLTTMYHLQKDIRDKNLPIDTLLIEASGKLGGKIQTVRKDGFTIERGPDSFLARKESAARLVKELGLGDELVNNQAGQSFILVNNRLHKMPSGSMMGIPTQITPFLFSGLFSPIGKLRAGFDLLMPRSKPVSDQSLGHFFRHRLGNEVVENLIEPLLSGIYAGDIDEMSLMSTFPQMYQIEQKHRSISLGMRTLAPKAEKAEPKKGIFQTVKTGLESIVESLELKMHEGTIIKGTRIEKVAKQGDGYAITLSNGKEIEADAVVVASSHKVLPSMFAQYKQFRFFRNIPSTSVANVAMAFPKSAIQRDIDGTGFVVSRNSDYTITACTWTHKKWPHTTPEGKTLLRCYVGRPGDEAVVEQTEEELVQLVLEDLRKTMDITEDPEFTVVSRWKEAMPQYTVGHNERMKKLTTFMEKELPGIYLAGSSYAGSGLPDCIDQGEKAAKRVLSHLEKVMNTELIAQ
>NC_006274.1|WP_000726790.1|1092947_1093883_+|ferrochelatase
MKKKIGLLVMAYGTPYKEEDIERYYTHIRRGRKPSPEMLEDLTERYRAIGGISPLATITLEQAKKLEKRLNEVQDEVEYHMYLGLKHIEPFIEDAVKEMHNDGIQDAIALVLAPHYSTFSVKSYVGRAQEEAEKLGNLTIHGIDSWYKEPKFIQYWVDAVKGIYNGMSDAEREKAVLIVSAHSLPEKIIAMGDPYPDQLNETADYIARGAEVANYAVGWQSAGNTPDPWIGPDVQDLTRELNEKYGYTSFVYAPVGFVAEHLEVLYDNDFECKVVTDEIGAKYYRPEMPNASDAFIDSLTDVVVKKKESVM
>NC_006274.1|WP_000252614.1|1091886_1092933_+|uroporphyrinogen-decarboxylase
MVRTINETFLKACRGERTDYVPAWYMRQAGRSQPEYRKIKEKYSLFEITHNPELCAYVTKLPVDQYNVDAAILYKDIMSPLPAIGVDVEIKSGIGPVIDNPIRSLQDVEKLGEINPEDDVPYILDTIRLLTTEMLDVPLIGFSGAPFTLASYMIEGGPSRNYHNTKAFMYAEPKAWFALMDKLADMVITYLKAQINAGAKAVQIFDSWVGTVNVADYRVFIKPAMERIFAEVRTMGVPMIMHGVGAAHLVNEWHDLPLDVVGLDWRLPIEEARARGVHKAVQGNMDPSFLLAPWSVIEEHVKGILDQGMKQPGYIFNLGHGVFPEVNPDTLKRLTTFIHEYSKGQLAK
>NC_006274.1|WP_011198620.1|1106962_1107178_+|hypothetical-protein
MMKGRLTYYFILNPLIIFLVYALSPILFHKEKYINMKDALGILVVYYVLISGYYFMDVVSERMKKNSKDKQ
>NC_006274.1|WP_000132242.1|1107214_1107520_+|DUF2087-domain-containing-protein
MTDSEMKFRDATIRNFFDKEDRLKSIPGQKKKKLVLLEYLISKLNAENQYTEKEINAFIKQYHDDFCTIRREFIVQGFMDREDNMYRINGREVWTKWEELK
>NC_006274.1|WP_000620020.1|1107591_1108101_+|GNAT-family-N-acetyltransferase
MIRLAKEIDAEAIMDIRKEIILSETTTKFFVVSPKKLQNDSNAEREKIRKSNEKGNLYIVYEVDNKVVGFLLFNRYELDRLRHAGTMGMGIKEAYCNQGIGTKLIEFLIRWAKEQKGLEKICLGVVSINDRAIKVYKRMGFVEEGRQRKQIKYEDGSYGDDVLMGFYIE
>NC_006274.1|WP_000713025.1|1108217_1108718_-|DinB-family-protein
MKKFEELATYYIEELERYSIEQFRTKPSSEEWSLGQMYSHLIASTYMQLDAIAKCKTETPSATNKKTDMGEKVYKLGAFPDIQIKVPNHPGYTPENPSNKEEIQKRMLELITVVKDIEPTLSSIPSDCKVEHPGLGYLHAAEWFQLISMHFAHHLRQKERLELKVF
>NC_006274.1|WP_001082254.1|1108802_1109744_-|YafY-family-transcriptional-regulator
MNRTDRLLAILIELQRRQTVTAKSLAEKFETSIRTIYRDMDALNESGIPIYSMPGHGYSLMDGYFLPPIQLTPEEAVTLLLGGDYIEKTFTSSFSVNARSAKEKLEIVLPADQQKKAQELRETFRFLSPIFSHQQSEQEKLENQLLLLQESIQKEQAISFSYRKPRETTKIKRTVHPYGLVNISGIWYIVAHCLLRKQIRNFRLDRMDTLQQEQEFFTKPKDFSLQNYKPESNRTVMIHLLFPSHIAHKIIESRYYFIDSYEHRNNGFHVFLKSRNIDEVFQWVLSWGSQVQVLEPKILSEKIRDEAKKMLKL
>NC_006274.1|WP_000103718.1|1109941_1110955_+|LacI-family-DNA-binding-transcriptional-regulator
MSTIEDVAKLAGLSRTTVSRVINNHPYVSDEKKKRVQLAMKHLGFVPNSAARRLRKQKTETIAVLVPRITNPFFSRFIEAIEIAASEHKYKLIICQTRYLPEKEMEYLQLLSTKQVDGIILCSLENPWEDVEPYLQHGPIVLCNEYIEEANIPTVKFDHAQGAYIAAKHVLEQGYRNLIFCRGNETKVVSQQRKMGFLRAITEKSRQVEAIDFLENAFSWEDGKRIFHEVLKDKKNPTAILAGGDEVAAGIISEAKRHDWSIPDDLAVIGFDNQILSQITEPGITTIEQPIDEMARKVVDLMMDKIHTKNYRKKELYEFELELLVKGSTMKDTMLLA
>NC_006274.1|WP_000567010.1|1110994_1111123_-|YhfH-family-protein
MIDQPMEFFRNLPTKTCAHCGKEIDEQHEAYHNKCDDCVHEE
>NC_006274.1|WP_000784696.1|1111302_1112037_+|MBL-fold-metallo-hydrolase
MKMTVVGFWGGFPEVGEATSGYLFEHDGFRLLVDCGSGVLAQLQKYITPSHIDAVVLSHYHHDHVADIGVLQYARLITSATKGQLPELPIYGHTFDENGFHSLTHEPHTKGIPYNPEETLQIGPFSISFLKTVHPVTCFAMRITAGNDIVVYSADSSYIPEFIPFTKDADLFICECNMYAHQEAAKAGHMNSTEVASIAKDANVKELLLTHLPHTGNPADLVTEAKQIFSGHITLAHSGYVWNS
>NC_006274.1|WP_000897258.1|1112046_1113036_+|lipoate--protein-ligase
MLFIDNKGITDPRINLAIEEYCVKNLDINETYLLFYINEPSIIIGKNQNTVEEINADYVKEKGIHVVRRLSGGGAVYHDLGNLNFSFITKDDGDSFSNFKKFTEPVTKALGKLGVNAELSGRNDILAEGRKISGNAQFSTKGRMFSHGTLLFDSEIDHVVSALKVKMDKIQSKGIKSIRSRVANITEFLNEEMTTEEFRQLLLETIFEGETEIPTYELTEEDWKEIHKLSEERYRNWDWNYGKSPKFNLQHSHRFPVGQVDVRLEVKKGTVTECKIYGDFFGSLDVHDIEERLTGVQFDKDAFTAALEGVDIARYFGNITTEDFLHLFF
>NC_006274.1|WP_000832618.1|1113290_1113719_+|hypothetical-protein
MKRVMYVVLLLSFVIGIAACNDETSSSRTILSIGKPAKDNVIYFTHTDNRRKIQEIQDMFQNKKWKRNETFSTVNKTPDVVFSIDEDNTGLPALYVTLYFHEDGADAINLFGEHTTLNKEELTKLREKMSAYYPKMIFGLVS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_006274_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_006274_2

1208186-1208294

Orphan

Consensus_repeat	Method
TGTATGATTACCTTCCGCATGAGAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_006274_2

>merge|NC_006274|2|1208186-1208294|CRISPRCasFinder
TGTATGATTACCTTCCGCATGAGAAGAGAATCCGTTAGCGATAGTCGCGGTTCCTTCTGCATGTGCTGCTTCGCCTAAAGCGATTGTATGTTTACCTTCCGCATGAGAA

>NC_006274|2|2|1208186-1208294|CRISPRCasFinder
TGTATGATTACCTTCCGCATGAGAA	GAGAATCCGTTAGCGATAGTCGCGGTTCCTTCTGCATGTGCTGCTTCGCCTAAAGCGAT
TGTATGTTTACCTTCCGCATGAGAA

Protein	Signature genes	Signature genes Name	Protein_function
NC_006274.1\|WP_000651518.1\|1217630_1218311_+\|streptomycin-biosynthesis-protein-StrF	unknown	unknown	gnl\|CDD\|379345
NC_006274.1\|WP_000191108.1\|1203998_1204577_-\|CYTH-domain-containing-protein	unknown	unknown	gnl\|CDD\|143627
NC_006274.1\|WP_041184829.1\|1202123_1202297_-\|hypothetical-protein	unknown	unknown	unknown
NC_006274.1\|WP_000612275.1\|1198881_1200126_+\|competence-protein	unknown	unknown	gnl\|CDD\|226875
NC_006274.1\|WP_001004742.1\|1212127_1212886_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|379312
NC_006274.1\|WP_001079107.1\|1206595_1207489_+\|RluA-family-pseudouridine-synthase	unknown	unknown	gnl\|CDD\|223638
NC_006274.1\|WP_000428861.1\|1213022_1213868_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|377550
NC_006274.1\|WP_000360666.1\|1202526_1203420_-\|DsbA-family-protein	unknown	unknown	gnl\|CDD\|372699
NC_006274.1\|WP_000402622.1\|1211185_1212121_-\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|366154
NC_006274.1\|WP_001180007.1\|1204723_1205095_+\|hypothetical-protein	unknown	unknown	unknown
NC_006274.1\|WP_000654693.1\|1209882_1211043_-\|rod-shape-determining-protein-RodA	unknown	unknown	gnl\|CDD\|274033
NC_006274.1\|WP_000932899.1\|1215007_1216105_+\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|133005
NC_006274.1\|WP_001081482.1\|1205125_1205764_+\|GTP-pyrophosphokinase-family-protein	unknown	unknown	gnl\|CDD\|225232
NC_006274.1\|WP_000043381.1\|1203419_1203818_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|381281
NC_006274.1\|WP_000872721.1\|1209067_1209808_-\|bis(5'-nucleosyl)-tetraphosphatase-PrpE	unknown	unknown	gnl\|CDD\|184187
NC_006274.1\|WP_001067693.1\|1216245_1216935_+\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|369778
NC_006274.1\|WP_000064954.1\|1213990_1214842_-\|exosporium-leader-peptide-containing-protein	unknown	unknown	gnl\|CDD\|375999
NC_006274.1\|WP_000673194.1\|1205782_1206580_+\|NAD-kinase	unknown	unknown	gnl\|CDD\|235317
NC_006274.1\|WP_001271204.1\|1216931_1217618_+\|streptomycin-biosynthesis-protein-StrF	unknown	unknown	gnl\|CDD\|379345
NC_006274.1\|WP_000003397.1\|1200176_1202003_+\|oligoendopeptidase-F	unknown	unknown	gnl\|CDD\|341071

Protein	Function_ID	Function_description	E-value
NC_006274.1\|WP_000651518.1\|1217630_1218311_+\|streptomycin-biosynthesis-protein-StrF	gnl\|CDD\|379345	pfam13712, Glyco_tranf_2_5, Glycosyltransferase like family. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.	4.38557e-107
NC_006274.1\|WP_000191108.1\|1203998_1204577_-\|CYTH-domain-containing-protein	gnl\|CDD\|143627	cd07762, CYTH-like_Pase_1, Uncharacterized subgroup 1 of the CYTH-like superfamily. Enzymes belonging to the CYTH-like (also known as triphosphate tunnel metalloenzyme (TTM)-like) superfamily hydrolyze triphosphate-containing substrates, require metal cations as cofactors, and have a unique active site located at the center of an eight-stranded antiparallel beta barrel tunnel (the triphosphate tunnel). The name CYTH originated from the gene designation for bacterial class IV adenylyl cyclases (CyaB) and from thiamine triphosphatase. Class IV adenylate cyclases catalyze the conversion of ATP to 3',5'-cyclic AMP (cAMP) and PPi. Thiamine triphosphatase is a soluble cytosolic enzyme which converts thiamine triphosphate to thiamine diphosphate. This domain superfamily also contains RNA triphosphatases, membrane-associated polyphosphate polymerases, tripolyphosphatases, nucleoside triphosphatases, nucleoside tetraphosphatases and other proteins with unknown functions. Proteins of this subgroup are of bacterial origin and have not been characterized.	9.75044e-84
NC_006274.1\|WP_000872721.1\|1209067_1209808_-\|bis(5'-nucleosyl)-tetraphosphatase-PrpE	gnl\|CDD\|184187	PRK13625, PRK13625, bis(5'-nucleosyl)-tetraphosphatase PrpE; Provisional.	0
NC_006274.1\|WP_001004742.1\|1212127_1212886_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	8.91872e-20
NC_006274.1\|WP_001079107.1\|1206595_1207489_+\|RluA-family-pseudouridine-synthase	gnl\|CDD\|223638	COG0564, RluA, Pseudouridylate synthases, 23S RNA-specific [Translation, ribosomal structure and biogenesis].	7.41091e-101
NC_006274.1\|WP_000428861.1\|1213022_1213868_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|377550	pfam05711, TylF, Macrocin-O-methyltransferase (TylF). This family consists of bacterial macrocin O-methyltransferase (TylF) proteins. TylF is responsible for the methylation of macrocin to produce tylosin. Tylosin is a macrolide antibiotic used in veterinary medicine to treat infections caused by Gram-positive bacteria and as an animal growth promoter in the swine industry. It is produced by several Streptomyces species. As with other macrolides, the antibiotic activity of tylosin is due to the inhibition of protein biosynthesis by a mechanism that involves the binding of tylosin to the ribosome, preventing the formation of the mRNA-aminoacyl-tRNA-ribosome complex. The structure of one representative sequence from this family, NovP, shows it to be an S-adenosyl-l-methionine-dependent O-methyltransferase that catalyzes the penultimate step in the biosynthesis of the aminocoumarin antibiotic novobiocin. Specifically, it methylates at 4-OH of the noviose moiety, and the resultant methoxy group is important for the potency of the mature antibiotic. It is likely that the key structural features of NovP are common to the rest of the family and include: a helical 'lid' region that gates access to the co-substrate binding pocket and an active centre that contains a 3-Asp putative metal binding site. A further conserved Asp probably acts as the general base that initiates the reaction by de-protonating the 4-OH group of the noviose unit.	1.18141e-149
NC_006274.1\|WP_000360666.1\|1202526_1203420_-\|DsbA-family-protein	gnl\|CDD\|372699	pfam13743, Thioredoxin_5, Thioredoxin.	4.45739e-93
NC_006274.1\|WP_000673194.1\|1205782_1206580_+\|NAD-kinase	gnl\|CDD\|235317	PRK04885, ppnK, inorganic polyphosphate/ATP-NAD kinase; Provisional.	0
NC_006274.1\|WP_000043381.1\|1203419_1203818_-\|hypothetical-protein	gnl\|CDD\|381281	cd14772, TrHb2_Bs-trHb-like_O, Truncated hemoglobins, group 2 (O); Bacillus subtilis TrHb like. The M- and S families exhibit the canonical secondary structure of hemoglobins, a 3-over-3 alpha-helical sandwich structure (3/3 Mb-fold), built by eight alpha-helical segments. Truncated hemoglobins (TrHbs, 2/2Hb, or 2/2 globins) or the T family globins adopt a 2-on-2 alpha-helical sandwich structure, resulting from extensive and complex modifications of the canonical 3-on-3 alpha-helical sandwich that are distributed throughout the whole protein molecule. TrHbs are classified into three main groups based on their structural properties and named after Mycobacterium sp. genes glbN, glbO, and glbP: TrHb1s (N), TrHb2s (O) and TrHb3s (P). TrHb2's belonging to this group include monomeric Bacillus subtilis trHb (Bs-trHb), which exhibits an extremely high oxygen affinity, and a dimeric TrHb2 from the thermophilic aerobic spore forming bacterium Geobacillus stearothermophilus(Gs-trHb).	1.17037e-69
NC_006274.1\|WP_000654693.1\|1209882_1211043_-\|rod-shape-determining-protein-RodA	gnl\|CDD\|274033	TIGR02210, Rod_shape-determining_protein_RodA, rod shape-determining protein RodA. This protein is a member of the FtsW/RodA/SpoVE family (pfam01098). It is found only in species with rod (or spiral) shapes. In many species, mutation of rodA has been shown to correlate with loss of the normal rod shape. Note that RodA homologs are found, scoring below the cutoffs for this model, in a number of both rod-shaped and coccoid bacteria, including four proteins in Bacillus anthracis, for example. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan, Cellular processes, Cell division].	6.87062e-100
NC_006274.1\|WP_000932899.1\|1215007_1216105_+\|glycosyltransferase-family-2-protein	gnl\|CDD\|133005	cd02511, Beta4Glucosyltransferase, UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.	2.52811e-53
NC_006274.1\|WP_000612275.1\|1198881_1200126_+\|competence-protein	gnl\|CDD\|226875	COG4469, CoiA, Competence protein CoiA-like family, contains a predicted nuclease domain [General function prediction only].	3.69959e-58
NC_006274.1\|WP_001081482.1\|1205125_1205764_+\|GTP-pyrophosphokinase-family-protein	gnl\|CDD\|225232	COG2357, COG2357, PpGpp synthetase catalytic domain [General function prediction only].	1.66713e-95
NC_006274.1\|WP_001067693.1\|1216245_1216935_+\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|369778	pfam08242, Methyltransf_12, Methyltransferase domain. Members of this family are SAM dependent methyltransferases.	2.49077e-18
NC_006274.1\|WP_000064954.1\|1213990_1214842_-\|exosporium-leader-peptide-containing-protein	gnl\|CDD\|375999	pfam18573, BclA_C, BclA C-terminal domain. This is the C-terminal domain of BclA (Bacillus collagen-like protein of anthracis) which is expressed on spores of Bacillus species. Trimers of the C-terminal domain (CTD) form the tips of the spore's hair-like nap and are the immunodominant target of vertebrate antibodies and drive trimerization. Structure analysis indicate the C-terminal region of the peptide folding into an all-beta structure with a jelly-fold topology, similar to the first human complement C1q, a member of the tumor necrosis factor (TNF)-like family. The C-terminal globular domain has been shown to be located on the exterior of the exosporium, and therefore is critical in determining the immunogenicity of the spore in a mammalian host.	2.67983e-17
NC_006274.1\|WP_000402622.1\|1211185_1212121_-\|glycosyltransferase-family-2-protein	gnl\|CDD\|366154	pfam00535, Glycos_transf_2, Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.	7.00404e-23
NC_006274.1\|WP_001271204.1\|1216931_1217618_+\|streptomycin-biosynthesis-protein-StrF	gnl\|CDD\|379345	pfam13712, Glyco_tranf_2_5, Glycosyltransferase like family. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.	2.00824e-110
NC_006274.1\|WP_000003397.1\|1200176_1202003_+\|oligoendopeptidase-F	gnl\|CDD\|341071	cd09608, M3B_PepF, Peptidase family M3B, oligopeptidase F (PepF). Peptidase family M3B oligopeptidase F (PepF; Pz-peptidase B; EC 3.4.24.-) is mostly bacterial and includes oligoendopeptidase F from Lactococcus lactis. This enzyme hydrolyzes peptides containing between 7 and 17 amino acids with fairly broad specificity. The PepF gene is duplicated in L. lactis on the plasmid that bears it, while a shortened second copy is found in Bacillus subtilis. Most bacterial PepFs are cytoplasmic endopeptidases; however, the Bacillus amyloliquefaciens PepF oligopeptidase is a secreted protein and may facilitate the process of sporulation. Specifically, the yjbG gene encoding the homolog of the PepF1 and PepF2 oligoendopeptidases of Lactococcus lactis has been identified in Bacillus subtilis as an inhibitor of sporulation initiation when over-expressed from a multicopy plasmid. This PepF family includes Streptococcus agalactiae PepB, a group B streptococcal oligopeptidase which has been shown to degrade a variety of bioactive peptides as well as the synthetic collagen-like substrate N-(3-[2-furyl]acryloyl)-Leu-Gly- Pro-Ala in vitro.	0

>NC_006274.1|WP_001079107.1|1206595_1207489_+|RluA-family-pseudouridine-synthase
MNRFTLKWDIESAEEGTLVREFLKTKGISKAALTDIKFHGGAIEVNGQHASVRHQLQVGEELRIFFPVEERSEGMIAEDIPLCIVYEDDAVLVINKEANMSTIPSREHPSGSVANALLSHYDKQYLASTVHIVTRLDRDTSGLMLIAKNRFVHHLLSKQHQQKAVKRTYEAIVHGEMVEREGTIDAPIGRKSDSIIERTVCEEGQRAVTHFRVIDSANHKTHVSLELDTGRTHQIRVHMAHIGHPLLGDNLYGGKRDEMKRQALHSTSLTFYHPILEKEMSFTTTIPNDMQAVVRHT
>NC_006274.1|WP_000673194.1|1205782_1206580_+|NAD-kinase
MKFTIMSKGDQSSDTLASTMKEYLLDFGFIMDEQEPDIVISVGGDGTLLYAFHRYYNRLDETAFVGVHTGHLGFYADWLPTEVEKLVIAIAKTPFQVVEYPLLEVIIRYMNGSKESQYLAMNEATVKSAEGTLVTEVEIRGEYFETFRGDGLCISTPSGSTAYNKALGGAIIHPSIEAIQIAEMASINNRVFRTVGSPLVLPKHHTCVLKPTAGMNLQITVDHLTMVHQDVKSIQYRVANEKVRFVRFRPFPFWKRVRDSFVADK
>NC_006274.1|WP_001081482.1|1205125_1205764_+|GTP-pyrophosphokinase-family-protein
MNRNWEEFLAPYHQAVAELKVKLKGMRTQFAMLTEHSPIEFVTGRVKSVASIIDKAEKRNVPLDRLREDMQDIAGLRMMCQFVDEIKPVVEYLRKRNDFEIVEERDYVTQKKDSGYRSYHVVISYPVQTIQGEQKVLVEIQIRTLAMNFWATIEHSLNYKYSGRFPEDIKIRLQRAAEAAFLLDEEMSSIRLEIQEAQKAFSRKQETKDSES
>NC_006274.1|WP_001180007.1|1204723_1205095_+|hypothetical-protein
MQNKIQVKSVEKRENALIFCAENSEIEVKGLSARNHVLVDSDNLSFIYILENESSFIYVSIPHTCWEAMHEAMNNDVVMFVRVNDIEMELEGLKEEVEYLVENIEGNANYGEELVTAVEKVFL
>NC_006274.1|WP_000191108.1|1203998_1204577_-|CYTH-domain-containing-protein
MTQEIEIEFKNIVTEEEFHTLCKSFSIEVFTKQVNHYFETPNFSLKEAGSALRIRHKGETYTLTLKQPAEVGLLETHQVVTENEAKMMMETNVIISGAVMDQLCKLQIPVSALTYMGSLTTERAETLFEGGTLVFDHSFYYNHDDYEIEFEVQDEETGKAAFIHLLKQHNIPIRHTNNKVKRFFLAKQNKAR
>NC_006274.1|WP_000043381.1|1203419_1203818_-|hypothetical-protein
MSKQPMTPFEAIGGEQCIAILVDTFYSYVSKHPDLSPIFPDDLTETARKQKQFLTQYLGGPNLYTEEHGHPMLRARHLPFEITPKRAEAWLSCMEQAMDDTGVHGHIREFVFERLALTAQHMVNTPNETGEI
>NC_006274.1|WP_000360666.1|1202526_1203420_-|DsbA-family-protein
MDKQEAKHINMPSPSTCEHKSVEAYLFIDPLCKDCWEIEPFIIKLWLEYGKYFSIRHIVTGKVDGTNASSHKWNKPANIRFVWEKTTSLHGFSCDGKVHMQEASSTPYLVSMAIKAAELQGRKAGSKFLRKLQEYIFLENVSNPDCELLLACAKDSDIDVEEFKKDLYSASAKKAFQCDLKFTNEMHITEIPSLVFFHANSDEEGIKIAGTYSYDVYVQLLKELVKCEIEPEPLPPLEVLLEATQFISSKEVAFIYDCSKQEIERELKKLQLKRKVQMIDVKCERYWKWIAKEKDLV
>NC_006274.1|WP_041184829.1|1202123_1202297_-|hypothetical-protein
MKKTYILLILLAVIVSFFLYILSLLQAFPKIIAFPLLFGVIVIGLSYFNHKKRFKGF
>NC_006274.1|WP_000003397.1|1200176_1202003_+|oligoendopeptidase-F
MSEQNTAKTLPDRNEIEESSTWRLEDIFQTDTEWEKEFQAIKELLPKLTEFKGKLGDSANNLLEALQYEDEISMRLGKLYTYAHMRYDQDTTNSVYQALNDRATNLYSQVSSSTAYIVPEILSISEDTLQTFLKENRDLSVYEHALEEITRQRPHVLSEAEEALLAEASEVMSASSNTFGMLNNADLKFPSIKGEDGEEVEITHGRYIQFLESDDRRVREDAFKAVYETYGKYKNTFASTLSGAVKRNNFNARVRKYDSARQAALSNNNIPEAVYDQLVESVNDNLHLLHRYIDIRKRALGLDELHMYDLYTPLVPEVKMNVKYEEAQDMLLKSLNVLGDEYVDILKEAYENRWVDVYENKGKRSGAYSSGAYGTNPYILMNWHDNVNNLFTLAHEFGHSVHSYYTRKTQPHVYGDYSIFVAEVASTCNEALLNDYLLKTTEDKKERLYLLNHYLEGFRGTVFRQTMFAEFEHIIHKKVQEGHAVTPDMLTEIYYDLNKKYFGDALVIDEEIGLEWSRIPHFYYNYYVYQYATGFSAATALSKQILEEGQPAVERYINEFLKAGSSDYPIEVLKKAGVDMASPEPVKEALQVFEEKLNELEALLFEEK
>NC_006274.1|WP_000612275.1|1198881_1200126_+|competence-protein
MIPIFIAKRENGEKIHLLDHHDEELLHHMRKRESFFCIACGKEVLMRLGKQKRWHFAHKKVDSCLAFYEAESTYHMYGKELLYRWFKRQNVHVEIEHYLPEIRQRPDIFIERAGKQIAIEYQCANLSIEQLCKRTYSYWRAGIQVIWIIGGNQLKKHSAYWMKFSSLMAFSLQSYPQPLLIFFCSKQKSFMKCTFITSFSTSVAFSHIIYLPIETTTFEMLFSPVPFQREVLNREWKRRKDYFRQNALPILNYNHKSLLRLLYQCKCNPANFPSEIGVPLPSSFAFQTNSFIWQAFLYMNCIGELAVGDCISLKYVCSYIKKYTKRRMLPYFSQHIWKVAVTEYMTFLCYAGVLYKIGMYTYRKIRDAVPLKTGGEIMKHDEICLAHALSLFEAKFNMRGGKGDIIKTDREGIT
>NC_006274.1|WP_000872721.1|1209067_1209808_-|bis(5'-nucleosyl)-tetraphosphatase-PrpE
MKYDIIGDIHGCLQEFQNLTEKLGYNWSSGLPVHPDQRKLAFVGDITDRGPHSLRMIEIVWELVIHKKVAYYAPGNHCNKLYRFFLGRNVTIAHGLETTVAEYEALPSHKQNMIKEKFITLYEQSPLYHVLDEKRLLVCHAGIRQDYIGRQDKKVQTFVLYGDITGEKHADGSPVRRDWAKEYKGTTWIVYGHTPVKEPRFVNHTVNIDTGAVFGGKLTGLRYPEMETVSVPSSLPFVPEKFRPIS
>NC_006274.1|WP_000654693.1|1209882_1211043_-|rod-shape-determining-protein-RodA
MKDPNSQYQIDYVLLCILFAIGTVSCFAIASAQASLPPFLQNVNFVLKQIQWYFIGFIAIGVIMIIDFDRYQKIAWYLYSFALVLLIGLELQVPGAITIKGATAWYRLPGIGNFQPSEIMKLFLIIVTGRIIANHNEKYFYRTIHDDFLLLGKICATSLPPLLLIAKEPDLGNTMVISAMLAAMILVSGIRWRFIFGLASGIFAAGITLTYIFFTHTKFFKAHILQEYQLNRFYGWLAPYKYDAQGYQLRQAFLATGSGEMQGKGWENGQVYFPEPHTDFIFTNVAEQFGFLGASVIIALFFLLIFRMIHIAIESNDPFGSYICAGTIGMFTFQVFQNIGMTIGLLPITGITLPLMSYGGSSLLTYMIAIGFVLNVRSRTKIFMFN
>NC_006274.1|WP_000402622.1|1211185_1212121_-|glycosyltransferase-family-2-protein
MEIIKNVPLVSILIPTYNRPHYFKIALESVLAQTYSNIEIIVGDDSTNNETEKLIYRDYLHKHKHITYIRNPSTLGQFHNALMLLEQSNGEYINFLMDDDIFYNNKIEKMMFYFQKDLDQNLALITSYRTWINDDGDIIEQHPSMKRLYDEDTLLNGKDLGNRMLILGQNIIGEPTTVLFRKRLLTEPFGTLNGRNYNCSVDMASWISLLSKGDAIYITEPLSSFRLHTGQQVHHKYLEGCEDFSHLVLHSKKYGFLQEIDYYKTSLLKACEWYKNATTFYQLYPELIPTTDTHTRLSHCLNIVTKELHAI
>NC_006274.1|WP_001004742.1|1212127_1212886_-|class-I-SAM-dependent-methyltransferase
MNENEKKITLIPPPELVQYVGGHFEEVGKEFMQYFIEIGNLKSNETVLDVGCGIGRMAVPLMNYLSDDGNYYGFDLFNKGITWCKNNISTRRNNFHFEHVDIYNQFYNPDGKEDASQYKFPYEDESFDFIFLTSVFTHLLPKELEHYVREIARVLKKDGRCFITFFLINPESSYYLNAGLSPLGFYHQIDNCYVLNKDIPNFAVAYPEEDIRTLLNKYGLEMQTPPHYGSWCGRTEHTSYQDIILTQKISER
>NC_006274.1|WP_000428861.1|1213022_1213868_-|class-I-SAM-dependent-methyltransferase
MENKSAVQLYLELLKKTILFEIWLEYEPYLPASLHISKELSYEPVTVPLPLFLKQYVENHNLKIVNPNVSNNERQGGKDWPRAAHSMVGRKRMNQLQEAMETVVRENIEGDFIETGVWRGGSCIFMNGFLQANNITDRTVWVADSFEGLPAPNLEQYPKDYGDYLHTFDYLRVSLETVQENFRKYDLLNDQVKFLKGWFKDTLPSAPIEKIAIARLDGDMYESTMDSLVNLYDKVSIGGFIIIDDYGLITCAEAVTDFRSERNIKTPMTQIDDFGIFWRKE
>NC_006274.1|WP_000064954.1|1213990_1214842_-|exosporium-leader-peptide-containing-protein
MSNHNYSDGLNPDESLSASAFDPNLVGPTLPPIPPFTLPTGPTGPTGPTGPTGPTVPTGPTGATGPTGPTGPTGDTGATGPTGPTGDTGATGPTGPTGDTGATGLTGPTGDTGATGLTGPTGDTGATGLTGPTGPTGATGLTGPTGPSGLGLPAGLYAFNSGGISLDLGINDPLPFNTVGSQFGTAISQLDADTFVISETGFYKITVVANTATVSALGGLTIQVNGVPVPGTGSSLISLGAPIVIQAITQITTTPSLVEVIVTGLGLSLALGTSASIIIEKIA
>NC_006274.1|WP_000932899.1|1215007_1216105_+|glycosyltransferase-family-2-protein
MLNKQGITISLCMIVRDEEDTIGRCLDAVEKIVDEIIIVDTGSIDRTKEIVAQYTSNIYDFPWINDFAAARNFSFSKATQEYILWLDADDVLLEDAQEALKLLKRELDPKIDAVSMPYHLALDSSGKPLYCTKRNRLVKREKQFQWFGKVHEYLAISGETFSSNVAITHKKEKKVTNRNLKIFQNAVAAGEELSPRDLFYYANECMDNQKYDDAVMLYETFLNQDEGWYEEKIYACGKLGDCYAKLGSWEKAIESCVKSFRYDVPRGENCTRIGYIYMEQQKYNEAIFWFKLATEVPMATESPFHSPASYTWLPYLQMCICYSKLGEQDKAYYYNELAAAYVPNNAAIEYNRKYFRSVFDKQYKV
>NC_006274.1|WP_001067693.1|1216245_1216935_+|class-I-SAM-dependent-methyltransferase
MNPEKSSLYEEKSEHYYNAANPNLLKHIKKEWKEVLDIGCSGGALGAAIKENGTRVSGIEAFPEAAEKAKERLDHVILGDIEKIDLPYEEEQFDCVIFGDVLEHLFDPWAVIEKVKPYIKENGVILASIPNVAHISVLAPLLAGNWSYTEYGLLDKTHIRFFTFNEMLRMFLKAGYSISKVDRVYIDHKMYEPLIEELYGVCKKYRLGSGFMAETVVFQYIIEAEKSQL
>NC_006274.1|WP_001271204.1|1216931_1217618_+|streptomycin-biosynthesis-protein-StrF
MSAAEKTILFVTCINDSKMYAQCVRHILRLPVPPGYVVQFMPIRNAKSMTSGYNQAISHPAKYKVYIHQDVFIMNIAFLHGLLQLFNEHEHLGMIGMIGAQYVPPNGVWNEGKGVVGKVIGYMNDLFYMATQEQPYHESKTFMPVECIDGLLMATQYDIPWREDLFDGFDYYDVSQSFEFRKAGYTVGVPVQRDAWCIHYHIDVNMTNYDKYRKIFVEHYMSDVNQDE
>NC_006274.1|WP_000651518.1|1217630_1218311_+|streptomycin-biosynthesis-protein-StrF
MKDHTILVVVCINNEKLFEQCERQIRNLFVPPGYVVQIFPIRDAKSMASAYNRALSYPAKYKVYIHQDTYLINREMFYTLISLFKDNEKLGLIGVAGAQFLPSNGIWWEGKNLVGKVIEYRSQNYQLLNLDQLFYGNQSFMSVQAIDGLLMATQYDIPWREDLFQGFHFYDVSQSLEFQKAGYLIGIPNQANLWCIHYNGDEFDADTYEKDRKVFVEHYKDILSPS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_006274_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_006274_3

2111302-2111523

Orphan

Consensus_repeat	Method
ATACAAAGCCAGATACAA	CRT

5 spacers

The CRISPR arrays of NC_006274_3

>merge|NC_006274|3|2111302-2111523|CRT
AAACAGATACAGGTACAAAGCCAGATACAAACCCGGATACAAAGCCAGATACAAAGCCAGATACAAACCCGGATACAAAGCCAGATACAAAGCCAGATACAAACCCGGATACAAAGCCAGATACAAAGCCAGATACAAAGCCAGATACAAAGCCAGATACAAACCCGGATACAAAGCCAGATACAAAACCAGACACAAAGCCAGATACAAAGCCAGATACAA

>NC_006274|3|1|2111302-2111523|CRT
AAACAGATACAGGTACAA	AGCCAGATACAAACCCGG
ATACAAAGCCAGATACAA	AGCCAGATACAAACCCGGATACAAAGCCAG
ATACAAAGCCAGATACAA	ACCCGGATACAAAGCCAG
ATACAAAGCCAGATACAA	AGCCAGATACAAAGCCAGATACAAACCCGG
ATACAAAGCCAGATACAA	AACCAGACACAAAGCCAG
ATACAAAGCCAGATACAA

Protein	Signature genes	Signature genes Name	Protein_function
NC_006274.1\|WP_000241765.1\|2102437_2103211_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|214624
NC_006274.1\|WP_001050361.1\|2114513_2114762_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377787
NC_006274.1\|WP_000856121.1\|2114785_2115442_+\|hypothetical-protein	unknown	unknown	unknown
NC_006274.1\|WP_001172756.1\|2103633_2107641_+\|type-VII-secretion-protein-EssC	unknown	unknown	gnl\|CDD\|274860
NC_006274.1\|WP_000506909.1\|2108124_2110800_+\|tetratricopeptide-repeat-protein	unknown	unknown	gnl\|CDD\|274350
NC_006274.1\|WP_000625109.1\|2113688_2114444_+\|DUF975-family-protein	unknown	unknown	gnl\|CDD\|283754
NC_006274.1\|WP_001091054.1\|2120132_2120618_+\|DUF600-family-protein	unknown	unknown	gnl\|CDD\|377394
NC_006274.1\|WP_000391134.1\|2103239_2103602_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|378057
NC_006274.1\|WP_001284948.1\|2123102_2124008_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223669
NC_006274.1\|WP_000443911.1\|2100162_2101461_+\|aspartate--tRNA(Asn)-ligase	unknown	unknown	gnl\|CDD\|235354
NC_006274.1\|WP_000804098.1\|2119691_2120132_+\|DNA/RNA-non-specific-endonuclease	unknown	unknown	gnl\|CDD\|372824
NC_006274.1\|WP_000966846.1\|2101661_2102426_+\|VWA-domain-containing-protein	unknown	unknown	gnl\|CDD\|238119
NC_006274.1\|WP_000243841.1\|2115494_2115968_+\|hypothetical-protein	unknown	unknown	unknown
NC_006274.1\|WP_049770079.1\|2098393_2099776_+\|UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D--alanine-ligase	unknown	unknown	gnl\|CDD\|223841
NC_006274.1\|WP_000136048.1\|2107768_2108041_+\|WXG100-family-type-VII-secretion-target	unknown	unknown	gnl\|CDD\|274862
NC_006274.1\|WP_000751334.1\|2097841_2098330_-\|hypothetical-protein	unknown	unknown	unknown
NC_006274.1\|WP_000504231.1\|2117395_2118181_+\|recombinase-family-protein	unknown	unknown	gnl\|CDD\|214861
NC_006274.1\|WP_185768389.1\|2115990_2116785_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|373948
NC_006274.1\|WP_000482269.1\|2096226_2097738_+\|M36-family-metallopeptidase	unknown	unknown	gnl\|CDD\|225768
NC_006274.1\|WP_000814515.1\|2121721_2123062_+\|sodium-dependent-transporter	unknown	unknown	gnl\|CDD\|271367

Protein	Function_ID	Function_description	E-value
NC_006274.1\|WP_000241765.1\|2102437_2103211_+\|hypothetical-protein	gnl\|CDD\|214624	smart00331, PP2C_SIG, Sigma factor PP2C-like phosphatases.	0.000475893
NC_006274.1\|WP_001050361.1\|2114513_2114762_+\|hypothetical-protein	gnl\|CDD\|377787	pfam07179, SseB, SseB protein N-terminal domain. This family consists of several SseB proteins which appear to be found exclusively in Enterobacteria. SseB is known to enhance serine-sensitivity in Escherichia coli and is part of the Salmonella pathogenicity island 2 (SPI-2) translocon. This entry contains the presumed N-terminal domain of SseB.	0.00953407
NC_006274.1\|WP_001172756.1\|2103633_2107641_+\|type-VII-secretion-protein-EssC	gnl\|CDD\|274860	TIGR03928, T7_EssCb_Firm, type VII secretion protein EssC, C-terminal domain. This model describes the C-terminal domain, or longer subunit, of the Firmicutes type VII secretion protein EssC. This protein (homologous to EccC in Actinobacteria) and the WXG100 target proteins are the only homologous parts of type VII secretion between Firmicutes and Actinobacteria. [Protein fate, Protein and peptide secretion and trafficking].	0
NC_006274.1\|WP_000506909.1\|2108124_2110800_+\|tetratricopeptide-repeat-protein	gnl\|CDD\|274350	TIGR02917, TPR_domain_protein, putative PEP-CTERM system TPR-repeat lipoprotein. This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.	1.04705e-13
NC_006274.1\|WP_000625109.1\|2113688_2114444_+\|DUF975-family-protein	gnl\|CDD\|283754	pfam06161, DUF975, Protein of unknown function (DUF975). Family of uncharacterized bacterial proteins.	3.86896e-18
NC_006274.1\|WP_001091054.1\|2120132_2120618_+\|DUF600-family-protein	gnl\|CDD\|377394	pfam04634, DUF600, Protein of unknown function, DUF600. This conserved region is found in several uncharacterized proteins from Gram positive bacteria.	3.20012e-37
NC_006274.1\|WP_000391134.1\|2103239_2103602_+\|hypothetical-protein	gnl\|CDD\|378057	pfam08817, YukD, WXG100 protein secretion system (Wss), protein YukD. The YukD protein family members participate in the formation of a translocon required for the secretion of WXG100 proteins (pfam06013) in monoderm bacteria, with the WXG100 protein secretion system (Wss). Like the cytoplasmic protein EsaC in Staphylococcus aureus, YukD was hypothesized to play a role of a chaperone. YukD adopts a ubiquitin-like fold. Usually, ubiquitin covalently binds to protein and flags them for protein degradation, however conjugation assays have indicated that the classical YukD lacks the capacity for covalent bond formation with other proteins. In contrast to the situation in firmicutes, YukD-like proteins in actinobacteria are often fused to a transporter involved in the ESAT-6/ESX/Wss secretion pathway. Members of the YukD family are also associated in gene neighborhoods with other enzymatic members of the ubiquitin signaling and degradation pathway such as the E1, E2 and E3 trienzyme complex that catalyze ubiquitin transfer to substrates, and the JAB family metallopeptidases that are involved in its release. This suggests that a subset of the YukD family in bacteria are conjugated and released from proteins as in the eukaryotic ubiquitin-mediated signaling and degradation pathway.	0.00245055
NC_006274.1\|WP_001284948.1\|2123102_2124008_+\|alpha/beta-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	3.53869e-30
NC_006274.1\|WP_000443911.1\|2100162_2101461_+\|aspartate--tRNA(Asn)-ligase	gnl\|CDD\|235354	PRK05159, aspC, aspartyl-tRNA synthetase; Provisional.	0
NC_006274.1\|WP_000804098.1\|2119691_2120132_+\|DNA/RNA-non-specific-endonuclease	gnl\|CDD\|372824	pfam13930, Endonuclea_NS_2, DNA/RNA non-specific endonuclease.	9.97382e-38
NC_006274.1\|WP_000966846.1\|2101661_2102426_+\|VWA-domain-containing-protein	gnl\|CDD\|238119	cd00198, vWFA, Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF). Typically, the vWA domain is made up of approximately 200 amino acid residues folded into a classic a/b para-rossmann type of fold. The vWA domain, since its discovery, has drawn great interest because of its widespread occurrence and its involvement in a wide variety of important cellular functions. These include basal membrane formation, cell migration, cell differentiation, adhesion, haemostasis, signaling, chromosomal stability, malignant transformation and in immune defenses In integrins these domains form heterodimers while in vWF it forms multimers. There are different interaction surfaces of this domain as seen by the various molecules it complexes with. Ligand binding in most cases is mediated by the presence of a metal ion dependent adhesion site termed as the MIDAS motif that is a characteristic feature of most, if not all A domains.	5.3007e-10
NC_006274.1\|WP_049770079.1\|2098393_2099776_+\|UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D--alanine-ligase	gnl\|CDD\|223841	COG0770, MurF, UDP-N-acetylmuramyl pentapeptide synthase [Cell envelope biogenesis, outer membrane].	3.03194e-157
NC_006274.1\|WP_000136048.1\|2107768_2108041_+\|WXG100-family-type-VII-secretion-target	gnl\|CDD\|274862	TIGR03930, WXG100_ESAT6, WXG100 family type VII secretion target. Members of this protein family include secretion targets for the two main variants of type VII secretion systems (T7SS), one found in the Actinobacteria, one found in the Firmicutes. This model was derived through iteration from pfam06013. The best characterized member of this family is ESAT-6 from Mycobacterium tuberculosis. Members of this family usually are ~100 amino acids in length but occasionally have a long C-terminal extension.	7.59834e-20
NC_006274.1\|WP_000504231.1\|2117395_2118181_+\|recombinase-family-protein	gnl\|CDD\|214861	smart00857, Resolvase, Resolvase, N terminal domain. The N-terminal domain of the resolvase family contains the active site and the dimer interface. The extended arm at the C-terminus of this domain connects to the C-terminal helix-turn-helix domain of resolvase.	2.81341e-32
NC_006274.1\|WP_185768389.1\|2115990_2116785_+\|hypothetical-protein	gnl\|CDD\|373948	pfam15573, Imm47, Immunity protein 47. A predicted immunity protein with an alpha+beta fold and a conserved KxGDxxK motif. Proteins containing this domain are present in heterogeneous poly-immunity loci in polymorphic toxin systems.	2.28225e-152
NC_006274.1\|WP_000482269.1\|2096226_2097738_+\|M36-family-metallopeptidase	gnl\|CDD\|225768	COG3227, LasB, Zinc metalloprotease (elastase) [Amino acid transport and metabolism].	9.28924e-26
NC_006274.1\|WP_000814515.1\|2121721_2123062_+\|sodium-dependent-transporter	gnl\|CDD\|271367	cd10336, SLC6sbd_Tyt1-Like, solute carrier 6 subfamily, Fusobacterium nucleatum Tyt1-like; solute-binding domain. SLC6 proteins (also called the sodium- and chloride-dependent neurotransmitter transporter family or Na+/Cl--dependent transporter family) include neurotransmitter transporters (NTTs): these are sodium- and chloride-dependent plasma membrane transporters for the monoamine neurotransmitters serotonin (5-hydroxytryptamine), dopamine, and norepinephrine, and the amino acid neurotransmitters GABA and glycine. These NTTs are widely expressed in the mammalian brain, involved in regulating neurotransmitter signaling and homeostasis, and the target of a range of therapeutic drugs for the treatment of psychiatric diseases. Bacterial members of the SLC6 family include the LeuT amino acid transporter. An arrangement of 12 transmembrane (TM) helices appears to be as a common topological motif for eukaryotic and some prokaryotic and archaeal NTTs. However, this subfamily which contains the majority of bacterial members and some archaeal members, appears to contain only 11 TMs; for example the functional Fusobacterium nucleatum tyrosine transporter Tyt1.	0

>NC_006274.1|WP_000506909.1|2108124_2110800_+|tetratricopeptide-repeat-protein
MGFRPEVGEEISLNKDVYRVEKHPAVVGIEMPYGQEGRQGTVYQLQHENGMERIALKVFKERYREEKHQLAFLKPLSSIAGLKVCSRYIVTKEEHISAIEKSEELANSIVMPWIEGPTWADILQEQRRLSKEQCFFIAEAFLITLKMMEENEVAHNDLSSSNILIPFLSENPIEGQHYIELVDVEQMYGPKTKRPSLLPAGSAGYAPKYLTSGIWQKEADRFAGAILLGEILSWCSEEVRNKKWTDASYFKTEEMQTECERYTLLQQVLHNQWNGEIAKLFKQAWSSNSFAECPSFAQWYDVFNSVRERIKIDAERQSAEEHSLFVSKCLEIARLLEERGFKQAALYEYKIIFNSLNPSTALQKELAYIIQTMESQEPEINKKMVLQHYLELATELERENNAAFACFVYSRIVQFPNIDQALKQEIESIIEEIKEEQGTESQQEIAATITVPTSILQSRKQTKKQVEYDIDDEILNAKASNQPLTIAHEQSEPSAFSTWWKKNKKRILIIGSTVVVVIGGSTLFYFYTTNAKYQKFMEQARQAYDDKKYTKAEEAVGHAIAVKGKDEAYLQLATIYVAEGKNKIAIDYITKLIKDREIDKENNEAAYLLASANFRIGKYQEAVQNFEQALANNAKGIEPYKKDAMRDLAVSHMKMKEFEKAEDVIVKMSTKTNEDKAIVSYLKGQLSTATVQLEKAESFFKEAIMQDSKNPIYTIELSNLYVLWNKTNLIDSAKKEMNYQQASHILQVAIQKDMKNIELLNQLGIVYYEAGQFYETRDGAKSTAAYQQALEAYNRVVSSGTRDINTLVNIGILYDKVGQGNEAEKLFTEAYSQNDENPHVNFAFGMFKIKQKKYEEASRFLRKTVQANENESEVRAAQEKLTEMKTNGWIQ
>NC_006274.1|WP_000136048.1|2107768_2108041_+|WXG100-family-type-VII-secretion-target
MTEIKIRPEDLERISNNFNNAAAEAQSQVNRLEGDIKSLDGQWAGSTQAKFRGEFENSKQKMQQYIPILEGISRDLKRIAEKFRSTDNTY
>NC_006274.1|WP_001172756.1|2103633_2107641_+|type-VII-secretion-protein-EssC
MQKSPYFQRSPRVKVDIPTGDVIIHDPPNIPEEPKFSIETMLLPAMMTVLTLVLYFVMMKFMKMNSSYMPLMMVSSIPMLGSYIITTMGHFRKKKEHRQMVEQLQTRYLEQIQKHRVELDTLKVEQAKYLITQNPSPLKSVQRIENRDSNLWERTPESPDFLDIRIGTGERPFLVELKVPEQKGYEENPLVTEAQNVKRDFNTIPNGHISISLKKNDVIGVVGNKEDRLNFIRIVTTQIMTHHAPNEVKIAAFYHEKEKKQWDWMRWLPHVWDEQRSMRFLSENQQDAQKLAEVLFTPLNMRRIYNSSAQADAKVPLIPMYVFFLSAREFLEDDPLTPMLLREGESVGASTFIFAEQKERLPMECDLVISLNGENGELVETFSSSAENSGTTRASFKVDRLSFERCELGARSIAPIRMKSSTAANIPKVLTFLDLFQAKNMEELQVLERWKENRYPTSLPVPIGVREGSKPVFLNIHDKIEKKGHGPHGLMAGTTGSGKSEVIQSIIAALAATYHPHEMAFMLIDYKGGGMSNTFAGLPHIIASITNLEDPNLIERARISLKAELERRQKLFIQAGNVQHLDEYYETSWREKEPLPHLFIVIDEFAQMKKEQPEFMDELISVAAIGRTLGVHLLLATQKPSGVVNDKIWSNSRFRICLRVQDDADSREMLKIPDASKINVPGRGYLQVGSNEVLELFQSAWSGAPYNPDEEKVLDIVDFTEVKLSGERIKVKKRPKPMTNSPKQLQAFIQYVQSVSEKENIKALPGPWLDPLPEKLLLKEFYAMEDWTIAEWNKSKEYLQVIVGLIDDVANQAQFPLKLDLQEGHLNIYGMPGTGKTTMLQTIIMSLAVSHTPEEVNFYIIDFGRMFLDFRDLPHVGGVVQEDENEKMKRLFGFLKKEVTERKERFSNIGAKSFSMYNRMVGKRIPAIVVMVDGYIRFKNEFEKENEVLEMLLRESSTYGVYFYFSLNQTIDMFDRVRNNIPMAITFELQDRAEYSSLVGRPNFPLIEVPTGRGLMKGQPPELFQAALPFIGESELEYSQQLKTIIRKMSSEWNGEKAKEIPMVPKEIFVEHMVEKLETAQISAGIETEDIRLQSFSLDEMSHIFIGGRIEGGKTSLLQTLLFTTTYQYSPEKVELYLVDLGERPTGILALGDLPHVKKKVTDDMQLKEMLDELLELINNREAVIPSIDPNVTVEFPYKKIIVAIDDIDQMLTILASDYEAKNKMELIVQNCKNKGVHFLTAATTSSVNSFSHEKWFAEIRKRSISYLLGTTHNNDVYFFNMKLPHAEIDQELLSGDGYCIRRKPIKIKCAYTPLHLLRKMTDKVIVKWSEIRVK
>NC_006274.1|WP_000391134.1|2103239_2103602_+|hypothetical-protein
MEEIIVTYIKQSNEEIDIAIPNDVKAVQIIEAILHHEKIDETLSSTYEIRVAKDKEEWHSIRNDETLRDNDVWDGQYVILYKKGSIIPSFEMLPAEEVYNEPVKQDISTSEEDYVWKIIE
>NC_006274.1|WP_000241765.1|2102437_2103211_+|hypothetical-protein
MVKYILSQKKETVLQEKKTKHFTYQYSYVRAKETQDLNESGQDFLAFQDNGTSFIFVLCDGVGLSFHGEIAAEFLGMKLLNLFETYQESGRDIATLLNEQLNNWIEEASEEVNAFRLPEQTPWLLRDVLEEKRKQGSEAMFIGGKIELIPNQDKVQITIVTHGDSFVQLFQDKENCSNVMKFERNIEKRWSTQRGIIGGELAVFSKTLSRQEANRIVIHSDGLTLLKQYNVEEVLKEIERAQNSPTSDDISFLDVSW
>NC_006274.1|WP_000966846.1|2101661_2102426_+|VWA-domain-containing-protein
MLYQTQATQQTPAYIIYLLDVSASMNQMMDAGGEEKRRIDIVTDALSLAIRQMVFRSTKGSRLLPRYKLSILAYSDHVFDLLGGVKTIDEVARLRPLEKIQTHRLTDTAKAFSVVEKLLQKELPNLQDGPAPVVCHMTDGASTGEDPELIVRRIMNMSVPDGNVLIENIFISDEIMQEQITNIKKWEGIMPNTEITDEYGAKLQRLSSPIPQSYREMMTEHGFHIADGAVMMFPGTNADLVSLGFQMSAATPVR
>NC_006274.1|WP_000443911.1|2100162_2101461_+|aspartate--tRNA(Asn)-ligase
MESIMKRSLTKECTKQSGKVVLLQGWVKKIRHLGNVSFLLLRDRTGVIQCVLENEFAGYKVDVESVVHVIGEIVETTKTELGVELLAHEVKVINGAEQLPFEINKKKLQVGLDQLLNERVLSLRHERTAAIFKVKSTFVHSFSEFLTENDFTRIFTPKIVSQGAEGGANVFKLPYFQKEAYLAQSPQFYKQMMVAGGLERVFEIAPVYRAEHHNSSRHLNEYISLDVELSFIHDFHEVMQLETDVLRYMFQQVAKNCEKELQLLQIEVPVITEIPKITLLEAQEILKSKYCKESPVGDLDTEGEKLLGKYVKETYKSEFVFITHYPKEARPMYTMPNNENSSITDSFDLLYKGLEITSGAQRIHNYEMLLDSFKGKGLHPDKFQSYLNTFRYGCPPHGGFGIGLERIVYKLLELSNVREASAFPRDCMRLIP
>NC_006274.1|WP_049770079.1|2098393_2099776_+|UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D--alanine-ligase
MEVDDNLIQMNLKKLEEVINGEGLHESFHHLEIHGVCIDSKNMKEGNVFVPIIRVKDGHEYVKEAMDNGAISSLWKKSYGTPPKGIPIIFVDDTLFALQQLAQFYRREINVKVIGITGSNGKTTVKDIIEGILRSTYRVHKTKGNFNSQIGLPLTILEMKRDTEFLILEMGMSEKGQIRNLSRIAQPDVAVITMIGQSHLETLGSRKEIAKAKLEIIDGLRENGLFLYNGDEPLFSRNNKTSGVNCKTFGEKDTNDLFPTNVQLDEYGVHFKLNHTKIQYDVPLHGKHNIFNTIVGIAVGQFYKVPTEKIQEALQQINITQMRFQFLTAKIGFTIINDAWNASPSSMKAAIETLQKLNAYKKKIIVIGDMLELGKKAETYHREIGKMLNEESIQYVFTYGELAKIVAEEASKKYDTGKVQSFDNKAEIAEEVLKVITKKDVVLLKGSRGMALEEIVQNWM
>NC_006274.1|WP_000751334.1|2097841_2098330_-|hypothetical-protein
MKKTISFFLLLLCLIVVNETYAYSPKSLPVSQHSDQWQVNIAEPKKANKKKLQAKKDEFQTYQFSVKNVGNSEVYNVQVEVFRNEPKTKTKTKYELFSLKESRLASGKTGFEHANLPVATKADEVDVIITWQEHPFRSMRNGQKVEARKFKEHFVFKDEKNK
>NC_006274.1|WP_000482269.1|2096226_2097738_+|M36-family-metallopeptidase
MFNKKMVAMAMTVPLVMGTISTVSALEKQQQVKLEAYSPQKKATEYLKENAAQYGLKPDLSDLQYISTTETSVASYVRFQQVVNGAPVFSKQITVTLNGEGKGVLAVSDYQSVKGVKEVTKKITEKDAIQKSMAYVGEASEQNLWAPTEKEFGYIVEEGIARPVYKVVVHSNNPFGAWETFIDAENGKLIKKVDINRKAEGSGKVFLPNPVVSSGSLAGLKDNNDADSTALTNQLKTVTLKGLDGTGFLIGEYVTISSKARTKSTNLQFNYTRANDSFEDVMSYYHIDTLQRYIQSLGFQNINNRSIKVNVNGTTADNSFYSPTTKALTFGTGGVDDAEDAGIIAHEYGHSIQDNQVPGFGSSAEGGAMGEGFGDFLGATYEDAVSTTGYGKACVGEWDATAYSSSDPTCLRRLDNNKVYPKDITNEVHDDGEIWAQGQYEMAQAFGRDVATKIILQSHWSLTPNSKFSDGAKAIKQADALLYGGQHAADIDRIWAARGISTN
>NC_006274.1|WP_000625109.1|2113688_2114444_+|DUF975-family-protein
MISNLKREALSSLKGQWGLGVGSTFLNYLIPVASMYIIGIVVFLIFGLFIDVIGPENFVYYAYGEPQINFGFILSQIIVWAIIFILYIVVQSVMSYGYYTITLRLAKNESTTIGDLFAGFNSNNIFRAMKLGVLQTIFISLWSLLFIVPGIIKFFSYSMAYYIMLEDPECTASEAIKKSKMMMKGHKLDLFITWLSFIGWFILGSLVGIFTLNLPYLWISPYYTTTVSHFYLNLVNRTNDSKEVSVINIQK
>NC_006274.1|WP_001050361.1|2114513_2114762_+|hypothetical-protein
MNLLEICPLDGALVEALQNEEKRVRFYEILQKSNLYVVASVEGDTTVDEEGKLISTENCNKLLEVFRKNTQDLRIEFKIYES
>NC_006274.1|WP_000856121.1|2114785_2115442_+|hypothetical-protein
MKTNKAFERVCNLISEKYLDNGWKYSKSGHWMSKKDKNFIYKVLFYTSWNNISDKNVVFYGECAILPLKSKDKIVHINTRQCNVPSGQLYWNIANEEEWERIVNEYINWLNSVFMPIVERCTNDLNNFVKEVVERGFYPQKGYMVDINFILKHGSRELAEEAIKRYYDSLEESIKKEFKDNYEMMVYGNEAVSAYGNNMMRNYTNFRTIIDNKIIVTL
>NC_006274.1|WP_000243841.1|2115494_2115968_+|hypothetical-protein
MVLNKGTGNNSSSKDVYGPYYDEAKKLHETNPDWYPNPDESTIVKGKELKEARADYQALVRRGELEKGHHVQGLSFGGENVSSNIKNTGESTIRREQIDDLNLDFYHEMGYGKENAKVLKIHENEKGIIVFGNNPQHTEVTVFQNKVLKWQRENGKR
>NC_006274.1|WP_185768389.1|2115990_2116785_+|hypothetical-protein
MGETRNLMNSIWFGEKTILAKSEIKEKILKSLTETEVLFNLIELFKTGDFTQKPLLVQLMNQTKDEAVLNLCIRVFLSVATHEDLRDSNNLRFLSEVTEETVDTFASAATTSLSLEVIPYLLALLEEWEEFSDTATIIRDSIDSFINFEDQIGEDATIDEIGNFYFKYCQEKDINSYYFQQNLAFPGDLAKKLIQRVMIAANNEEQLKMELIPSLLSIWTGKRVPADYTTIISASNYKDFIDYINELSSENWEKGQKYFYGYKL
>NC_006274.1|WP_000504231.1|2117395_2118181_+|recombinase-family-protein
MGEKVVGYVRVSTEGQVREGYSLTYQVEEIERYCIENKLQLLHIYEDKGISGATVDEDGLTVEREGLQELLSDLAYQQVSHVIVLNTSRLWRSDMAKVLIQRELKKHEVDVKAIEQPNYSIYTHDPNDFLVNGMLELLDQYQRLEIALKLSRGRKKKAEQGGYAGGGVMFGYRVKKGQKVLEVDAEKAIVVRRLFELRHFFKHWSLTQLAERLNREGYCTEKRKLFTKVQVKRMLDRENFYRGVYTYGQIQTIGKHPVIIL
>NC_006274.1|WP_000804098.1|2119691_2120132_+|DNA/RNA-non-specific-endonuclease
MKPNVKYETNGYLYQTDELGRIERASGELTLDMGERNSKHQLAAGGEDRVKAPSTQGDHGGHLIGTQFNGSPLIDNIVAMNGNVNVSAYKKLESAWAKALRDKREVIVDIRPVYEGNSVRPVSFNIKYRIDGEKFKASLKNVYGGK
>NC_006274.1|WP_001091054.1|2120132_2120618_+|DUF600-family-protein
MNTENLESIYQKVAIQLNNIIPEPWEKVMVYSEVEEYSDSTVFFYYPKNKQEPIYSLDIEDMEGIDEDETNRQLNLLDSLFRELWEEFKRNKQEPWTNLTFELYSTGKFDIEFDYTLLDEENNYNHYERLIIWKYKKLGISPDEKRESDVKLIREYINTQK
>NC_006274.1|WP_000814515.1|2121721_2123062_+|sodium-dependent-transporter
MKQTEQWTSKLGFIMAAAGSAIGLGAIWKFPYIAGKSGGGAFFLIFILFTLLIGLPLLIAEFMIGRSTQKQAVGAFKSIAPNTGWHWIGRLGVGTCFILLSFYSVVGGWVFIYLFRGVTGQLITPGQNYGALFTETIGNPAWAILGHFAFMFITVWVVSKGVQNGIEKASKYMLPALFVLFVALIVRSLTLDNAMQGVKFFLQPDFSKITSESILFAMGQSFFAISIGISIMVTYSSYLNKKESLPKSAITIVGLNLFVSLFAGLAIFPAVFSLGMEPTEGPGLLFIVLPSVFSQIPFGGFFLTVFLALFTFATLTSAFSLLETVVSALANGEQERRTKLSWMIGFCIFLVGIPSALSFGVWSDITIFGKNIFDAVDFLSSNILMPLGALFISIFVSFKMEKKVLEAEFFVGGNYGKKVFTCWAFLLRFVAPLAIIIVFLNVIGVI
>NC_006274.1|WP_001284948.1|2123102_2124008_+|alpha/beta-hydrolase
MANLIETGKYMNIRGKKLYVETHGDPKNKPVLYLHGGPGESCYDFSFHQAERLKDSLYVIMIDQRGVCRSEEITEDEAFGLNDLIEDCEELKKVLQIEKWSIIGHSFGGYLALRYASIYPGSIKKIIFEGPTFDFALTSRALLQKTGHLLKKYGKEEVAEESLAYSSSKASSEELLEAYIRLSDELEEKRMEIYNYKEDGADESLYSDEEWEVFSNRSKIHFDRLKLEGACHTSLLSKIKDVQNPMLLIVGKHDVVTCEKQIEIFNKDARNGKYIVFEESGHSPHYEEADRFAETVIHFLK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_006274_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_006274_4

3337759-3337861

Orphan

Consensus_repeat	Method
AAGTTTAGGTTTCTTTTGAGAATGT	CRISPRCasFinder

1 spacers

csa3

The CRISPR arrays of NC_006274_4

>merge|NC_006274|4|3337759-3337861|CRISPRCasFinder
AAGTTTAGGTTTCTTTTGAGAATGTGGTATATTTACATGCCCCGAAGTAGCCGTGGATTGTCTCCTTTCCTTCCTTGACAATTTAGGTTTCTTTTGAGAATGT

>NC_006274|4|3|3337759-3337861|CRISPRCasFinder
AAGTTTAGGTTTCTTTTGAGAATGT	GGTATATTTACATGCCCCGAAGTAGCCGTGGATTGTCTCCTTTCCTTCCTTGA
CAATTTAGGTTTCTTTTGAGAATGT

Protein	Signature genes	Signature genes Name	Protein_function
NC_006274.1\|WP_000549064.1\|3334939_3335449_+\|DUF3916-domain-containing-protein	unknown	unknown	gnl\|CDD\|372464
NC_006274.1\|WP_000797131.1\|3324483_3325188_-\|histidine-phosphatase-family-protein	unknown	unknown	gnl\|CDD\|366010
NC_006274.1\|WP_000129204.1\|3328318_3329110_+\|arylamine-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366312
NC_006274.1\|WP_000445387.1\|3339754_3341377_-\|FAD-dependent-monooxygenase	unknown	unknown	gnl\|CDD\|366675
NC_006274.1\|WP_001226316.1\|3336262_3337207_-\|glycerophosphodiester-phosphodiesterase	unknown	unknown	gnl\|CDD\|176543
NC_006274.1\|WP_000137569.1\|3329226_3331014_+\|oligoendopeptidase-F	unknown	unknown	gnl\|CDD\|341071
NC_006274.1\|WP_001102713.1\|3345256_3346351_+\|tetratricopeptide-repeat-protein	unknown	unknown	gnl\|CDD\|376220
NC_006274.1\|WP_000164878.1\|3343535_3345002_+\|YdiU-family-protein	unknown	unknown	gnl\|CDD\|234583
NC_006274.1\|WP_000915209.1\|3331049_3332183_-\|serine-hydrolase	unknown	unknown	gnl\|CDD\|365903
NC_006274.1\|WP_000592007.1\|3346347_3346536_+\|Phr-family-secreted-Rap-phosphatase-inhibitor	unknown	unknown	gnl\|CDD\|275222
NC_006274.1\|WP_000275809.1\|3346609_3347209_-\|protease-synthase/sporulation-negative-transcriptional-regulator-PaiB	unknown	unknown	gnl\|CDD\|377290
NC_006274.1\|WP_001172051.1\|3347860_3348208_-\|DUF4260-domain-containing-protein	unknown	unknown	gnl\|CDD\|379455
NC_006274.1\|WP_000646407.1\|3342358_3343357_+\|NADP-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|176191
NC_006274.1\|WP_000351712.1\|3334095_3334947_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176133
NC_006274.1\|WP_041184862.1\|3332765_3334010_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|341028
NC_006274.1\|WP_000417243.1\|3338500_3339154_-\|hypothetical-protein	unknown	unknown	unknown
NC_006274.1\|WP_001095179.1\|3325881_3327783_-\|mannonate-oxidoreductase	unknown	unknown	gnl\|CDD\|234750
NC_006274.1\|WP_041184863.1\|3339170_3339413_-\|hypothetical-protein	unknown	unknown	unknown
NC_006274.1\|WP_000594281.1\|3341844_3342249_+\|winged-helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|238042
NC_006274.1\|WP_000256496.1\|3325350_3325875_-\|N-acetyltransferase	unknown	unknown	gnl\|CDD\|225695

Protein	Function_ID	Function_description	E-value
NC_006274.1\|WP_000549064.1\|3334939_3335449_+\|DUF3916-domain-containing-protein	gnl\|CDD\|372464	pfam13079, DUF3916, Protein of unknown function (DUF3916). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 170 amino acids in length. There is a single completely conserved residue S that may be functionally important.	2.50919e-74
NC_006274.1\|WP_000797131.1\|3324483_3325188_-\|histidine-phosphatase-family-protein	gnl\|CDD\|366010	pfam00300, His_Phos_1, Histidine phosphatase superfamily (branch 1). The histidine phosphatase superfamily is so named because catalysis centers on a conserved His residue that is transiently phosphorylated during the catalytic cycle. Other conserved residues contribute to a 'phosphate pocket' and interact with the phospho group of substrate before, during and after its transfer to the His residue. Structure and sequence analyses show that different families contribute different additional residues to the 'phosphate pocket' and, more surprisingly, differ in the position, in sequence and in three dimensions, of a catalytically essential acidic residue. The superfamily may be divided into two main branches. The larger branch 1 contains a wide variety of catalytic functions, the best known being fructose 2,6-bisphosphatase (found in a bifunctional protein with 2-phosphofructokinase) and cofactor-dependent phosphoglycerate mutase. The latter is an unusual example of a mutase activity in the superfamily: the vast majority of members appear to be phosphatases. The bacterial regulatory protein phosphatase SixA is also in branch 1 and has a minimal, and possible ancestral-like structure, lacking the large domain insertions that contribute to binding of small molecules in branch 1 members.	1.68805e-37
NC_006274.1\|WP_000129204.1\|3328318_3329110_+\|arylamine-N-acetyltransferase	gnl\|CDD\|366312	pfam00797, Acetyltransf_2, N-acetyltransferase. Arylamine N-acetyltransferase (NAT) is a cytosolic enzyme of approximately 30kDa. It facilitates the transfer of an acetyl group from Acetyl Coenzyme A on to a wide range of arylamine, N-hydroxyarylamines and hydrazines. Acetylation of these compounds generally results in inactivation. NAT is found in many species from Mycobacteria (M. tuberculosis, M. smegmatis etc) to man. It was the first enzyme to be observed to have polymorphic activity amongst human individuals. NAT is responsible for the inactivation of Isoniazid (a drug used to treat Tuberculosis) in humans. The NAT protein has also been shown to be involved in the breakdown of folic acid.	5.26917e-48
NC_006274.1\|WP_000445387.1\|3339754_3341377_-\|FAD-dependent-monooxygenase	gnl\|CDD\|366675	pfam01494, FAD_binding_3, FAD binding domain. This domain is involved in FAD binding in a number of enzymes.	2.98526e-107
NC_006274.1\|WP_001226316.1\|3336262_3337207_-\|glycerophosphodiester-phosphodiesterase	gnl\|CDD\|176543	cd08601, GDPD_SaGlpQ_like, Glycerophosphodiester phosphodiesterase domain of Staphylococcus aureus and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in uncharacterized glycerophosphodiester phosphodiesterase (GP-GDE, EC 3.1.4.46) from Staphylococcus aureus, Bacillus subtilis and similar proteins. Members in this family show very high sequence similarity to Escherichia coli periplasmic phosphodiesterase GlpQ, which catalyzes the Ca2+-dependent degradation of periplasmic glycerophosphodiesters to produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols.	7.64821e-147
NC_006274.1\|WP_000137569.1\|3329226_3331014_+\|oligoendopeptidase-F	gnl\|CDD\|341071	cd09608, M3B_PepF, Peptidase family M3B, oligopeptidase F (PepF). Peptidase family M3B oligopeptidase F (PepF; Pz-peptidase B; EC 3.4.24.-) is mostly bacterial and includes oligoendopeptidase F from Lactococcus lactis. This enzyme hydrolyzes peptides containing between 7 and 17 amino acids with fairly broad specificity. The PepF gene is duplicated in L. lactis on the plasmid that bears it, while a shortened second copy is found in Bacillus subtilis. Most bacterial PepFs are cytoplasmic endopeptidases; however, the Bacillus amyloliquefaciens PepF oligopeptidase is a secreted protein and may facilitate the process of sporulation. Specifically, the yjbG gene encoding the homolog of the PepF1 and PepF2 oligoendopeptidases of Lactococcus lactis has been identified in Bacillus subtilis as an inhibitor of sporulation initiation when over-expressed from a multicopy plasmid. This PepF family includes Streptococcus agalactiae PepB, a group B streptococcal oligopeptidase which has been shown to degrade a variety of bioactive peptides as well as the synthetic collagen-like substrate N-(3-[2-furyl]acryloyl)-Leu-Gly- Pro-Ala in vitro.	0
NC_006274.1\|WP_001102713.1\|3345256_3346351_+\|tetratricopeptide-repeat-protein	gnl\|CDD\|376220	pfam18801, RapH_N, response regulator aspartate phosphatase H, N terminal. Rap proteins consist of a N-terminal 3-helix bundle and a tetratricopeptide domain. This entry represents the conserved region of the C-terminal bundle.	5.79035e-18
NC_006274.1\|WP_000915209.1\|3331049_3332183_-\|serine-hydrolase	gnl\|CDD\|365903	pfam00144, Beta-lactamase, Beta-lactamase. This family appears to be distantly related to pfam00905 and PF00768 D-alanyl-D-alanine carboxypeptidase.	8.31431e-59
NC_006274.1\|WP_000592007.1\|3346347_3346536_+\|Phr-family-secreted-Rap-phosphatase-inhibitor	gnl\|CDD\|275222	TIGR04429, hypothetical_protein_bmyco0001_31490, Phr family secreted Rap phosphatase inhibitor. Phr peptides are short peptides, best conserved in their amino-terminal regions, that are almost always encoded immediately downstream of a Rap phosphatase. A portion of the Phr peptide is secreted, enters another cell, and forms a quorum-sensing system by inhibiting its Rap phosphatase partner. The set of Phr peptides recognized by this N-terminal region model is disjoint from the PhrC/PhrF set recognized by pfam11131. [Regulatory functions, Protein interactions].	1.25964e-06
NC_006274.1\|WP_000275809.1\|3346609_3347209_-\|protease-synthase/sporulation-negative-transcriptional-regulator-PaiB	gnl\|CDD\|377290	pfam04299, FMN_bind_2, Putative FMN-binding domain. In Bacillus subtilis, family member PAI 2/ORF-2 was found to be essential for growth. The SUPERFAMILY database finds that this domain is related to FMN-binding domains, suggesting this protein is also FMN-binding.	1.11069e-69
NC_006274.1\|WP_001172051.1\|3347860_3348208_-\|DUF4260-domain-containing-protein	gnl\|CDD\|379455	pfam14079, DUF4260, Domain of unknown function (DUF4260). This family of integral membrane proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 114 and 126 amino acids in length. There is a conserved GLK sequence motif.	1.67181e-50
NC_006274.1\|WP_000646407.1\|3342358_3343357_+\|NADP-dependent-oxidoreductase	gnl\|CDD\|176191	cd05289, MDR_like_2, alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases. Members identified as zinc-dependent alcohol dehydrogenases and quinone oxidoreductase. QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR actin the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction.	1.08203e-149
NC_006274.1\|WP_000351712.1\|3334095_3334947_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176133	cd08442, PBP2_YofA_SoxR_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators, YofA and SoxR, contains the type 2 periplasmic binding fold. YofA is a LysR-like transcriptional regulator of cell growth in Bacillus subtillis. YofA controls cell viability and the formation of constrictions during cell division. YofaA positively regulates expression of the cell division gene ftsW, and thus is essential for cell viability during stationary-phase growth of Bacillus substilis. YofA shows significant homology to SoxR from Arthrobacter sp. TE1826. SoxR is a negative regulator for the sarcosine oxidase gene soxA. Sarcosine oxidase catalyzes the oxidative demethylation of sarcosine, which is involved in the metabolism of creatine and choline. The topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	3.06601e-88
NC_006274.1\|WP_041184862.1\|3332765_3334010_-\|MFS-transporter	gnl\|CDD\|341028	cd17475, MFS_MT3072_like, Mycobacterium tuberculosis uncharacterized MFS-type transporter MT3072 and similar transporters of the Major Facilitator Superfamily. This family includes the Mycobacterium tuberculosis uncharacterized MFS-type transporter MT3072. It belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	2.53562e-96
NC_006274.1\|WP_000164878.1\|3343535_3345002_+\|YdiU-family-protein	gnl\|CDD\|234583	PRK00029, PRK00029, YdiU family protein.	0
NC_006274.1\|WP_001095179.1\|3325881_3327783_-\|mannonate-oxidoreductase	gnl\|CDD\|234750	PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed.	7.00011e-162
NC_006274.1\|WP_000594281.1\|3341844_3342249_+\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238042	cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.	2.96467e-15
NC_006274.1\|WP_000256496.1\|3325350_3325875_-\|N-acetyltransferase	gnl\|CDD\|225695	COG3153, COG3153, Predicted acetyltransferase [General function prediction only].	6.14601e-55

>NC_006274.1|WP_001226316.1|3336262_3337207_-|glycerophosphodiester-phosphodiesterase
MRKIISVLVIFFMMGSIFAGGAVHAKAEGKHEWNTNKFLNIAHRGASGHAPEHTFASYDLVKKMKADYLELDIQLTKDGQLIAMHDTAVDRTTNGTGEVRDKTLSEIKSLDAGSWFNKAYPEKAKQEYVGQKVPTLEEIFQKYGRSMKYYIETKSPDVYPGMEEKLLALLEKYNLIGQNMSSSRVMIQSFSKDSLTKIHSMNKNIPLVQLLWYYPNENNEIVEWSGITHEPKRVTNDDFKEIKKYAVGIGPNLRNDNGELIIDESYMKMARENRLLIHPYTINEKPDMRLLMKWGATGMFTNYPDRLHSVLKEK
>NC_006274.1|WP_000549064.1|3334939_3335449_+|DUF3916-domain-containing-protein
MHKKKIRGIKRKTNAMIKHIEEHTKTFPSTFYNDEYWYMPLPVSQDFIESHKTPRKVKRLCIQTLIDRVNYLIKIKSSDTHTYRVVALISIENLWRSQIIVFKNDDYFHNFFNRNNEFQKWILLSNEIDFWETWGISICPTPQMLRFQEVIYDEDAIDEKEIWFIGELS
>NC_006274.1|WP_000351712.1|3334095_3334947_+|LysR-family-transcriptional-regulator
MDIKDLTVFYEVAKENNISHAAKNLNYVQSSVTMRMKQLENELGVPLFYRNGKGVTLTSNGEILLTYAKQIIHLMDQSIKAVQSNGTEPKGTLKIGCTESTTAVRLPSILTTYYEKYPEVELILETNTTEQLIKLVLDRKLDGAFIAGSTQHNELHSNVFHEEELVLISKKTLSSLKDIEDMNLLAFSHGCYYRSLLEDWLQEEDISPKRVLEFGTIEAILACVKSSMGVAIMMKSILKGHEHNVSFNPLPNSFKKVPTTFITRNDIFRSAALQKFMEVTHNA
>NC_006274.1|WP_041184862.1|3332765_3334010_-|MFS-transporter
MEEDGGIIVLMEERLNSTYKWVMLIVATIAQTTATLITYGVGVFALFWKEEYALTNMESGLLVSVVNVGPLFCMLFVGRLLDQYNEKILISISSFLLGSSLLLTNIVSGFNGLLFVLLLIGMFYSVSQPGGSKVILKWFPKENRGLAMGIRQAGIPIGGALAGVLIPFLTVQYNMTYAINSIACICIIGGVLFFVFYKEPYVQEEARKGHNKISFWMELKVVICKKELYPIYITGICMISLQMVLVGHFMKFLAGEQSITSIVAGTVFSVMFFSGMIGRIALAAISDVFYKGNRRIPLFIAVCASIGLILLLVMNIHTITSGVLYSISALLGFVSIGWFSLFIAEVAELASEESVGITVSVALTLNQIAIIVAPVLFGYIVDEKGYAYAWLCIVVLLSISAVSLYRKNKKIKES
>NC_006274.1|WP_000915209.1|3331049_3332183_-|serine-hydrolase
MLKKWLIVFFIFAVFSGSVVALIHASKGKKYDIKAFSNLNNKQKHDMQEVDANEKKHYEVVAGKLDQYLKDKGFNGSVLVASKDHVILQKGYGYANVKDKVFTTPRTKYRIGSITKTVVAISIMQLKEKGKLNIEDNVNKYIPSFPADKNITLRNLLTHTSGLPDQGKGRVDAASRLKLVTWIGSQALQFPAGTGWKYTDYNYMVLAYIVEKITNKPLAEYVKENIFTPVEMHESGMGATLPEDIFLAEGYTRKDNELIAAPRLKMNWLYGCGEMYTTVEDMKRLDEAIMNGKLLSKQSVLDMFTASPARKYGFSFYTYPDYYHNHGVLAGWNTFNNFNWDKRTFVILFSNVQNGMNDAFNQEFRKMANDLIEGKGA
>NC_006274.1|WP_000137569.1|3329226_3331014_+|oligoendopeptidase-F
MTELKDRLQVADKEKWNLTDIYDTIEDWESDFHKIEVLTNELYEFNGNIHDGNSLLAYLTKSEEISSIISLMFAYARLQSDLDTRDTDAQSLVDKVSQLHVKVSAAKSFFSPFLLSIDENTLQSYIEEAEGLQYYKEDLFELYRYKKHVLNKDQEEILSQMGEALSSPQHTYGMLNNADILFGEVTSNDGEKVTLTRGMYAKLIEDENREKRKEAYKAYYKPYVQLKNSIASTLSAAIKNNVTVSKLRKYPSALEKSLFGDMVPKEVYENLIETTKKNIQSLHTYNELRKEKLNVDELRQYDLSVDLVKGVKQDIPYDNAFDIMIESLAPLGEEYIETLKSFKDKRYIDVRETPGKRSGAYNFGVYGVHPFILLNHHDDLNSLFTLTHECGHGMHTHYSHGYQPRISAHYTIFVAEVASTVNEVLLIHHLLKEAKDANVRNNLVNHFIEKFKGTFFTQIMFAEFEKITHEMAQQGKPLNAQVFSEVYENLFREYNGDSLVFDEEVKYGWARIPHFYRPFYVYKYATGFASAIQIADKLLSGDPNAQKNYLEFLKGGSSDYPLNLLKKAGVDLTTPEPIESALNRFSELVEEFSTL
>NC_006274.1|WP_000129204.1|3328318_3329110_+|arylamine-N-acetyltransferase
MTDFQKQFFARLHIEEKQKVSFEDLPNIMYAMAQTVPFENLNVLEKNFKEISKENLKEKILVNNRGGLCYELNPTMYYFLKDAGFDVYLVSGTVYNAANSIWAVDSGHIATVLKHHNELYLIEVGFGSYLPLAPVPFSGEVIHSVTGDYRIRKEITEKGNYILEMRKNDEFLDQSSTDDWTLGYAFYIEEVDEEKANAAQKIIVEHEGSPFNKVPLIVKLTEDGHASLTKDSLTVTKNGAKTKETVTDVQYKNLLHSKFGITL
>NC_006274.1|WP_001095179.1|3325881_3327783_-|mannonate-oxidoreductase
MNTMTFEKLQYNELKDIVKSYCVSGLGKELINKLEPSTSIKVVRNRLNETTEARAILDAEGHVPFFGISNIASTIQKLEKGMILDPEELVSVSDFLRGCRKIKKFMLDKEFFAPVLASYANSMTEYKSIEEEINFSIKGNSIDSAASKELKRIRNNIDSVDGKIKERLTKFLNSSANKKYIQEFFISKKDDRYTIPIKSSYKNQVAGSIVEASAKGSTVFIEPHTVTKLNAELASLKAEEAMEEYQILATLSGMVVENIYHIKINMELISQYDMVFAKAKFSKSIDGIEPKLNDHGYVHLVNCKHPLLSGKVVPLNFEIGQNYRSLIITGPNAGGKTIVLKTIGLLTLATMSGLHIAGDKETEIAIFENVFVDIGDNQSIENALSTFSSHMKNLSEIMRMSNNNTLLLFDEIGSGTEPNEGAALAISILEEFYLAGCITVASTHYGEIKRFSEMHDDFMNAAMQFNSETLEPLYKLVIGKSGESNALWIANKMNVREHVLKRAKAYMGNKEYTLEKVNESKIRKPKFLQEKRENHYEYKIGDRVNLLDHDDFGIIYKEKDNFYNVVVYYNGEFIEVNVKRITLEVAAKELYPEGYDLNTLFVDYKERKMQHDIERGSKKALRNIQKEMRKNRG
>NC_006274.1|WP_000256496.1|3325350_3325875_-|N-acetyltransferase
MVTIRQERQTDYRKTEEVVQQAFLNEEFSDKKEHELVKRIRECDAFVPELSIVAVDEEIVGHIMLSKITIEQDGTSEESLALAPVSVARGHQKKGIGGKLIVAALEKAKELGYGSVVVLGHPEYYPKFGFKKASEWNIKAPFEVPEEVFMVIELTENALESVEGVVQYSSAFAE
>NC_006274.1|WP_000797131.1|3324483_3325188_-|histidine-phosphatase-family-protein
MKNRETDSNVVTLYVTRHGKTILNTNHRAQGWADSPLVEKGVEVATNLGTGLKDIHFMNAYSSDSGRAIETANLVLKYSEQSKLKLEQRKKLRELNFGIFEGEKLDNMWDAVGKAAGVASTEELMKFSIQEVIDLIRAADPTKQAEDWELFSTRIKAEIDKISEEAAKDGGGNVLVVVHGLLITTLIEMLDSSKTKLGVENASVTKIVYQDGIYTVESVGDMSYVAKGKESVEI
>NC_006274.1|WP_000417243.1|3338500_3339154_-|hypothetical-protein
MEKYHGKSTEQIIQKVMPGSVKSSVVMVWVVINFMILTPFLFPPTFTIYLYIILPFLLIANIWGVWVFFYKPNELRLVHILYNGFMGITFSFGSFIVIQKIAYTFIKIETPLFFIVTFLLYILTNYKLISIGMKSFLRRLNNEENDNIKISPIVYVSGLGYVIGQICIGTLSQNGLATVLILVFSLFAVVLSISGVYIWVYVDLKRKEMDGMHNGQI
>NC_006274.1|WP_041184863.1|3339170_3339413_-|hypothetical-protein
MGVGTTAVSAFAGAKAGALVGTFLGGPIGTAAGACIGFGVSIGASIVTDGIKGDWNHDGKQDSIKDKVKTGIGATLDKIF
>NC_006274.1|WP_000445387.1|3339754_3341377_-|FAD-dependent-monooxygenase
MESNDVPVLIVGGGLSGLASALFLAKHNIEYLLIERHPSTAIHPKAGGITFRTMELFRELGLEQRIRSAGKTLENCRGRIAVHTIAEANQEEFAQLRVTQYENDEKLLQKVKEISPSKQTACYQIILEEMMLQEAKTLGGQLSFYHELVSFEQNENGVKATIRNRETKKEGVIHCDYVIAADGAKSKIREQLGISTEGRGTIGGYYMNIYFEADLSEFIQGDAFGFSMVLHPEVLGALIPVDNERRWIYHVSYDPLKGEQPEDFTIERCKQIIQTAIGSTNVESEIVSVLPWEATESTATKFQDNRIFLVGDSAHIMPPTGGLGSNTGIQDAHNLAWKLAAVIKGKANPKLLETYHKERYPVAKLTTDYASSLLFRAANREEGSLNKMDGLAVTAGYHYSSDAIIDDDSVTPHRMDIVQLNGRPGTRAPHFIGMYEEKEVSVLDLLGNDFVLLTGAENDSWAESAHTVSAKLGVNIKVYRVGLSGDFIAQENVFSELYGLSDGGAVLIRPDAFIGWRSEKEVVNLDVVLEEVMGNLLCDF
>NC_006274.1|WP_000594281.1|3341844_3342249_+|winged-helix-turn-helix-transcriptional-regulator
MIKMNKQEQLNVIKKDFVDSQKVLLAIGDETRQAILLVLMETECQTGLRVGEITKQTHLSRPAVSHHLRILREAGIILMRKEGTKNFYYIDIRTKLSLLKNLVLDIEKLLHNFYPTLTGSKTPTSEFSESKEFR
>NC_006274.1|WP_000646407.1|3342358_3343357_+|NADP-dependent-oxidoreductase
MKAMIIDKYGKVPMRMAEVPIPEINEHEVLAEIYAASINPIDFKIRDGKVKMLLKYEMPLILGNDFAGVIIKVGSKVTRFKVGDEIYARPRKNKIGTFAEYIAIHEDDIALKPKNLSFEEAASIPLVGLTSYQALHDIMQLQKDQKILIHAGSGGVGTFAIQLAKIMGATVTTTASEAGSDLVKSLGADQIINYKTEKFEEILKDYDAVFDTIGGTTLEKSFDIIKSGGSIVSVSGMPNARFGKEFGSGFFKTFLFSLASKKLTALEKKHNAQYSFLFMKPSGDQLRIIANYIEAGKIKPVIDRVFPFEDAQKAMEYSEAGRAKGKIIVKMK
>NC_006274.1|WP_000164878.1|3343535_3345002_+|YdiU-family-protein
MTKNNEAGWNLDHSYTTLPQSFYTEIPPTPVSSPELVKLNHSLAISLGFHPEELKKEAEIAIFAGNALPEGAHPLAQAYAGHQFGHFNMLGDGRALLIGEQITPSGKRFDIQLKGSGPTPYSRRGDGRAALGPMLREYIISEAMYALDIPTTRSLAVVTTGEPTYRETKLPGAILTRVASSHIRVGTFQYAAARGSIEDLQSLADYTIKRHYPEIEAHENRYTALLQEVIKKQASLIAKWQLVGFIHGVMNTDNITISGETIDYGPCAFMDNYDQGTVFSSIDTQGRYAYGNQPYMAAWDLARLAESLIPILHEDEEEALKIAQDEISKFSVQYENQWFLGMKKKLGLFSNEEQDQSLIEQLLKMMEKFKADYTNTFRSLTLNTIENTALFESPEFKEWYKLWQSRLERQEESKENAYEMMKNNNPSIIPRNHRVEEALEAAVTSGDYSVMEKLLEALSNPYAYSADQEDYCAPPAPTNRPYRTFCGT
>NC_006274.1|WP_001102713.1|3345256_3346351_+|tetratricopeptide-repeat-protein
MNVQLQGNEQITKLFNDWYLAMLKQDVSQATNLKHEIEEKELNFEEDENLALYYSLLDFRFKVLTDGLSITKDSFNKIDSYAISPNHQLSYYYHLFKAIHATLTTNYNLAGEHYEKAERLLVNTTDDLEKGEFNYRMAIFYYHFYQPIEAIEYATKAKEFFIKAVGYEKNVASCESVLGAAFVYLKQYEQAEEKYNSAINILQKQGEESLLLRVRNNLGWLYANQNLSTLAIRHLSEVTTKMPTHFKAIFLQAREHSKLGEINIASEFIKKGLKICTELNNEEYMLHFKILESLNNNESTEDLEKIILEGITYFDKESLYNYTQEYSEKLAIKLYDENNHIKASEYFHKALQAKEKTFEKGALK
>NC_006274.1|WP_000592007.1|3346347_3346536_+|Phr-family-secreted-Rap-phosphatase-inhibitor
MIKKISSIVLGFSVLGIVSIGLNSSFTYQAGHADFPAPQRPDLVQSVDVSKDYNSTTTEKAL
>NC_006274.1|WP_000275809.1|3346609_3347209_-|protease-synthase/sporulation-negative-transcriptional-regulator-PaiB
MYIPKYFAIQDEKMKYEIMEQNSFATLFSQHNGEPYATHLPLLPNRETLTLHGHFARPNEQWKDIGTQQVLAIFQGPHSYISPSWYETKNAVPTWNYVAVHVYGELELVEDEQELIDSLQDLVDTYEDPQSTYSLNDVDPNYMEGLSKGIVGFKIKISKIEGKAKLSQNHSVERRKLVVGELEKVGSEGSKRIAELMRK
>NC_006274.1|WP_001172051.1|3347860_3348208_-|DUF4260-domain-containing-protein
MQKRIVHFEGLVVFVATIYIYSLYEFSWIIFLIFLLAPDLSMLAYGINNHIGANIYNLFHTYIISILIVIIGVYFKVDTVIMIGLIWTAHIGMDRMFGYGLKYETDFKDTHIQRL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_006274_5

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_006274_5

3594418-3595065

Orphan

Consensus_repeat	Method
NGCNACTGGACCTCAAGG	CRT

15 spacers

The CRISPR arrays of NC_006274_5

>merge|NC_006274|5|3594418-3595065|CRT
CGCCACTGGACCTCAAGGTGCTCAAGGTAACACAGGTGCTACTGGTGCCACTGGACCTCAAGGTGCTCAAGGTAACACAGGTGCTACTGGTGCCACTGGACCTCAAGGTGCTCAAGGTAACACAGGTGCTACTGGTGCCACTGGACCTCAAGGTGCTCAAGGTAACACAGGTGCTACTGGTGCCACTGGACCTCAAGGTGTTCAAGGTAACACGGGCGCTACTGGTGCCACTGGACCTCAAGGTGCTCAAGGTAACACAGGTGCTACTGGTGCCACTGGACCTCAAGGCGCTCAAGGTAACACAGGTGCTACTGGACCTCAGGGTGCTCAAGGTAACACGGGCGCTACTGGACCTCAGGGTGTTCAAGGTAACACGGGCGCTACTGGTGCCACTGGACCTCAAGGTGCTCAAGGTAACACAGGTGCTACTGGTGCCACTGGACCTCAGGGTGCTCAAGGTAACACGGGCGCTACTGGACCTCAAGGCGCTCAAGGACCAGCGGGTGTTACTGGCGCTACTGGACCTCAAGGTGCTCAAGGTAACACGGGTGCTACTGGACCTCAAGGCGCTCAAGGACCAGCGGGTGCTACTGGCGCTACTGGACCTCAAGGTGCTCAAGGTAACACAGGTGCTACTGGACCTCAGGG

>NC_006274|5|2|3594418-3595065|CRT
CGCCACTGGACCTCAAGG	TGCTCAAGGTAACACAGGTGCTACTGG
TGCCACTGGACCTCAAGG	TGCTCAAGGTAACACAGGTGCTACTGG
TGCCACTGGACCTCAAGG	TGCTCAAGGTAACACAGGTGCTACTGG
TGCCACTGGACCTCAAGG	TGCTCAAGGTAACACAGGTGCTACTGG
TGCCACTGGACCTCAAGG	TGTTCAAGGTAACACGGGCGCTACTGG
TGCCACTGGACCTCAAGG	TGCTCAAGGTAACACAGGTGCTACTGG
TGCCACTGGACCTCAAGG	CGCTCAAGGTAACACAGG
TGCTACTGGACCTCAGGG	TGCTCAAGGTAACACGGG
CGCTACTGGACCTCAGGG	TGTTCAAGGTAACACGGGCGCTACTGG
TGCCACTGGACCTCAAGG	TGCTCAAGGTAACACAGGTGCTACTGG
TGCCACTGGACCTCAGGG	TGCTCAAGGTAACACGGG
CGCTACTGGACCTCAAGG	CGCTCAAGGACCAGCGGGTGTTACTGG
CGCTACTGGACCTCAAGG	TGCTCAAGGTAACACGGG
TGCTACTGGACCTCAAGG	CGCTCAAGGACCAGCGGGTGCTACTGG
CGCTACTGGACCTCAAGG	TGCTCAAGGTAACACAGG
TGCTACTGGACCTCAGGG

Protein	Signature genes	Signature genes Name	Protein_function
NC_006274.1\|WP_000312262.1\|3590866_3591490_+\|trimeric-intracellular-cation-channel-family-protein	unknown	unknown	gnl\|CDD\|225415
NC_006274.1\|WP_000228315.1\|3605601_3606144_-\|DUF420-domain-containing-protein	unknown	unknown	gnl\|CDD\|225204
NC_006274.1\|WP_000704553.1\|3600628_3602488_-\|PTS-sugar-transporter-subunit-IIA	unknown	unknown	gnl\|CDD\|236740
NC_006274.1\|WP_000957268.1\|3603410_3604163_-\|DeoR/GlpR-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224268
NC_006274.1\|WP_000135915.1\|3585028_3586174_+\|site-specific-integrase	unknown	unknown	gnl\|CDD\|271189
NC_006274.1\|WP_000460301.1\|3588235_3589507_-\|methionine-gamma-lyase-family-protein	unknown	unknown	gnl\|CDD\|311036
NC_006274.1\|WP_000734636.1\|3599344_3600280_-\|3D-domain-containing-protein	unknown	unknown	gnl\|CDD\|226112
NC_006274.1\|WP_000450308.1\|3592829_3593795_+\|tyrosine-type-recombinase/integrase	unknown	unknown	gnl\|CDD\|227308
NC_006274.1\|WP_000656783.1\|3587671_3588061_-\|transcriptional-repressor-GlnR	unknown	unknown	gnl\|CDD\|133380
NC_006274.1\|WP_001179108.1\|3604321_3605485_-\|iron-containing-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|341466
NC_006274.1\|WP_000504940.1\|3597901_3598855_-\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	unknown	unknown	gnl\|CDD\|234626
NC_006274.1\|WP_000135328.1\|3586288_3587623_-\|type-I-glutamate--ammonia-ligase	unknown	unknown	gnl\|CDD\|273198
NC_006274.1\|WP_000640769.1\|3602502_3603414_-\|1-phosphofructokinase	unknown	unknown	gnl\|CDD\|238570
NC_006274.1\|WP_000813784.1\|3599036_3599282_+\|hypothetical-protein	unknown	unknown	unknown
NC_006274.1\|WP_000582644.1\|3584819_3584987_+\|hypothetical-protein	unknown	unknown	unknown
NC_006274.1\|WP_000673782.1\|3584375_3584804_+\|ImmA/IrrE-family-metallo-endopeptidase	unknown	unknown	gnl\|CDD\|225412
NC_006274.1\|WP_000391387.1\|3589499_3590774_-\|GTPase-HflX	unknown	unknown	gnl\|CDD\|274455
NC_006274.1\|WP_140420305.1\|3606460_3606799_-\|hypothetical-protein	unknown	unknown	unknown
NC_006274.1\|WP_000813896.1\|3597655_3597880_-\|RNA-chaperone-Hfq	unknown	unknown	gnl\|CDD\|179001
NC_006274.1\|WP_000438184.1\|3591759_3592716_-\|stage-V-sporulation-protein-K	unknown	unknown	gnl\|CDD\|163057

Protein	Function_ID	Function_description	E-value
NC_006274.1\|WP_000312262.1\|3590866_3591490_+\|trimeric-intracellular-cation-channel-family-protein	gnl\|CDD\|225415	COG2860, COG2860, Predicted membrane protein [Function unknown].	1.16693e-59
NC_006274.1\|WP_000957268.1\|3603410_3604163_-\|DeoR/GlpR-transcriptional-regulator	gnl\|CDD\|224268	COG1349, GlpR, Transcriptional regulators of sugar metabolism [Transcription / Carbohydrate transport and metabolism].	8.90772e-82
NC_006274.1\|WP_000135915.1\|3585028_3586174_+\|site-specific-integrase	gnl\|CDD\|271189	cd01189, INT_ICEBs1_C_like, C-terminal catalytic domain of integrases from bacterial phages and conjugate transposons. This family of tyrosine based site-specific integrases is has origins in bacterial phages and conjugate transposons. One member is the integrase from Bacillus subtilis conjugative transposon ICEBs1. ICEBs1 can be excised and transfered to various recipients in response to DNA damage or high concentrations of potential mating partners. The family belongs to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	4.07286e-46
NC_006274.1\|WP_000460301.1\|3588235_3589507_-\|methionine-gamma-lyase-family-protein	gnl\|CDD\|311036	pfam06838, Met_gamma_lyase, Methionine gamma-lyase. This is a putative pyridoxal 5'-phosphate-dependent methionine gamma-lyase enzyme involved in methionine catabolism.	0
NC_006274.1\|WP_000734636.1\|3599344_3600280_-\|3D-domain-containing-protein	gnl\|CDD\|226112	COG3584, COG3584, Uncharacterized protein conserved in bacteria [Function unknown].	3.58981e-36
NC_006274.1\|WP_000450308.1\|3592829_3593795_+\|tyrosine-type-recombinase/integrase	gnl\|CDD\|227308	COG4974, XerD, Site-specific recombinase XerD [DNA replication, recombination, and repair].	8.96506e-13
NC_006274.1\|WP_000656783.1\|3587671_3588061_-\|transcriptional-repressor-GlnR	gnl\|CDD\|133380	cd01105, HTH_GlnR-like, Helix-Turn-Helix DNA binding domain of GlnR-like transcription regulators. Helix-turn-helix (HTH) transcription regulator GlnR and related proteins, N-terminal domain. The GlnR and TnrA (also known as ScgR) proteins have been shown to regulate expression of glutamine synthetase as well as several genes involved in nitrogen metabolism. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules.	1.14369e-23
NC_006274.1\|WP_001179108.1\|3604321_3605485_-\|iron-containing-alcohol-dehydrogenase	gnl\|CDD\|341466	cd08187, BDH, Butanol dehydrogenase catalyzes the conversion of butyraldehyde to butanol with the cofactor NAD(P)H being oxidized in the process. The butanol dehydrogenase (BDH) is involved in the final step of the butanol formation pathway in anaerobic micro-organism. Butanol dehydrogenase catalyzes the conversion of butyraldehyde to butanol with the cofactor NAD(P)H being oxidized in the process. Activity in the reverse direction is 50-fold lower than that in the forward direction. The NADH-BDH has higher activity with longer chained aldehydes and is inhibited by metabolites containing an adenine moiety. This protein family belongs to the so-called iron-containing alcohol dehydrogenase superfamily. Since members of this superfamily use different divalent ions, preferentially iron or zinc, it has been suggested to be renamed to family III metal-dependent polyol dehydrogenases. This family also includes E. coli YqhD enzyme, an NADP-dependent dehydrogenase whose activity measurements with several alcohols demonstrate preference for alcohols longer than C3. The active site of YqhD contains a Zn metal, and a modified NADPH cofactor bearing OH groups on the saturated C5 and C6 atoms, possibly due to oxygen stress on the enzyme, which would functionally work under anaerobic conditions.	0
NC_006274.1\|WP_000228315.1\|3605601_3606144_-\|DUF420-domain-containing-protein	gnl\|CDD\|225204	COG2322, COG2322, Predicted membrane protein [Function unknown].	9.14687e-57
NC_006274.1\|WP_000135328.1\|3586288_3587623_-\|type-I-glutamate--ammonia-ligase	gnl\|CDD\|273198	TIGR00653, Glutamine_synthetase, glutamine synthetase, type I. Alternate name: glutamate--ammonia ligase. This model represents the dodecameric form, which can be subdivided into 1-alpha and 1-beta forms. The phylogeny of the 1-alpha and 1-beta forms appears polyphyletic. E. coli, Synechocystis PCC6803, Aquifex aeolicus, and the crenarcheon Sulfolobus acidocaldarius have form 1-beta, while Bacillus subtilis, Thermotoga maritima, and various euryarchaea has form 1-alpha. The 1-beta dodecamer from the crenarcheon Sulfolobus acidocaldarius differs from that in E. coli in that it is not regulated by adenylylation. [Amino acid biosynthesis, Glutamate family].	0
NC_006274.1\|WP_000640769.1\|3602502_3603414_-\|1-phosphofructokinase	gnl\|CDD\|238570	cd01164, FruK_PfkB_like, 1-phosphofructokinase (FruK), minor 6-phosphofructokinase (pfkB) and related sugar kinases. FruK plays an important role in the predominant pathway for fructose utilisation.This group also contains tagatose-6-phophate kinase, an enzyme of the tagatose 6-phosphate pathway, which responsible for breakdown of the galactose moiety during lactose metabolism by bacteria such as L. lactis.	3.93937e-142
NC_006274.1\|WP_000704553.1\|3600628_3602488_-\|PTS-sugar-transporter-subunit-IIA	gnl\|CDD\|236740	PRK10712, PRK10712, PTS system fructose-specific transporter subunits IIBC; Provisional.	3.0915e-143
NC_006274.1\|WP_000504940.1\|3597901_3598855_-\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	gnl\|CDD\|234626	PRK00091, miaA, tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed.	5.63434e-166
NC_006274.1\|WP_000673782.1\|3584375_3584804_+\|ImmA/IrrE-family-metallo-endopeptidase	gnl\|CDD\|225412	COG2856, COG2856, Predicted Zn peptidase [Amino acid transport and metabolism].	7.03454e-22
NC_006274.1\|WP_000391387.1\|3589499_3590774_-\|GTPase-HflX	gnl\|CDD\|274455	TIGR03156, GTP_HflX, GTP-binding protein HflX. This protein family is one of a number of homologous small, well-conserved GTP-binding proteins with pleiotropic effects. Bacterial members are designated HflX, following the naming convention in Escherichia coli where HflX is encoded immediately downstream of the RNA chaperone Hfq, and immediately upstream of HflKC, a membrane-associated protease pair with an important housekeeping function. Over large numbers of other bacterial genomes, the pairing with hfq is more significant than with hflK and hlfC. The gene from Homo sapiens in this family has been named PGPL (pseudoautosomal GTP-binding protein-like). [Unknown function, General].	0
NC_006274.1\|WP_000813896.1\|3597655_3597880_-\|RNA-chaperone-Hfq	gnl\|CDD\|179001	PRK00395, hfq, RNA-binding protein Hfq; Provisional.	3.4363e-41
NC_006274.1\|WP_000438184.1\|3591759_3592716_-\|stage-V-sporulation-protein-K	gnl\|CDD\|163057	TIGR02881, Stage_V_sporulation_protein_K, stage V sporulation protein K. Members of this protein family are the stage V sporulation protein K (SpoVK), a close homolog of the Rubisco expression protein CbbX (TIGR02880) and a members of the ATPase family associated with various cellular activities (pfam00004). Members are strictly limited to bacterial endospore-forming species, but are not universal in this group and are missing from the Clostridium group. [Cellular processes, Sporulation and germination].	9.21003e-156

>NC_006274.1|WP_000450308.1|3592829_3593795_+|tyrosine-type-recombinase/integrase
METTEFHDTIQAFSIFLLNKGRKPSTIKRYVYDIEDFGHWLEKNKKLPSSNIWATLCTKDYEDYFSDLKKNRHYSEKTMHRVFIVLNRMHHFLNIPNPLKNMEISIQPDRTLRNEDFISSDEEKRLKHIVTSLEGLSEKQRPVRPLLMDRNIAILNLLIDYGLSLQELTALTMHHVHFETNTLSIPATAGVERTISLTNEDKKQLYTYYKSIPEPVRPKYHSNDPLFVAFDFNRGTYRWVYENDAPKGLTEIAIQKMIRLEVSRANLRKGISGQHFRNTYILNLIKKETPESEIIKLAGFKSKISLKRYYQYAENGKNALS
>NC_006274.1|WP_000438184.1|3591759_3592716_-|stage-V-sporulation-protein-K
MEQSMRKKNNNQINIVLNHRKKISLPAAENKTVISSETTTKHEMLQRIEEEMGKLVGMDDIKKIIKEIYAWIYVNKKRQEIGLKSEKQVLHMLFKGNPGTGKTTVARMIGKLLFEMNILSKGHLVEAERADLVGEYIGHTAQKTRDLIKKAMGGILFIDEAYSLARGGEKDFGKEAIDTLVKHMEDKQHGFVLILAGYSREMNHFLSLNPGLQSRFPFIIEFADYSVNQLLEIGKRMYEEREYQLSKEAEWKFRDHLHAVKYSSQITSFSNGRYVRNIVEKSIRTQAMRLLQEDAYDKYDLIGISSSDLMLEEETHST
>NC_006274.1|WP_000312262.1|3590866_3591490_+|trimeric-intracellular-cation-channel-family-protein
MAWEIFSIIGTIAFALSGAIVAMEEDYDIFGVYILGMATAFGGGALRNLLIGYPIVAFWQQDMLFQIALLSMTIIFLFPNKLIKHWKKWENITDAIGLSAFAVQGALYAQKLNLPISATIVAAVLTGIGGGIIRDLLARRKPLVLRADVYAFWTILAGFLIGAQIIVSDWALYTLFILIVCFRMVSIHYKWHLPHRRIDTNERSMHK
>NC_006274.1|WP_000391387.1|3589499_3590774_-|GTPase-HflX
MEEKEKVILVGCQLPQDDDEKFMHSMKELASLAKTARAELLVSTTQKRPKFHPATYIGKGKLEELTMLTEELEPDVIVFNNELTLSQIRNLSSVLDARVIDRTQLILDIFAQRAKSREGKLQVELAQLQYTMPRLMGQGLSLSRLGGGIGTRGPGETKLETDRRHIRSRVDEIKKQLAVVVEHRKRYRERRKDNKVFQVSLIGYTNAGKSTLFNRLTEADTFEENLLFATLDPTTRKMPLPSGYTVLLTDTVGFIQDLPTSLIAAFRSTLEEAGEADVILHVVDAADPNYVGHEKTVKQLLSELEINHIPIITLYNKKDELHQNFIPFPKNDFLMTSAFEEKDLLHIKEAIETKMKEEMNRYQVEIPPSEGKLLTLLKTETLLTKMEFLEDKFVYDCAGYIFAHSSLNVQLKRFLVEEGENKNV
>NC_006274.1|WP_000460301.1|3588235_3589507_-|methionine-gamma-lyase-family-protein
MFDRLKNGEKIAPIVKEVESQITEVHKRADEVIESNQFRVLESFRKHKISDSHFIPTTGYGYDDIGRDTLEKVYADVFGAEAGLVRPQIISGTHAISTALFGILRPGDELLYITGKPYDTLEEIVGVRGKGVGSFKEYNIGYNAVPLTEEGLVDLGAVAAAIHSNTKMIGIQRSKGYATRPSFTISQIKEMIAFVKEIKPDVVVFVDNCYGEFIEEQEPCHVGADLMAGSLIKNPGGGIVKTGGYIVGKEQYVEACAYRLTSPGIGAEAGASLYSLQEMYQGFFLAPHVAGQALKGAIFTAAFLEKLGMNTSPAWNAPRTDLIQSVQFDDKDRMIAFCQAIQYASPVNSHFTPYANYMPGYEDDVIMAAGTFIQGASIELSADGPIRPPYVAYVQGGLTYSHVKIAICSAIDALIEKELLTIS
>NC_006274.1|WP_000656783.1|3587671_3588061_-|transcriptional-repressor-GlnR
MKEDRRSAPLFPIGIVMDLTQLSARQIRYYEEHNLVSPTRTKGNRRLFSFNDVDKLLEIKDLLDQGLNMAGIKQVLLMKENQTEAVKVKEETKEISKTELRKILRDELQHTGRFNRTSLRQGDISRFFH
>NC_006274.1|WP_000135328.1|3586288_3587623_-|type-I-glutamate--ammonia-ligase
MARYTKEDIFRLAKEENVKYIRLQFTDLLGVIKNVEIPVSQLTKALDNKMMFDGSSIEGFVRIEESDMYLYPDLDTWVIFPWTAEKGKVARLICDIYNADGTPFEGDPRNNLKRVLKEMEALGFSDFNLGPEPEFFLFKVDEKGNPTLELNDNGGYFDLAPMDLGENCRRDIVLELEEMGFEIEASHHEVAPGQHEIDFKYANAIRSCDDIQTFKLVVKTIARKHGLHATFMPKPLYGVNGSGMHCNLSLFKNGENVFFDQNGDLQLSDDARHFIAGILKHAPAFTAVANPTVNSYKRLVPGYEAPCYVAWSAQNRSPLVRIPASRGISTRVEVRSVDPAANPYLVMATLLAAGLDGIKNKLTPPAAVDRNIYVMTKEEREEAGIVDLPATLAQALVTLQSNEVISNALGDHLLEHFIEAKEIEWDIFRTQVHQWERDQYMSLY
>NC_006274.1|WP_000135915.1|3585028_3586174_+|site-specific-integrase
MASFRKFGDVWEFRVRFKDPYTQKYKEKSKRGFKTKKEAQLAAAEEEKKLLNGLEVEITPTSLKHYLRDWLKLFKQDNVRKNTFILHERNIEKHIIPYFQNMNIKELKPMMYQKFINSLTDQGYSKRTVQIIHGTMNNAMKKAVSLKKIENNPCEEVVISNKNNKEREGLKYMRSEDIPLFLKTSYQYNYIYYIFFKALLNTGMRKGEAAALQWKDINLKEHTITISKTLDFTAKTKEELFGDTKTFTSKRTIMIPKSLVDELLAHKKWQNANKLVLQDAYEHELDLVFSRVDGKFLPKSTLFNAFSRILKKANLPRLEIHSLRHTHAVLLLESGASMKYIQDRLGHKSIEITSNVYSHISDKINKDSISGFEAYMNNVLG
>NC_006274.1|WP_000582644.1|3584819_3584987_+|hypothetical-protein
MIIDLNAEREKRKKRTIKQEEFKKVPIVEKIHIVDGEIKYEVSGYKETPVKWLDE
>NC_006274.1|WP_000673782.1|3584375_3584804_+|ImmA/IrrE-family-metallo-endopeptidase
MKFVIRDLVQQLCTKYNTTNPYELADYLKINVLTWDLHEEINGFYKYEKRNRFIVINNHLSPSMQRTVCAHELGHAILHTHANTPFLRKNTFFSVDKLEIEANTFAALLLIDKKTIQPGDTKACIAYKNDIPVELLEFYKPY
>NC_006274.1|WP_000813896.1|3597655_3597880_-|RNA-chaperone-Hfq
MKQSINIQDQFLNQLRKENTFVTLYLLNGFQLRGLIKGFDNFTVLLETEGKQQLIYKHAISTFVPQKNVSIELE
>NC_006274.1|WP_000504940.1|3597901_3598855_-|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA
MGEVQREKVAVIIGPTAVGKTKLSIDLAKALNGEIISGDSMQIYRTMDIGTAKVTKEEMDGIPHYMVDIKNPEESFSVAEFQERVRKHIREITERGKLPIIVGGTGLYIQSVLFDYQFTDDAGDAIYREQMEKLALERGVEYVHKKLQEVDPESAERIHANNVRRVIRALEIFHTSGEKMSDQLEKQENELLYDVSLIGLTMDREMLYDRINLRVDIMMDQGLLEEVEGLYNRGIRDCQSIQAIGYKEIYDYFEDRVSLEEAVSQLKTNSRRYAKRQLTWFRNKMDVTWFDVTDGEKTSEILRYIEGKLQLKSNNSK
>NC_006274.1|WP_000813784.1|3599036_3599282_+|hypothetical-protein
MKQSAINFSSLTKDLILATATKEQNCSQEELYFALNCLLRSFHSTLQETTLHPENKNTEYIQNQFCSAYKIITGKTIYPFQ
>NC_006274.1|WP_000734636.1|3599344_3600280_-|3D-domain-containing-protein
MKKLLGIATAAVFGLGIFAGSAQAETIVTTDVLNVRENPTVESKLVGKMLSGNKLDVINTENGWTKIKVNGKEAFVSAEFTKSTYYVTAGVLNVRAGANTDSEILGKLNKDDVIETTNQVQNEWLQFDYNGKVGYVHVPFLTGTAPVVEKKEVVTQEEVPVRVNAPVKNNKVVKNKESVKNVESSKPVAKAKPAVQQQVAKSKGTSTPAGGREITVEATAYTADPSENGSYGGRVLTAMGHDLTANPNMKVIAVDPKVIPLGSKVWVEGYGEAIAGDTGGAIKGNRIDVLVGSDGSANSWGRKSVKVKVIE
>NC_006274.1|WP_000704553.1|3600628_3602488_-|PTS-sugar-transporter-subunit-IIA
MKITDLLKRDTVIMNLTASNKEAVIDELVEKLNGANRLNSKVEFKEAILKRESQSTTGIGEGIAIPHAKTKAVKQPAICFGRSVSGINYESLDGQPAHLFFMIAASEGANNTHLETLSRLSTLLMDEGFRKQLLEAKDEEELLRLFDEKENEKEETDIEVAKPEGNEPYVLAVTACPTGIAHTYMAADSLKAKAAELGIVIKVETNGSTGIKNGLTKEDIERATAIIVAADKQVEMNRFAGKHVIQVPVADGIRKTEKLLNRAVKQDAPIFKGVKEDGKAENTEKENGLGIYKHLMNGVSNMLPFVVGGGILIALAFSFGGIKAEGPLAELFMSIGGGGTGAFLFLVPILAGFIASSIADRPGFMPGVVGGFLAAHANAGFLGGLIAGFLAGYVVLGLKRLFSGLPVQLEGIKPVLLYPVFGLLITGVVMQKVVIPPVVALNEMLTGWLNGLNGTNAILLGLILGAMMAIDMGGPINKAAFTFGIAAIEAQNFGVHSAVMAGGMVPPLAIALATTFFKSKFTEAERKSGLTNYIMGASFITEGAIPFAAADPVRVIVSCVVGSSIAGALSMLFQITLPAPHGGLFVIALVNKPVLYIFSILIGAVVSALMMGIWKKKVK
>NC_006274.1|WP_000640769.1|3602502_3603414_-|1-phosphofructokinase
MIYTVTLNPSIDYIVQVNSLELGAVNRAEKDMKFPGGKGINVSRVLHRLGVKNVALGFTGGFTGRFIKDVLQTEGVITNFIQVNEDTRINVKIKGEEETELNGQGPSVTNEQFEQLMKQIESMQKGDCVVLAGSVPASIPTTFYESIAAFGAEKGIRVVVDASGSALQHVVKNKPFLIKPNHHELGELFGVEISTAEDILPYGRKLIEQGVEHVIVSMAGDGALLFTTEGIYEATVPKGVVINSVGAGDSLVAGFVGKYEQTKDIEKAFQYGVATGSATAFSADLCEKEKVEELLSQVIVTKR
>NC_006274.1|WP_000957268.1|3603410_3604163_-|DeoR/GlpR-transcriptional-regulator
MLTPERHQMILQLVKEQKVVKLQQLVERTASSESTIRRDLAQLEKQRLLKRVHGGAAVLTGKGQEPTMVEKSSKNIQIKQQIAKYAASVVEQGDCIYLDAGSTTFEMIPFLINKDVTVVTNGLMHIEALVENNIRAYLLGGMMKSRTKALIGAMAQESMQKYRFDKCFLGANGVHEQLGFTTPDPEEALLKQMALTLANEGYFLIDESKFSEVAFAKIANVEEANIITNHLEIDLEKYKRQTNVIEADKQ
>NC_006274.1|WP_001179108.1|3604321_3605485_-|iron-containing-alcohol-dehydrogenase
MQNFVFRNPTKLIFGKGQLEQLKTEIPQFGKKVLLVYGGGSIKRNGIYDNVISILKEINAEVFELTGVEPNPRVSTVKKGIQICKENGVEFILAVGGGSVIDCTKAIAAGSKYDGDVWDIVTKKTFASEALPFGTVLTLAATGSEMNAGSVITNWETNEKYGWGSPVTFPQFSILDPAHTASVPKDQTIYGMVDIMSHVLEQYFHHGTNTELQDRYCESVLKTVIETAPKLLSDLENYEHRETILYCGTMALNGILAMGVKGDWATHNIEHAVSAVHDIPHGGGLAILFPNWMKHVVDENVSRFKQFAIRVFDVETDGKTDREIALEGIEALRQFWTSIEAPVTLDDYTIGENEIDLMADKAMANGEFGNFKKLNKDDVLSIYKASL
>NC_006274.1|WP_000228315.1|3605601_3606144_-|DUF420-domain-containing-protein
MVDQSTNQKSYAPIVITLSVIVNAIILFLFFGPVGYEGEVHFDVTILPMLNAIFNSFTFVFLLAALFSIIKKNVKMHRGFILAAFTTTLLFCVSYLSYHYLAPATHFGGEGFIKYVYFIILITHIILAAIIVPLALFALVFGFTNQLTRHRKIVRWTMPIWLYVSLSGVIVYLMISPYYQ
>NC_006274.1|WP_140420305.1|3606460_3606799_-|hypothetical-protein
MIKKEGGMTMEEYVLELYNLLYTTEWQDIVSFLGIVFCMKIVIVYMEEQGMFYSFSSPFDMQREPLLNYAKVNYEQFPFVVFFMIRFITAIVKKKESDDEECHSTCNVANVF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_006274_6

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_006274_6

4811501-4811626

Orphan

Consensus_repeat	Method
CTTAAACAAACGTTTGATTAACTCACTATTTTTCTTTGTTCACCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_006274_6

>merge|NC_006274|6|4811501-4811626|CRISPRCasFinder
CTTAAACAAACGTTTGATTAACTCACTATTTTTCTTTGTTCACCCTTGAGCTGCAACAATTTCTCCCTACCGAACATATCCCTTAAACAAACGTTTGATTAACTCACTATTTTTCTTTGTTCACCC

>NC_006274|6|4|4811501-4811626|CRISPRCasFinder
CTTAAACAAACGTTTGATTAACTCACTATTTTTCTTTGTTCACCC	TTGAGCTGCAACAATTTCTCCCTACCGAACATATCC
CTTAAACAAACGTTTGATTAACTCACTATTTTTCTTTGTTCACCC

Protein	Signature genes	Signature genes Name	Protein_function
NC_006274.1\|WP_001180555.1\|4817094_4817280_-\|hypothetical-protein	unknown	unknown	unknown
NC_006274.1\|WP_000735108.1\|4806043_4806856_-\|MetQ/NlpA-family-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|224381
NC_006274.1\|WP_000026899.1\|4810503_4810887_-\|glycine-cleavage-system-protein-GcvH	unknown	unknown	gnl\|CDD\|234918
NC_006274.1\|WP_000475825.1\|4812528_4812768_-\|DUF3937-family-protein	unknown	unknown	gnl\|CDD\|372461
NC_006274.1\|WP_001224771.1\|4812039_4812411_-\|hypothetical-protein	unknown	unknown	unknown
NC_006274.1\|WP_001982629.1\|4809473_4809782_-\|thioredoxin-family-protein	unknown	unknown	gnl\|CDD\|239245
NC_006274.1\|WP_000713748.1\|4813895_4814543_+\|phosphatase-PAP2-family-protein	unknown	unknown	gnl\|CDD\|239481
NC_006274.1\|WP_000218967.1\|4810928_4811294_-\|arsenate-reductase-family-protein	unknown	unknown	gnl\|CDD\|239334
NC_006274.1\|WP_000048031.1\|4817426_4818140_-\|CPBP-family-intramembrane-metalloprotease	unknown	unknown	gnl\|CDD\|376806
NC_006274.1\|WP_000640869.1\|4809785_4810130_-\|DNA-primase	unknown	unknown	gnl\|CDD\|224572
NC_006274.1\|WP_000359553.1\|4806879_4807545_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224922
NC_006274.1\|WP_000826901.1\|4813224_4813752_-\|hypothetical-protein	unknown	unknown	unknown
NC_006274.1\|WP_000601759.1\|4807537_4808563_-\|methionine-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224058
NC_006274.1\|WP_000666185.1\|4814600_4815614_-\|PTS-sugar-transporter-subunit-IIC	unknown	unknown	gnl\|CDD\|379113
NC_006274.1\|WP_000781212.1\|4808974_4809319_-\|hypothetical-protein	unknown	unknown	unknown
NC_006274.1\|WP_000722412.1\|4805164_4805971_-\|MetQ/NlpA-family-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|224381
NC_006274.1\|WP_001002987.1\|4816832_4817081_-\|spore-coat-protein	unknown	unknown	gnl\|CDD\|377935
NC_006274.1\|WP_000929160.1\|4804140_4804926_-\|Fe-S-cluster-assembly-ATPase-SufC	unknown	unknown	gnl\|CDD\|223473
NC_006274.1\|WP_000029288.1\|4818559_4818847_-\|DUF2178-domain-containing-protein	unknown	unknown	unknown
NC_006274.1\|WP_001998539.1\|4815636_4816671_-\|L-lactate-dehydrogenase	unknown	unknown	gnl\|CDD\|133427

Protein	Function_ID	Function_description	E-value
NC_006274.1\|WP_000929160.1\|4804140_4804926_-\|Fe-S-cluster-assembly-ATPase-SufC	gnl\|CDD\|223473	COG0396, sufC, Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones].	8.75164e-150
NC_006274.1\|WP_000475825.1\|4812528_4812768_-\|DUF3937-family-protein	gnl\|CDD\|372461	pfam13073, DUF3937, Protein of unknown function (DUF3937). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 80 amino acids in length.	1.67302e-27
NC_006274.1\|WP_001982629.1\|4809473_4809782_-\|thioredoxin-family-protein	gnl\|CDD\|239245	cd02947, TRX_family, TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains. Group I TRX is a small ancient protein that alter the redox state of target proteins via the reversible oxidation of an active site dithiol, present in a CXXC motif, partially exposed at the protein's surface. TRX reduces protein disulfide bonds, resulting in a disulfide bond at its active site. Oxidized TRX is converted to the active form by TRX reductase, using reducing equivalents derived from either NADPH or ferredoxins. By altering their redox state, TRX regulates the functions of at least 30 target proteins, some of which are enzymes and transcription factors. It also plays an important role in the defense against oxidative stress by directly reducing hydrogen peroxide and certain radicals, and by serving as a reductant for peroxiredoxins. At least two major types of functional TRXs have been reported in most organisms; in eukaryotes, they are located in the cytoplasm and the mitochondria. Higher plants contain more types (at least 20 TRX genes have been detected in the genome of Arabidopsis thaliana), two of which (types f amd m) are located in the same compartment, the chloroplast. Also included in the alignment are TRX-like domains which show sequence homology to TRX but do not contain the redox active CXXC motif. Group II proteins, in addition to either a redox active TRX or a TRX-like domain, also contain additional domains, which may or may not possess homology to known proteins.	1.87765e-18
NC_006274.1\|WP_000735108.1\|4806043_4806856_-\|MetQ/NlpA-family-ABC-transporter-substrate-binding-protein	gnl\|CDD\|224381	COG1464, NlpA, ABC-type metal ion transport system, periplasmic component/surface antigen [Inorganic ion transport and metabolism].	5.25729e-111
NC_006274.1\|WP_000026899.1\|4810503_4810887_-\|glycine-cleavage-system-protein-GcvH	gnl\|CDD\|234918	PRK01202, PRK01202, glycine cleavage system protein GcvH.	5.279e-70
NC_006274.1\|WP_000218967.1\|4810928_4811294_-\|arsenate-reductase-family-protein	gnl\|CDD\|239334	cd03036, ArsC_like, Arsenate Reductase (ArsC) family, unknown subfamily; uncharacterized proteins containing a CXXC motif with similarity to thioredoxin (TRX)-fold arsenic reductases, ArsC. Proteins containing a redox active CXXC motif like TRX and glutaredoxin (GRX) function as protein disulfide oxidoreductases, altering the redox state of target proteins via the reversible oxidation of the active site dithiol. ArsC catalyzes the reduction of arsenate [As(V)] to arsenite [As(III)], using reducing equivalents derived from glutathione via GRX, through a single catalytic cysteine.	6.64822e-61
NC_006274.1\|WP_000048031.1\|4817426_4818140_-\|CPBP-family-intramembrane-metalloprotease	gnl\|CDD\|376806	pfam02517, Abi, CAAX protease self-immunity. Members of this family are probably proteases (after a isoprenyl group is attached to the Cys residue in the C-terminal CAAX motif of a protein to attach it to the membrane, the AAX tripeptide being removed by one of the CAAX prenyl proteases). The family contains the CAAX prenyl protease. The proteins contain a highly conserved Glu-Glu motif at the amino end of the alignment. The alignment also contains two histidine residues that may be involved in zinc binding. While they are involved in membrane anchoring of proteins in eukaryotes, little is known about their function in prokaryotes. In some known bacteriocin loci, Abi genes have been found downstream of bacteriocin structural genes where they are probably involved in self-immunity. Investigation of the bacteriocin-like loci in the Gram positive bacteria locus from Lactobacillus sakei 23K confirmed that the bacteriocin-like genes (sak23Kalphabeta) exhibited antimicrobial activity when expressed in a heterologous host and that the associated Abi gene (sak23Ki) conferred immunity against the cognate bacteriocin. Interestingly, the immunity genes from three similar systems conferred a high degree of cross-immunity against each other's bacteriocins, suggesting the recognition of a common receptor. Site-directed mutagenesis demonstrated that the conserved motifs constituting the putative proteolytic active site of the Abi proteins are essential for the immunity function of Sak23Ki - thus a new concept in self-immunity.	2.25062e-16
NC_006274.1\|WP_000640869.1\|4809785_4810130_-\|DNA-primase	gnl\|CDD\|224572	COG1658, COG1658, Small primase-like proteins (Toprim domain) [DNA replication, recombination, and repair].	2.03274e-21
NC_006274.1\|WP_000359553.1\|4806879_4807545_-\|ABC-transporter-permease	gnl\|CDD\|224922	COG2011, AbcD, ABC-type metal ion transport system, permease component [Inorganic ion transport and metabolism].	2.85082e-98
NC_006274.1\|WP_000601759.1\|4807537_4808563_-\|methionine-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224058	COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism].	5.49515e-177
NC_006274.1\|WP_000666185.1\|4814600_4815614_-\|PTS-sugar-transporter-subunit-IIC	gnl\|CDD\|379113	pfam13303, PTS_EIIC_2, Phosphotransferase system, EIIC. The bacterial phosphoenolpyruvate: sugar phosphotransferase system (PTS) is a multi-protein system involved in the regulation of a variety of metabolic and transcriptional processes. The sugar-specific permease of the PTS consists of three domains (IIA, IIB and IIC). The IIC domain catalyzes the transfer of a phosphoryl group from IIB to the sugar substrate.	2.35374e-86
NC_006274.1\|WP_000722412.1\|4805164_4805971_-\|MetQ/NlpA-family-ABC-transporter-substrate-binding-protein	gnl\|CDD\|224381	COG1464, NlpA, ABC-type metal ion transport system, periplasmic component/surface antigen [Inorganic ion transport and metabolism].	2.53478e-112
NC_006274.1\|WP_001002987.1\|4816832_4817081_-\|spore-coat-protein	gnl\|CDD\|377935	pfam07875, Coat_F, Coat F domain. The Coat F proteins, which contribute to the Bacillales spore coat. It occurs multiple times in the genomes it is found in.	9.62029e-15
NC_006274.1\|WP_000713748.1\|4813895_4814543_+\|phosphatase-PAP2-family-protein	gnl\|CDD\|239481	cd03386, PAP2_Aur1_like, PAP2_like proteins, Aur1_like subfamily. Yeast Aur1p or Ipc1p is necessary for the addition of inositol phosphate to ceramide, an essential step in yeast sphingolipid synthesis, and is the target of several antifungal compounds such as aureobasidin.	1.179e-15
NC_006274.1\|WP_001998539.1\|4815636_4816671_-\|L-lactate-dehydrogenase	gnl\|CDD\|133427	cd05291, HicDH_like, L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases. L-2-hydroxyisocapronate dehydrogenase (HicDH) catalyzes the conversion of a variety of 2-oxo carboxylic acids with medium-sized aliphatic or aromatic side chains. This subfamily is composed of HicDHs and some bacterial L-lactate dehydrogenases (LDH). LDHs catalyze the last step of glycolysis in which pyruvate is converted to L-lactate. Bacterial LDHs can be non-allosteric or may be activated by an allosteric effector such as fructose-1,6-bisphosphate. Members of this subfamily with known structures such as the HicDH of Lactobacillus confusus, the non-allosteric LDH of Lactobacillus pentosus, and the allosteric LDH of Bacillus stearothermophilus, show that they exist as homotetramers. The HicDH-like subfamily is part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.	0

>NC_006274.1|WP_000218967.1|4810928_4811294_-|arsenate-reductase-family-protein
MTVTFYSYPKCGTCQKAKKWFEANDVAYEMIHIVENPPSKEDLRNLHEKSELPLKKFFNTSGMRYRELGLKDKLKDASEDEMYELLASDGMLIKRPIVTDGTKVTLGFNEEQFESVWKKYQ
>NC_006274.1|WP_000026899.1|4810503_4810887_-|glycine-cleavage-system-protein-GcvH
MSIPNNLRYSEEHEWVKTEGNEVVIGITHFAQNELGDIVFVELPEVGATIEADEPFGSVESVKTVSELYAPVSGKVVAVNEELSDQPELVNESPYEGAWMVKVELSDASQVEKLLTAEKYAEMTNQD
>NC_006274.1|WP_000640869.1|4809785_4810130_-|DNA-primase
MIYVEKVIIVEGTSDRRKIESIIREPVEIVCTNGTIGLSKMDELVDQFFDKEVYVLVDADDAGEKLRKQFRKEFPQAEHIYIDRSYREVATAPSSHLANVLWGADIDVYTEYLR
>NC_006274.1|WP_001982629.1|4809473_4809782_-|thioredoxin-family-protein
MIEVIDWTGAEATALIENEEKTVLYVYTPMCGTCQLAKKMLTVVEMTIEDLKIGMLDLNYAPHFAKEYGIESVPCLLVFENGTLIKKIYAFHSVEYLYTELK
>NC_006274.1|WP_000781212.1|4808974_4809319_-|hypothetical-protein
MKLYSLLQSFVNYANGQYHLEPLLRQGEKTVNFRFGDESCSLQISKDYIELLHEERGTEQIVCVDEEDVKQLVNGNVRLQTLMNDGRIQYSGTYRTMLLIESMFHICKPMSVGA
>NC_006274.1|WP_000601759.1|4807537_4808563_-|methionine-ABC-transporter-ATP-binding-protein
MILLENVKKIYKAKSGDVTAVDNANLKIDKGEIFGVIGYSGAGKSSLIRLFNQLEKPTSGQITIANRVISAITGSELRKARQEIGMIFQHFNLLWSRTVRENIEFPLEIAGVDKAKRRKRVDELIHLVGLEGRGDAYPSQLSGGQKQRVGIARALANNPQVLLCDEATSALDPETTDQILDLLLDINKRLGLTIVLITHEMHVIRKICNRVAVMEKGKIVETGPVLDVFRNPQQDITKRFVQQLTDSEDTNETIESLIEKYPDGKVVRLQFIGEAVERPVLQRLMQRSDIEVSILQGNIAQTNNGSYGSLVVHLNGEETAIQQAIEGIHQDQVELEVIAHG
>NC_006274.1|WP_000359553.1|4806879_4807545_-|ABC-transporter-permease
MDKLLTNVDWNQMLEATGETLYMTAIAALATFILGLILGLLLFMTAKDNLWENKAVNTAIGAFVNIFRSIPFIILIILLIPFTKILLGTILGASAALPALIIGAAPFYARMVEIALREIDKGVIEASKAMGAKTSTIILKVLIPESLPALVSGITVTTIALVGYTAMAGVVGAGGLGTLAYLEGFQRGNNDVTIVATICVLLVVFFIQWIGDRVTTRIDKR
>NC_006274.1|WP_000735108.1|4806043_4806856_-|MetQ/NlpA-family-ABC-transporter-substrate-binding-protein
MKKLLLTALISTSIFGLAACGGKDNDEKKLVVGASNVPHAEILEKAKPLLEKKGIELEVKKFQDYVLPNKSLADKDLDANYFQHIPYLEKEIKDKKYDFEVAGKIHLEPIGVYSQKYKSLKELPDGATIIMSNSVADHGRGLAILQKEGILKIKDGVDPVKATPKDIADNPKNLKFKTDIEPGLLPQVYNNKEGDAVLINSNYAIDAKLNPEKDAIAIESNDSPYANVVAVRKGDKDKKEIKELVEVLHSKEIEDFINKEYKGAVVPVKE
>NC_006274.1|WP_000722412.1|4805164_4805971_-|MetQ/NlpA-family-ABC-transporter-substrate-binding-protein
MKKILLSVVTALSVFTLAACGGKEENKLVVGASNVPHAVILEKVQPILEKKGIKLEIKKFQDYVLPNKALADKEIDANYFQHIPYLDKEIQEKGYKIVNAGKIHLEPMGIYSKRYKSLKDLPDGGTVIMSNNVAERGRMLALLQKGGVIKLKDGVDVVKATVKDVVENPKNLKFKTDVEPGLSPKLYENNEGDALFINSNYAIDAKLNPTKDAIAIEGSDSPYANIIAVRKGDEKKKEIKELVEVLHSKEIQDFINKEYKGAVLPVSE
>NC_006274.1|WP_000929160.1|4804140_4804926_-|Fe-S-cluster-assembly-ATPase-SufC
MAGSTLTVKDLHVSIDGKEILKGVNLEVKGGEIHAIMGPNGTGKSTLSSAIMGHPKYEVTEGSIIIDGEDVLEMEVDERAQAGLFLAMQYPSEISGVTNADFLRSAINARREEGDEISLMKFIRTLDKNMEFLEMDPEMAQRYLNEGFSGGEKKRNEILQLMMIEPKIAILDEIDSGLDIDALKVVSKGINEMRGEEFGCLMITHYQRLLNYITPDFVHVMMNGRIVKSGGPELAQRLEAEGYDWIKKELGIEDETTEQEA
>NC_006274.1|WP_001224771.1|4812039_4812411_-|hypothetical-protein
MRKFLISYAASLLTFTIIWFLIPYISDPSYSNENGLPNIVGFIVILIIFGSVLDLVACLIGEVFYRNIKQCRKFRFGIPVFIGLALIYTFILSLFTITSAYASSLVAPIIMGSLAFYVVRRKI
>NC_006274.1|WP_000475825.1|4812528_4812768_-|DUF3937-family-protein
MFKNKKLIRFGLTLLVCLFIIDFTISYFQAYLESAGIKWVISETWKTILLDVPESILVILGAIALYDFTKETSPKDASI
>NC_006274.1|WP_000826901.1|4813224_4813752_-|hypothetical-protein
MKRLSYFLVFILICLASAGCAKDKEGEKLEYNGRALVIGVVGEKPKDTFRNVKFENVKLEEMKGNAAKVDGFLVMKEYFQEASKEQYTDLFLSLKKPVFFIGLQDRPYLIFTEKDLDYDNAPRDGAMMYTQGFVNMGNPEGQYWGMGLYNDTVSNQNIHNMYIIVFQTIADYLSR
>NC_006274.1|WP_000713748.1|4813895_4814543_+|phosphatase-PAP2-family-protein
MKKFKLSSFLPLSYILLLVLVSPLYDVLNKSAVHAVDVTTVVDDWIPFVKAFIIPYLLWFPYLYGALIYYCFADRKQYYVTLSSIILGKLSCFSIYYFWQTTVPRPTVVGSDVFSELVRYIYSIDQPVNCFPSIHVLTTFIIMLAAFRRREQHAFEYYILTFFGTLIILSTLFTKQHAFVDAISGMTLASILYFGVQLLLAKETVRVPVKQNHKI
>NC_006274.1|WP_000666185.1|4814600_4815614_-|PTS-sugar-transporter-subunit-IIC
MKEYIMSRVFKASAGIAQGIFVSLGIGLLIENIGRIVDIPLLITIGVVAKSLMAPAIGAGIAFMLGANGLVIFSAMVAGAIGAGSISITEVGLIIKTGEPIGALLTATLAVYIGKRLSGKTALDMMLVPFAAILGSGLVGIWLSHNITPVLNAVGAFIKDSSAGSPFIASIVIAVVWGLLLISPASSAALAIALSLDGVAGGAALAGCVAQFIGFSVISAKENNLGGILAQALCTPKVQLPNITKNPMILVPTVVASAIVGPVSALIFQLEAGKEIAGLGLSSLIAPINLISSEGWEVVPAMVITYIVIPVAVSYILYIALKKAGRIHSGDMTVPQS
>NC_006274.1|WP_001998539.1|4815636_4816671_-|L-lactate-dehydrogenase
MVSIVGTSIIRSVRNKRNRLYDQLGEIAMKRHTRKIAIIGTGLVGSSCAYSIVNQGICEELLLIDINHERAVGEAMDLSHCINFTNTRTKVYAGSYEDCKDMDIVIITAGPAPKPGQSRLDTLGASAKIMESVVGGVMESGFDGIFLLASNPVDIITYQVWKLSGLPRNRVIGTGTSLDSSRLRTILSEMLHVDPRSIHGYSLGEHGDSQMVAWSHVTVGGKPILQILEEQKERFGEIDLDEIVEKTAKAGWEIYKRKGTTYYGIGNSLAYIANSIFNDDHRVIAVSAILDGEYGEYDICTGVPAIITRDGIREIVELNLTEDEESRFAKSNDILRDYMKTIGY
>NC_006274.1|WP_001002987.1|4816832_4817081_-|spore-coat-protein
MNEKDMVNDYLAGLNASLTSYANYIAQSDNEQLHQTLIQIRNQDEMRQRNMYEYAKQKSYYKPAAPANPMIVQQLKSQLSAE
>NC_006274.1|WP_001180555.1|4817094_4817280_-|hypothetical-protein
MQNLTELEVENLRHLIGGHATIINKLEQYAQTCTDPQLKQMLQKDAQDARNTKQQLMTFLG
>NC_006274.1|WP_000048031.1|4817426_4818140_-|CPBP-family-intramembrane-metalloprotease
MSKTVLEAYSVERKIENITYKNLFVMIAMIIGISLLGGLFLSLAFGIYGEAVLSTNLEGYYLLLFDAIVVAIVLLAYKPVFHFIKSIWDLSVLKSGKTYLYLLIGFIIIAVSQYLMLHVFSFESAAEQKEQLGSLGLQNSIQSIIYVLSVAIITPVKEEILFRGILYRFLEKKYNFLVSIIISSFIFGILHGGLLITATIMGMVFAMLYKKTQSIIPSIILHIVWNLLVSISMIVSL
>NC_006274.1|WP_000029288.1|4818559_4818847_-|DUF2178-domain-containing-protein
MSIVIGIIISVAGLIGVLYATRFQKNEGEDERGEHITGNAAKISLFVFLLLYLVIFLIGNLYSLTGEQYKLANACLLAGVLCSYALTIVVLKRRY

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NC_006274_3	3.5\|2111488\|18\|NC_006274\|CRT	2111488-2111505	18	NC_006274.1	2111524-2111541	0	1.0
NC_006274_5	5.1\|3594436\|27\|NC_006274\|CRT	3594436-3594462	27	NC_006274.1	3595660-3595686	1	0.963
NC_006274_5	5.1\|3594436\|27\|NC_006274\|CRT	3594436-3594462	27	NC_006274.1	3595795-3595821	1	0.963
NC_006274_5	5.1\|3594436\|27\|NC_006274\|CRT	3594436-3594462	27	NC_006274.1	3596144-3596170	1	0.963
NC_006274_5	5.1\|3594436\|27\|NC_006274\|CRT	3594436-3594462	27	NC_006274.1	3595840-3595866	2	0.926
NC_006274_5	5.1\|3594436\|27\|NC_006274\|CRT	3594436-3594462	27	NC_006274.1	3595966-3595992	2	0.926
NC_006274_5	5.1\|3594436\|27\|NC_006274\|CRT	3594436-3594462	27	NC_006274.1	3596189-3596215	2	0.926
NC_006274_5	5.1\|3594436\|27\|NC_006274\|CRT	3594436-3594462	27	NC_006274.1	3596315-3596341	2	0.926
NC_006274_5	5.1\|3594436\|27\|NC_006274\|CRT	3594436-3594462	27	NC_006274.1	3596360-3596386	2	0.926
NC_006274_5	5.1\|3594436\|27\|NC_006274\|CRT	3594436-3594462	27	NC_006274.1	3596477-3596503	2	0.926
NC_006274_5	5.1\|3594436\|27\|NC_006274\|CRT	3594436-3594462	27	NC_006274.1	3596522-3596548	2	0.926
NC_006274_5	5.2\|3594481\|27\|NC_006274\|CRT	3594481-3594507	27	NC_006274.1	3595660-3595686	1	0.963
NC_006274_5	5.2\|3594481\|27\|NC_006274\|CRT	3594481-3594507	27	NC_006274.1	3595795-3595821	1	0.963
NC_006274_5	5.2\|3594481\|27\|NC_006274\|CRT	3594481-3594507	27	NC_006274.1	3596144-3596170	1	0.963
NC_006274_5	5.2\|3594481\|27\|NC_006274\|CRT	3594481-3594507	27	NC_006274.1	3595840-3595866	2	0.926
NC_006274_5	5.2\|3594481\|27\|NC_006274\|CRT	3594481-3594507	27	NC_006274.1	3595966-3595992	2	0.926
NC_006274_5	5.2\|3594481\|27\|NC_006274\|CRT	3594481-3594507	27	NC_006274.1	3596189-3596215	2	0.926
NC_006274_5	5.2\|3594481\|27\|NC_006274\|CRT	3594481-3594507	27	NC_006274.1	3596315-3596341	2	0.926
NC_006274_5	5.2\|3594481\|27\|NC_006274\|CRT	3594481-3594507	27	NC_006274.1	3596360-3596386	2	0.926
NC_006274_5	5.2\|3594481\|27\|NC_006274\|CRT	3594481-3594507	27	NC_006274.1	3596477-3596503	2	0.926
NC_006274_5	5.2\|3594481\|27\|NC_006274\|CRT	3594481-3594507	27	NC_006274.1	3596522-3596548	2	0.926
NC_006274_5	5.3\|3594526\|27\|NC_006274\|CRT	3594526-3594552	27	NC_006274.1	3595660-3595686	1	0.963
NC_006274_5	5.3\|3594526\|27\|NC_006274\|CRT	3594526-3594552	27	NC_006274.1	3595795-3595821	1	0.963
NC_006274_5	5.3\|3594526\|27\|NC_006274\|CRT	3594526-3594552	27	NC_006274.1	3596144-3596170	1	0.963
NC_006274_5	5.3\|3594526\|27\|NC_006274\|CRT	3594526-3594552	27	NC_006274.1	3595840-3595866	2	0.926
NC_006274_5	5.3\|3594526\|27\|NC_006274\|CRT	3594526-3594552	27	NC_006274.1	3595966-3595992	2	0.926
NC_006274_5	5.3\|3594526\|27\|NC_006274\|CRT	3594526-3594552	27	NC_006274.1	3596189-3596215	2	0.926
NC_006274_5	5.3\|3594526\|27\|NC_006274\|CRT	3594526-3594552	27	NC_006274.1	3596315-3596341	2	0.926
NC_006274_5	5.3\|3594526\|27\|NC_006274\|CRT	3594526-3594552	27	NC_006274.1	3596360-3596386	2	0.926
NC_006274_5	5.3\|3594526\|27\|NC_006274\|CRT	3594526-3594552	27	NC_006274.1	3596477-3596503	2	0.926
NC_006274_5	5.3\|3594526\|27\|NC_006274\|CRT	3594526-3594552	27	NC_006274.1	3596522-3596548	2	0.926
NC_006274_5	5.4\|3594571\|27\|NC_006274\|CRT	3594571-3594597	27	NC_006274.1	3595660-3595686	1	0.963
NC_006274_5	5.4\|3594571\|27\|NC_006274\|CRT	3594571-3594597	27	NC_006274.1	3595795-3595821	1	0.963
NC_006274_5	5.4\|3594571\|27\|NC_006274\|CRT	3594571-3594597	27	NC_006274.1	3596144-3596170	1	0.963
NC_006274_5	5.4\|3594571\|27\|NC_006274\|CRT	3594571-3594597	27	NC_006274.1	3595840-3595866	2	0.926
NC_006274_5	5.4\|3594571\|27\|NC_006274\|CRT	3594571-3594597	27	NC_006274.1	3595966-3595992	2	0.926
NC_006274_5	5.4\|3594571\|27\|NC_006274\|CRT	3594571-3594597	27	NC_006274.1	3596189-3596215	2	0.926
NC_006274_5	5.4\|3594571\|27\|NC_006274\|CRT	3594571-3594597	27	NC_006274.1	3596315-3596341	2	0.926
NC_006274_5	5.4\|3594571\|27\|NC_006274\|CRT	3594571-3594597	27	NC_006274.1	3596360-3596386	2	0.926
NC_006274_5	5.4\|3594571\|27\|NC_006274\|CRT	3594571-3594597	27	NC_006274.1	3596477-3596503	2	0.926
NC_006274_5	5.4\|3594571\|27\|NC_006274\|CRT	3594571-3594597	27	NC_006274.1	3596522-3596548	2	0.926
NC_006274_5	5.5\|3594616\|27\|NC_006274\|CRT	3594616-3594642	27	NC_006274.1	3595201-3595227	0	1.0
NC_006274_5	5.5\|3594616\|27\|NC_006274\|CRT	3594616-3594642	27	NC_006274.1	3595840-3595866	1	0.963
NC_006274_5	5.5\|3594616\|27\|NC_006274\|CRT	3594616-3594642	27	NC_006274.1	3595966-3595992	1	0.963
NC_006274_5	5.5\|3594616\|27\|NC_006274\|CRT	3594616-3594642	27	NC_006274.1	3596189-3596215	1	0.963
NC_006274_5	5.5\|3594616\|27\|NC_006274\|CRT	3594616-3594642	27	NC_006274.1	3596315-3596341	1	0.963
NC_006274_5	5.5\|3594616\|27\|NC_006274\|CRT	3594616-3594642	27	NC_006274.1	3596360-3596386	1	0.963
NC_006274_5	5.5\|3594616\|27\|NC_006274\|CRT	3594616-3594642	27	NC_006274.1	3596477-3596503	1	0.963
NC_006274_5	5.5\|3594616\|27\|NC_006274\|CRT	3594616-3594642	27	NC_006274.1	3596522-3596548	1	0.963
NC_006274_5	5.5\|3594616\|27\|NC_006274\|CRT	3594616-3594642	27	NC_006274.1	3595660-3595686	2	0.926
NC_006274_5	5.5\|3594616\|27\|NC_006274\|CRT	3594616-3594642	27	NC_006274.1	3595795-3595821	2	0.926
NC_006274_5	5.5\|3594616\|27\|NC_006274\|CRT	3594616-3594642	27	NC_006274.1	3596144-3596170	2	0.926
NC_006274_5	5.6\|3594661\|27\|NC_006274\|CRT	3594661-3594687	27	NC_006274.1	3595660-3595686	1	0.963
NC_006274_5	5.6\|3594661\|27\|NC_006274\|CRT	3594661-3594687	27	NC_006274.1	3595795-3595821	1	0.963
NC_006274_5	5.6\|3594661\|27\|NC_006274\|CRT	3594661-3594687	27	NC_006274.1	3596144-3596170	1	0.963
NC_006274_5	5.6\|3594661\|27\|NC_006274\|CRT	3594661-3594687	27	NC_006274.1	3595840-3595866	2	0.926
NC_006274_5	5.6\|3594661\|27\|NC_006274\|CRT	3594661-3594687	27	NC_006274.1	3595966-3595992	2	0.926
NC_006274_5	5.6\|3594661\|27\|NC_006274\|CRT	3594661-3594687	27	NC_006274.1	3596189-3596215	2	0.926
NC_006274_5	5.6\|3594661\|27\|NC_006274\|CRT	3594661-3594687	27	NC_006274.1	3596315-3596341	2	0.926
NC_006274_5	5.6\|3594661\|27\|NC_006274\|CRT	3594661-3594687	27	NC_006274.1	3596360-3596386	2	0.926
NC_006274_5	5.6\|3594661\|27\|NC_006274\|CRT	3594661-3594687	27	NC_006274.1	3596477-3596503	2	0.926
NC_006274_5	5.6\|3594661\|27\|NC_006274\|CRT	3594661-3594687	27	NC_006274.1	3596522-3596548	2	0.926
NC_006274_5	5.7\|3594706\|18\|NC_006274\|CRT	3594706-3594723	18	NC_006274.1	3595534-3595551	0	1.0
NC_006274_5	5.7\|3594706\|18\|NC_006274\|CRT	3594706-3594723	18	NC_006274.1	3595327-3595344	1	0.944
NC_006274_5	5.8\|3594742\|18\|NC_006274\|CRT	3594742-3594759	18	NC_006274.1	3595840-3595857	0	1.0
NC_006274_5	5.8\|3594742\|18\|NC_006274\|CRT	3594742-3594759	18	NC_006274.1	3596189-3596206	0	1.0
NC_006274_5	5.8\|3594742\|18\|NC_006274\|CRT	3594742-3594759	18	NC_006274.1	3596360-3596377	0	1.0
NC_006274_5	5.8\|3594742\|18\|NC_006274\|CRT	3594742-3594759	18	NC_006274.1	3596522-3596539	0	1.0
NC_006274_5	5.8\|3594742\|18\|NC_006274\|CRT	3594742-3594759	18	NC_006274.1	3595201-3595218	1	0.944
NC_006274_5	5.8\|3594742\|18\|NC_006274\|CRT	3594742-3594759	18	NC_006274.1	3595966-3595983	1	0.944
NC_006274_5	5.8\|3594742\|18\|NC_006274\|CRT	3594742-3594759	18	NC_006274.1	3596315-3596332	1	0.944
NC_006274_5	5.8\|3594742\|18\|NC_006274\|CRT	3594742-3594759	18	NC_006274.1	3596477-3596494	1	0.944
NC_006274_5	5.9\|3594778\|27\|NC_006274\|CRT	3594778-3594804	27	NC_006274.1	3595201-3595227	0	1.0
NC_006274_5	5.9\|3594778\|27\|NC_006274\|CRT	3594778-3594804	27	NC_006274.1	3595840-3595866	1	0.963
NC_006274_5	5.9\|3594778\|27\|NC_006274\|CRT	3594778-3594804	27	NC_006274.1	3595966-3595992	1	0.963
NC_006274_5	5.9\|3594778\|27\|NC_006274\|CRT	3594778-3594804	27	NC_006274.1	3596189-3596215	1	0.963
NC_006274_5	5.9\|3594778\|27\|NC_006274\|CRT	3594778-3594804	27	NC_006274.1	3596315-3596341	1	0.963
NC_006274_5	5.9\|3594778\|27\|NC_006274\|CRT	3594778-3594804	27	NC_006274.1	3596360-3596386	1	0.963
NC_006274_5	5.9\|3594778\|27\|NC_006274\|CRT	3594778-3594804	27	NC_006274.1	3596477-3596503	1	0.963
NC_006274_5	5.9\|3594778\|27\|NC_006274\|CRT	3594778-3594804	27	NC_006274.1	3596522-3596548	1	0.963
NC_006274_5	5.9\|3594778\|27\|NC_006274\|CRT	3594778-3594804	27	NC_006274.1	3595660-3595686	2	0.926
NC_006274_5	5.9\|3594778\|27\|NC_006274\|CRT	3594778-3594804	27	NC_006274.1	3595795-3595821	2	0.926
NC_006274_5	5.9\|3594778\|27\|NC_006274\|CRT	3594778-3594804	27	NC_006274.1	3596144-3596170	2	0.926
NC_006274_5	5.10\|3594823\|27\|NC_006274\|CRT	3594823-3594849	27	NC_006274.1	3595660-3595686	1	0.963
NC_006274_5	5.10\|3594823\|27\|NC_006274\|CRT	3594823-3594849	27	NC_006274.1	3595795-3595821	1	0.963
NC_006274_5	5.10\|3594823\|27\|NC_006274\|CRT	3594823-3594849	27	NC_006274.1	3596144-3596170	1	0.963
NC_006274_5	5.10\|3594823\|27\|NC_006274\|CRT	3594823-3594849	27	NC_006274.1	3595840-3595866	2	0.926
NC_006274_5	5.10\|3594823\|27\|NC_006274\|CRT	3594823-3594849	27	NC_006274.1	3595966-3595992	2	0.926
NC_006274_5	5.10\|3594823\|27\|NC_006274\|CRT	3594823-3594849	27	NC_006274.1	3596189-3596215	2	0.926
NC_006274_5	5.10\|3594823\|27\|NC_006274\|CRT	3594823-3594849	27	NC_006274.1	3596315-3596341	2	0.926
NC_006274_5	5.10\|3594823\|27\|NC_006274\|CRT	3594823-3594849	27	NC_006274.1	3596360-3596386	2	0.926
NC_006274_5	5.10\|3594823\|27\|NC_006274\|CRT	3594823-3594849	27	NC_006274.1	3596477-3596503	2	0.926
NC_006274_5	5.10\|3594823\|27\|NC_006274\|CRT	3594823-3594849	27	NC_006274.1	3596522-3596548	2	0.926
NC_006274_5	5.11\|3594868\|18\|NC_006274\|CRT	3594868-3594885	18	NC_006274.1	3595840-3595857	0	1.0
NC_006274_5	5.11\|3594868\|18\|NC_006274\|CRT	3594868-3594885	18	NC_006274.1	3596189-3596206	0	1.0
NC_006274_5	5.11\|3594868\|18\|NC_006274\|CRT	3594868-3594885	18	NC_006274.1	3596360-3596377	0	1.0
NC_006274_5	5.11\|3594868\|18\|NC_006274\|CRT	3594868-3594885	18	NC_006274.1	3596522-3596539	0	1.0
NC_006274_5	5.11\|3594868\|18\|NC_006274\|CRT	3594868-3594885	18	NC_006274.1	3595201-3595218	1	0.944
NC_006274_5	5.11\|3594868\|18\|NC_006274\|CRT	3594868-3594885	18	NC_006274.1	3595966-3595983	1	0.944
NC_006274_5	5.11\|3594868\|18\|NC_006274\|CRT	3594868-3594885	18	NC_006274.1	3596315-3596332	1	0.944
NC_006274_5	5.11\|3594868\|18\|NC_006274\|CRT	3594868-3594885	18	NC_006274.1	3596477-3596494	1	0.944
NC_006274_5	5.12\|3594904\|27\|NC_006274\|CRT	3594904-3594930	27	NC_006274.1	3595282-3595308	1	0.963
NC_006274_5	5.12\|3594904\|27\|NC_006274\|CRT	3594904-3594930	27	NC_006274.1	1430848-1430874	2	0.926
NC_006274_5	5.12\|3594904\|27\|NC_006274\|CRT	3594904-3594930	27	NC_006274.1	3595372-3595398	2	0.926
NC_006274_5	5.13\|3594949\|18\|NC_006274\|CRT	3594949-3594966	18	NC_006274.1	3595840-3595857	0	1.0
NC_006274_5	5.13\|3594949\|18\|NC_006274\|CRT	3594949-3594966	18	NC_006274.1	3596189-3596206	0	1.0
NC_006274_5	5.13\|3594949\|18\|NC_006274\|CRT	3594949-3594966	18	NC_006274.1	3596360-3596377	0	1.0
NC_006274_5	5.13\|3594949\|18\|NC_006274\|CRT	3594949-3594966	18	NC_006274.1	3596522-3596539	0	1.0
NC_006274_5	5.13\|3594949\|18\|NC_006274\|CRT	3594949-3594966	18	NC_006274.1	3595201-3595218	1	0.944
NC_006274_5	5.13\|3594949\|18\|NC_006274\|CRT	3594949-3594966	18	NC_006274.1	3595966-3595983	1	0.944
NC_006274_5	5.13\|3594949\|18\|NC_006274\|CRT	3594949-3594966	18	NC_006274.1	3596315-3596332	1	0.944
NC_006274_5	5.13\|3594949\|18\|NC_006274\|CRT	3594949-3594966	18	NC_006274.1	3596477-3596494	1	0.944
NC_006274_5	5.14\|3594985\|27\|NC_006274\|CRT	3594985-3595011	27	NC_006274.1	3595282-3595308	0	1.0
NC_006274_5	5.14\|3594985\|27\|NC_006274\|CRT	3594985-3595011	27	NC_006274.1	1430848-1430874	1	0.963
NC_006274_5	5.14\|3594985\|27\|NC_006274\|CRT	3594985-3595011	27	NC_006274.1	3595372-3595398	1	0.963
NC_006274_5	5.14\|3594985\|27\|NC_006274\|CRT	3594985-3595011	27	NC_006274.1	1430704-1430730	2	0.926
NC_006274_5	5.15\|3595030\|18\|NC_006274\|CRT	3595030-3595047	18	NC_006274.1	3595660-3595677	1	0.944
NC_006274_5	5.15\|3595030\|18\|NC_006274\|CRT	3595030-3595047	18	NC_006274.1	3595795-3595812	1	0.944
NC_006274_5	5.15\|3595030\|18\|NC_006274\|CRT	3595030-3595047	18	NC_006274.1	3595840-3595857	1	0.944
NC_006274_5	5.15\|3595030\|18\|NC_006274\|CRT	3595030-3595047	18	NC_006274.1	3596144-3596161	1	0.944
NC_006274_5	5.15\|3595030\|18\|NC_006274\|CRT	3595030-3595047	18	NC_006274.1	3596189-3596206	1	0.944
NC_006274_5	5.15\|3595030\|18\|NC_006274\|CRT	3595030-3595047	18	NC_006274.1	3596360-3596377	1	0.944
NC_006274_5	5.15\|3595030\|18\|NC_006274\|CRT	3595030-3595047	18	NC_006274.1	3596522-3596539	1	0.944

1. spacer 3.5|2111488|18|NC_006274|CRT matches to position: 2111524-2111541, mismatch: 0, identity: 1.0

aaccagacacaaagccag	CRISPR spacer
aaccagacacaaagccag	Protospacer
******************

2. spacer 5.1|3594436|27|NC_006274|CRT matches to position: 3595660-3595686, mismatch: 1, identity: 0.963

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgttcaaggtaacacaggtgctactgg	Protospacer
**.************************

3. spacer 5.1|3594436|27|NC_006274|CRT matches to position: 3595795-3595821, mismatch: 1, identity: 0.963

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgttcaaggtaacacaggtgctactgg	Protospacer
**.************************

4. spacer 5.1|3594436|27|NC_006274|CRT matches to position: 3596144-3596170, mismatch: 1, identity: 0.963

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgttcaaggtaacacaggtgctactgg	Protospacer
**.************************

5. spacer 5.1|3594436|27|NC_006274|CRT matches to position: 3595840-3595866, mismatch: 2, identity: 0.926

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgctcaaggtaacacgggcgctactgg	Protospacer
***************.**.********

6. spacer 5.1|3594436|27|NC_006274|CRT matches to position: 3595966-3595992, mismatch: 2, identity: 0.926

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgttcaaggtaacacgggtgctactgg	Protospacer
**.************.***********

7. spacer 5.1|3594436|27|NC_006274|CRT matches to position: 3596189-3596215, mismatch: 2, identity: 0.926

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgctcaaggtaacacgggcgctactgg	Protospacer
***************.**.********

8. spacer 5.1|3594436|27|NC_006274|CRT matches to position: 3596315-3596341, mismatch: 2, identity: 0.926

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgttcaaggtaacacgggtgctactgg	Protospacer
**.************.***********

9. spacer 5.1|3594436|27|NC_006274|CRT matches to position: 3596360-3596386, mismatch: 2, identity: 0.926

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgctcaaggtaacacgggcgctactgg	Protospacer
***************.**.********

10. spacer 5.1|3594436|27|NC_006274|CRT matches to position: 3596477-3596503, mismatch: 2, identity: 0.926

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgttcaaggtaacacgggtgctactgg	Protospacer
**.************.***********

11. spacer 5.1|3594436|27|NC_006274|CRT matches to position: 3596522-3596548, mismatch: 2, identity: 0.926

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgctcaaggtaacacgggcgctactgg	Protospacer
***************.**.********

12. spacer 5.2|3594481|27|NC_006274|CRT matches to position: 3595660-3595686, mismatch: 1, identity: 0.963

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgttcaaggtaacacaggtgctactgg	Protospacer
**.************************

13. spacer 5.2|3594481|27|NC_006274|CRT matches to position: 3595795-3595821, mismatch: 1, identity: 0.963

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgttcaaggtaacacaggtgctactgg	Protospacer
**.************************

14. spacer 5.2|3594481|27|NC_006274|CRT matches to position: 3596144-3596170, mismatch: 1, identity: 0.963

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgttcaaggtaacacaggtgctactgg	Protospacer
**.************************

15. spacer 5.2|3594481|27|NC_006274|CRT matches to position: 3595840-3595866, mismatch: 2, identity: 0.926

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgctcaaggtaacacgggcgctactgg	Protospacer
***************.**.********

16. spacer 5.2|3594481|27|NC_006274|CRT matches to position: 3595966-3595992, mismatch: 2, identity: 0.926

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgttcaaggtaacacgggtgctactgg	Protospacer
**.************.***********

17. spacer 5.2|3594481|27|NC_006274|CRT matches to position: 3596189-3596215, mismatch: 2, identity: 0.926

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgctcaaggtaacacgggcgctactgg	Protospacer
***************.**.********

18. spacer 5.2|3594481|27|NC_006274|CRT matches to position: 3596315-3596341, mismatch: 2, identity: 0.926

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgttcaaggtaacacgggtgctactgg	Protospacer
**.************.***********

19. spacer 5.2|3594481|27|NC_006274|CRT matches to position: 3596360-3596386, mismatch: 2, identity: 0.926

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgctcaaggtaacacgggcgctactgg	Protospacer
***************.**.********

20. spacer 5.2|3594481|27|NC_006274|CRT matches to position: 3596477-3596503, mismatch: 2, identity: 0.926

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgttcaaggtaacacgggtgctactgg	Protospacer
**.************.***********

21. spacer 5.2|3594481|27|NC_006274|CRT matches to position: 3596522-3596548, mismatch: 2, identity: 0.926

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgctcaaggtaacacgggcgctactgg	Protospacer
***************.**.********

22. spacer 5.3|3594526|27|NC_006274|CRT matches to position: 3595660-3595686, mismatch: 1, identity: 0.963

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgttcaaggtaacacaggtgctactgg	Protospacer
**.************************

23. spacer 5.3|3594526|27|NC_006274|CRT matches to position: 3595795-3595821, mismatch: 1, identity: 0.963

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgttcaaggtaacacaggtgctactgg	Protospacer
**.************************

24. spacer 5.3|3594526|27|NC_006274|CRT matches to position: 3596144-3596170, mismatch: 1, identity: 0.963

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgttcaaggtaacacaggtgctactgg	Protospacer
**.************************

25. spacer 5.3|3594526|27|NC_006274|CRT matches to position: 3595840-3595866, mismatch: 2, identity: 0.926

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgctcaaggtaacacgggcgctactgg	Protospacer
***************.**.********

26. spacer 5.3|3594526|27|NC_006274|CRT matches to position: 3595966-3595992, mismatch: 2, identity: 0.926

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgttcaaggtaacacgggtgctactgg	Protospacer
**.************.***********

27. spacer 5.3|3594526|27|NC_006274|CRT matches to position: 3596189-3596215, mismatch: 2, identity: 0.926

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgctcaaggtaacacgggcgctactgg	Protospacer
***************.**.********

28. spacer 5.3|3594526|27|NC_006274|CRT matches to position: 3596315-3596341, mismatch: 2, identity: 0.926

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgttcaaggtaacacgggtgctactgg	Protospacer
**.************.***********

29. spacer 5.3|3594526|27|NC_006274|CRT matches to position: 3596360-3596386, mismatch: 2, identity: 0.926

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgctcaaggtaacacgggcgctactgg	Protospacer
***************.**.********

30. spacer 5.3|3594526|27|NC_006274|CRT matches to position: 3596477-3596503, mismatch: 2, identity: 0.926

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgttcaaggtaacacgggtgctactgg	Protospacer
**.************.***********

31. spacer 5.3|3594526|27|NC_006274|CRT matches to position: 3596522-3596548, mismatch: 2, identity: 0.926

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgctcaaggtaacacgggcgctactgg	Protospacer
***************.**.********

32. spacer 5.4|3594571|27|NC_006274|CRT matches to position: 3595660-3595686, mismatch: 1, identity: 0.963

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgttcaaggtaacacaggtgctactgg	Protospacer
**.************************

33. spacer 5.4|3594571|27|NC_006274|CRT matches to position: 3595795-3595821, mismatch: 1, identity: 0.963

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgttcaaggtaacacaggtgctactgg	Protospacer
**.************************

34. spacer 5.4|3594571|27|NC_006274|CRT matches to position: 3596144-3596170, mismatch: 1, identity: 0.963

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgttcaaggtaacacaggtgctactgg	Protospacer
**.************************

35. spacer 5.4|3594571|27|NC_006274|CRT matches to position: 3595840-3595866, mismatch: 2, identity: 0.926

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgctcaaggtaacacgggcgctactgg	Protospacer
***************.**.********

36. spacer 5.4|3594571|27|NC_006274|CRT matches to position: 3595966-3595992, mismatch: 2, identity: 0.926

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgttcaaggtaacacgggtgctactgg	Protospacer
**.************.***********

37. spacer 5.4|3594571|27|NC_006274|CRT matches to position: 3596189-3596215, mismatch: 2, identity: 0.926

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgctcaaggtaacacgggcgctactgg	Protospacer
***************.**.********

38. spacer 5.4|3594571|27|NC_006274|CRT matches to position: 3596315-3596341, mismatch: 2, identity: 0.926

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgttcaaggtaacacgggtgctactgg	Protospacer
**.************.***********

39. spacer 5.4|3594571|27|NC_006274|CRT matches to position: 3596360-3596386, mismatch: 2, identity: 0.926

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgctcaaggtaacacgggcgctactgg	Protospacer
***************.**.********

40. spacer 5.4|3594571|27|NC_006274|CRT matches to position: 3596477-3596503, mismatch: 2, identity: 0.926

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgttcaaggtaacacgggtgctactgg	Protospacer
**.************.***********

41. spacer 5.4|3594571|27|NC_006274|CRT matches to position: 3596522-3596548, mismatch: 2, identity: 0.926

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgctcaaggtaacacgggcgctactgg	Protospacer
***************.**.********

42. spacer 5.5|3594616|27|NC_006274|CRT matches to position: 3595201-3595227, mismatch: 0, identity: 1.0

tgttcaaggtaacacgggcgctactgg	CRISPR spacer
tgttcaaggtaacacgggcgctactgg	Protospacer
***************************

43. spacer 5.5|3594616|27|NC_006274|CRT matches to position: 3595840-3595866, mismatch: 1, identity: 0.963

tgttcaaggtaacacgggcgctactgg	CRISPR spacer
tgctcaaggtaacacgggcgctactgg	Protospacer
**.************************

44. spacer 5.5|3594616|27|NC_006274|CRT matches to position: 3595966-3595992, mismatch: 1, identity: 0.963

tgttcaaggtaacacgggcgctactgg	CRISPR spacer
tgttcaaggtaacacgggtgctactgg	Protospacer
******************.********

45. spacer 5.5|3594616|27|NC_006274|CRT matches to position: 3596189-3596215, mismatch: 1, identity: 0.963

tgttcaaggtaacacgggcgctactgg	CRISPR spacer
tgctcaaggtaacacgggcgctactgg	Protospacer
**.************************

46. spacer 5.5|3594616|27|NC_006274|CRT matches to position: 3596315-3596341, mismatch: 1, identity: 0.963

tgttcaaggtaacacgggcgctactgg	CRISPR spacer
tgttcaaggtaacacgggtgctactgg	Protospacer
******************.********

47. spacer 5.5|3594616|27|NC_006274|CRT matches to position: 3596360-3596386, mismatch: 1, identity: 0.963

tgttcaaggtaacacgggcgctactgg	CRISPR spacer
tgctcaaggtaacacgggcgctactgg	Protospacer
**.************************

48. spacer 5.5|3594616|27|NC_006274|CRT matches to position: 3596477-3596503, mismatch: 1, identity: 0.963

tgttcaaggtaacacgggcgctactgg	CRISPR spacer
tgttcaaggtaacacgggtgctactgg	Protospacer
******************.********

49. spacer 5.5|3594616|27|NC_006274|CRT matches to position: 3596522-3596548, mismatch: 1, identity: 0.963

tgttcaaggtaacacgggcgctactgg	CRISPR spacer
tgctcaaggtaacacgggcgctactgg	Protospacer
**.************************

50. spacer 5.5|3594616|27|NC_006274|CRT matches to position: 3595660-3595686, mismatch: 2, identity: 0.926

tgttcaaggtaacacgggcgctactgg	CRISPR spacer
tgttcaaggtaacacaggtgctactgg	Protospacer
***************.**.********

51. spacer 5.5|3594616|27|NC_006274|CRT matches to position: 3595795-3595821, mismatch: 2, identity: 0.926

tgttcaaggtaacacgggcgctactgg	CRISPR spacer
tgttcaaggtaacacaggtgctactgg	Protospacer
***************.**.********

52. spacer 5.5|3594616|27|NC_006274|CRT matches to position: 3596144-3596170, mismatch: 2, identity: 0.926

tgttcaaggtaacacgggcgctactgg	CRISPR spacer
tgttcaaggtaacacaggtgctactgg	Protospacer
***************.**.********

53. spacer 5.6|3594661|27|NC_006274|CRT matches to position: 3595660-3595686, mismatch: 1, identity: 0.963

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgttcaaggtaacacaggtgctactgg	Protospacer
**.************************

54. spacer 5.6|3594661|27|NC_006274|CRT matches to position: 3595795-3595821, mismatch: 1, identity: 0.963

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgttcaaggtaacacaggtgctactgg	Protospacer
**.************************

55. spacer 5.6|3594661|27|NC_006274|CRT matches to position: 3596144-3596170, mismatch: 1, identity: 0.963

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgttcaaggtaacacaggtgctactgg	Protospacer
**.************************

56. spacer 5.6|3594661|27|NC_006274|CRT matches to position: 3595840-3595866, mismatch: 2, identity: 0.926

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgctcaaggtaacacgggcgctactgg	Protospacer
***************.**.********

57. spacer 5.6|3594661|27|NC_006274|CRT matches to position: 3595966-3595992, mismatch: 2, identity: 0.926

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgttcaaggtaacacgggtgctactgg	Protospacer
**.************.***********

58. spacer 5.6|3594661|27|NC_006274|CRT matches to position: 3596189-3596215, mismatch: 2, identity: 0.926

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgctcaaggtaacacgggcgctactgg	Protospacer
***************.**.********

59. spacer 5.6|3594661|27|NC_006274|CRT matches to position: 3596315-3596341, mismatch: 2, identity: 0.926

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgttcaaggtaacacgggtgctactgg	Protospacer
**.************.***********

60. spacer 5.6|3594661|27|NC_006274|CRT matches to position: 3596360-3596386, mismatch: 2, identity: 0.926

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgctcaaggtaacacgggcgctactgg	Protospacer
***************.**.********

61. spacer 5.6|3594661|27|NC_006274|CRT matches to position: 3596477-3596503, mismatch: 2, identity: 0.926

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgttcaaggtaacacgggtgctactgg	Protospacer
**.************.***********

62. spacer 5.6|3594661|27|NC_006274|CRT matches to position: 3596522-3596548, mismatch: 2, identity: 0.926

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgctcaaggtaacacgggcgctactgg	Protospacer
***************.**.********

63. spacer 5.7|3594706|18|NC_006274|CRT matches to position: 3595534-3595551, mismatch: 0, identity: 1.0

cgctcaaggtaacacagg	CRISPR spacer
cgctcaaggtaacacagg	Protospacer
******************

64. spacer 5.7|3594706|18|NC_006274|CRT matches to position: 3595327-3595344, mismatch: 1, identity: 0.944

cgctcaaggtaacacagg	CRISPR spacer
cgttcaaggtaacacagg	Protospacer
**.***************

65. spacer 5.8|3594742|18|NC_006274|CRT matches to position: 3595840-3595857, mismatch: 0, identity: 1.0

tgctcaaggtaacacggg	CRISPR spacer
tgctcaaggtaacacggg	Protospacer
******************

66. spacer 5.8|3594742|18|NC_006274|CRT matches to position: 3596189-3596206, mismatch: 0, identity: 1.0

tgctcaaggtaacacggg	CRISPR spacer
tgctcaaggtaacacggg	Protospacer
******************

67. spacer 5.8|3594742|18|NC_006274|CRT matches to position: 3596360-3596377, mismatch: 0, identity: 1.0

tgctcaaggtaacacggg	CRISPR spacer
tgctcaaggtaacacggg	Protospacer
******************

68. spacer 5.8|3594742|18|NC_006274|CRT matches to position: 3596522-3596539, mismatch: 0, identity: 1.0

tgctcaaggtaacacggg	CRISPR spacer
tgctcaaggtaacacggg	Protospacer
******************

69. spacer 5.8|3594742|18|NC_006274|CRT matches to position: 3595201-3595218, mismatch: 1, identity: 0.944

tgctcaaggtaacacggg	CRISPR spacer
tgttcaaggtaacacggg	Protospacer
**.***************

70. spacer 5.8|3594742|18|NC_006274|CRT matches to position: 3595966-3595983, mismatch: 1, identity: 0.944

tgctcaaggtaacacggg	CRISPR spacer
tgttcaaggtaacacggg	Protospacer
**.***************

71. spacer 5.8|3594742|18|NC_006274|CRT matches to position: 3596315-3596332, mismatch: 1, identity: 0.944

tgctcaaggtaacacggg	CRISPR spacer
tgttcaaggtaacacggg	Protospacer
**.***************

72. spacer 5.8|3594742|18|NC_006274|CRT matches to position: 3596477-3596494, mismatch: 1, identity: 0.944

tgctcaaggtaacacggg	CRISPR spacer
tgttcaaggtaacacggg	Protospacer
**.***************

73. spacer 5.9|3594778|27|NC_006274|CRT matches to position: 3595201-3595227, mismatch: 0, identity: 1.0

tgttcaaggtaacacgggcgctactgg	CRISPR spacer
tgttcaaggtaacacgggcgctactgg	Protospacer
***************************

74. spacer 5.9|3594778|27|NC_006274|CRT matches to position: 3595840-3595866, mismatch: 1, identity: 0.963

tgttcaaggtaacacgggcgctactgg	CRISPR spacer
tgctcaaggtaacacgggcgctactgg	Protospacer
**.************************

75. spacer 5.9|3594778|27|NC_006274|CRT matches to position: 3595966-3595992, mismatch: 1, identity: 0.963

tgttcaaggtaacacgggcgctactgg	CRISPR spacer
tgttcaaggtaacacgggtgctactgg	Protospacer
******************.********

76. spacer 5.9|3594778|27|NC_006274|CRT matches to position: 3596189-3596215, mismatch: 1, identity: 0.963

tgttcaaggtaacacgggcgctactgg	CRISPR spacer
tgctcaaggtaacacgggcgctactgg	Protospacer
**.************************

77. spacer 5.9|3594778|27|NC_006274|CRT matches to position: 3596315-3596341, mismatch: 1, identity: 0.963

tgttcaaggtaacacgggcgctactgg	CRISPR spacer
tgttcaaggtaacacgggtgctactgg	Protospacer
******************.********

78. spacer 5.9|3594778|27|NC_006274|CRT matches to position: 3596360-3596386, mismatch: 1, identity: 0.963

tgttcaaggtaacacgggcgctactgg	CRISPR spacer
tgctcaaggtaacacgggcgctactgg	Protospacer
**.************************

79. spacer 5.9|3594778|27|NC_006274|CRT matches to position: 3596477-3596503, mismatch: 1, identity: 0.963

tgttcaaggtaacacgggcgctactgg	CRISPR spacer
tgttcaaggtaacacgggtgctactgg	Protospacer
******************.********

80. spacer 5.9|3594778|27|NC_006274|CRT matches to position: 3596522-3596548, mismatch: 1, identity: 0.963

tgttcaaggtaacacgggcgctactgg	CRISPR spacer
tgctcaaggtaacacgggcgctactgg	Protospacer
**.************************

81. spacer 5.9|3594778|27|NC_006274|CRT matches to position: 3595660-3595686, mismatch: 2, identity: 0.926

tgttcaaggtaacacgggcgctactgg	CRISPR spacer
tgttcaaggtaacacaggtgctactgg	Protospacer
***************.**.********

82. spacer 5.9|3594778|27|NC_006274|CRT matches to position: 3595795-3595821, mismatch: 2, identity: 0.926

tgttcaaggtaacacgggcgctactgg	CRISPR spacer
tgttcaaggtaacacaggtgctactgg	Protospacer
***************.**.********

83. spacer 5.9|3594778|27|NC_006274|CRT matches to position: 3596144-3596170, mismatch: 2, identity: 0.926

tgttcaaggtaacacgggcgctactgg	CRISPR spacer
tgttcaaggtaacacaggtgctactgg	Protospacer
***************.**.********

84. spacer 5.10|3594823|27|NC_006274|CRT matches to position: 3595660-3595686, mismatch: 1, identity: 0.963

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgttcaaggtaacacaggtgctactgg	Protospacer
**.************************

85. spacer 5.10|3594823|27|NC_006274|CRT matches to position: 3595795-3595821, mismatch: 1, identity: 0.963

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgttcaaggtaacacaggtgctactgg	Protospacer
**.************************

86. spacer 5.10|3594823|27|NC_006274|CRT matches to position: 3596144-3596170, mismatch: 1, identity: 0.963

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgttcaaggtaacacaggtgctactgg	Protospacer
**.************************

87. spacer 5.10|3594823|27|NC_006274|CRT matches to position: 3595840-3595866, mismatch: 2, identity: 0.926

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgctcaaggtaacacgggcgctactgg	Protospacer
***************.**.********

88. spacer 5.10|3594823|27|NC_006274|CRT matches to position: 3595966-3595992, mismatch: 2, identity: 0.926

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgttcaaggtaacacgggtgctactgg	Protospacer
**.************.***********

89. spacer 5.10|3594823|27|NC_006274|CRT matches to position: 3596189-3596215, mismatch: 2, identity: 0.926

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgctcaaggtaacacgggcgctactgg	Protospacer
***************.**.********

90. spacer 5.10|3594823|27|NC_006274|CRT matches to position: 3596315-3596341, mismatch: 2, identity: 0.926

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgttcaaggtaacacgggtgctactgg	Protospacer
**.************.***********

91. spacer 5.10|3594823|27|NC_006274|CRT matches to position: 3596360-3596386, mismatch: 2, identity: 0.926

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgctcaaggtaacacgggcgctactgg	Protospacer
***************.**.********

92. spacer 5.10|3594823|27|NC_006274|CRT matches to position: 3596477-3596503, mismatch: 2, identity: 0.926

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgttcaaggtaacacgggtgctactgg	Protospacer
**.************.***********

93. spacer 5.10|3594823|27|NC_006274|CRT matches to position: 3596522-3596548, mismatch: 2, identity: 0.926

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tgctcaaggtaacacgggcgctactgg	Protospacer
***************.**.********

94. spacer 5.11|3594868|18|NC_006274|CRT matches to position: 3595840-3595857, mismatch: 0, identity: 1.0

tgctcaaggtaacacggg	CRISPR spacer
tgctcaaggtaacacggg	Protospacer
******************

95. spacer 5.11|3594868|18|NC_006274|CRT matches to position: 3596189-3596206, mismatch: 0, identity: 1.0

tgctcaaggtaacacggg	CRISPR spacer
tgctcaaggtaacacggg	Protospacer
******************

96. spacer 5.11|3594868|18|NC_006274|CRT matches to position: 3596360-3596377, mismatch: 0, identity: 1.0

tgctcaaggtaacacggg	CRISPR spacer
tgctcaaggtaacacggg	Protospacer
******************

97. spacer 5.11|3594868|18|NC_006274|CRT matches to position: 3596522-3596539, mismatch: 0, identity: 1.0

tgctcaaggtaacacggg	CRISPR spacer
tgctcaaggtaacacggg	Protospacer
******************

98. spacer 5.11|3594868|18|NC_006274|CRT matches to position: 3595201-3595218, mismatch: 1, identity: 0.944

tgctcaaggtaacacggg	CRISPR spacer
tgttcaaggtaacacggg	Protospacer
**.***************

99. spacer 5.11|3594868|18|NC_006274|CRT matches to position: 3595966-3595983, mismatch: 1, identity: 0.944

tgctcaaggtaacacggg	CRISPR spacer
tgttcaaggtaacacggg	Protospacer
**.***************

100. spacer 5.11|3594868|18|NC_006274|CRT matches to position: 3596315-3596332, mismatch: 1, identity: 0.944

tgctcaaggtaacacggg	CRISPR spacer
tgttcaaggtaacacggg	Protospacer
**.***************

101. spacer 5.11|3594868|18|NC_006274|CRT matches to position: 3596477-3596494, mismatch: 1, identity: 0.944

tgctcaaggtaacacggg	CRISPR spacer
tgttcaaggtaacacggg	Protospacer
**.***************

102. spacer 5.12|3594904|27|NC_006274|CRT matches to position: 3595282-3595308, mismatch: 1, identity: 0.963

cgctcaaggaccagcgggtgttactgg	CRISPR spacer
cgctcaaggaccagcgggtgctactgg	Protospacer
********************.******

103. spacer 5.12|3594904|27|NC_006274|CRT matches to position: 1430848-1430874, mismatch: 2, identity: 0.926

cgctcaaggaccagcgggtgttactgg	CRISPR spacer
cgctcaaggaccagccggtgctactgg	Protospacer
*************** ****.******

104. spacer 5.12|3594904|27|NC_006274|CRT matches to position: 3595372-3595398, mismatch: 2, identity: 0.926

cgctcaaggaccagcgggtgttactgg	CRISPR spacer
cgctcaaggaccagcaggtgctactgg	Protospacer
***************.****.******

105. spacer 5.13|3594949|18|NC_006274|CRT matches to position: 3595840-3595857, mismatch: 0, identity: 1.0

tgctcaaggtaacacggg	CRISPR spacer
tgctcaaggtaacacggg	Protospacer
******************

106. spacer 5.13|3594949|18|NC_006274|CRT matches to position: 3596189-3596206, mismatch: 0, identity: 1.0

tgctcaaggtaacacggg	CRISPR spacer
tgctcaaggtaacacggg	Protospacer
******************

107. spacer 5.13|3594949|18|NC_006274|CRT matches to position: 3596360-3596377, mismatch: 0, identity: 1.0

tgctcaaggtaacacggg	CRISPR spacer
tgctcaaggtaacacggg	Protospacer
******************

108. spacer 5.13|3594949|18|NC_006274|CRT matches to position: 3596522-3596539, mismatch: 0, identity: 1.0

tgctcaaggtaacacggg	CRISPR spacer
tgctcaaggtaacacggg	Protospacer
******************

109. spacer 5.13|3594949|18|NC_006274|CRT matches to position: 3595201-3595218, mismatch: 1, identity: 0.944

tgctcaaggtaacacggg	CRISPR spacer
tgttcaaggtaacacggg	Protospacer
**.***************

110. spacer 5.13|3594949|18|NC_006274|CRT matches to position: 3595966-3595983, mismatch: 1, identity: 0.944

tgctcaaggtaacacggg	CRISPR spacer
tgttcaaggtaacacggg	Protospacer
**.***************

111. spacer 5.13|3594949|18|NC_006274|CRT matches to position: 3596315-3596332, mismatch: 1, identity: 0.944

tgctcaaggtaacacggg	CRISPR spacer
tgttcaaggtaacacggg	Protospacer
**.***************

112. spacer 5.13|3594949|18|NC_006274|CRT matches to position: 3596477-3596494, mismatch: 1, identity: 0.944

tgctcaaggtaacacggg	CRISPR spacer
tgttcaaggtaacacggg	Protospacer
**.***************

113. spacer 5.14|3594985|27|NC_006274|CRT matches to position: 3595282-3595308, mismatch: 0, identity: 1.0

cgctcaaggaccagcgggtgctactgg	CRISPR spacer
cgctcaaggaccagcgggtgctactgg	Protospacer
***************************

114. spacer 5.14|3594985|27|NC_006274|CRT matches to position: 1430848-1430874, mismatch: 1, identity: 0.963

cgctcaaggaccagcgggtgctactgg	CRISPR spacer
cgctcaaggaccagccggtgctactgg	Protospacer
*************** ***********

115. spacer 5.14|3594985|27|NC_006274|CRT matches to position: 3595372-3595398, mismatch: 1, identity: 0.963

cgctcaaggaccagcgggtgctactgg	CRISPR spacer
cgctcaaggaccagcaggtgctactgg	Protospacer
***************.***********

116. spacer 5.14|3594985|27|NC_006274|CRT matches to position: 1430704-1430730, mismatch: 2, identity: 0.926

cgctcaaggaccagcgggtgctactgg	CRISPR spacer
cgttcaaggaccagcaggtgctactgg	Protospacer
**.************.***********

117. spacer 5.15|3595030|18|NC_006274|CRT matches to position: 3595660-3595677, mismatch: 1, identity: 0.944

tgctcaaggtaacacagg	CRISPR spacer
tgttcaaggtaacacagg	Protospacer
**.***************

118. spacer 5.15|3595030|18|NC_006274|CRT matches to position: 3595795-3595812, mismatch: 1, identity: 0.944

tgctcaaggtaacacagg	CRISPR spacer
tgttcaaggtaacacagg	Protospacer
**.***************

119. spacer 5.15|3595030|18|NC_006274|CRT matches to position: 3595840-3595857, mismatch: 1, identity: 0.944

tgctcaaggtaacacagg	CRISPR spacer
tgctcaaggtaacacggg	Protospacer
***************.**

120. spacer 5.15|3595030|18|NC_006274|CRT matches to position: 3596144-3596161, mismatch: 1, identity: 0.944

tgctcaaggtaacacagg	CRISPR spacer
tgttcaaggtaacacagg	Protospacer
**.***************

121. spacer 5.15|3595030|18|NC_006274|CRT matches to position: 3596189-3596206, mismatch: 1, identity: 0.944

tgctcaaggtaacacagg	CRISPR spacer
tgctcaaggtaacacggg	Protospacer
***************.**

122. spacer 5.15|3595030|18|NC_006274|CRT matches to position: 3596360-3596377, mismatch: 1, identity: 0.944

tgctcaaggtaacacagg	CRISPR spacer
tgctcaaggtaacacggg	Protospacer
***************.**

123. spacer 5.15|3595030|18|NC_006274|CRT matches to position: 3596522-3596539, mismatch: 1, identity: 0.944

tgctcaaggtaacacagg	CRISPR spacer
tgctcaaggtaacacggg	Protospacer
***************.**

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_006274_5	5.1\|3594436\|27\|NC_006274\|CRT	3594436-3594462	27	JQ691611	Cronobacter phage CR9, complete genome	9702-9728	3	0.889
NC_006274_5	5.1\|3594436\|27\|NC_006274\|CRT	3594436-3594462	27	MN101228	Klebsiella phage KPN4, complete genome	27720-27746	3	0.889
NC_006274_5	5.1\|3594436\|27\|NC_006274\|CRT	3594436-3594462	27	MN163280	Klebsiella phage KpGranit, complete genome	83373-83399	3	0.889
NC_006274_5	5.1\|3594436\|27\|NC_006274\|CRT	3594436-3594462	27	MN163280	Klebsiella phage KpGranit, complete genome	84576-84602	3	0.889
NC_006274_5	5.2\|3594481\|27\|NC_006274\|CRT	3594481-3594507	27	JQ691611	Cronobacter phage CR9, complete genome	9702-9728	3	0.889
NC_006274_5	5.2\|3594481\|27\|NC_006274\|CRT	3594481-3594507	27	MN101228	Klebsiella phage KPN4, complete genome	27720-27746	3	0.889
NC_006274_5	5.2\|3594481\|27\|NC_006274\|CRT	3594481-3594507	27	MN163280	Klebsiella phage KpGranit, complete genome	83373-83399	3	0.889
NC_006274_5	5.2\|3594481\|27\|NC_006274\|CRT	3594481-3594507	27	MN163280	Klebsiella phage KpGranit, complete genome	84576-84602	3	0.889
NC_006274_5	5.3\|3594526\|27\|NC_006274\|CRT	3594526-3594552	27	JQ691611	Cronobacter phage CR9, complete genome	9702-9728	3	0.889
NC_006274_5	5.3\|3594526\|27\|NC_006274\|CRT	3594526-3594552	27	MN101228	Klebsiella phage KPN4, complete genome	27720-27746	3	0.889
NC_006274_5	5.3\|3594526\|27\|NC_006274\|CRT	3594526-3594552	27	MN163280	Klebsiella phage KpGranit, complete genome	83373-83399	3	0.889
NC_006274_5	5.3\|3594526\|27\|NC_006274\|CRT	3594526-3594552	27	MN163280	Klebsiella phage KpGranit, complete genome	84576-84602	3	0.889
NC_006274_5	5.4\|3594571\|27\|NC_006274\|CRT	3594571-3594597	27	JQ691611	Cronobacter phage CR9, complete genome	9702-9728	3	0.889
NC_006274_5	5.4\|3594571\|27\|NC_006274\|CRT	3594571-3594597	27	MN101228	Klebsiella phage KPN4, complete genome	27720-27746	3	0.889
NC_006274_5	5.4\|3594571\|27\|NC_006274\|CRT	3594571-3594597	27	MN163280	Klebsiella phage KpGranit, complete genome	83373-83399	3	0.889
NC_006274_5	5.4\|3594571\|27\|NC_006274\|CRT	3594571-3594597	27	MN163280	Klebsiella phage KpGranit, complete genome	84576-84602	3	0.889
NC_006274_5	5.6\|3594661\|27\|NC_006274\|CRT	3594661-3594687	27	JQ691611	Cronobacter phage CR9, complete genome	9702-9728	3	0.889
NC_006274_5	5.6\|3594661\|27\|NC_006274\|CRT	3594661-3594687	27	MN101228	Klebsiella phage KPN4, complete genome	27720-27746	3	0.889
NC_006274_5	5.6\|3594661\|27\|NC_006274\|CRT	3594661-3594687	27	MN163280	Klebsiella phage KpGranit, complete genome	83373-83399	3	0.889
NC_006274_5	5.6\|3594661\|27\|NC_006274\|CRT	3594661-3594687	27	MN163280	Klebsiella phage KpGranit, complete genome	84576-84602	3	0.889
NC_006274_5	5.10\|3594823\|27\|NC_006274\|CRT	3594823-3594849	27	JQ691611	Cronobacter phage CR9, complete genome	9702-9728	3	0.889
NC_006274_5	5.10\|3594823\|27\|NC_006274\|CRT	3594823-3594849	27	MN101228	Klebsiella phage KPN4, complete genome	27720-27746	3	0.889
NC_006274_5	5.10\|3594823\|27\|NC_006274\|CRT	3594823-3594849	27	MN163280	Klebsiella phage KpGranit, complete genome	83373-83399	3	0.889
NC_006274_5	5.10\|3594823\|27\|NC_006274\|CRT	3594823-3594849	27	MN163280	Klebsiella phage KpGranit, complete genome	84576-84602	3	0.889
NC_006274_5	5.14\|3594985\|27\|NC_006274\|CRT	3594985-3595011	27	KU716094	Mycobacterium phage Eidsmoe, complete genome	5025-5051	3	0.889
NC_006274_5	5.14\|3594985\|27\|NC_006274\|CRT	3594985-3595011	27	MH371122	Mycobacterium phage Priya, complete genome	5026-5052	3	0.889
NC_006274_5	5.14\|3594985\|27\|NC_006274\|CRT	3594985-3595011	27	NC_023716	Mycobacterium virus Alma, complete genome	5026-5052	3	0.889
NC_006274_5	5.14\|3594985\|27\|NC_006274\|CRT	3594985-3595011	27	MG872835	Mycobacterium phage Conquerage, complete genome	5025-5051	3	0.889
NC_006274_5	5.1\|3594436\|27\|NC_006274\|CRT	3594436-3594462	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	81955-81981	4	0.852
NC_006274_5	5.1\|3594436\|27\|NC_006274\|CRT	3594436-3594462	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	85222-85248	4	0.852
NC_006274_5	5.1\|3594436\|27\|NC_006274\|CRT	3594436-3594462	27	MN163280	Klebsiella phage KpGranit, complete genome	81270-81296	4	0.852
NC_006274_5	5.1\|3594436\|27\|NC_006274\|CRT	3594436-3594462	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	76467-76493	4	0.852
NC_006274_5	5.1\|3594436\|27\|NC_006274\|CRT	3594436-3594462	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	78603-78629	4	0.852
NC_006274_5	5.1\|3594436\|27\|NC_006274\|CRT	3594436-3594462	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	79815-79841	4	0.852
NC_006274_5	5.1\|3594436\|27\|NC_006274\|CRT	3594436-3594462	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	80972-80998	4	0.852
NC_006274_5	5.1\|3594436\|27\|NC_006274\|CRT	3594436-3594462	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	83108-83134	4	0.852
NC_006274_5	5.1\|3594436\|27\|NC_006274\|CRT	3594436-3594462	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	84320-84346	4	0.852
NC_006274_5	5.2\|3594481\|27\|NC_006274\|CRT	3594481-3594507	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	81955-81981	4	0.852
NC_006274_5	5.2\|3594481\|27\|NC_006274\|CRT	3594481-3594507	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	85222-85248	4	0.852
NC_006274_5	5.2\|3594481\|27\|NC_006274\|CRT	3594481-3594507	27	MN163280	Klebsiella phage KpGranit, complete genome	81270-81296	4	0.852
NC_006274_5	5.2\|3594481\|27\|NC_006274\|CRT	3594481-3594507	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	76467-76493	4	0.852
NC_006274_5	5.2\|3594481\|27\|NC_006274\|CRT	3594481-3594507	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	78603-78629	4	0.852
NC_006274_5	5.2\|3594481\|27\|NC_006274\|CRT	3594481-3594507	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	79815-79841	4	0.852
NC_006274_5	5.2\|3594481\|27\|NC_006274\|CRT	3594481-3594507	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	80972-80998	4	0.852
NC_006274_5	5.2\|3594481\|27\|NC_006274\|CRT	3594481-3594507	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	83108-83134	4	0.852
NC_006274_5	5.2\|3594481\|27\|NC_006274\|CRT	3594481-3594507	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	84320-84346	4	0.852
NC_006274_5	5.3\|3594526\|27\|NC_006274\|CRT	3594526-3594552	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	81955-81981	4	0.852
NC_006274_5	5.3\|3594526\|27\|NC_006274\|CRT	3594526-3594552	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	85222-85248	4	0.852
NC_006274_5	5.3\|3594526\|27\|NC_006274\|CRT	3594526-3594552	27	MN163280	Klebsiella phage KpGranit, complete genome	81270-81296	4	0.852
NC_006274_5	5.3\|3594526\|27\|NC_006274\|CRT	3594526-3594552	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	76467-76493	4	0.852
NC_006274_5	5.3\|3594526\|27\|NC_006274\|CRT	3594526-3594552	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	78603-78629	4	0.852
NC_006274_5	5.3\|3594526\|27\|NC_006274\|CRT	3594526-3594552	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	79815-79841	4	0.852
NC_006274_5	5.3\|3594526\|27\|NC_006274\|CRT	3594526-3594552	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	80972-80998	4	0.852
NC_006274_5	5.3\|3594526\|27\|NC_006274\|CRT	3594526-3594552	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	83108-83134	4	0.852
NC_006274_5	5.3\|3594526\|27\|NC_006274\|CRT	3594526-3594552	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	84320-84346	4	0.852
NC_006274_5	5.4\|3594571\|27\|NC_006274\|CRT	3594571-3594597	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	81955-81981	4	0.852
NC_006274_5	5.4\|3594571\|27\|NC_006274\|CRT	3594571-3594597	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	85222-85248	4	0.852
NC_006274_5	5.4\|3594571\|27\|NC_006274\|CRT	3594571-3594597	27	MN163280	Klebsiella phage KpGranit, complete genome	81270-81296	4	0.852
NC_006274_5	5.4\|3594571\|27\|NC_006274\|CRT	3594571-3594597	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	76467-76493	4	0.852
NC_006274_5	5.4\|3594571\|27\|NC_006274\|CRT	3594571-3594597	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	78603-78629	4	0.852
NC_006274_5	5.4\|3594571\|27\|NC_006274\|CRT	3594571-3594597	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	79815-79841	4	0.852
NC_006274_5	5.4\|3594571\|27\|NC_006274\|CRT	3594571-3594597	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	80972-80998	4	0.852
NC_006274_5	5.4\|3594571\|27\|NC_006274\|CRT	3594571-3594597	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	83108-83134	4	0.852
NC_006274_5	5.4\|3594571\|27\|NC_006274\|CRT	3594571-3594597	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	84320-84346	4	0.852
NC_006274_5	5.6\|3594661\|27\|NC_006274\|CRT	3594661-3594687	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	81955-81981	4	0.852
NC_006274_5	5.6\|3594661\|27\|NC_006274\|CRT	3594661-3594687	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	85222-85248	4	0.852
NC_006274_5	5.6\|3594661\|27\|NC_006274\|CRT	3594661-3594687	27	MN163280	Klebsiella phage KpGranit, complete genome	81270-81296	4	0.852
NC_006274_5	5.6\|3594661\|27\|NC_006274\|CRT	3594661-3594687	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	76467-76493	4	0.852
NC_006274_5	5.6\|3594661\|27\|NC_006274\|CRT	3594661-3594687	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	78603-78629	4	0.852
NC_006274_5	5.6\|3594661\|27\|NC_006274\|CRT	3594661-3594687	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	79815-79841	4	0.852
NC_006274_5	5.6\|3594661\|27\|NC_006274\|CRT	3594661-3594687	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	80972-80998	4	0.852
NC_006274_5	5.6\|3594661\|27\|NC_006274\|CRT	3594661-3594687	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	83108-83134	4	0.852
NC_006274_5	5.6\|3594661\|27\|NC_006274\|CRT	3594661-3594687	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	84320-84346	4	0.852
NC_006274_5	5.10\|3594823\|27\|NC_006274\|CRT	3594823-3594849	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	81955-81981	4	0.852
NC_006274_5	5.10\|3594823\|27\|NC_006274\|CRT	3594823-3594849	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	85222-85248	4	0.852
NC_006274_5	5.10\|3594823\|27\|NC_006274\|CRT	3594823-3594849	27	MN163280	Klebsiella phage KpGranit, complete genome	81270-81296	4	0.852
NC_006274_5	5.10\|3594823\|27\|NC_006274\|CRT	3594823-3594849	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	76467-76493	4	0.852
NC_006274_5	5.10\|3594823\|27\|NC_006274\|CRT	3594823-3594849	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	78603-78629	4	0.852
NC_006274_5	5.10\|3594823\|27\|NC_006274\|CRT	3594823-3594849	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	79815-79841	4	0.852
NC_006274_5	5.10\|3594823\|27\|NC_006274\|CRT	3594823-3594849	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	80972-80998	4	0.852
NC_006274_5	5.10\|3594823\|27\|NC_006274\|CRT	3594823-3594849	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	83108-83134	4	0.852
NC_006274_5	5.10\|3594823\|27\|NC_006274\|CRT	3594823-3594849	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	84320-84346	4	0.852
NC_006274_5	5.14\|3594985\|27\|NC_006274\|CRT	3594985-3595011	27	NZ_CP023408	Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence	650048-650074	4	0.852
NC_006274_5	5.14\|3594985\|27\|NC_006274\|CRT	3594985-3595011	27	AP014476	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, * SEQUENCING IN PROGRESS *, 2 ordered pieces	17319-17345	4	0.852
NC_006274_5	5.14\|3594985\|27\|NC_006274\|CRT	3594985-3595011	27	AP013564	Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5-MedDCM-OCT-S33-C6, * SEQUENCING IN PROGRESS *, 4 ordered pieces	9183-9209	4	0.852
NC_006274_5	5.14\|3594985\|27\|NC_006274\|CRT	3594985-3595011	27	AP013944	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, * SEQUENCING IN PROGRESS *	9013-9039	4	0.852
NC_006274_5	5.14\|3594985\|27\|NC_006274\|CRT	3594985-3595011	27	AP013943	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S40-C165, * SEQUENCING IN PROGRESS *	9785-9811	4	0.852
NC_006274_5	5.14\|3594985\|27\|NC_006274\|CRT	3594985-3595011	27	AP013942	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, * SEQUENCING IN PROGRESS *	14919-14945	4	0.852
NC_006274_5	5.14\|3594985\|27\|NC_006274\|CRT	3594985-3595011	27	AP013945	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, * SEQUENCING IN PROGRESS *	4482-4508	4	0.852
NC_006274_3	3.4\|2111440\|30\|NC_006274\|CRT	2111440-2111469	30	NZ_CP004877	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence	373741-373770	5	0.833
NC_006274_5	5.1\|3594436\|27\|NC_006274\|CRT	3594436-3594462	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3951-3977	5	0.815
NC_006274_5	5.1\|3594436\|27\|NC_006274\|CRT	3594436-3594462	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29528-29554	5	0.815
NC_006274_5	5.2\|3594481\|27\|NC_006274\|CRT	3594481-3594507	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3951-3977	5	0.815
NC_006274_5	5.2\|3594481\|27\|NC_006274\|CRT	3594481-3594507	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29528-29554	5	0.815
NC_006274_5	5.3\|3594526\|27\|NC_006274\|CRT	3594526-3594552	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3951-3977	5	0.815
NC_006274_5	5.3\|3594526\|27\|NC_006274\|CRT	3594526-3594552	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29528-29554	5	0.815
NC_006274_5	5.4\|3594571\|27\|NC_006274\|CRT	3594571-3594597	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3951-3977	5	0.815
NC_006274_5	5.4\|3594571\|27\|NC_006274\|CRT	3594571-3594597	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29528-29554	5	0.815
NC_006274_5	5.6\|3594661\|27\|NC_006274\|CRT	3594661-3594687	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3951-3977	5	0.815
NC_006274_5	5.6\|3594661\|27\|NC_006274\|CRT	3594661-3594687	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29528-29554	5	0.815
NC_006274_5	5.10\|3594823\|27\|NC_006274\|CRT	3594823-3594849	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3951-3977	5	0.815
NC_006274_5	5.10\|3594823\|27\|NC_006274\|CRT	3594823-3594849	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29528-29554	5	0.815
NC_006274_3	3.4\|2111440\|30\|NC_006274\|CRT	2111440-2111469	30	NZ_CP010730	Phaeobacter inhibens strain P88 plasmid pP88_e, complete sequence	25847-25876	7	0.767
NC_006274_3	3.4\|2111440\|30\|NC_006274\|CRT	2111440-2111469	30	NZ_CP010640	Phaeobacter gallaeciensis strain P73 plasmid pP73_d, complete sequence	25847-25876	7	0.767
NC_006274_3	3.4\|2111440\|30\|NC_006274\|CRT	2111440-2111469	30	NC_023141	Phaeobacter gallaeciensis DSM 26640 plasmid pGal_E78, complete sequence	53606-53635	7	0.767
NC_006274_3	3.4\|2111440\|30\|NC_006274\|CRT	2111440-2111469	30	NC_009543	Xanthomonas phage Xop411, complete genome	11989-12018	7	0.767
NC_006274_3	3.4\|2111440\|30\|NC_006274\|CRT	2111440-2111469	30	NC_004902	Xanthomonas phage Xp10, complete genome	12950-12979	7	0.767
NC_006274_3	3.4\|2111440\|30\|NC_006274\|CRT	2111440-2111469	30	AY299121	Xanthomonas oryzae bacteriophage Xp10 genomic DNA, complete genome	12950-12979	7	0.767
NC_006274_3	3.2\|2111356\|30\|NC_006274\|CRT	2111356-2111385	30	NC_048850	Mycobacterium phage Cornie, complete genome	11405-11434	8	0.733

1. spacer 5.1|3594436|27|NC_006274|CRT matches to JQ691611 (Cronobacter phage CR9, complete genome) position: , mismatch: 3, identity: 0.889

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tcctcaaggtaacacaggtcctaccgg	Protospacer
* ***************** ****.**

2. spacer 5.1|3594436|27|NC_006274|CRT matches to MN101228 (Klebsiella phage KPN4, complete genome) position: , mismatch: 3, identity: 0.889

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tcctcagggtaacactggtgctactgg	Protospacer
* ****.******** ***********

3. spacer 5.1|3594436|27|NC_006274|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 3, identity: 0.889

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacacaggtgctactgg	Protospacer
* * **.********************

4. spacer 5.1|3594436|27|NC_006274|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 3, identity: 0.889

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacacaggtgctactgg	Protospacer
* * **.********************

5. spacer 5.2|3594481|27|NC_006274|CRT matches to JQ691611 (Cronobacter phage CR9, complete genome) position: , mismatch: 3, identity: 0.889

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tcctcaaggtaacacaggtcctaccgg	Protospacer
* ***************** ****.**

6. spacer 5.2|3594481|27|NC_006274|CRT matches to MN101228 (Klebsiella phage KPN4, complete genome) position: , mismatch: 3, identity: 0.889

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tcctcagggtaacactggtgctactgg	Protospacer
* ****.******** ***********

7. spacer 5.2|3594481|27|NC_006274|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 3, identity: 0.889

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacacaggtgctactgg	Protospacer
* * **.********************

8. spacer 5.2|3594481|27|NC_006274|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 3, identity: 0.889

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacacaggtgctactgg	Protospacer
* * **.********************

9. spacer 5.3|3594526|27|NC_006274|CRT matches to JQ691611 (Cronobacter phage CR9, complete genome) position: , mismatch: 3, identity: 0.889

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tcctcaaggtaacacaggtcctaccgg	Protospacer
* ***************** ****.**

10. spacer 5.3|3594526|27|NC_006274|CRT matches to MN101228 (Klebsiella phage KPN4, complete genome) position: , mismatch: 3, identity: 0.889

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tcctcagggtaacactggtgctactgg	Protospacer
* ****.******** ***********

11. spacer 5.3|3594526|27|NC_006274|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 3, identity: 0.889

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacacaggtgctactgg	Protospacer
* * **.********************

12. spacer 5.3|3594526|27|NC_006274|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 3, identity: 0.889

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacacaggtgctactgg	Protospacer
* * **.********************

13. spacer 5.4|3594571|27|NC_006274|CRT matches to JQ691611 (Cronobacter phage CR9, complete genome) position: , mismatch: 3, identity: 0.889

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tcctcaaggtaacacaggtcctaccgg	Protospacer
* ***************** ****.**

14. spacer 5.4|3594571|27|NC_006274|CRT matches to MN101228 (Klebsiella phage KPN4, complete genome) position: , mismatch: 3, identity: 0.889

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tcctcagggtaacactggtgctactgg	Protospacer
* ****.******** ***********

15. spacer 5.4|3594571|27|NC_006274|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 3, identity: 0.889

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacacaggtgctactgg	Protospacer
* * **.********************

16. spacer 5.4|3594571|27|NC_006274|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 3, identity: 0.889

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacacaggtgctactgg	Protospacer
* * **.********************

17. spacer 5.6|3594661|27|NC_006274|CRT matches to JQ691611 (Cronobacter phage CR9, complete genome) position: , mismatch: 3, identity: 0.889

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tcctcaaggtaacacaggtcctaccgg	Protospacer
* ***************** ****.**

18. spacer 5.6|3594661|27|NC_006274|CRT matches to MN101228 (Klebsiella phage KPN4, complete genome) position: , mismatch: 3, identity: 0.889

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tcctcagggtaacactggtgctactgg	Protospacer
* ****.******** ***********

19. spacer 5.6|3594661|27|NC_006274|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 3, identity: 0.889

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacacaggtgctactgg	Protospacer
* * **.********************

20. spacer 5.6|3594661|27|NC_006274|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 3, identity: 0.889

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacacaggtgctactgg	Protospacer
* * **.********************

21. spacer 5.10|3594823|27|NC_006274|CRT matches to JQ691611 (Cronobacter phage CR9, complete genome) position: , mismatch: 3, identity: 0.889

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tcctcaaggtaacacaggtcctaccgg	Protospacer
* ***************** ****.**

22. spacer 5.10|3594823|27|NC_006274|CRT matches to MN101228 (Klebsiella phage KPN4, complete genome) position: , mismatch: 3, identity: 0.889

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tcctcagggtaacactggtgctactgg	Protospacer
* ****.******** ***********

23. spacer 5.10|3594823|27|NC_006274|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 3, identity: 0.889

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacacaggtgctactgg	Protospacer
* * **.********************

24. spacer 5.10|3594823|27|NC_006274|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 3, identity: 0.889

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacacaggtgctactgg	Protospacer
* * **.********************

25. spacer 5.14|3594985|27|NC_006274|CRT matches to KU716094 (Mycobacterium phage Eidsmoe, complete genome) position: , mismatch: 3, identity: 0.889

cgctcaaggaccagcgggtgctactgg	CRISPR spacer
ggctcagggaccagcgggcgctactgg	Protospacer
 *****.***********.********

26. spacer 5.14|3594985|27|NC_006274|CRT matches to MH371122 (Mycobacterium phage Priya, complete genome) position: , mismatch: 3, identity: 0.889

cgctcaaggaccagcgggtgctactgg	CRISPR spacer
ggctcagggaccagcgggcgctactgg	Protospacer
 *****.***********.********

27. spacer 5.14|3594985|27|NC_006274|CRT matches to NC_023716 (Mycobacterium virus Alma, complete genome) position: , mismatch: 3, identity: 0.889

cgctcaaggaccagcgggtgctactgg	CRISPR spacer
ggctcagggaccagcgggcgctactgg	Protospacer
 *****.***********.********

28. spacer 5.14|3594985|27|NC_006274|CRT matches to MG872835 (Mycobacterium phage Conquerage, complete genome) position: , mismatch: 3, identity: 0.889

cgctcaaggaccagcgggtgctactgg	CRISPR spacer
ggctcagggaccagcgggcgctactgg	Protospacer
 *****.***********.********

29. spacer 5.1|3594436|27|NC_006274|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
ccctcagggtaacactggtgctactgg	Protospacer
. ****.******** ***********

30. spacer 5.1|3594436|27|NC_006274|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacaaggtaacaaaggtgatactgg	Protospacer
* * ********** ***** ******

31. spacer 5.1|3594436|27|NC_006274|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacaccggtgctactgg	Protospacer
* * **.******** ***********

32. spacer 5.1|3594436|27|NC_006274|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
* * **.******** ***********

33. spacer 5.1|3594436|27|NC_006274|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
* * **.******** ***********

34. spacer 5.1|3594436|27|NC_006274|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccgcagggtaacactggtgctactgg	Protospacer
* * **.******** ***********

35. spacer 5.1|3594436|27|NC_006274|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
* * **.******** ***********

36. spacer 5.1|3594436|27|NC_006274|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
* * **.******** ***********

37. spacer 5.1|3594436|27|NC_006274|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccgcagggtaacactggtgctactgg	Protospacer
* * **.******** ***********

38. spacer 5.2|3594481|27|NC_006274|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
ccctcagggtaacactggtgctactgg	Protospacer
. ****.******** ***********

39. spacer 5.2|3594481|27|NC_006274|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacaaggtaacaaaggtgatactgg	Protospacer
* * ********** ***** ******

40. spacer 5.2|3594481|27|NC_006274|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacaccggtgctactgg	Protospacer
* * **.******** ***********

41. spacer 5.2|3594481|27|NC_006274|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
* * **.******** ***********

42. spacer 5.2|3594481|27|NC_006274|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
* * **.******** ***********

43. spacer 5.2|3594481|27|NC_006274|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccgcagggtaacactggtgctactgg	Protospacer
* * **.******** ***********

44. spacer 5.2|3594481|27|NC_006274|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
* * **.******** ***********

45. spacer 5.2|3594481|27|NC_006274|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
* * **.******** ***********

46. spacer 5.2|3594481|27|NC_006274|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccgcagggtaacactggtgctactgg	Protospacer
* * **.******** ***********

47. spacer 5.3|3594526|27|NC_006274|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
ccctcagggtaacactggtgctactgg	Protospacer
. ****.******** ***********

48. spacer 5.3|3594526|27|NC_006274|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacaaggtaacaaaggtgatactgg	Protospacer
* * ********** ***** ******

49. spacer 5.3|3594526|27|NC_006274|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacaccggtgctactgg	Protospacer
* * **.******** ***********

50. spacer 5.3|3594526|27|NC_006274|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
* * **.******** ***********

51. spacer 5.3|3594526|27|NC_006274|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
* * **.******** ***********

52. spacer 5.3|3594526|27|NC_006274|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccgcagggtaacactggtgctactgg	Protospacer
* * **.******** ***********

53. spacer 5.3|3594526|27|NC_006274|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
* * **.******** ***********

54. spacer 5.3|3594526|27|NC_006274|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
* * **.******** ***********

55. spacer 5.3|3594526|27|NC_006274|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccgcagggtaacactggtgctactgg	Protospacer
* * **.******** ***********

56. spacer 5.4|3594571|27|NC_006274|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
ccctcagggtaacactggtgctactgg	Protospacer
. ****.******** ***********

57. spacer 5.4|3594571|27|NC_006274|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacaaggtaacaaaggtgatactgg	Protospacer
* * ********** ***** ******

58. spacer 5.4|3594571|27|NC_006274|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacaccggtgctactgg	Protospacer
* * **.******** ***********

59. spacer 5.4|3594571|27|NC_006274|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
* * **.******** ***********

60. spacer 5.4|3594571|27|NC_006274|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
* * **.******** ***********

61. spacer 5.4|3594571|27|NC_006274|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccgcagggtaacactggtgctactgg	Protospacer
* * **.******** ***********

62. spacer 5.4|3594571|27|NC_006274|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
* * **.******** ***********

63. spacer 5.4|3594571|27|NC_006274|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
* * **.******** ***********

64. spacer 5.4|3594571|27|NC_006274|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccgcagggtaacactggtgctactgg	Protospacer
* * **.******** ***********

65. spacer 5.6|3594661|27|NC_006274|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
ccctcagggtaacactggtgctactgg	Protospacer
. ****.******** ***********

66. spacer 5.6|3594661|27|NC_006274|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacaaggtaacaaaggtgatactgg	Protospacer
* * ********** ***** ******

67. spacer 5.6|3594661|27|NC_006274|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacaccggtgctactgg	Protospacer
* * **.******** ***********

68. spacer 5.6|3594661|27|NC_006274|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
* * **.******** ***********

69. spacer 5.6|3594661|27|NC_006274|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
* * **.******** ***********

70. spacer 5.6|3594661|27|NC_006274|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccgcagggtaacactggtgctactgg	Protospacer
* * **.******** ***********

71. spacer 5.6|3594661|27|NC_006274|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
* * **.******** ***********

72. spacer 5.6|3594661|27|NC_006274|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
* * **.******** ***********

73. spacer 5.6|3594661|27|NC_006274|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccgcagggtaacactggtgctactgg	Protospacer
* * **.******** ***********

74. spacer 5.10|3594823|27|NC_006274|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
ccctcagggtaacactggtgctactgg	Protospacer
. ****.******** ***********

75. spacer 5.10|3594823|27|NC_006274|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacaaggtaacaaaggtgatactgg	Protospacer
* * ********** ***** ******

76. spacer 5.10|3594823|27|NC_006274|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacaccggtgctactgg	Protospacer
* * **.******** ***********

77. spacer 5.10|3594823|27|NC_006274|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
* * **.******** ***********

78. spacer 5.10|3594823|27|NC_006274|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
* * **.******** ***********

79. spacer 5.10|3594823|27|NC_006274|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccgcagggtaacactggtgctactgg	Protospacer
* * **.******** ***********

80. spacer 5.10|3594823|27|NC_006274|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
* * **.******** ***********

81. spacer 5.10|3594823|27|NC_006274|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
* * **.******** ***********

82. spacer 5.10|3594823|27|NC_006274|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 4, identity: 0.852

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
tccgcagggtaacactggtgctactgg	Protospacer
* * **.******** ***********

83. spacer 5.14|3594985|27|NC_006274|CRT matches to NZ_CP023408 (Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence) position: , mismatch: 4, identity: 0.852

cgctcaaggaccagcgggtgctactgg	CRISPR spacer
agctcaaggaccagctggtgctgctga	Protospacer
 ************** ******.***.

84. spacer 5.14|3594985|27|NC_006274|CRT matches to AP014476 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, *** SEQUENCING IN PROGRESS ***, 2 ordered pieces) position: , mismatch: 4, identity: 0.852

cgctcaaggaccagcgggtgctactgg	CRISPR spacer
gcctcaaggaccagcaggtgcaactgg	Protospacer
  *************.***** *****

85. spacer 5.14|3594985|27|NC_006274|CRT matches to AP013564 (Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5-MedDCM-OCT-S33-C6, *** SEQUENCING IN PROGRESS ***, 4 ordered pieces) position: , mismatch: 4, identity: 0.852

cgctcaaggaccagcgggtgctactgg	CRISPR spacer
gcctcaaggaccagcaggtgcaactgg	Protospacer
  *************.***** *****

86. spacer 5.14|3594985|27|NC_006274|CRT matches to AP013944 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

cgctcaaggaccagcgggtgctactgg	CRISPR spacer
gcctcaaggaccagcaggtgcaactgg	Protospacer
  *************.***** *****

87. spacer 5.14|3594985|27|NC_006274|CRT matches to AP013943 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S40-C165, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

cgctcaaggaccagcgggtgctactgg	CRISPR spacer
gcctcaaggaccagcaggtgcaactgg	Protospacer
  *************.***** *****

88. spacer 5.14|3594985|27|NC_006274|CRT matches to AP013942 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

cgctcaaggaccagcgggtgctactgg	CRISPR spacer
gcctcaaggaccagcaggtgcaactgg	Protospacer
  *************.***** *****

89. spacer 5.14|3594985|27|NC_006274|CRT matches to AP013945 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

cgctcaaggaccagcgggtgctactgg	CRISPR spacer
gcctcaaggaccagcaggtgcaactgg	Protospacer
  *************.***** *****

90. spacer 3.4|2111440|30|NC_006274|CRT matches to NZ_CP004877 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence) position: , mismatch: 5, identity: 0.833

agccagatacaaagccagatacaaacccgg	CRISPR spacer
agccagaaacaaagccagagacaaagacag	Protospacer
******* *********** *****  *.*

91. spacer 5.1|3594436|27|NC_006274|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
accacaaggtaatacaggagctactgg	Protospacer
  * ********.***** ********

92. spacer 5.1|3594436|27|NC_006274|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 5, identity: 0.815

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
accacaaggtaatacaggagctactgg	Protospacer
  * ********.***** ********

93. spacer 5.2|3594481|27|NC_006274|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
accacaaggtaatacaggagctactgg	Protospacer
  * ********.***** ********

94. spacer 5.2|3594481|27|NC_006274|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 5, identity: 0.815

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
accacaaggtaatacaggagctactgg	Protospacer
  * ********.***** ********

95. spacer 5.3|3594526|27|NC_006274|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
accacaaggtaatacaggagctactgg	Protospacer
  * ********.***** ********

96. spacer 5.3|3594526|27|NC_006274|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 5, identity: 0.815

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
accacaaggtaatacaggagctactgg	Protospacer
  * ********.***** ********

97. spacer 5.4|3594571|27|NC_006274|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
accacaaggtaatacaggagctactgg	Protospacer
  * ********.***** ********

98. spacer 5.4|3594571|27|NC_006274|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 5, identity: 0.815

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
accacaaggtaatacaggagctactgg	Protospacer
  * ********.***** ********

99. spacer 5.6|3594661|27|NC_006274|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
accacaaggtaatacaggagctactgg	Protospacer
  * ********.***** ********

100. spacer 5.6|3594661|27|NC_006274|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 5, identity: 0.815

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
accacaaggtaatacaggagctactgg	Protospacer
  * ********.***** ********

101. spacer 5.10|3594823|27|NC_006274|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
accacaaggtaatacaggagctactgg	Protospacer
  * ********.***** ********

102. spacer 5.10|3594823|27|NC_006274|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 5, identity: 0.815

tgctcaaggtaacacaggtgctactgg	CRISPR spacer
accacaaggtaatacaggagctactgg	Protospacer
  * ********.***** ********

103. spacer 3.4|2111440|30|NC_006274|CRT matches to NZ_CP010730 (Phaeobacter inhibens strain P88 plasmid pP88_e, complete sequence) position: , mismatch: 7, identity: 0.767

-agccagatacaaagccagatacaaacccgg	CRISPR spacer
caaccgcgc-caaagccagaaacaaacccgg	Protospacer
 *.**. .. ********** **********

104. spacer 3.4|2111440|30|NC_006274|CRT matches to NZ_CP010640 (Phaeobacter gallaeciensis strain P73 plasmid pP73_d, complete sequence) position: , mismatch: 7, identity: 0.767

-agccagatacaaagccagatacaaacccgg	CRISPR spacer
caaccgcgc-caaagccagaaacaaacccgg	Protospacer
 *.**. .. ********** **********

105. spacer 3.4|2111440|30|NC_006274|CRT matches to NC_023141 (Phaeobacter gallaeciensis DSM 26640 plasmid pGal_E78, complete sequence) position: , mismatch: 7, identity: 0.767

-agccagatacaaagccagatacaaacccgg	CRISPR spacer
caaccgcgc-caaagccagaaacaaacccgg	Protospacer
 *.**. .. ********** **********

106. spacer 3.4|2111440|30|NC_006274|CRT matches to NC_009543 (Xanthomonas phage Xop411, complete genome) position: , mismatch: 7, identity: 0.767

agccagatacaaagccagatacaaacccgg	CRISPR spacer
cgccagatgcaaagccagatactgcaccag	Protospacer
 *******.************* .  **.*

107. spacer 3.4|2111440|30|NC_006274|CRT matches to NC_004902 (Xanthomonas phage Xp10, complete genome) position: , mismatch: 7, identity: 0.767

agccagatacaaagccagatacaaacccgg	CRISPR spacer
cgccagatgcaaagccagatactgcaccag	Protospacer
 *******.************* .  **.*

108. spacer 3.4|2111440|30|NC_006274|CRT matches to AY299121 (Xanthomonas oryzae bacteriophage Xp10 genomic DNA, complete genome) position: , mismatch: 7, identity: 0.767

agccagatacaaagccagatacaaacccgg	CRISPR spacer
cgccagatgcaaagccagatactgcaccag	Protospacer
 *******.************* .  **.*

109. spacer 3.2|2111356|30|NC_006274|CRT matches to NC_048850 (Mycobacterium phage Cornie, complete genome) position: , mismatch: 8, identity: 0.733

agccagatacaaacccggatacaaagccag	CRISPR spacer
tcgctgacacaaacccggatacaaacccca	Protospacer
   * **.***************** ** .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

262030 : 271725

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001029999.1\|262030_263665_+	chaperonin GroEL	A0A219YK78	uncultured_virus	2.0e-157	58.2
WP_000483525.1\|263950_264997_+	hypothetical protein	A0A2H4J389	uncultured_Caudovirales_phage	1.4e-34	49.7
WP_000481696.1\|265017_265473_+	SMI1/KNR4 family protein	NA	NA	NA	NA
WP_162837124.1\|266138_267680_+	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	3.4e-21	31.2
WP_000833092.1\|268064_269390_+	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	7.1e-44	29.2
WP_000929883.1\|269534_270236_+	response regulator transcription factor	W8CYM9	Bacillus_phage	5.6e-40	36.9
WP_000719203.1\|270219_271725_+	aminopeptidase AmpS	W8CYF6	Bacillus_phage	7.8e-31	29.1

DBSCAN-SWA_2

310935 : 319311

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000625691.1\|310935_312243_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	8.3e-21	25.5
WP_001170542.1\|312331_313051_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	G8EYA2	Synechococcus_phage	5.2e-49	44.3
WP_000278823.1\|313043_313298_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_000666778.1\|313294_313978_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_000055575.1\|313961_316181_+	phosphoribosylformylglycinamidine synthase II	A6N228	Microbacterium_phage	1.3e-162	41.2
WP_000879029.1\|316165_317581_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	7.3e-55	35.4
WP_001262434.1\|317686_318727_+	phosphoribosylformylglycinamidine cyclo-ligase	Q58MH8	Prochlorococcus_phage	1.2e-67	48.4
WP_000088587.1\|318723_319311_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	7.0e-28	37.1

DBSCAN-SWA_3

1894127 : 1903394

Bacillus_phage(71.43%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000755542.1\|1894127_1895390_+	C40 family peptidase	A0A1V0DZX6	Clostridioides_phage	6.8e-12	32.0
WP_001194298.1\|1895488_1896253_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_000453754.1\|1896493_1898254_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	8.8e-268	95.9
WP_171856546.1\|1898315_1899020_+	response regulator	W8CYM9	Bacillus_phage	5.0e-121	93.6
WP_001231490.1\|1899016_1900078_+	HAMP domain-containing sensor histidine kinase	W8CYF6	Bacillus_phage	1.6e-168	88.6
WP_000273036.1\|1900055_1900655_-	DUF3139 domain-containing protein	NA	NA	NA	NA
WP_000818985.1\|1900847_1901567_+	3-ketoacyl-ACP reductase	W8CYX9	Bacillus_phage	5.9e-61	100.0
WP_000103836.1\|1901716_1902388_+	O-methyltransferase	W8CYT3	Bacillus_phage	3.6e-60	86.1
WP_001258485.1\|1902521_1903394_+	aminoglycoside 6-adenylyltransferase	A0A1X9I6F2	Streptococcus_phage	2.1e-65	44.7

DBSCAN-SWA_4

2649725 : 2657672

Geobacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000795729.1\|2649725_2651093_-	lytic polysaccharide monooxygenase	A0A0K1Y848	Apis_mellifera_filamentous_virus	4.3e-20	38.6
WP_000720573.1\|2651529_2652048_-	DNA topology modulation protein	A0A097BYE2	Leuconostoc_phage	4.3e-45	47.9
WP_000389482.1\|2652050_2652974_-	phosphotransferase	NA	NA	NA	NA
WP_001093443.1\|2653000_2653387_-	DUF2809 domain-containing protein	NA	NA	NA	NA
WP_000655493.1\|2653452_2654160_-	class I SAM-dependent methyltransferase	A0A1X9I6N4	Streptococcus_phage	6.1e-18	26.6
WP_000994646.1\|2654181_2654535_-	MmcQ/YjbR family DNA-binding protein	NA	NA	NA	NA
WP_000288933.1\|2654547_2654952_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_000714657.1\|2655199_2656585_+	S-layer homology domain-containing protein	Q0H255	Geobacillus_phage	7.8e-78	60.3
WP_000820170.1\|2656587_2656800_+	DUF3006 domain-containing protein	Q0H256	Geobacillus_phage	5.6e-12	54.4
WP_000540634.1\|2656865_2657672_-	N-acetylmuramoyl-L-alanine amidase	D2XR33	Bacillus_phage	6.5e-109	69.7

DBSCAN-SWA_5

3511681 : 3565374

Bacillus_phage(25.81%)

capsid,tail,head,portal,holin,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000872364.1\|3511681_3512047_+\|holin	CidA/LrgA family holin-like protein	NA	NA	NA	NA
WP_000578960.1\|3512043_3512721_+	LrgB family protein	NA	NA	NA	NA
WP_000442969.1\|3512733_3513147_-	NUDIX hydrolase	NA	NA	NA	NA
WP_000624205.1\|3513288_3513489_+	DUF3903 domain-containing protein	NA	NA	NA	NA
WP_000974676.1\|3513804_3514560_-	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
WP_000644411.1\|3514668_3514815_-	BC1881 family protein	NA	NA	NA	NA
WP_011198927.1\|3516882_3517449_-	hypothetical protein	NA	NA	NA	NA
WP_000386808.1\|3517455_3518475_-	NERD domain-containing protein	A0A1L2JY40	Aeribacillus_phage	8.7e-26	27.2
WP_000136733.1\|3518593_3520357_-	ABC transporter ATP-binding protein	A0A1V0SD74	Indivirus	3.2e-15	23.2
WP_000862476.1\|3520356_3522108_-	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	1.8e-47	28.3
WP_001123317.1\|3522231_3522453_-	YneF family protein	NA	NA	NA	NA
WP_000860645.1\|3522531_3522972_-	sporulation inhibitor of replication protein SirA	NA	NA	NA	NA
WP_000019770.1\|3523128_3525129_-	transketolase	NA	NA	NA	NA
WP_000047898.1\|3525431_3526235_-	phosphonate ABC transporter, permease protein PhnE	NA	NA	NA	NA
WP_001000753.1\|3526234_3527029_-	phosphonate ABC transporter, permease protein PhnE	NA	NA	NA	NA
WP_000569253.1\|3527025_3527799_-	phosphonate ABC transporter ATP-binding protein	W5SAS9	Pithovirus	2.7e-11	27.5
WP_000915045.1\|3527882_3528821_-	phosphate/phosphite/phosphonate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_001069257.1\|3529005_3530589_+	5'-nucleotidase C-terminal domain-containing protein	NA	NA	NA	NA
WP_000948565.1\|3530628_3530868_-	DUF896 domain-containing protein	NA	NA	NA	NA
WP_000991464.1\|3530913_3531570_-	recombinase family protein	NA	NA	NA	NA
WP_000413738.1\|3531711_3532332_+	transcriptional repressor LexA	A0A1B2APZ1	Phage_Wrath	8.2e-19	62.2
WP_000976121.1\|3532433_3533237_-	DUF4097 family beta strand repeat protein	NA	NA	NA	NA
WP_000032392.1\|3533237_3533780_-	DUF1700 domain-containing protein	NA	NA	NA	NA
WP_001102621.1\|3533772_3534096_-	PadR family transcriptional regulator	NA	NA	NA	NA
WP_000947629.1\|3535073_3535385_+	hypothetical protein	NA	NA	NA	NA
WP_000534159.1\|3535557_3535866_+	hypothetical protein	NA	NA	NA	NA
WP_000453442.1\|3536737_3538336_-	SIR2 family protein	A0A1S5SA14	Streptococcus_phage	2.2e-76	39.7
WP_000282194.1\|3538510_3538723_-	hypothetical protein	A0A1Z1LZP5	Bacillus_phage	2.8e-19	71.4
WP_000383803.1\|3538956_3539109_-	hypothetical protein	NA	NA	NA	NA
WP_000286793.1\|3539548_3540913_+	ATP-binding protein	NA	NA	NA	NA
WP_000340858.1\|3540905_3541883_+	DUF4435 domain-containing protein	NA	NA	NA	NA
WP_000731144.1\|3542071_3543127_-	N-acetylmuramoyl-L-alanine amidase	A0A1B0T6C8	Bacillus_phage	7.9e-155	73.8
WP_000461737.1\|3543123_3543363_-	hypothetical protein	A0A0A7AR38	Bacillus_phage	6.8e-30	84.8
WP_000398740.1\|3543362_3543599_-	hemolysin XhlA family protein	A0A2H4J382	uncultured_Caudovirales_phage	5.5e-16	92.3
WP_000077309.1\|3543709_3543985_-	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	A0A1B1P7E8	Bacillus_phage	1.8e-34	81.2
WP_001260141.1\|3544002_3548880_-\|tail	phage tail protein	A0A2H4JF18	uncultured_Caudovirales_phage	0.0e+00	46.1
WP_000094111.1\|3548876_3550358_-\|tail	phage tail family protein	A0A1B1P7W7	Bacillus_phage	4.5e-241	79.7
WP_000180084.1\|3550399_3552580_-	hypothetical protein	A0A2H4JC82	uncultured_Caudovirales_phage	1.9e-30	78.8
WP_011198932.1\|3552844_3553102_-	hypothetical protein	A0A1B1P763	Bacillus_phage	6.4e-34	84.7
WP_000477711.1\|3554584_3554746_-	hypothetical protein	A0A2H4JHE4	uncultured_Caudovirales_phage	2.0e-22	94.3
WP_000415943.1\|3554799_3555162_-	hypothetical protein	A0A2H4JAG8	uncultured_Caudovirales_phage	9.2e-47	74.8
WP_001004916.1\|3555166_3555760_-\|tail	phage tail protein	A0A2H4JDV4	uncultured_Caudovirales_phage	5.3e-92	84.1
WP_000172073.1\|3555760_3556090_-	hypothetical protein	A0A2H4JAG4	uncultured_Caudovirales_phage	2.2e-47	83.5
WP_000065124.1\|3556086_3556443_-	HK97 gp10 family phage protein	D2XR21	Bacillus_phage	2.7e-30	60.3
WP_000997895.1\|3556435_3556735_-\|head	phage head closure protein	R9TPZ2	Paenibacillus_phage	1.7e-09	38.3
WP_000979030.1\|3556731_3557004_-	DNA-packaging protein	R9TMB7	Paenibacillus_phage	6.5e-21	58.4
WP_000015464.1\|3557006_3557297_-	hypothetical protein	A6XMJ7	Bacillus_virus	4.8e-06	37.8
WP_000854836.1\|3557333_3558497_-\|capsid	phage major capsid protein	H7BUQ0	unidentified_phage	4.1e-80	54.7
WP_001043897.1\|3558510_3559095_-\|head,protease	HK97 family phage prohead protease	A0A2I7SBY1	Paenibacillus_phage	1.0e-39	50.5
WP_000522230.1\|3559060_3560272_-\|portal	phage portal protein	J9QE83	Clostridium_phage	7.7e-138	59.4
WP_000834963.1\|3561527_3562268_-	GIY-YIG nuclease family protein	G3MA96	Bacillus_virus	1.5e-14	29.2
WP_000985226.1\|3563004_3563376_-	hypothetical protein	R9TQ46	Paenibacillus_phage	1.3e-24	55.0
WP_001051279.1\|3563543_3563840_-	HNH endonuclease	R9TNN2	Paenibacillus_phage	1.0e-27	59.4
WP_000352022.1\|3564172_3564334_+	hypothetical protein	NA	NA	NA	NA
WP_000109231.1\|3564604_3565027_+	type II toxin-antitoxin system HicB family antitoxin	A0A1L2JY34	Aeribacillus_phage	2.6e-40	58.3
WP_011198935.1\|3565095_3565374_-	helix-turn-helix domain-containing protein	A0A2H4JBQ8	uncultured_Caudovirales_phage	1.5e-09	43.8

DBSCAN-SWA_6

3574434 : 3586174

Bacillus_phage(76.47%)

integrase

attL 3563549:3563564|attR 3592266:3592281

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3563549:3563564	attL	NA	NA	NA	NA
WP_000884068.1\|3574434_3574809_-	ArpU family transcriptional regulator	A0A0M4R397	Bacillus_phage	6.4e-43	70.7
WP_000520474.1\|3574813_3575101_-	hypothetical protein	A6M999	Geobacillus_virus	1.4e-34	71.3
WP_000424750.1\|3575230_3575746_+	restriction endonuclease	NA	NA	NA	NA
WP_001032094.1\|3575966_3576179_+	hypothetical protein	NA	NA	NA	NA
WP_000382670.1\|3576282_3577029_-	FAD-dependent thymidylate synthase	A0A2P1JUN2	Bacillus_phage	2.5e-78	62.2
WP_000615367.1\|3577067_3577640_-	dUTP diphosphatase	A0A0A7AQI4	Bacillus_phage	1.3e-79	73.3
WP_000553935.1\|3577734_3577857_-	Fur-regulated basic protein FbpA	NA	NA	NA	NA
WP_000861090.1\|3577859_3578489_-	hypothetical protein	A0A0M4RU33	Bacillus_phage	4.4e-28	41.4
WP_000156891.1\|3578485_3578656_-	hypothetical protein	NA	NA	NA	NA
WP_000573308.1\|3578652_3578841_-	hypothetical protein	NA	NA	NA	NA
WP_001229823.1\|3578864_3579695_-	ATP-binding protein	U5PWH5	Bacillus_phage	1.2e-36	38.7
WP_000067432.1\|3579630_3580395_-	phage protein	A0A1W6JNI1	Staphylococcus_phage	7.4e-62	51.7
WP_000849733.1\|3580391_3580664_-	hypothetical protein	A0A0M4S680	Bacillus_phage	6.5e-37	80.9
WP_001002738.1\|3580677_3581349_-	DUF1071 domain-containing protein	A0A1B1P7F0	Bacillus_phage	8.0e-28	45.8
WP_000780688.1\|3581345_3581828_-	siphovirus Gp157 family protein	E5DV79	Deep-sea_thermophilic_phage	1.2e-33	47.5
WP_000391987.1\|3581842_3582007_-	hypothetical protein	A0A0M5M3T1	Bacillus_phage	7.4e-12	64.8
WP_000510718.1\|3582077_3582395_-	hypothetical protein	NA	NA	NA	NA
WP_000483547.1\|3582545_3582812_-	hypothetical protein	S5MC08	Brevibacillus_phage	6.6e-26	57.0
WP_000517003.1\|3582831_3583542_-	Rha family transcriptional regulator	A0A288WFT2	Bacillus_phage	1.7e-52	50.5
WP_000791069.1\|3583541_3583787_-	helix-turn-helix transcriptional regulator	W8CYU0	Bacillus_phage	1.7e-12	60.3
WP_000579784.1\|3583924_3584353_+	helix-turn-helix transcriptional regulator	Q786F1	Bacillus_phage	5.1e-28	48.6
WP_000673782.1\|3584375_3584804_+	ImmA/IrrE family metallo-endopeptidase	Q9T201	Bacillus_phage	2.8e-34	55.1
WP_000582644.1\|3584819_3584987_+	hypothetical protein	NA	NA	NA	NA
WP_000135915.1\|3585028_3586174_+\|integrase	site-specific integrase	A0A0M5M609	Bacillus_phage	7.4e-66	38.0
3592266:3592281	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_007103

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NC_006274

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection