CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NC_006270	Bacillus licheniformis DSM 13 = ATCC 14580, complete sequence	1 crisprs	csa3,WYL,DinG,cas3,DEDDh	7	12	7	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_006270_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_006270_1

815942-817872

Orphan

Consensus_repeat	Method
GGAGCNACNGGAGCAACNGGAGC	CRT

30 spacers

The CRISPR arrays of NC_006270_1

>merge|NC_006270|1|815942-817872|CRT
GGTCCAACGGGAGCGACGGGTCCGACCGGAGCGACAGGCCCGACAGGAGCAACGGGAGCGACAGGCCCGACAGGAGCAACGGGAGCGACCGGCCCGACAGGAGCAACAGGAGCGACCGGCCCGACAGGAGCGACAGGCCCGACAGGAGCAACGGGAGCGACCGGCCCGACAGGAGCAACAGGAGCGACCGGCCCGACAGGAGCGACAGGCCCGACAGGAGCGACAGGCCCGACAGGAGCAACAGGAGCGACCGGAGCAACGGGAGCAACCGGCCCGACAGGCCCGACAGGAGCAACAGGGGCGACAGGCCCGACAGGAGCAACGGGAGCGACCGGCCCGACAGGAGCAACAGGAGCGACCGGCCCGACAGGAGCGACCGGAGCAACAGGAGCGACCGGAGCAACAGGAGCGACAGGAGCGACAGGAGCAACAGGAGCGACCGGAGCAACGGGAGCAACCGGCCCGACCGGCCCGACAGGAGCAACAGGAGCGACCGGCCCGACAGGAGCGACAGGCCCGACAGGAGCAACGGGAGCGACAGGCCCGACAGGTCCAACGGGAGCCACCGGCCCGACGGGAGCAACGGGAGCGACCGGCCCGACAGGAGCGACCGGAGCAACAGGTCCAACAGGAGCGACAGGAGCGACCGGAGCAACAGGTCCAACAGGAGCGACCGGAGCAACAGGAGCGACAGGTCCGACGGGAGCGACCGGCCCGACAGGTCCGACCGGAGCAACGGGAGCGACAGGTCCGACCGGAGCAACGGGAGCGACAGGAGCGACCGGAGCAACGGGAGCGACCGGCCCGACAGGAGCAACGGGAGCAACGGGAGCGACAGGTCCGACGGGAGCGACAGGAGCGACCGGAGCAACGGGAGCGACCGGCCCGACAGGAGCAACAGGTCCAACAGGAGCGACAGGAGCGACAGGAGCAACGGGAGCAACGGGAGCGACAGGTCCGACAGGAGCAACAGGAGCCACCGGCCCGACCGGAGCCACCGGAGCAACAGGAGCGACAGGAGCAACGGGAGCGACAGGTCCGACGGGAGCAACGGGAGCGACAGGAGCAACGGGAGCGACCGGCCCGACAGGAGCAACGGGAGCAACGGGAGCAACAGGTCCAACAGGAGCGACAGGAGCGACAGGAGCAACGGGAGCGACCGGCCCGACCGGAGCCACCGGAGCAACAGGAGCGACAGGAGCAACGGGAGCAACGGGAGCGACAGGTCCGACAGGAGCAACAGGAGCCACCGGCCCGACCGGAGCCACCGGAGCAACAGGAGCGACAGGAGCAACGGGAGCGACAGGTCCGACGGGAGCAACGGGAGCGACAGGAGCAACAGGAGCCACCGGCCCGACCGGAGCCACCGGAGCAACAGGAGCGACAGGAGCAACGGGAGCGACAGGTCCGACGGGAGCAACGGGAGCGACAGGTCCGACGGGAGCAACGGGAGCAACAGGTCCAACAGGAGCGACCGGAGCAACGGGAGCCACCGGCCCGACCGGAGCCACCGGAGCAACAGGTCCAACAGGAGCGACCGGAGCAACGGGAGCCACCGGCCCGACAGGAGCGACCGGAGCCACCGGAGCAACGGGAGCGACAGGTCCGACAGGAGCAACAGGAGTGACAGGAGCAACGGGAGCGACAGGTCCAACAGGAGCGACAGGAGCGACAGGAGCTACGGGAGCAACAGGAGCCACCGGCCCGACCGGAGCAACGGGAGCAACGGGAGCGACAGGTCCAACAGGAGCCACCGGAGCAACAGGTCCAACAGGAGCCACCGGTCCGACCGGTCCAACAGGAGCGACAGGAGCAACCGGAGCAACAGGAGCCATCGGCCCGACCGGAGCGACCGGCCCGACAGGAGCAACAGGAGCGACCGGCCCGACAGGAGCAACAGGAGCGACCGGCCCGACAGGTCCAACAGGAGC

>NC_006270|1|1|815942-817872|CRT
GGTCCAACGGGAGCGACGGGTCC	GACCGGAGCGACAGGCCCGACAGGAGCAACGGGAGCGACAGGCCCGACA
GGAGCAACGGGAGCGACCGGCCC	GACAGGAGCAACAGGAGCGACCGGCCCGACAGGAGCGACAGGCCCGACA
GGAGCAACGGGAGCGACCGGCCC	GACAGGAGCAACAGGAGCGACCGGCCCGACAGGAGCGACAGGCCCGACAGGAGCGACAGGCCCGACA
GGAGCAACAGGAGCGACCGGAGC	AACGGGAGCAACCGGCCCGACAGGCCCGACAGGAGCAACAGGGGCGACAGGCCCGACAGGAGCAACGGGAGCGACCGGCCCGACA
GGAGCAACAGGAGCGACCGGCCC	GACAGGAGCGACCGGAGCAACAGGAGCGACCGGAGCAACAGGAGCGACAGGAGCGACAGGAGCAACAGGAGCGACC
GGAGCAACGGGAGCAACCGGCCC	GACCGGCCCGACAGGAGCAACAGGAGCGACCGGCCCGACAGGAGCGACAGGCCCGACA
GGAGCAACGGGAGCGACAGGCCC	GACAGGTCCAACGGGAGCCACCGGCCCGACGGGAGCAACGGGAGCGACCGGCCCGACA
GGAGCGACCGGAGCAACAGGTCC	AACAGGAGCGACAGGAGCGACCGGAGCAACAGGTCCAACA
GGAGCGACCGGAGCAACAGGAGC	GACAGGTCCGACGGGAGCGACCGGCCCGACA
GGTCCGACCGGAGCAACGGGAGC	GACAGGTCCGACCGGAGCAACGGGAGCGACA
GGAGCGACCGGAGCAACGGGAGC	GACCGGCCCGACAGGAGCAACGGGAGCAACGGGAGCGACAGGTCCGACGGGAGCGACA
GGAGCGACCGGAGCAACGGGAGC	GACCGGCCCGACAGGAGCAACAGGTCCAACAGGAGCGACA
GGAGCGACAGGAGCAACGGGAGC	AACGGGAGCGACAGGTCCGACAGGAGCAACAGGAGCCACCGGCCCGACCGGAGCCACCGGAGCAACA
GGAGCGACAGGAGCAACGGGAGC	GACAGGTCCGACGGGAGCAACGGGAGCGACAGGAGCAACGGGAGCGACC
GGCCCGACAGGAGCAACGGGAGC	AACGGGAGCAACAGGTCCAACAGGAGCGACAGGAGCGACAGGAGCAACGGGAGCGACC
GGCCCGACCGGAGCCACCGGAGC	AACAGGAGCGACAGGAGCAACGGGAGCAACGGGAGCGACA
GGTCCGACAGGAGCAACAGGAGC	CACCGGCCCGACCGGAGCCACCGGAGCAACA
GGAGCGACAGGAGCAACGGGAGC	GACAGGTCCGACGGGAGCAACG
GGAGCGACAGGAGCAACAGGAGC	CACCGGCCCGACCGGAGCCACCGGAGCAACA
GGAGCGACAGGAGCAACGGGAGC	GACAGGTCCGACGGGAGCAACG
GGAGCGACAGGTCCGACGGGAGC	AACGGGAGCAACAGGTCCAACA
GGAGCGACCGGAGCAACGGGAGC	CACCGGCCCGACCGGAGCCACCGGAGCAACAGGTCCAACA
GGAGCGACCGGAGCAACGGGAGC	CACCGGCCCGACAGGAGCGACC
GGAGCCACCGGAGCAACGGGAGC	GACAGGTCCGACAGGAGCAACA
GGAGTGACAGGAGCAACGGGAGC	GACAGGTCCAACAGGAGCGACA
GGAGCGACAGGAGCTACGGGAGC	AACAGGAGCCACCGGCCCGACC
GGAGCAACGGGAGCAACGGGAGC	GACAGGTCCAACAGGAGCCACC
GGAGCAACAGGTCCAACAGGAGC	CACCGGTCCGACCGGTCCAACAGGAGCGACA
GGAGCAACCGGAGCAACAGGAGC	CATCGGCCCGACCGGAGCGACC
GGCCCGACAGGAGCAACAGGAGC	GACCGGCCCGACAGGAGCAACAGGAGCGACC
GGCCCGACAGGTCCAACAGGAGC

Protein	Signature genes	Signature genes Name	Protein_function
NC_006270.3\|WP_011197652.1\|828763_830059_+\|nucleotide-sugar-dehydrogenase	unknown	unknown	gnl\|CDD\|274399
NC_006270.3\|WP_003179735.1\|801477_802230_-\|type-I-methionyl-aminopeptidase	unknown	unknown	gnl\|CDD\|237252
NC_006270.3\|WP_011197645.1\|806626_808039_+\|PTS-system-trehalose-specific-EIIBC-component	unknown	unknown	gnl\|CDD\|273916
NC_006270.3\|WP_011197653.1\|830139_831051_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223999
NC_006270.3\|WP_003179769.1\|826507_827617_+\|DegT/DnrJ/EryC1/StrS-family-aminotransferase	unknown	unknown	gnl\|CDD\|99740
NC_006270.3\|WP_011197650.1\|821335_822709_-\|glycosyltransferase	unknown	unknown	gnl\|CDD\|223515
NC_006270.3\|WP_011201585.1\|822864_825108_-\|glycosyltransferase	unknown	unknown	gnl\|CDD\|133055
NC_006270.3\|WP_009329060.1\|818642_819737_-\|DegT/DnrJ/EryC1/StrS-family-aminotransferase	unknown	unknown	gnl\|CDD\|99740
NC_006270.3\|WP_003179733.1\|801236_801392_-\|hypothetical-protein	unknown	unknown	unknown
NC_006270.3\|WP_009329067.1\|805025_806438_+\|sodium:alanine-symporter-family-protein	unknown	unknown	gnl\|CDD\|224040
NC_006270.3\|WP_003179768.1\|825302_826385_+\|glycosyltransferase	unknown	unknown	gnl\|CDD\|133005
NC_006270.3\|WP_011197646.1\|811463_815243_+\|collagen-like-protein	unknown	unknown	unknown
NC_006270.3\|WP_003179737.1\|802354_804316_-\|LTA-synthase-family-protein	unknown	unknown	gnl\|CDD\|224287
NC_006270.3\|WP_011197648.1\|819733_820276_-\|transferase	unknown	unknown	gnl\|CDD\|100047
NC_006270.3\|WP_003179750.1\|810645_811338_+\|N-acetyltransferase	unknown	unknown	gnl\|CDD\|100048
NC_006270.3\|WP_009329065.1\|809822_810539_+\|trehalose-operon-repressor	unknown	unknown	gnl\|CDD\|274116
NC_006270.3\|WP_011197649.1\|820293_821268_-\|NAD-dependent-epimerase/dehydratase-family-protein	unknown	unknown	gnl\|CDD\|187566
NC_006270.3\|WP_003179771.1\|827613_828678_+\|Gfo/Idh/MocA-family-oxidoreductase	unknown	unknown	gnl\|CDD\|223745
NC_006270.3\|WP_003179739.1\|804577_804964_+\|DUF1992-domain-containing-protein	unknown	unknown	gnl\|CDD\|378159
NC_006270.3\|WP_003179746.1\|808112_809801_+\|alpha,alpha-phosphotrehalase	unknown	unknown	gnl\|CDD\|274115

Protein	Function_ID	Function_description	E-value
NC_006270.3\|WP_011197652.1\|828763_830059_+\|nucleotide-sugar-dehydrogenase	gnl\|CDD\|274399	TIGR03026, NDP-sugDHase, nucleotide sugar dehydrogenase. Enzymes in this family catalyze the NAD-dependent alcohol-to-acid oxidation of nucleotide-linked sugars. Examples include UDP-glucose 6-dehydrogenase (1.1.1.22), GDP-mannose 6-dehydrogenase (1.1.1.132), UDP-N-acetylglucosamine 6-dehydrogenase (1.1.1.136), UDP-N-acetyl-D-galactosaminuronic acid dehydrogenase, and UDP-N-acetyl-D-mannosaminuronic acid dehydrogenase. These enzymes are most often involved in the biosynthesis of polysaccharides and are often found in operons devoted to that purpose. All of these enzymes contain three Pfam domains, pfam03721, pfam00984, and pfam03720 for the N-terminal, central, and C-terminal regions respectively.	0
NC_006270.3\|WP_003179735.1\|801477_802230_-\|type-I-methionyl-aminopeptidase	gnl\|CDD\|237252	PRK12896, PRK12896, methionine aminopeptidase; Reviewed.	1.50659e-143
NC_006270.3\|WP_011197645.1\|806626_808039_+\|PTS-system-trehalose-specific-EIIBC-component	gnl\|CDD\|273916	TIGR01992, phosphotransferase_system_trehalose_permease, PTS system, trehalose-specific IIBC component. This model represents the fused enzyme II B and C components of the trehalose-specific PTS sugar transporter system. Trehalose is converted to trehalose-6-phosphate in the process of translocation into the cell. These transporters lack their own IIA domains and instead use the glucose IIA protein (IIAglc or Crr). The exceptions to this rule are Staphylococci and Streptococci which contain their own A domain as a C-terminal fusion. This family is closely related to the sucrose transporting PTS IIBC enzymes and the B and C domains of each are described by subfamily-domain level TIGRFAMs models (TIGR00826 and TIGR00852, respectively). In E. coli, B. subtilis and P. fluorescens the presence of this gene is associated with the presence of trehalase which degrades T6P to glucose and glucose-6-P. Trehalose may also be transported (in Salmonella) via the mannose PTS or galactose permease systems, or (in Sinorhizobium, Thermococcus and Sulfolobus, for instance) by ABC transporters.	0
NC_006270.3\|WP_011197653.1\|830139_831051_+\|alpha/beta-hydrolase	gnl\|CDD\|223999	COG1073, COG1073, Hydrolases of the alpha/beta superfamily [General function prediction only].	7.87289e-17
NC_006270.3\|WP_003179769.1\|826507_827617_+\|DegT/DnrJ/EryC1/StrS-family-aminotransferase	gnl\|CDD\|99740	cd00616, AHBA_syn, 3-amino-5-hydroxybenzoic acid synthase family (AHBA_syn). AHBA_syn family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The members of this CD are involved in various biosynthetic pathways for secondary metabolites. Some well studied proteins in this CD are AHBA_synthase, protein product of pleiotropic regulatory gene degT, Arnb aminotransferase and pilin glycosylation protein. The prototype of this family, the AHBA_synthase, is a dimeric PLP dependent enzyme. AHBA_syn is the terminal enzyme of 3-amino-5-hydroxybenzoic acid (AHBA) formation which is involved in the biosynthesis of ansamycin antibiotics, including rifamycin B. Some members of this CD are involved in 4-amino-6-deoxy-monosaccharide D-perosamine synthesis. Perosamine is an important element in the glycosylation of several cell products, such as antibiotics and lipopolysaccharides of gram-positive and gram-negative bacteria. The pilin glycosylation protein encoded by gene pglA, is a galactosyltransferase involved in pilin glycosylation. Additionally, this CD consists of ArnB (PmrH) aminotransferase, a 4-amino-4-deoxy-L-arabinose lipopolysaccharide-modifying enzyme. This CD also consists of several predicted pyridoxal phosphate-dependent enzymes apparently involved in regulation of cell wall biogenesis. The catalytic lysine which is present in all characterized PLP dependent enzymes is replaced by histidine in some members of this CD.	5.519e-169
NC_006270.3\|WP_011201585.1\|822864_825108_-\|glycosyltransferase	gnl\|CDD\|133055	cd06433, GT_2_WfgS_like, WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.	3.78259e-24
NC_006270.3\|WP_009329060.1\|818642_819737_-\|DegT/DnrJ/EryC1/StrS-family-aminotransferase	gnl\|CDD\|99740	cd00616, AHBA_syn, 3-amino-5-hydroxybenzoic acid synthase family (AHBA_syn). AHBA_syn family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The members of this CD are involved in various biosynthetic pathways for secondary metabolites. Some well studied proteins in this CD are AHBA_synthase, protein product of pleiotropic regulatory gene degT, Arnb aminotransferase and pilin glycosylation protein. The prototype of this family, the AHBA_synthase, is a dimeric PLP dependent enzyme. AHBA_syn is the terminal enzyme of 3-amino-5-hydroxybenzoic acid (AHBA) formation which is involved in the biosynthesis of ansamycin antibiotics, including rifamycin B. Some members of this CD are involved in 4-amino-6-deoxy-monosaccharide D-perosamine synthesis. Perosamine is an important element in the glycosylation of several cell products, such as antibiotics and lipopolysaccharides of gram-positive and gram-negative bacteria. The pilin glycosylation protein encoded by gene pglA, is a galactosyltransferase involved in pilin glycosylation. Additionally, this CD consists of ArnB (PmrH) aminotransferase, a 4-amino-4-deoxy-L-arabinose lipopolysaccharide-modifying enzyme. This CD also consists of several predicted pyridoxal phosphate-dependent enzymes apparently involved in regulation of cell wall biogenesis. The catalytic lysine which is present in all characterized PLP dependent enzymes is replaced by histidine in some members of this CD.	1.52929e-109
NC_006270.3\|WP_011197650.1\|821335_822709_-\|glycosyltransferase	gnl\|CDD\|223515	COG0438, RfaG, Glycosyltransferase [Cell envelope biogenesis, outer membrane].	4.89595e-16
NC_006270.3\|WP_009329067.1\|805025_806438_+\|sodium:alanine-symporter-family-protein	gnl\|CDD\|224040	COG1115, AlsT, Na+/alanine symporter [Amino acid transport and metabolism].	0
NC_006270.3\|WP_011197649.1\|820293_821268_-\|NAD-dependent-epimerase/dehydratase-family-protein	gnl\|CDD\|187566	cd05256, UDP_AE_SDR_e, UDP-N-acetylglucosamine 4-epimerase, extended (e) SDRs. This subgroup contains UDP-N-acetylglucosamine 4-epimerase of Pseudomonas aeruginosa, WbpP, an extended SDR, that catalyzes the NAD+ dependent conversion of UDP-GlcNAc and UDPGalNA to UDP-Glc and UDP-Gal. This subgroup has the characteristic active site tetrad and NAD-binding motif of the extended SDRs. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	1.1039e-69
NC_006270.3\|WP_003179737.1\|802354_804316_-\|LTA-synthase-family-protein	gnl\|CDD\|224287	COG1368, MdoB, Phosphoglycerol transferase and related proteins, alkaline phosphatase superfamily [Cell envelope biogenesis, outer membrane].	0
NC_006270.3\|WP_003179771.1\|827613_828678_+\|Gfo/Idh/MocA-family-oxidoreductase	gnl\|CDD\|223745	COG0673, MviM, Predicted dehydrogenases and related proteins [General function prediction only].	3.52576e-71
NC_006270.3\|WP_011197648.1\|819733_820276_-\|transferase	gnl\|CDD\|100047	cd03357, LbH_MAT_GAT, Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates. MAT acetylates maltose and glucose exclusively at the C6 position of the nonreducing end glucosyl moiety. GAT specifically acetylates galactopyranosides. Furthermore, MAT shows higher affinity toward artificial substrates containing an alkyl or hydrophobic chain as well as a glucosyl unit. Active MAT and GAT are homotrimers, with each subunit consisting of an N-terminal alpha-helical region and a C-terminal left-handed parallel alpha-helix (LbH) subdomain with 6 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X).	1.58848e-37
NC_006270.3\|WP_003179750.1\|810645_811338_+\|N-acetyltransferase	gnl\|CDD\|100048	cd03358, LbH_WxcM_N_like, WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain. WcxM is thought to be bifunctional, catalyzing both the isomerization and transacetylation reactions of keto-hexoses. It contains an N-terminal LbH domain responsible for the transacetylation function and a C-terminal isomerase domain. The LbH domain contains imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X), typical of enzymes with acyltransferase activity.	9.65846e-50
NC_006270.3\|WP_003179768.1\|825302_826385_+\|glycosyltransferase	gnl\|CDD\|133005	cd02511, Beta4Glucosyltransferase, UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.	3.61835e-47
NC_006270.3\|WP_003179746.1\|808112_809801_+\|alpha,alpha-phosphotrehalase	gnl\|CDD\|274115	TIGR02403, Trehalose-6-phosphate_hydrolase, alpha,alpha-phosphotrehalase. Trehalose is a glucose disaccharide that serves in many biological systems as a compatible solute for protection against hyperosmotic and thermal stress. This family describes trehalose-6-phosphate hydrolase, product of the treC (or treA) gene, which is often found together with a trehalose uptake transporter and a trehalose operon repressor.	0
NC_006270.3\|WP_003179739.1\|804577_804964_+\|DUF1992-domain-containing-protein	gnl\|CDD\|378159	pfam09350, DUF1992, Domain of unknown function (DUF1992). This family of proteins are functionally uncharacterized.	9.89474e-19
NC_006270.3\|WP_009329065.1\|809822_810539_+\|trehalose-operon-repressor	gnl\|CDD\|274116	TIGR02404, Trehalose_operon_transcriptional_repressor, trehalose operon repressor, B. subtilis-type. This family consists of repressors of the GntR family typically associated with trehalose utilization operons. Trehalose is imported as trehalose-6-phosphate and then hydrolyzed by alpha,alpha-phosphotrehalase to glucose and glucose-6-P. This family includes repressors mostly from Gram-positive lineages and does not include the TreR from E. coli. [Regulatory functions, DNA interactions].	1.1936e-116

>NC_006270.3|WP_011197646.1|811463_815243_+|collagen-like-protein
MSIQNAVMNGGFETGAFSPWVGVNTSVTSQFSHSGFFSARFLGGTATSYIAQFVPAGAGEGSEFLVSLAKAGFLPAPSVTIQVTYFDSQFNFLGYGLFATVTSSRIPAAENGTWLEVYQTTSPAPLGTTQAFILINNIPQAGTASVFVDDVALLSVEGGGAPTGATGPTGATGPTGATGPTGVTGPTGVTGATGPTGVTGPTGAMGPTGATGATGPTGVTGSTGVTGATGATGPTGVTGPTGAMGPTGATGATGATGATGATGATGPTGVTGATGATGPTGVTGATGATGPTGATGATGPTGATGPTGATGATGPTGATGAMGPTGATGPTGATGPTGVTGSTGATGATGPTGATGAMGPTGATGPTGATGPTGVTGSTGATGATGPTGATGAMGPTGATGPTGATGPTGVTGPTGETGATGPTGATGPTGVTGATGPTGVTGPTGATGATGPTGATGATGATGPTGVTGATGVTGSTGATGPTGATGPTGATGATGATGPTGVTGATGATGPTGVTGPTGATGATGATGATGATGATGPTGVTGAAGATGPTGATGATGPTGVTGAAGATGATGPTGATGATGPTGATGPTGATGATGPTGATGATGPTGVTGPTGATGATGATGPTGVTGATGATGPTGVTGATGPTGETGATGPTGATGPTGATGATGPTGATGAMGPTGATGPTGATGPTGVTGPTGETGATGPTGTTGAMGPTGATGPTGATGPTGVTGSTGATGATGATGATGPTGATGPTGATGPTGVTGATGPTGVTGPTGATGATGPTGATGPTGVTGPTGATGATGATGPTGATGATGPTGATGPTGATGATGPTGATGAMGPTGATGPTGATGPTGVTGPTGETGATGPTGTTGAMGPTGATGPTGTTGAMGPTGATGPTGTTGAMGPTGATGPTGTTGAMGPTGATGPTGTTGAMGPTGATGPTGTTGAMGPTGATGPTGTTGAMGPTGATGPTGATGPTGVTGSTGATGATGATGPTGATGAMGPTGATGPTGATGPTGVTGATGPTGVTGPTGATGATGPTGATGATGATGPTGPTGVTGAAGATGPTGVTGATGVTGSTGATGATGATGATGPTGVTGAAGATGPTGAAGATGPASPQTAIFFNNLFGSTSVYNPPTIPLNTEVTVVNVPNVPVTSGQNIKVDYALAVEAVNTANSNIVFEIRLYRGGTLVQSRIFNRSLASAGTQRFPLASTIVDTVPATATIDYSVRVAVTTASNVTSAAAFNRDLNLIRFP
>NC_006270.3|WP_003179750.1|810645_811338_+|N-acetyltransferase
MIHETAKIGKNVVLGEHAVIEENVVIGDNVTIGHHAIIKKDTHIGSGVKIGDLAVLGKAASSNKKMARQPKQAGAPLRIEDDAIVGASAVIYRDVLLEQGVFVGDMASIRENVAIGRESIIGRNAMVENNTRIGSKATIQTGCYITADMTIEDEVFIGPCCSTSNDKYMGKGNYPYQGPTIKRGAKIGNNATLLPAVVVGEGAVIGAGAVITKDVPAGKTAVGNPGRLMK
>NC_006270.3|WP_009329065.1|809822_810539_+|trehalose-operon-repressor
MKINKYMMIYKQIAEQIDQSILNAGDILPSENDLAEQHDTSRETVRKALNVLAQNGYIQKIKGKGSVVLHREKMQFPVSGLVSFKELSETLGKETSTTVHEFGLTHPDAYIQKQLRTSGDEEVWRVVRSRNINGERIILDKDYFIRKHVPLLTKEICEDSIYQYLEDECGLVISYAHKEIVVEPCTAEDQEYLDLNGYEHIVVVKNFVFLDDTTLFQYTESRHRLDKFRFVDFARREK
>NC_006270.3|WP_003179746.1|808112_809801_+|alpha,alpha-phosphotrehalase
METKENPWWKKAVVYQIYPKSFKDTTGNGVGDIRGIIEKLDYIKELACDVIWLTPIYQSPQNDNGYDISDYYSIHEEYGTMADFEELLEEAHKRGIKVIMDLVVNHTSTEHRWFKEAASGKENLYRDFYIWKDMKPNGAPPTNWESKFGGSAWEFHAESGQYYLHLYDVTQADLNWENEAVRKKVYEMMHFWFEKGIDGFRLDVINVISKDQRFPDDDEGDGRRFYTDGPRVHEFLNEMNREVFSKYDSMTVGEMSSTTIADCIRYTNPESRELDMVFNFHHLKADYPNGEKWALADFDFLKLKKILSEWQTEMNKGGGWNALFWCNHDQPRIVSRYGDDGKYRKKSAKMLATAIHMLQGTPYIYQGEELGMTNPKFDDISLYRDVESLNMYRILKEAGKPEAEIIEILKAKSRDNSRTPVQWNGEENAGFTAGTPWIPVPDNYKEINAEEALNDPDSIFYHYKKLNELRKEFDIITTGDYQLILEDDQELYAYLRNGADEKLLVINNFYGKETEFQLPDDIDIEGYDAKVLISNDTDLPESFKRFTVKPYQSIVYHLAKPC
>NC_006270.3|WP_011197645.1|806626_808039_+|PTS-system-trehalose-specific-EIIBC-component
MTDLNQSARRIVDAVGGADNIAAVTHCVTRLRFALLDESKVNQEVLEQIDVVKGSFSTNGQFQVVIGQGTVNNVYAELVKATGIGESSKDDVKKASEKNMNPLQRAVKTLADIFIPILPAIVTAGLLMGINNILTAQDIFFSGKSIVEVYPQWADLANMINLIAGTAFAFLPALIGWSAVKRFGGNPLLGIVLGVMLVHPDLLNAWGYGAAEQSGEIPVWNLFGLEVQKVGYQGQVLPILLASYLLAKIERFLTKRTPESIQLLVVAPITLLVTGFASFIVLGPITFAIGNVLTSGLIAVFEQFAVLGGLLYGGLYAALVITGMHHTFLAVDLQLIGSKLGGTFLWPMLALSNIAQGSAALAMMFIVKDEKQKGLSLTSGISAYLGITEPALFGVNLRYRFPFVIAMISSGIAGMFISSQGVLASSVGVGGVPGIFSIMSQYWGAFAIGMAIVLIAPFAGTYLYAKLKMK
>NC_006270.3|WP_009329067.1|805025_806438_+|sodium:alanine-symporter-family-protein
MERLLNWVEYISDWLWGPPLIILLTGTGVYLTILLKFFQFRYPLYIFKQTIGSVGKKPKGEGTVTPLQALTSALSSTVGAANIVGVPAAIMFGGPGAVFWMWLVALFAMAIKFSESVLAVHYREKNEEGEYVGGPMYYITKGLSMKWLGVFFSVALMIELVPSIMVQGNSVSASLAETFSFNRLYTGIGIAFLIGLVVIGGIKRIGKVTELAVPLMAGAYIGAGFLIVVTNLSSVPAFFSLIFSNAFTSSSAFGGFAGAAVAETVRWGFARGLYSNEAGMGTAPIAHAAAMTDHPVRQGFWAVIGIVVDTLLICTTTAFVVLASGVWTGENASSDPGALAAAAFRSYFGPVGGYFVSVSLVFFVLSTITVVIFYGVKQAEFLFGRLAGHVIKFIYLAAVVIGAAGGAKAIWGFLDLALVFILLPNILAVLLLSRKVRSLYDEFFTSEKYYLKDIGQQDGVYEGDEKVNNL
>NC_006270.3|WP_003179739.1|804577_804964_+|DUF1992-domain-containing-protein
MDFSSIVSEDKIKQAIKDGEFEGLPGMGKPLKKDDAAHVPEHLRMAYRVMKNAGMAGDEGALKKELMTIDDLIAKCADEDERERLIERKTETRLRLDRLADKKGMFSKPASAFYKEKVYRRLSGNKKR
>NC_006270.3|WP_003179737.1|802354_804316_-|LTA-synthase-family-protein
MKRFIKERGLAFFLIAAILLWLKTYAAYVIEFNLGITNTVQHILLFVNPISSSLFFLGLGLLFKKKIQQTAIIVIHFLMSFLLYANVVYYRFFSDFITLPAIMQAKTNGGQLGDSIFSLMHPLDVLYFIDTFILIGLAVFYNRPSETTTKRPFKIVMGASILVFLANLAVAEIDRPELLTRSFDRNYLVKYLGTYNFTIYDAVQNIKSNSQRALASSSDVTEVENYIKANHDKPNAEYFGKAKGMNVVYISLESLQTFLIDYKLDGKEVTPFLNSLAHDNETFYFDNFFHQTGQGKTSDAEFMMDNSLYPLSQGSVFINKAQNTLQSAPAILKSQGYTSAAFHGNYKTFWNRNEMYKAIGYDKFFDATYYDMSEDKTKNYGLKDKPFFEESMPLLKSLKQPFYTKFITLSNHFPFEMDEGDTDFPAGDTGDSVVDHYFQSANYMDQALEQFFNDLKKAGLYDNTIVVMYGDHYGISENHNKAMAKVLGKDITPYENAQLQRVPLFIHAPGVKGIKSHKYGGEVDVAPTLLHLMGVNTKDYLMSGSDLLSPEHREIIPFRNGDFVSPEYTKTNGNYYDTKTGELLNEKDIDPNIEEAVKKELEMSDKIVDGDLLRFYKPKGFKAINPSDYDYTNHNPKTSESDAAQTTKSDSGQ
>NC_006270.3|WP_003179735.1|801477_802230_-|type-I-methionyl-aminopeptidase
MIVTNDQELEGLKKIGRIVALAREEMKAKAAPGMSTKELDLIGKEVLEAHGAASAPEKEYDFPGTTCISVNDEVAHGIPSESRILKEGDLINIDISAEFGGYYSDTGISFVLGKGDEMLHKLCQSAESAFQKGLLQARAGKKQNQIGRAVYNEAKANGFTVIKNLTGHGIGRNLHEAPNHILNYYDPFDNALFKNGTVIALEPFVSTKAEHTIEAGDGWTFKTPDGSFVAQIEHTIVITKNEPIILTQLD
>NC_006270.3|WP_003179733.1|801236_801392_-|hypothetical-protein
MLFAIIGLIFFIESILLIVYAHKKKNGFLKYIGIVLSIAIIVMIVTSLTHG
>NC_006270.3|WP_009329060.1|818642_819737_-|DegT/DnrJ/EryC1/StrS-family-aminotransferase
MIRLIEPYITFEEVQAELKEIFSSGMLTKGPYVRTFADHMRQYVSAKHAFLTTSATTALSMCLKSLNVQPGDEVIVSDFSFPATVNVIEDLGAKPVFADVDLETFNMLPEELESQITSRTKAVLFVDALGNPTGITNIKQICKEYGLPLVDDAACAIGSSEYGCKSGKIADLTCFSFHPRKLLTTGEGGAITTDREELKDWLSVKLNHGAAISDGKLDFIDFGYNYRLSDIQAALGIKQLQKLDDIIHRRNLQQKAYSEQLEPLGFQSQKIGPAVVHNIQSAVFKVPKNIVRDELIQYLSDCHIESTFGTYCLSGTPYYRRKYQQLKSNSLFLEQHTITLPCHDEVDLDHVVSAIQSFIKFKVD
>NC_006270.3|WP_011197648.1|819733_820276_-|transferase
MKQWKSEGKGEFTLSQLGGCGENVVIEDGVRIFHPENIYIGDNVYIGHDTILKGYYKHDLIIGSNSWIGQQCFIHGAGGVTIGEFAGIGPNVRIHAAYHTDPDKPDSTILFSPLTFAPIHIEENCNIGIGASILAGVTIGAHSKIGANAVVNRNIPPYSIAVGVPAKVIKNRRMKDEDLS
>NC_006270.3|WP_011197649.1|820293_821268_-|NAD-dependent-epimerase/dehydratase-family-protein
MSDMTELSGQHIFITGGAGFIGSSLIGKLIERNSVTVYDNFSRDSLRYKPYRDHPHLKVLQGDILDLNALKKAIQGASHIVHAAGIAGIDTVIQNPVKTMQVNMIGSANLLEAAAGLTECKRVVCFSTSEVFGQIAFRARETSHTVLGAVGEARWTYAVSKLAEEHMAYAYFKELGLPTVTVRPFNVYGPEQVGEGAIKTMVHRALLDEPIYIHGDGTQIRAWCYVDDMIDGILRCLTMKEAIGESFNIGNERTVITVYGLASTIIRVLGSKSQIFFGEKKEADIELRIPQVNKAKEMLGFSAKVDLEEGIRRTAESIKKNLDQ
>NC_006270.3|WP_011197650.1|821335_822709_-|glycosyltransferase
MKDFKSDIIHCLEQKEWNKAMKRLKEWEAQGSHNEPDFYFLQASLSVYLGHDYNAWLWLWRGLDLFPENRSLNLLMGKVCLRTGREKESAAYLQKGDGAETASWPKLDLPVDEKTEPPAGQIRILQGTMEIANQMNTLAKGLSQHGALAHTLNYYPYYLNYAADYTWSLLKERNTPAMNAKLRRLANDLLPSYDLFHFHFGTSFTLDMSDYPILKQAEKPMVMHHWGSDVRLYSTLAKTNPYAVVKTKNEARIRYHLKRISQYVQHCIVADMELYEYVKDYYEHVHMIPTMIQLDRYTPDYRSNEKPLIVHAPTSPGIKGTRHILKAVESLKEKYDFHFHLVQGVSHEQAKKIYQKADLIIDQLHIGSYGLFAVESMAMGKPVICWISDFMKDHYPSELPLIRANPANITEVIENVLKNRDMLPEIGQKGRKYAEVHHDMVKNSKKTLAVYQSLLSE
>NC_006270.3|WP_011201585.1|822864_825108_-|glycosyltransferase
MDNELEYLLDSVGLSWRETEISQLIFHHKWHDAAQKLEEKLKAAPFDPGLLISAAFVCEKKQQAQRASELYDDALLFVRREHRPRLMKEKEDLFKKMVRRPKIIFFVKPDLDRFLNSVVEHLSGTYRTKKIVVHDLNQIDAGMQWADICWFEWCDDLLIHGSKVPSAAAKTLICRLHSYEAFTFYIKKVYWQAVDQVIFDGEHLREYVLDQVKALKKEKTAVVPNGIKLDQYTFKQRQKGFHIAYVGYINYKKGPMLLLQAFKALIDKDPRYKLFIAGTFQDARYQLYFKQMIDELRLTDSVQFDGWQDDMNQYLEDKHYLICTSLLESQHMSAMEAMAKGIKPLIHNFYGAKTIYDESVVWNTIDEFVAMITSGDYTSLHYRSFIEEHYSYDLSMRKIEEMISGFAKQSELTVMPNPPLITVGIINYNYSNFIDECLQSVLNQLYPNIDILIVDDHSTDDSMQKISSYQKTHPHIRTICHSENTKLPDLAFKEIFQEAKGEYVLLLSADDFLPHNLVIHDFMQCFFEEEGLDYVYGDLLLVDQHGKNAGLWTYQEYGDEELVRTIFQRGGSGIVPMVGMFKASYYQQKGFTWLVDPQKPLAGDVLNCLANTKRGWKRRYLKKPVLCYRRHQKNISYQLHKRIQSLVYVMDYIVKEFDESVYFPHIKWKELEENQRQSLKYFSIGKTFWRMARRYAQNGYTRHLDQDAKKECIQPLLDKMDEYFQLSLASDNQYERYMKNIKKIQLI
>NC_006270.3|WP_003179768.1|825302_826385_+|glycosyltransferase
MVTISLCMIVKNEEEVLARCLDTVKDIVDEINIVDTGSTDKTVEIAKRYTDRVFFFEWIGDFAAARNESFKHATKDYILYLDADDVLLEEDQKKLKELKETLDPSVDSVSMYYDAGTDEFGNVTLRYRRNRLVKREKNFKWKGDCHQYLEVFGNIINADISVTHKKIRHSVGRNLNIYQKKIDRGDTFTPRDYFYYGNELRENRHYEKAIESYNKNIEMKEGWIEDKVYACINKADCHRFLGDMDNELRSLFQSFEFSKTPRAETCSRIGYNFQRRREYKAAIYWYELATTLVPDSNKWSFTYPAYYTWYPHLQMCVCYYNLGDFEKSYHHNEEARKYRPEDKSVLHNKQLLEGKLGINN
>NC_006270.3|WP_003179769.1|826507_827617_+|DegT/DnrJ/EryC1/StrS-family-aminotransferase
MIPLVNLKRQFQTVKQDILKEFEHVLDSGQYILGPKVEELEKRIAEKLGVKEAVAVANGTDALVLTLEAFGIGKGDEVITTPFTFFATAEAVSRVGAEPVFADVDPETYNLDPKKIEEKITPATKAIIPVHIFGQPADMDEIMELAKKHGLLVIEDACQAFGASYKERPVGSIGDAACFSFFPTKNLGTLGDGGMVTISDPDAARQLRTLRTHGTSKKYFHDKIGFNSRLDELHAAALLILLEKIDGWNEQRRRVASRYREGLKTAEHLTLPAEKEDRTHIYHLYCIGAKNRDYIIQSLKEQDIHSGVYYPCCLHLQSVYSSLQYKKGDFPIAESLSETLFAIPMDPFLAAEEQDQIISALLKKGGGEK
>NC_006270.3|WP_003179771.1|827613_828678_+|Gfo/Idh/MocA-family-oxidoreductase
MTVHFGLIGCGYMSRKHLQALAECDDAKLSAVSDLQEERMKEAEEYYASLAGEESRMTRYPQYQALLSDPKIEAVIIAAVSGLHAEMAKHALLAGKHVIVEKPMTLSLRDADELIELAEQNGLKLMVCHQMRHRPIMKKLKETIEEGKLGKIYLGTVSLRLNRSPAYYEAASWRGSWEKDGGMLVNQGIHLIDLLQWFLGDVKGVYGDMLGGSGAKETEDVAVGILTFASQAKGVVEANIVTQPNNIGSSLSIFGENGTISLEGPALNRISRWYIHGEKADAEEAAKLIDIGGEQTAMYQNFISALKRQDTLLVDGYEGKKAIETIFGIYQSVLQKQPVQLPLSSFQTTDMKNK
>NC_006270.3|WP_011197652.1|828763_830059_+|nucleotide-sugar-dehydrogenase
MSKQEIHNETIAVIGLGFVGLPLAMLLISKGMRVIGVDLDKKKVEALRKGTSYISDINDQAVQDGIGTGFFRPVSDYSLIGEADAVIICVPTPLNDDAGPDLNYVKRAAQLIGAHLKKGQLVVLESSTYPGTTRDIVKPILEKSGLVCGKDFYLAYSPERVDPGNQFPIEVVPKVVGGATDACLEKVHQLYSGIYEEVVPVTSPETAELTKLLENTYRFINISFINEFAMICDRLGVNVWEVIEAASTKPYGFAAFYPGPGIGGHCIPVDPLYLQFVMKQSGLSSDFIELSEATNDRIVRYISERSLQLAGKDKATDARILIYGVTYKRNIADVRESKSLDIIEKLIGMGADVSYHDPHVPDLDLSGKKLASVPIDSKMLKEYDCVVILTDHDALPKELLLNHANVIFDTRGVLREAAGKAKVIQLGNGRS
>NC_006270.3|WP_011197653.1|830139_831051_+|alpha/beta-hydrolase
MWIGILLMVSGIGISIFAVSLIVSYLFVLPNRSTYEETFFSGLKHGEIIDDVFESHDKEELFLTAGDGCRLHALLFPVQKSRKAVIISHGIKWSLFGGYKYVELFQSIGYNVLLCDSRCHGLSGGSHVSYGFYEKDDLARWADELENRFGKDLWIGVLGESLGAAAAIELMKQDRRIKFCIADSCFSDLTELCRFQLKAAVKLSVPFLIPLASGLIKRRHGWSLADISPVSNLEQSDTPLLIIHGTKDQLVPPEMAKSLYERKKGFKKLYWIEGAGHVGGFRHNPEEYLNKIKDFILKIEPAN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NC_006270_1	1.18\|817243\|22\|NC_006270\|CRT	817243-817264	22	NC_006270.3	813884-813905	1	0.955
NC_006270_1	1.20\|817342\|22\|NC_006270\|CRT	817342-817363	22	NC_006270.3	813884-813905	1	0.955
NC_006270_1	1.21\|817387\|22\|NC_006270\|CRT	817387-817408	22	NC_006270.3	817864-817885	1	0.955
NC_006270_1	1.24\|817540\|22\|NC_006270\|CRT	817540-817561	22	NC_006270.3	817855-817876	1	0.955
NC_006270_1	1.25\|817585\|22\|NC_006270\|CRT	817585-817606	22	NC_006270.3	812237-812258	1	0.955
NC_006270_1	1.25\|817585\|22\|NC_006270\|CRT	817585-817606	22	NC_006270.3	812939-812960	1	0.955
NC_006270_1	1.25\|817585\|22\|NC_006270\|CRT	817585-817606	22	NC_006270.3	813254-813275	1	0.955
NC_006270_1	1.25\|817585\|22\|NC_006270\|CRT	817585-817606	22	NC_006270.3	813317-813338	1	0.955
NC_006270_1	1.25\|817585\|22\|NC_006270\|CRT	817585-817606	22	NC_006270.3	813866-813887	1	0.955
NC_006270_1	1.25\|817585\|22\|NC_006270\|CRT	817585-817606	22	NC_006270.3	817855-817876	1	0.955
NC_006270_1	1.18\|817243\|22\|NC_006270\|CRT	817243-817264	22	NC_006270.3	812372-812393	2	0.909
NC_006270_1	1.18\|817243\|22\|NC_006270\|CRT	817243-817264	22	NC_006270.3	813398-813419	2	0.909
NC_006270_1	1.18\|817243\|22\|NC_006270\|CRT	817243-817264	22	NC_006270.3	813443-813464	2	0.909
NC_006270_1	1.18\|817243\|22\|NC_006270\|CRT	817243-817264	22	NC_006270.3	813929-813950	2	0.909
NC_006270_1	1.20\|817342\|22\|NC_006270\|CRT	817342-817363	22	NC_006270.3	812372-812393	2	0.909
NC_006270_1	1.20\|817342\|22\|NC_006270\|CRT	817342-817363	22	NC_006270.3	813398-813419	2	0.909
NC_006270_1	1.20\|817342\|22\|NC_006270\|CRT	817342-817363	22	NC_006270.3	813443-813464	2	0.909
NC_006270_1	1.20\|817342\|22\|NC_006270\|CRT	817342-817363	22	NC_006270.3	813929-813950	2	0.909
NC_006270_1	1.21\|817387\|22\|NC_006270\|CRT	817387-817408	22	NC_006270.3	812453-812474	2	0.909
NC_006270_1	1.21\|817387\|22\|NC_006270\|CRT	817387-817408	22	NC_006270.3	812561-812582	2	0.909
NC_006270_1	1.21\|817387\|22\|NC_006270\|CRT	817387-817408	22	NC_006270.3	812669-812690	2	0.909
NC_006270_1	1.21\|817387\|22\|NC_006270\|CRT	817387-817408	22	NC_006270.3	812732-812753	2	0.909
NC_006270_1	1.21\|817387\|22\|NC_006270\|CRT	817387-817408	22	NC_006270.3	813524-813545	2	0.909
NC_006270_1	1.21\|817387\|22\|NC_006270\|CRT	817387-817408	22	NC_006270.3	813668-813689	2	0.909
NC_006270_1	1.21\|817387\|22\|NC_006270\|CRT	817387-817408	22	NC_006270.3	813731-813752	2	0.909
NC_006270_1	1.21\|817387\|22\|NC_006270\|CRT	817387-817408	22	NC_006270.3	813839-813860	2	0.909
NC_006270_1	1.21\|817387\|22\|NC_006270\|CRT	817387-817408	22	NC_006270.3	814010-814031	2	0.909
NC_006270_1	1.21\|817387\|22\|NC_006270\|CRT	817387-817408	22	NC_006270.3	814505-814526	2	0.909
NC_006270_1	1.23\|817495\|22\|NC_006270\|CRT	817495-817516	22	NC_006270.3	812444-812465	2	0.909
NC_006270_1	1.23\|817495\|22\|NC_006270\|CRT	817495-817516	22	NC_006270.3	812660-812681	2	0.909
NC_006270_1	1.23\|817495\|22\|NC_006270\|CRT	817495-817516	22	NC_006270.3	814001-814022	2	0.909
NC_006270_1	1.24\|817540\|22\|NC_006270\|CRT	817540-817561	22	NC_006270.3	811994-812015	2	0.909
NC_006270_1	1.24\|817540\|22\|NC_006270\|CRT	817540-817561	22	NC_006270.3	813227-813248	2	0.909
NC_006270_1	1.25\|817585\|22\|NC_006270\|CRT	817585-817606	22	NC_006270.3	812921-812942	2	0.909
NC_006270_1	1.25\|817585\|22\|NC_006270\|CRT	817585-817606	22	NC_006270.3	813227-813248	2	0.909
NC_006270_1	1.27\|817675\|22\|NC_006270\|CRT	817675-817696	22	NC_006270.3	811958-811979	2	0.909
NC_006270_1	1.27\|817675\|22\|NC_006270\|CRT	817675-817696	22	NC_006270.3	812336-812357	2	0.909
NC_006270_1	1.27\|817675\|22\|NC_006270\|CRT	817675-817696	22	NC_006270.3	812786-812807	2	0.909
NC_006270_1	1.27\|817675\|22\|NC_006270\|CRT	817675-817696	22	NC_006270.3	813011-813032	2	0.909
NC_006270_1	1.27\|817675\|22\|NC_006270\|CRT	817675-817696	22	NC_006270.3	813785-813806	2	0.909
NC_006270_1	1.27\|817675\|22\|NC_006270\|CRT	817675-817696	22	NC_006270.3	814559-814580	2	0.909

1. spacer 1.18|817243|22|NC_006270|CRT matches to position: 813884-813905, mismatch: 1, identity: 0.955

gacaggtccgacgggagcaacg	CRISPR spacer
gacaggtccgaccggagcaacg	Protospacer
************ *********

2. spacer 1.20|817342|22|NC_006270|CRT matches to position: 813884-813905, mismatch: 1, identity: 0.955

gacaggtccgacgggagcaacg	CRISPR spacer
gacaggtccgaccggagcaacg	Protospacer
************ *********

3. spacer 1.21|817387|22|NC_006270|CRT matches to position: 817864-817885, mismatch: 1, identity: 0.955

aacgggagcaacaggtccaaca	CRISPR spacer
aacaggagcaacaggtccaaca	Protospacer
***.******************

4. spacer 1.24|817540|22|NC_006270|CRT matches to position: 817855-817876, mismatch: 1, identity: 0.955

gacaggtccgacaggagcaaca	CRISPR spacer
gacaggtccaacaggagcaaca	Protospacer
*********.************

5. spacer 1.25|817585|22|NC_006270|CRT matches to position: 812237-812258, mismatch: 1, identity: 0.955

gacaggtccaacaggagcgaca	CRISPR spacer
gacaggtgcaacaggagcgaca	Protospacer
******* **************

6. spacer 1.25|817585|22|NC_006270|CRT matches to position: 812939-812960, mismatch: 1, identity: 0.955

gacaggtccaacaggagcgaca	CRISPR spacer
gacaggtgcaacaggagcgaca	Protospacer
******* **************

7. spacer 1.25|817585|22|NC_006270|CRT matches to position: 813254-813275, mismatch: 1, identity: 0.955

gacaggtccaacaggagcgaca	CRISPR spacer
gacgggtccaacaggagcgaca	Protospacer
***.******************

8. spacer 1.25|817585|22|NC_006270|CRT matches to position: 813317-813338, mismatch: 1, identity: 0.955

gacaggtccaacaggagcgaca	CRISPR spacer
gacaggtgcaacaggagcgaca	Protospacer
******* **************

9. spacer 1.25|817585|22|NC_006270|CRT matches to position: 813866-813887, mismatch: 1, identity: 0.955

gacaggtccaacaggagcgaca	CRISPR spacer
gacaggtgcaacaggagcgaca	Protospacer
******* **************

10. spacer 1.25|817585|22|NC_006270|CRT matches to position: 817855-817876, mismatch: 1, identity: 0.955

gacaggtccaacaggagcgaca	CRISPR spacer
gacaggtccaacaggagcaaca	Protospacer
******************.***

11. spacer 1.18|817243|22|NC_006270|CRT matches to position: 812372-812393, mismatch: 2, identity: 0.909

gacaggtccgacgggagcaacg	CRISPR spacer
gacgggtccgaccggagcaacg	Protospacer
***.******** *********

12. spacer 1.18|817243|22|NC_006270|CRT matches to position: 813398-813419, mismatch: 2, identity: 0.909

gacaggtccgacgggagcaacg	CRISPR spacer
gacaggtccgaccggagaaacg	Protospacer
************ **** ****

13. spacer 1.18|817243|22|NC_006270|CRT matches to position: 813443-813464, mismatch: 2, identity: 0.909

gacaggtccgacgggagcaacg	CRISPR spacer
gacgggtccgaccggagcaacg	Protospacer
***.******** *********

14. spacer 1.18|817243|22|NC_006270|CRT matches to position: 813929-813950, mismatch: 2, identity: 0.909

gacaggtccgacgggagcaacg	CRISPR spacer
gacgggtccgaccggagcaacg	Protospacer
***.******** *********

15. spacer 1.20|817342|22|NC_006270|CRT matches to position: 812372-812393, mismatch: 2, identity: 0.909

gacaggtccgacgggagcaacg	CRISPR spacer
gacgggtccgaccggagcaacg	Protospacer
***.******** *********

16. spacer 1.20|817342|22|NC_006270|CRT matches to position: 813398-813419, mismatch: 2, identity: 0.909

gacaggtccgacgggagcaacg	CRISPR spacer
gacaggtccgaccggagaaacg	Protospacer
************ **** ****

17. spacer 1.20|817342|22|NC_006270|CRT matches to position: 813443-813464, mismatch: 2, identity: 0.909

gacaggtccgacgggagcaacg	CRISPR spacer
gacgggtccgaccggagcaacg	Protospacer
***.******** *********

18. spacer 1.20|817342|22|NC_006270|CRT matches to position: 813929-813950, mismatch: 2, identity: 0.909

gacaggtccgacgggagcaacg	CRISPR spacer
gacgggtccgaccggagcaacg	Protospacer
***.******** *********

19. spacer 1.21|817387|22|NC_006270|CRT matches to position: 812453-812474, mismatch: 2, identity: 0.909

aacgggagcaacaggtccaaca	CRISPR spacer
aacgggagcgaccggtccaaca	Protospacer
*********.** *********

20. spacer 1.21|817387|22|NC_006270|CRT matches to position: 812561-812582, mismatch: 2, identity: 0.909

aacgggagcaacaggtccaaca	CRISPR spacer
aacgggagcgacgggtccaaca	Protospacer
*********.**.*********

21. spacer 1.21|817387|22|NC_006270|CRT matches to position: 812669-812690, mismatch: 2, identity: 0.909

aacgggagcaacaggtccaaca	CRISPR spacer
aacgggagcgaccggtccaaca	Protospacer
*********.** *********

22. spacer 1.21|817387|22|NC_006270|CRT matches to position: 812732-812753, mismatch: 2, identity: 0.909

aacgggagcaacaggtccaaca	CRISPR spacer
aacgggagcgacgggtccaaca	Protospacer
*********.**.*********

23. spacer 1.21|817387|22|NC_006270|CRT matches to position: 813524-813545, mismatch: 2, identity: 0.909

aacgggagcaacaggtccaaca	CRISPR spacer
aacgggagcgacgggtccaaca	Protospacer
*********.**.*********

24. spacer 1.21|817387|22|NC_006270|CRT matches to position: 813668-813689, mismatch: 2, identity: 0.909

aacgggagcaacaggtccaaca	CRISPR spacer
aacgggagcaacaggagcaaca	Protospacer
***************  *****

25. spacer 1.21|817387|22|NC_006270|CRT matches to position: 813731-813752, mismatch: 2, identity: 0.909

aacgggagcaacaggtccaaca	CRISPR spacer
aacgggagcgacgggtccaaca	Protospacer
*********.**.*********

26. spacer 1.21|817387|22|NC_006270|CRT matches to position: 813839-813860, mismatch: 2, identity: 0.909

aacgggagcaacaggtccaaca	CRISPR spacer
aacaggagtaacaggtccaaca	Protospacer
***.****.*************

27. spacer 1.21|817387|22|NC_006270|CRT matches to position: 814010-814031, mismatch: 2, identity: 0.909

aacgggagcaacaggtccaaca	CRISPR spacer
aacgggagcgaccggtccaaca	Protospacer
*********.** *********

28. spacer 1.21|817387|22|NC_006270|CRT matches to position: 814505-814526, mismatch: 2, identity: 0.909

aacgggagcaacaggtccaaca	CRISPR spacer
aacgggagcgacgggtccaaca	Protospacer
*********.**.*********

29. spacer 1.23|817495|22|NC_006270|CRT matches to position: 812444-812465, mismatch: 2, identity: 0.909

caccggcccgacaggagcgacc	CRISPR spacer
caccggcccaacgggagcgacc	Protospacer
*********.**.*********

30. spacer 1.23|817495|22|NC_006270|CRT matches to position: 812660-812681, mismatch: 2, identity: 0.909

caccggcccgacaggagcgacc	CRISPR spacer
caccggcccaacgggagcgacc	Protospacer
*********.**.*********

31. spacer 1.23|817495|22|NC_006270|CRT matches to position: 814001-814022, mismatch: 2, identity: 0.909

caccggcccgacaggagcgacc	CRISPR spacer
caccggcccaacgggagcgacc	Protospacer
*********.**.*********

32. spacer 1.24|817540|22|NC_006270|CRT matches to position: 811994-812015, mismatch: 2, identity: 0.909

gacaggtccgacaggagcaaca	CRISPR spacer
gacgggtccgacaggagtaaca	Protospacer
***.*************.****

33. spacer 1.24|817540|22|NC_006270|CRT matches to position: 813227-813248, mismatch: 2, identity: 0.909

gacaggtccgacaggagcaaca	CRISPR spacer
gacgggtccaacaggagcaaca	Protospacer
***.*****.************

34. spacer 1.25|817585|22|NC_006270|CRT matches to position: 812921-812942, mismatch: 2, identity: 0.909

gacaggtccaacaggagcgaca	CRISPR spacer
gacgggtccaactggagcgaca	Protospacer
***.******** *********

35. spacer 1.25|817585|22|NC_006270|CRT matches to position: 813227-813248, mismatch: 2, identity: 0.909

gacaggtccaacaggagcgaca	CRISPR spacer
gacgggtccaacaggagcaaca	Protospacer
***.**************.***

36. spacer 1.27|817675|22|NC_006270|CRT matches to position: 811958-811979, mismatch: 2, identity: 0.909

gacaggtccaacaggagccacc	CRISPR spacer
gaccgggccaacaggagccacc	Protospacer
*** ** ***************

37. spacer 1.27|817675|22|NC_006270|CRT matches to position: 812336-812357, mismatch: 2, identity: 0.909

gacaggtccaacaggagccacc	CRISPR spacer
gacaggtgcaaccggagccacc	Protospacer
******* **** *********

38. spacer 1.27|817675|22|NC_006270|CRT matches to position: 812786-812807, mismatch: 2, identity: 0.909

gacaggtccaacaggagccacc	CRISPR spacer
gacgggtccaacgggagccacc	Protospacer
***.********.*********

39. spacer 1.27|817675|22|NC_006270|CRT matches to position: 813011-813032, mismatch: 2, identity: 0.909

gacaggtccaacaggagccacc	CRISPR spacer
gacgggtccaacgggagccacc	Protospacer
***.********.*********

40. spacer 1.27|817675|22|NC_006270|CRT matches to position: 813785-813806, mismatch: 2, identity: 0.909

gacaggtccaacaggagccacc	CRISPR spacer
gacgggtccaacgggagccacc	Protospacer
***.********.*********

41. spacer 1.27|817675|22|NC_006270|CRT matches to position: 814559-814580, mismatch: 2, identity: 0.909

gacaggtccaacaggagccacc	CRISPR spacer
gacgggtccaacgggagccacc	Protospacer
***.********.*********

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_006270_1	1.21\|817387\|22\|NC_006270\|CRT	817387-817408	22	NZ_CP053936	Bacillus thuringiensis strain FDAARGOS_794 plasmid unnamed4, complete sequence	11649-11670	1	0.955
NC_006270_1	1.21\|817387\|22\|NC_006270\|CRT	817387-817408	22	NZ_CP053933	Bacillus thuringiensis strain FDAARGOS_794 plasmid unnamed2, complete sequence	41510-41531	1	0.955
NC_006270_1	1.21\|817387\|22\|NC_006270\|CRT	817387-817408	22	NZ_CP009718	Bacillus thuringiensis strain HD682 plasmid pBGN_2, complete sequence	15502-15523	1	0.955
NC_006270_1	1.21\|817387\|22\|NC_006270\|CRT	817387-817408	22	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	125285-125306	1	0.955
NC_006270_1	1.21\|817387\|22\|NC_006270\|CRT	817387-817408	22	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	125342-125363	1	0.955
NC_006270_1	1.21\|817387\|22\|NC_006270\|CRT	817387-817408	22	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	125399-125420	1	0.955
NC_006270_1	1.21\|817387\|22\|NC_006270\|CRT	817387-817408	22	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	125531-125552	1	0.955
NC_006270_1	1.21\|817387\|22\|NC_006270\|CRT	817387-817408	22	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	125588-125609	1	0.955
NC_006270_1	1.21\|817387\|22\|NC_006270\|CRT	817387-817408	22	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	125645-125666	1	0.955
NC_006270_1	1.21\|817387\|22\|NC_006270\|CRT	817387-817408	22	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	125702-125723	1	0.955
NC_006270_1	1.21\|817387\|22\|NC_006270\|CRT	817387-817408	22	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	125759-125780	1	0.955
NC_006270_1	1.25\|817585\|22\|NC_006270\|CRT	817585-817606	22	MT219824	Escherichia coli strain RT18-1 plasmid pRT18-1_294k_tetX, complete sequence	246940-246961	2	0.909
NC_006270_1	1.25\|817585\|22\|NC_006270\|CRT	817585-817606	22	MT219824	Escherichia coli strain RT18-1 plasmid pRT18-1_294k_tetX, complete sequence	246958-246979	2	0.909
NC_006270_1	1.18\|817243\|22\|NC_006270\|CRT	817243-817264	22	NC_016586	Azospirillum lipoferum 4B plasmid AZO_p2, complete sequence	182325-182346	3	0.864
NC_006270_1	1.20\|817342\|22\|NC_006270\|CRT	817342-817363	22	NC_016586	Azospirillum lipoferum 4B plasmid AZO_p2, complete sequence	182325-182346	3	0.864
NC_006270_1	1.26\|817630\|22\|NC_006270\|CRT	817630-817651	22	NC_023607	Mycobacterium phage 40AC, complete genome	5081-5102	3	0.864
NC_006270_1	1.16\|817126\|40\|NC_006270\|CRT	817126-817165	40	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321878-321917	5	0.875
NC_006270_1	1.16\|817126\|40\|NC_006270\|CRT	817126-817165	40	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	130-169	5	0.875
NC_006270_1	1.16\|817126\|40\|NC_006270\|CRT	817126-817165	40	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	229-268	5	0.875
NC_006270_1	1.10\|816685\|31\|NC_006270\|CRT	816685-816715	31	NZ_CP009638	Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence	42486-42516	6	0.806
NC_006270_1	1.10\|816685\|31\|NC_006270\|CRT	816685-816715	31	NZ_CP009639	Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence	137887-137917	6	0.806
NC_006270_1	1.10\|816685\|31\|NC_006270\|CRT	816685-816715	31	NZ_CP053963	Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence	179472-179502	6	0.806
NC_006270_1	1.10\|816685\|31\|NC_006270\|CRT	816685-816715	31	NZ_CP053966	Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence	53676-53706	6	0.806
NC_006270_1	1.16\|817126\|40\|NC_006270\|CRT	817126-817165	40	MG209611	Aphanizomenon phage vB_AphaS-CL131, complete genome	32378-32417	6	0.85
NC_006270_1	1.28\|817720\|31\|NC_006270\|CRT	817720-817750	31	NC_010180	Bacillus mycoides KBAB4 plasmid pBWB401, complete sequence	116658-116688	6	0.806
NC_006270_1	1.30\|817819\|31\|NC_006270\|CRT	817819-817849	31	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68962-68992	6	0.806
NC_006270_1	1.30\|817819\|31\|NC_006270\|CRT	817819-817849	31	NZ_CP015063	Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence	1287-1317	6	0.806
NC_006270_1	1.30\|817819\|31\|NC_006270\|CRT	817819-817849	31	NC_008464	Stx2-converting phage 86, complete genome	18069-18099	6	0.806
NC_006270_1	1.30\|817819\|31\|NC_006270\|CRT	817819-817849	31	KJ603229	Shigella phage POCJ13, complete genome	38799-38829	6	0.806
NC_006270_1	1.30\|817819\|31\|NC_006270\|CRT	817819-817849	31	AB255436	Stx2-converting phage 86 DNA, complete genome	18069-18099	6	0.806
NC_006270_1	1.10\|816685\|31\|NC_006270\|CRT	816685-816715	31	NZ_CP009638	Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence	42450-42480	7	0.774
NC_006270_1	1.10\|816685\|31\|NC_006270\|CRT	816685-816715	31	NZ_CP009638	Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence	42522-42552	7	0.774
NC_006270_1	1.10\|816685\|31\|NC_006270\|CRT	816685-816715	31	NZ_CP009638	Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence	42558-42588	7	0.774
NC_006270_1	1.10\|816685\|31\|NC_006270\|CRT	816685-816715	31	NZ_CP009638	Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence	42594-42624	7	0.774
NC_006270_1	1.10\|816685\|31\|NC_006270\|CRT	816685-816715	31	NZ_CP009638	Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence	42630-42660	7	0.774
NC_006270_1	1.10\|816685\|31\|NC_006270\|CRT	816685-816715	31	NZ_CP009639	Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence	137851-137881	7	0.774
NC_006270_1	1.10\|816685\|31\|NC_006270\|CRT	816685-816715	31	NZ_CP009639	Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence	137923-137953	7	0.774
NC_006270_1	1.10\|816685\|31\|NC_006270\|CRT	816685-816715	31	NZ_CP009639	Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence	137959-137989	7	0.774
NC_006270_1	1.10\|816685\|31\|NC_006270\|CRT	816685-816715	31	NZ_CP009639	Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence	137995-138025	7	0.774
NC_006270_1	1.10\|816685\|31\|NC_006270\|CRT	816685-816715	31	NZ_CP009639	Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence	138031-138061	7	0.774
NC_006270_1	1.10\|816685\|31\|NC_006270\|CRT	816685-816715	31	NZ_CP053963	Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence	179436-179466	7	0.774
NC_006270_1	1.10\|816685\|31\|NC_006270\|CRT	816685-816715	31	NZ_CP053963	Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence	179508-179538	7	0.774
NC_006270_1	1.10\|816685\|31\|NC_006270\|CRT	816685-816715	31	NZ_CP053963	Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence	179544-179574	7	0.774
NC_006270_1	1.10\|816685\|31\|NC_006270\|CRT	816685-816715	31	NZ_CP053963	Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence	179580-179610	7	0.774
NC_006270_1	1.10\|816685\|31\|NC_006270\|CRT	816685-816715	31	NZ_CP053963	Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence	179616-179646	7	0.774
NC_006270_1	1.10\|816685\|31\|NC_006270\|CRT	816685-816715	31	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	328232-328262	7	0.774
NC_006270_1	1.10\|816685\|31\|NC_006270\|CRT	816685-816715	31	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	327944-327974	7	0.774
NC_006270_1	1.10\|816685\|31\|NC_006270\|CRT	816685-816715	31	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	327980-328010	7	0.774
NC_006270_1	1.10\|816685\|31\|NC_006270\|CRT	816685-816715	31	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	328106-328136	7	0.774
NC_006270_1	1.10\|816685\|31\|NC_006270\|CRT	816685-816715	31	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	328142-328172	7	0.774
NC_006270_1	1.10\|816685\|31\|NC_006270\|CRT	816685-816715	31	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	328178-328208	7	0.774
NC_006270_1	1.10\|816685\|31\|NC_006270\|CRT	816685-816715	31	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	328196-328226	7	0.774
NC_006270_1	1.10\|816685\|31\|NC_006270\|CRT	816685-816715	31	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	328286-328316	7	0.774
NC_006270_1	1.10\|816685\|31\|NC_006270\|CRT	816685-816715	31	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	328322-328352	7	0.774
NC_006270_1	1.10\|816685\|31\|NC_006270\|CRT	816685-816715	31	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	328358-328388	7	0.774
NC_006270_1	1.10\|816685\|31\|NC_006270\|CRT	816685-816715	31	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4792-4822	7	0.774
NC_006270_1	1.10\|816685\|31\|NC_006270\|CRT	816685-816715	31	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4504-4534	7	0.774
NC_006270_1	1.10\|816685\|31\|NC_006270\|CRT	816685-816715	31	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4540-4570	7	0.774
NC_006270_1	1.10\|816685\|31\|NC_006270\|CRT	816685-816715	31	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4666-4696	7	0.774
NC_006270_1	1.10\|816685\|31\|NC_006270\|CRT	816685-816715	31	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4702-4732	7	0.774
NC_006270_1	1.10\|816685\|31\|NC_006270\|CRT	816685-816715	31	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4738-4768	7	0.774
NC_006270_1	1.10\|816685\|31\|NC_006270\|CRT	816685-816715	31	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4756-4786	7	0.774
NC_006270_1	1.10\|816685\|31\|NC_006270\|CRT	816685-816715	31	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4846-4876	7	0.774
NC_006270_1	1.10\|816685\|31\|NC_006270\|CRT	816685-816715	31	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4882-4912	7	0.774
NC_006270_1	1.10\|816685\|31\|NC_006270\|CRT	816685-816715	31	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4918-4948	7	0.774
NC_006270_1	1.10\|816685\|31\|NC_006270\|CRT	816685-816715	31	NZ_CP053966	Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence	53532-53562	7	0.774
NC_006270_1	1.10\|816685\|31\|NC_006270\|CRT	816685-816715	31	NZ_CP053966	Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence	53568-53598	7	0.774
NC_006270_1	1.10\|816685\|31\|NC_006270\|CRT	816685-816715	31	NZ_CP053966	Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence	53604-53634	7	0.774
NC_006270_1	1.10\|816685\|31\|NC_006270\|CRT	816685-816715	31	NZ_CP053966	Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence	53640-53670	7	0.774
NC_006270_1	1.10\|816685\|31\|NC_006270\|CRT	816685-816715	31	NZ_CP053966	Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence	53712-53742	7	0.774
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	KJ019142	Synechococcus phage ACG-2014f isolate Syn7803C11, complete genome	178277-178307	7	0.774
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	NC_022043	Paracoccus aminophilus JCM 7686 plasmid pAMI5, complete sequence	107244-107274	7	0.774
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	KJ019142	Synechococcus phage ACG-2014f isolate Syn7803C11, complete genome	178277-178307	7	0.774
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	NC_022043	Paracoccus aminophilus JCM 7686 plasmid pAMI5, complete sequence	107244-107274	7	0.774
NC_006270_1	1.28\|817720\|31\|NC_006270\|CRT	817720-817750	31	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	131127-131157	7	0.774
NC_006270_1	1.30\|817819\|31\|NC_006270\|CRT	817819-817849	31	NZ_CP021213	Sinorhizobium meliloti RU11/001 plasmid pSmeRU11a, complete sequence	24922-24952	7	0.774
NC_006270_1	1.30\|817819\|31\|NC_006270\|CRT	817819-817849	31	NZ_CP053933	Bacillus thuringiensis strain FDAARGOS_794 plasmid unnamed2, complete sequence	41405-41435	7	0.774
NC_006270_1	1.30\|817819\|31\|NC_006270\|CRT	817819-817849	31	NZ_CP053936	Bacillus thuringiensis strain FDAARGOS_794 plasmid unnamed4, complete sequence	11745-11775	7	0.774
NC_006270_1	1.30\|817819\|31\|NC_006270\|CRT	817819-817849	31	NZ_CP009718	Bacillus thuringiensis strain HD682 plasmid pBGN_2, complete sequence	15397-15427	7	0.774
NC_006270_1	1.30\|817819\|31\|NC_006270\|CRT	817819-817849	31	NZ_CP013524	Rhizobium phaseoli strain R744 plasmid pRphaR744b, complete sequence	199021-199051	7	0.774
NC_006270_1	1.30\|817819\|31\|NC_006270\|CRT	817819-817849	31	NZ_CP013553	Rhizobium phaseoli strain N931 plasmid pRphaN931a, complete sequence	208481-208511	7	0.774
NC_006270_1	1.30\|817819\|31\|NC_006270\|CRT	817819-817849	31	NZ_CP013586	Rhizobium phaseoli strain N161 plasmid pRphaN161a, complete sequence	213175-213205	7	0.774
NC_006270_1	1.30\|817819\|31\|NC_006270\|CRT	817819-817849	31	NZ_CP013559	Rhizobium phaseoli strain N841 plasmid pRphaN841b, complete sequence	209863-209893	7	0.774
NC_006270_1	1.30\|817819\|31\|NC_006270\|CRT	817819-817849	31	NZ_CP013576	Rhizobium phaseoli strain N671 plasmid pRphaN671b, complete sequence	210256-210286	7	0.774
NC_006270_1	1.30\|817819\|31\|NC_006270\|CRT	817819-817849	31	NZ_CP013548	Rhizobium phaseoli strain R611 plasmid pRetR611a, complete sequence	210254-210284	7	0.774
NC_006270_1	1.30\|817819\|31\|NC_006270\|CRT	817819-817849	31	NZ_CP013528	Rhizobium phaseoli strain R723 plasmid pRphaR723a, complete sequence	208434-208464	7	0.774
NC_006270_1	1.30\|817819\|31\|NC_006270\|CRT	817819-817849	31	NZ_CP013533	Rhizobium phaseoli strain R650 plasmid pRphaR650a, complete sequence	210254-210284	7	0.774
NC_006270_1	1.30\|817819\|31\|NC_006270\|CRT	817819-817849	31	NZ_CP013543	Rhizobium phaseoli strain R620 plasmid pRphaR620a, complete sequence	213666-213696	7	0.774
NC_006270_1	1.30\|817819\|31\|NC_006270\|CRT	817819-817849	31	NZ_CP013564	Rhizobium phaseoli strain N831 plasmid pRphaN831a, complete sequence	208481-208511	7	0.774
NC_006270_1	1.30\|817819\|31\|NC_006270\|CRT	817819-817849	31	NZ_CP013581	Rhizobium phaseoli strain N261 plasmid pRphaN261a, complete sequence	208437-208467	7	0.774
NC_006270_1	1.30\|817819\|31\|NC_006270\|CRT	817819-817849	31	NZ_CP013570	Rhizobium phaseoli strain N771 plasmid pRphaN771b, complete sequence	210256-210286	7	0.774
NC_006270_1	1.9\|816631\|31\|NC_006270\|CRT	816631-816661	31	NZ_CP013267	Sphingobium baderi strain DE-13 plasmid pDE3, complete sequence	53499-53529	8	0.742
NC_006270_1	1.9\|816631\|31\|NC_006270\|CRT	816631-816661	31	NC_014007	Sphingobium japonicum UT26S plasmid pCHQ1, complete sequence	14694-14724	8	0.742
NC_006270_1	1.10\|816685\|31\|NC_006270\|CRT	816685-816715	31	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	251877-251907	8	0.742
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	NZ_CP054617	Azospirillum oryzae strain KACC 14407 plasmid unnamed3, complete sequence	180129-180159	8	0.742
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	NZ_AP022319	Burkholderia sp. THE68 plasmid BTHE68_p1, complete sequence	1136542-1136572	8	0.742
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	NC_016585	Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence	787561-787591	8	0.742
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	NZ_CP054616	Azospirillum oryzae strain KACC 14407 plasmid unnamed2, complete sequence	410986-411016	8	0.742
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	NZ_CP054617	Azospirillum oryzae strain KACC 14407 plasmid unnamed3, complete sequence	180129-180159	8	0.742
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	NZ_AP022319	Burkholderia sp. THE68 plasmid BTHE68_p1, complete sequence	1136542-1136572	8	0.742
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	NC_016585	Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence	787561-787591	8	0.742
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	NZ_CP054616	Azospirillum oryzae strain KACC 14407 plasmid unnamed2, complete sequence	410986-411016	8	0.742
NC_006270_1	1.28\|817720\|31\|NC_006270\|CRT	817720-817750	31	NC_018512	Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence	2695-2725	8	0.742
NC_006270_1	1.28\|817720\|31\|NC_006270\|CRT	817720-817750	31	NC_004334	Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence	196-226	8	0.742
NC_006270_1	1.30\|817819\|31\|NC_006270\|CRT	817819-817849	31	NZ_CP032322	Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence	1350789-1350819	8	0.742
NC_006270_1	1.30\|817819\|31\|NC_006270\|CRT	817819-817849	31	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	1045167-1045197	8	0.742
NC_006270_1	1.30\|817819\|31\|NC_006270\|CRT	817819-817849	31	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	174804-174834	8	0.742
NC_006270_1	1.30\|817819\|31\|NC_006270\|CRT	817819-817849	31	NZ_CP032340	Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence	545649-545679	8	0.742
NC_006270_1	1.30\|817819\|31\|NC_006270\|CRT	817819-817849	31	NZ_CP032346	Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence	1358048-1358078	8	0.742
NC_006270_1	1.30\|817819\|31\|NC_006270\|CRT	817819-817849	31	NZ_CP012915	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence	1586738-1586768	8	0.742
NC_006270_1	1.9\|816631\|31\|NC_006270\|CRT	816631-816661	31	NC_022235	Sphingomonas sp. ERG5 plasmid pCADAB1, complete sequence	118303-118333	9	0.71
NC_006270_1	1.9\|816631\|31\|NC_006270\|CRT	816631-816661	31	NZ_CP017078	Novosphingobium resinovorum strain SA1 plasmid pSA3, complete sequence	166367-166397	9	0.71
NC_006270_1	1.9\|816631\|31\|NC_006270\|CRT	816631-816661	31	KX641263	Mycobacterium phage Kalpine, complete genome	5060-5090	9	0.71
NC_006270_1	1.9\|816631\|31\|NC_006270\|CRT	816631-816661	31	MK937594	Gordonia phage Galadriel, complete genome	47808-47838	9	0.71
NC_006270_1	1.9\|816631\|31\|NC_006270\|CRT	816631-816661	31	NC_013190	Candidatus Accumulibacter phosphatis clade IIA str. UW-1 plasmid pAph02, complete sequence	29330-29360	9	0.71
NC_006270_1	1.10\|816685\|31\|NC_006270\|CRT	816685-816715	31	NZ_CP033971	Cupriavidus pauculus strain FDAARGOS_614 plasmid unnamed2, complete sequence	251878-251908	9	0.71
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	NZ_CP016613	Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence	936204-936234	9	0.71
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	NZ_CP021449	Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence	354086-354116	9	0.71
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	NZ_CP049794	Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence	936693-936723	9	0.71
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	NZ_CP049788	Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence	128389-128419	9	0.71
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	NZ_CP049792	Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence	718169-718199	9	0.71
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	599694-599724	9	0.71
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	NZ_CP015851	Ralstonia solanacearum strain YC40-M plasmid, complete sequence	701587-701617	9	0.71
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	NZ_CP022781	Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence	267829-267859	9	0.71
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	NZ_CP052111	Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence	235689-235719	9	0.71
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	NZ_CP052113	Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence	235689-235719	9	0.71
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	CP023013	Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence	1708497-1708527	9	0.71
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	NZ_CP049790	Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence	1735155-1735185	9	0.71
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	NZ_CP022766	Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence	1763964-1763994	9	0.71
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	NZ_CP021763	Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence	1795458-1795488	9	0.71
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	NZ_CP015116	Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence	1939675-1939705	9	0.71
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	NZ_CP016555	Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence	1416282-1416312	9	0.71
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	NZ_CP052069	Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence	1694710-1694740	9	0.71
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	NZ_CP016915	Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence	309792-309822	9	0.71
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	NZ_CP016905	Ralstonia solanacearum strain KACC 10709 plasmid unnamed1	693405-693435	9	0.71
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	NZ_CP022769	Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence	1773460-1773490	9	0.71
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	NZ_CP022773	Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence	1481084-1481114	9	0.71
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	NZ_CP022783	Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence	1715740-1715770	9	0.71
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	NZ_CP022791	Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence	1734626-1734656	9	0.71
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	NZ_CP022795	Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence	1710560-1710590	9	0.71
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	NZ_CP052071	Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence	1779392-1779422	9	0.71
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	NZ_CP009763	Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence	1653489-1653519	9	0.71
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	CP023015	Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence	1710026-1710056	9	0.71
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	NZ_CP022779	Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence	1784940-1784970	9	0.71
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	NZ_CP052075	Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence	1779359-1779389	9	0.71
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	NZ_CP052085	Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence	1688813-1688843	9	0.71
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	NZ_CP052095	Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence	1764381-1764411	9	0.71
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	NZ_CP052105	Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence	1778141-1778171	9	0.71
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	NZ_CP021765	Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence	1795460-1795490	9	0.71
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	NZ_CP052077	Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence	1675288-1675318	9	0.71
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	NZ_CP052087	Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence	1689125-1689155	9	0.71
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	NZ_CP052097	Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence	1764381-1764411	9	0.71
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	NZ_CP052115	Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence	1778193-1778223	9	0.71
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	NZ_CP052127	Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence	1688813-1688843	9	0.71
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	NZ_CP052079	Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence	1675935-1675965	9	0.71
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	NZ_CP052089	Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence	1688016-1688046	9	0.71
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	NZ_CP052093	Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence	1764381-1764411	9	0.71
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	NZ_CP052101	Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence	1764381-1764411	9	0.71
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	NZ_CP052099	Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence	1764381-1764411	9	0.71
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	NZ_CP052107	Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence	1778189-1778219	9	0.71
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	NZ_CP052117	Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence	1778178-1778208	9	0.71
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	NZ_CP052125	Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence	1675311-1675341	9	0.71
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	NZ_CP022793	Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence	1689026-1689056	9	0.71
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	NZ_CP022785	Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence	1669672-1669702	9	0.71
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	NZ_CP022787	Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence	1730716-1730746	9	0.71
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	NZ_CP022756	Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence	1762697-1762727	9	0.71
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	NZ_CP052129	Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence	1761696-1761726	9	0.71
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	NZ_CP052121	Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence	1778178-1778208	9	0.71
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	NZ_CP052123	Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence	1675311-1675341	9	0.71
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	NZ_CP052131	Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence	1689124-1689154	9	0.71
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	NZ_CP052073	Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence	1779183-1779213	9	0.71
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	NZ_CP052081	Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence	1675311-1675341	9	0.71
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	NZ_CP052083	Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence	1675311-1675341	9	0.71
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	NZ_CP052109	Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence	1778189-1778219	9	0.71
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	NZ_CP052091	Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence	1764386-1764416	9	0.71
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	NZ_CP052103	Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence	1778200-1778230	9	0.71
NC_006270_1	1.17\|817189\|31\|NC_006270\|CRT	817189-817219	31	NZ_CP052119	Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence	1778001-1778031	9	0.71
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	NZ_CP016613	Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence	936204-936234	9	0.71
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	NZ_CP021449	Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence	354086-354116	9	0.71
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	NZ_CP049794	Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence	936693-936723	9	0.71
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	NZ_CP049788	Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence	128389-128419	9	0.71
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	NZ_CP049792	Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence	718169-718199	9	0.71
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	599694-599724	9	0.71
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	NZ_CP015851	Ralstonia solanacearum strain YC40-M plasmid, complete sequence	701587-701617	9	0.71
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	NZ_CP022781	Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence	267829-267859	9	0.71
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	NZ_CP052111	Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence	235689-235719	9	0.71
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	NZ_CP052113	Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence	235689-235719	9	0.71
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	CP023013	Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence	1708497-1708527	9	0.71
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	NZ_CP049790	Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence	1735155-1735185	9	0.71
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	NZ_CP022766	Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence	1763964-1763994	9	0.71
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	NZ_CP021763	Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence	1795458-1795488	9	0.71
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	NZ_CP015116	Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence	1939675-1939705	9	0.71
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	NZ_CP016555	Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence	1416282-1416312	9	0.71
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	NZ_CP052069	Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence	1694710-1694740	9	0.71
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	NZ_CP016915	Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence	309792-309822	9	0.71
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	NZ_CP016905	Ralstonia solanacearum strain KACC 10709 plasmid unnamed1	693405-693435	9	0.71
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	NZ_CP022769	Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence	1773460-1773490	9	0.71
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	NZ_CP022773	Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence	1481084-1481114	9	0.71
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	NZ_CP022783	Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence	1715740-1715770	9	0.71
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	NZ_CP022791	Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence	1734626-1734656	9	0.71
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	NZ_CP022795	Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence	1710560-1710590	9	0.71
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	NZ_CP052071	Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence	1779392-1779422	9	0.71
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	NZ_CP009763	Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence	1653489-1653519	9	0.71
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	CP023015	Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence	1710026-1710056	9	0.71
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	NZ_CP022779	Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence	1784940-1784970	9	0.71
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	NZ_CP052075	Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence	1779359-1779389	9	0.71
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	NZ_CP052085	Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence	1688813-1688843	9	0.71
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	NZ_CP052095	Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence	1764381-1764411	9	0.71
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	NZ_CP052105	Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence	1778141-1778171	9	0.71
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	NZ_CP021765	Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence	1795460-1795490	9	0.71
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	NZ_CP052077	Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence	1675288-1675318	9	0.71
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	NZ_CP052087	Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence	1689125-1689155	9	0.71
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	NZ_CP052097	Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence	1764381-1764411	9	0.71
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	NZ_CP052115	Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence	1778193-1778223	9	0.71
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	NZ_CP052127	Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence	1688813-1688843	9	0.71
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	NZ_CP052079	Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence	1675935-1675965	9	0.71
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	NZ_CP052089	Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence	1688016-1688046	9	0.71
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	NZ_CP052093	Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence	1764381-1764411	9	0.71
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	NZ_CP052101	Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence	1764381-1764411	9	0.71
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	NZ_CP052099	Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence	1764381-1764411	9	0.71
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	NZ_CP052107	Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence	1778189-1778219	9	0.71
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	NZ_CP052117	Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence	1778178-1778208	9	0.71
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	NZ_CP052125	Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence	1675311-1675341	9	0.71
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	NZ_CP022793	Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence	1689026-1689056	9	0.71
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	NZ_CP022785	Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence	1669672-1669702	9	0.71
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	NZ_CP022787	Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence	1730716-1730746	9	0.71
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	NZ_CP022756	Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence	1762697-1762727	9	0.71
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	NZ_CP052129	Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence	1761696-1761726	9	0.71
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	NZ_CP052121	Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence	1778178-1778208	9	0.71
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	NZ_CP052123	Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence	1675311-1675341	9	0.71
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	NZ_CP052131	Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence	1689124-1689154	9	0.71
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	NZ_CP052073	Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence	1779183-1779213	9	0.71
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	NZ_CP052081	Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence	1675311-1675341	9	0.71
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	NZ_CP052083	Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence	1675311-1675341	9	0.71
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	NZ_CP052109	Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence	1778189-1778219	9	0.71
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	NZ_CP052091	Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence	1764386-1764416	9	0.71
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	NZ_CP052103	Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence	1778200-1778230	9	0.71
NC_006270_1	1.19\|817288\|31\|NC_006270\|CRT	817288-817318	31	NZ_CP052119	Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence	1778001-1778031	9	0.71
NC_006270_1	1.16\|817126\|40\|NC_006270\|CRT	817126-817165	40	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130557-130596	11	0.725
NC_006270_1	1.16\|817126\|40\|NC_006270\|CRT	817126-817165	40	KY421186	Flavobacterium phage FL-1, complete genome	26878-26917	12	0.7

1. spacer 1.21|817387|22|NC_006270|CRT matches to NZ_CP053936 (Bacillus thuringiensis strain FDAARGOS_794 plasmid unnamed4, complete sequence) position: , mismatch: 1, identity: 0.955

aacgggagcaacaggtccaaca	CRISPR spacer
aacgggagcaacaggtccaacc	Protospacer
*********************

2. spacer 1.21|817387|22|NC_006270|CRT matches to NZ_CP053933 (Bacillus thuringiensis strain FDAARGOS_794 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.955

aacgggagcaacaggtccaaca	CRISPR spacer
aacgggagcaacaggtccaacc	Protospacer
*********************

3. spacer 1.21|817387|22|NC_006270|CRT matches to NZ_CP009718 (Bacillus thuringiensis strain HD682 plasmid pBGN_2, complete sequence) position: , mismatch: 1, identity: 0.955

aacgggagcaacaggtccaaca	CRISPR spacer
aacgggagcaacaggtccaacc	Protospacer
*********************

4. spacer 1.21|817387|22|NC_006270|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.955

aacgggagcaacaggtccaaca	CRISPR spacer
aacgggagcaacaggtccatca	Protospacer
******************* **

5. spacer 1.21|817387|22|NC_006270|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.955

aacgggagcaacaggtccaaca	CRISPR spacer
aacgggagcaacaggtccatca	Protospacer
******************* **

6. spacer 1.21|817387|22|NC_006270|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.955

aacgggagcaacaggtccaaca	CRISPR spacer
aacgggagcaacaggtccatca	Protospacer
******************* **

7. spacer 1.21|817387|22|NC_006270|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.955

aacgggagcaacaggtccaaca	CRISPR spacer
aacgggagcaacaggtccatca	Protospacer
******************* **

8. spacer 1.21|817387|22|NC_006270|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.955

aacgggagcaacaggtccaaca	CRISPR spacer
aacgggagcaacaggtccatca	Protospacer
******************* **

9. spacer 1.21|817387|22|NC_006270|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.955

aacgggagcaacaggtccaaca	CRISPR spacer
aacgggagcaacaggtccatca	Protospacer
******************* **

10. spacer 1.21|817387|22|NC_006270|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.955

aacgggagcaacaggtccaaca	CRISPR spacer
aacgggagcaacaggtccatca	Protospacer
******************* **

11. spacer 1.21|817387|22|NC_006270|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.955

aacgggagcaacaggtccaaca	CRISPR spacer
aacgggagcaacaggtccatca	Protospacer
******************* **

12. spacer 1.25|817585|22|NC_006270|CRT matches to MT219824 (Escherichia coli strain RT18-1 plasmid pRT18-1_294k_tetX, complete sequence) position: , mismatch: 2, identity: 0.909

gacaggtccaacaggagcgaca	CRISPR spacer
gacaggtcctacaggagcgact	Protospacer
********* ***********

13. spacer 1.25|817585|22|NC_006270|CRT matches to MT219824 (Escherichia coli strain RT18-1 plasmid pRT18-1_294k_tetX, complete sequence) position: , mismatch: 2, identity: 0.909

gacaggtccaacaggagcgaca	CRISPR spacer
aacaggtcctacaggagcgaca	Protospacer
.******** ************

14. spacer 1.18|817243|22|NC_006270|CRT matches to NC_016586 (Azospirillum lipoferum 4B plasmid AZO_p2, complete sequence) position: , mismatch: 3, identity: 0.864

gacaggtccgacgggagcaacg	CRISPR spacer
gacaggtccgacgggagcagat	Protospacer
*******************.

15. spacer 1.20|817342|22|NC_006270|CRT matches to NC_016586 (Azospirillum lipoferum 4B plasmid AZO_p2, complete sequence) position: , mismatch: 3, identity: 0.864

gacaggtccgacgggagcaacg	CRISPR spacer
gacaggtccgacgggagcagat	Protospacer
*******************.

16. spacer 1.26|817630|22|NC_006270|CRT matches to NC_023607 (Mycobacterium phage 40AC, complete genome) position: , mismatch: 3, identity: 0.864

aacaggagccaccggcccgacc	CRISPR spacer
tacaggagccaccggcccgaaa	Protospacer
 *******************

17. spacer 1.16|817126|40|NC_006270|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 5, identity: 0.875

aacaggagcgacaggagcaacgggagcaacgggagcgaca	CRISPR spacer
aacaggagcaacaggagcaacgggagcaacaggagtaacg	Protospacer
*********.********************.****..**.

18. spacer 1.16|817126|40|NC_006270|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 5, identity: 0.875

aacaggagcgacaggagcaacgggagcaacgggagcgaca	CRISPR spacer
aacaggagcaacaggagcaacgggagcaacaggagtaacg	Protospacer
*********.********************.****..**.

19. spacer 1.16|817126|40|NC_006270|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 5, identity: 0.875

aacaggagcgacaggagcaacgggagcaacgggagcgaca	CRISPR spacer
aacaggagcaacaggagcaacgggagcaacaggagtaacg	Protospacer
*********.********************.****..**.

20. spacer 1.10|816685|31|NC_006270|CRT matches to NZ_CP009638 (Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence) position: , mismatch: 6, identity: 0.806

gacaggtccgaccggagcaacgggagcgaca	CRISPR spacer
gacaggtcctaccggagcaacaggccctact	Protospacer
********* ***********.**  * **

21. spacer 1.10|816685|31|NC_006270|CRT matches to NZ_CP009639 (Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence) position: , mismatch: 6, identity: 0.806

gacaggtccgaccggagcaacgggagcgaca	CRISPR spacer
gacaggtcctaccggagcaacaggccctact	Protospacer
********* ***********.**  * **

22. spacer 1.10|816685|31|NC_006270|CRT matches to NZ_CP053963 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence) position: , mismatch: 6, identity: 0.806

gacaggtccgaccggagcaacgggagcgaca	CRISPR spacer
gacaggtcctaccggagcaacaggccctact	Protospacer
********* ***********.**  * **

23. spacer 1.10|816685|31|NC_006270|CRT matches to NZ_CP053966 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence) position: , mismatch: 6, identity: 0.806

gacaggtccgaccggagcaacgggagcgaca	CRISPR spacer
gacaggtcctaccggagcaacaggccctact	Protospacer
********* ***********.**  * **

24. spacer 1.16|817126|40|NC_006270|CRT matches to MG209611 (Aphanizomenon phage vB_AphaS-CL131, complete genome) position: , mismatch: 6, identity: 0.85

aacaggagcgacaggagcaacgggagcaacgggagcgaca	CRISPR spacer
tataggagcaacgggagcaacgggagcaacgggagcgatc	Protospacer
 *.******.**.*************************.

25. spacer 1.28|817720|31|NC_006270|CRT matches to NC_010180 (Bacillus mycoides KBAB4 plasmid pBWB401, complete sequence) position: , mismatch: 6, identity: 0.806

caccggtccgaccggtccaacaggagcgaca	CRISPR spacer
aaccggtccaaccggtccaacgggagtaacg	Protospacer
 ********.***********.****..**.

26. spacer 1.30|817819|31|NC_006270|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.806

gaccggcccgacaggagcaacaggagcgacc	CRISPR spacer
aacggggccgacaggagcaacaggagcatca	Protospacer
.** ** ********************. *

27. spacer 1.30|817819|31|NC_006270|CRT matches to NZ_CP015063 (Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence) position: , mismatch: 6, identity: 0.806

gaccggcccgacaggagcaacaggagcgacc	CRISPR spacer
gaccggctcgactggagcaacaggctctact	Protospacer
*******.**** ***********  * **.

28. spacer 1.30|817819|31|NC_006270|CRT matches to NC_008464 (Stx2-converting phage 86, complete genome) position: , mismatch: 6, identity: 0.806

gaccggcccgacaggagcaacaggagcgacc	CRISPR spacer
ggcaggcccgacaggagcaaccggaccggcg	Protospacer
*.* ***************** *** **.*

29. spacer 1.30|817819|31|NC_006270|CRT matches to KJ603229 (Shigella phage POCJ13, complete genome) position: , mismatch: 6, identity: 0.806

gaccggcccgacaggagcaacaggagcgacc	CRISPR spacer
ggcaggcccgacaggagcaaccggaccggcg	Protospacer
*.* ***************** *** **.*

30. spacer 1.30|817819|31|NC_006270|CRT matches to AB255436 (Stx2-converting phage 86 DNA, complete genome) position: , mismatch: 6, identity: 0.806

gaccggcccgacaggagcaacaggagcgacc	CRISPR spacer
ggcaggcccgacaggagcaaccggaccggcg	Protospacer
*.* ***************** *** **.*

31. spacer 1.10|816685|31|NC_006270|CRT matches to NZ_CP009638 (Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence) position: , mismatch: 7, identity: 0.774

gacaggtccgaccggagcaacgggagcgaca	CRISPR spacer
aacaggtcctaccggagcaacaggtcctact	Protospacer
.******** ***********.**  * **

32. spacer 1.10|816685|31|NC_006270|CRT matches to NZ_CP009638 (Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence) position: , mismatch: 7, identity: 0.774

gacaggtccgaccggagcaacgggagcgaca	CRISPR spacer
aacaggtcctaccggagcaacaggtcctacc	Protospacer
.******** ***********.**  * **

33. spacer 1.10|816685|31|NC_006270|CRT matches to NZ_CP009638 (Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence) position: , mismatch: 7, identity: 0.774

gacaggtccgaccggagcaacgggagcgaca	CRISPR spacer
aacaggtcctaccggagcaacaggccctact	Protospacer
.******** ***********.**  * **

34. spacer 1.10|816685|31|NC_006270|CRT matches to NZ_CP009638 (Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence) position: , mismatch: 7, identity: 0.774

gacaggtccgaccggagcaacgggagcgaca	CRISPR spacer
aacaggtcctaccggagcaacaggccctact	Protospacer
.******** ***********.**  * **

35. spacer 1.10|816685|31|NC_006270|CRT matches to NZ_CP009638 (Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence) position: , mismatch: 7, identity: 0.774

gacaggtccgaccggagcaacgggagcgaca	CRISPR spacer
aacaggtcctaccggagcaacaggtcctact	Protospacer
.******** ***********.**  * **

36. spacer 1.10|816685|31|NC_006270|CRT matches to NZ_CP009639 (Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence) position: , mismatch: 7, identity: 0.774

gacaggtccgaccggagcaacgggagcgaca	CRISPR spacer
aacaggtcctaccggagcaacaggtcctact	Protospacer
.******** ***********.**  * **

37. spacer 1.10|816685|31|NC_006270|CRT matches to NZ_CP009639 (Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence) position: , mismatch: 7, identity: 0.774

gacaggtccgaccggagcaacgggagcgaca	CRISPR spacer
aacaggtcctaccggagcaacaggtcctacc	Protospacer
.******** ***********.**  * **

38. spacer 1.10|816685|31|NC_006270|CRT matches to NZ_CP009639 (Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence) position: , mismatch: 7, identity: 0.774

gacaggtccgaccggagcaacgggagcgaca	CRISPR spacer
aacaggtcctaccggagcaacaggccctact	Protospacer
.******** ***********.**  * **

39. spacer 1.10|816685|31|NC_006270|CRT matches to NZ_CP009639 (Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence) position: , mismatch: 7, identity: 0.774

gacaggtccgaccggagcaacgggagcgaca	CRISPR spacer
aacaggtcctaccggagcaacaggccctact	Protospacer
.******** ***********.**  * **

40. spacer 1.10|816685|31|NC_006270|CRT matches to NZ_CP009639 (Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence) position: , mismatch: 7, identity: 0.774

gacaggtccgaccggagcaacgggagcgaca	CRISPR spacer
aacaggtcctaccggagcaacaggtcctact	Protospacer
.******** ***********.**  * **

41. spacer 1.10|816685|31|NC_006270|CRT matches to NZ_CP053963 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.774

gacaggtccgaccggagcaacgggagcgaca	CRISPR spacer
aacaggtcctaccggagcaacaggtcctact	Protospacer
.******** ***********.**  * **

42. spacer 1.10|816685|31|NC_006270|CRT matches to NZ_CP053963 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.774

gacaggtccgaccggagcaacgggagcgaca	CRISPR spacer
aacaggtcctaccggagcaacaggtcctacc	Protospacer
.******** ***********.**  * **

43. spacer 1.10|816685|31|NC_006270|CRT matches to NZ_CP053963 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.774

gacaggtccgaccggagcaacgggagcgaca	CRISPR spacer
aacaggtcctaccggagcaacaggccctact	Protospacer
.******** ***********.**  * **

44. spacer 1.10|816685|31|NC_006270|CRT matches to NZ_CP053963 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.774

gacaggtccgaccggagcaacgggagcgaca	CRISPR spacer
aacaggtcctaccggagcaacaggccctact	Protospacer
.******** ***********.**  * **

45. spacer 1.10|816685|31|NC_006270|CRT matches to NZ_CP053963 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.774

gacaggtccgaccggagcaacgggagcgaca	CRISPR spacer
aacaggtcctaccggagcaacaggtcctact	Protospacer
.******** ***********.**  * **

46. spacer 1.10|816685|31|NC_006270|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.774

gacaggtccgaccggagcaacgggagcgaca	CRISPR spacer
gacaggtcctaccggagcaacaggtttcact	Protospacer
********* ***********.**  . **

47. spacer 1.10|816685|31|NC_006270|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.774

gacaggtccgaccggagcaacgggagcgaca	CRISPR spacer
aacaggtcctaccggagcaacaggccctact	Protospacer
.******** ***********.**  * **

48. spacer 1.10|816685|31|NC_006270|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.774

gacaggtccgaccggagcaacgggagcgaca	CRISPR spacer
aacaggtcctaccggagcaacaggccctact	Protospacer
.******** ***********.**  * **

49. spacer 1.10|816685|31|NC_006270|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.774

gacaggtccgaccggagcaacgggagcgaca	CRISPR spacer
aacaggtcctaccggagcaacaggccctact	Protospacer
.******** ***********.**  * **

50. spacer 1.10|816685|31|NC_006270|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.774

gacaggtccgaccggagcaacgggagcgaca	CRISPR spacer
aacaggtcctaccggagcaacaggccctact	Protospacer
.******** ***********.**  * **

51. spacer 1.10|816685|31|NC_006270|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.774

gacaggtccgaccggagcaacgggagcgaca	CRISPR spacer
aacaggtcctaccggagcaacaggtcctacc	Protospacer
.******** ***********.**  * **

52. spacer 1.10|816685|31|NC_006270|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.774

gacaggtccgaccggagcaacgggagcgaca	CRISPR spacer
aacaggtcctaccggagcaacaggtcctacc	Protospacer
.******** ***********.**  * **

53. spacer 1.10|816685|31|NC_006270|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.774

gacaggtccgaccggagcaacgggagcgaca	CRISPR spacer
aacaggtcctaccggagcaacaggtcctact	Protospacer
.******** ***********.**  * **

54. spacer 1.10|816685|31|NC_006270|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.774

gacaggtccgaccggagcaacgggagcgaca	CRISPR spacer
aacaggtcctaccggagcaacaggccctact	Protospacer
.******** ***********.**  * **

55. spacer 1.10|816685|31|NC_006270|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.774

gacaggtccgaccggagcaacgggagcgaca	CRISPR spacer
aacaggtcctaccggagcaacaggttccact	Protospacer
.******** ***********.**  * **

56. spacer 1.10|816685|31|NC_006270|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 7, identity: 0.774

gacaggtccgaccggagcaacgggagcgaca	CRISPR spacer
gacaggtcctaccggagcaacaggtttcact	Protospacer
********* ***********.**  . **

57. spacer 1.10|816685|31|NC_006270|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 7, identity: 0.774

gacaggtccgaccggagcaacgggagcgaca	CRISPR spacer
aacaggtcctaccggagcaacaggccctact	Protospacer
.******** ***********.**  * **

58. spacer 1.10|816685|31|NC_006270|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 7, identity: 0.774

gacaggtccgaccggagcaacgggagcgaca	CRISPR spacer
aacaggtcctaccggagcaacaggccctact	Protospacer
.******** ***********.**  * **

59. spacer 1.10|816685|31|NC_006270|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 7, identity: 0.774

gacaggtccgaccggagcaacgggagcgaca	CRISPR spacer
aacaggtcctaccggagcaacaggccctact	Protospacer
.******** ***********.**  * **

60. spacer 1.10|816685|31|NC_006270|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 7, identity: 0.774

gacaggtccgaccggagcaacgggagcgaca	CRISPR spacer
aacaggtcctaccggagcaacaggccctact	Protospacer
.******** ***********.**  * **

61. spacer 1.10|816685|31|NC_006270|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 7, identity: 0.774

gacaggtccgaccggagcaacgggagcgaca	CRISPR spacer
aacaggtcctaccggagcaacaggtcctacc	Protospacer
.******** ***********.**  * **

62. spacer 1.10|816685|31|NC_006270|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 7, identity: 0.774

gacaggtccgaccggagcaacgggagcgaca	CRISPR spacer
aacaggtcctaccggagcaacaggtcctacc	Protospacer
.******** ***********.**  * **

63. spacer 1.10|816685|31|NC_006270|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 7, identity: 0.774

gacaggtccgaccggagcaacgggagcgaca	CRISPR spacer
aacaggtcctaccggagcaacaggtcctact	Protospacer
.******** ***********.**  * **

64. spacer 1.10|816685|31|NC_006270|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 7, identity: 0.774

gacaggtccgaccggagcaacgggagcgaca	CRISPR spacer
aacaggtcctaccggagcaacaggccctact	Protospacer
.******** ***********.**  * **

65. spacer 1.10|816685|31|NC_006270|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 7, identity: 0.774

gacaggtccgaccggagcaacgggagcgaca	CRISPR spacer
aacaggtcctaccggagcaacaggttccact	Protospacer
.******** ***********.**  * **

66. spacer 1.10|816685|31|NC_006270|CRT matches to NZ_CP053966 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence) position: , mismatch: 7, identity: 0.774

gacaggtccgaccggagcaacgggagcgaca	CRISPR spacer
aacaggtcctaccggagcaacaggtcctact	Protospacer
.******** ***********.**  * **

67. spacer 1.10|816685|31|NC_006270|CRT matches to NZ_CP053966 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence) position: , mismatch: 7, identity: 0.774

gacaggtccgaccggagcaacgggagcgaca	CRISPR spacer
aacaggtcctaccggagcaacaggccctact	Protospacer
.******** ***********.**  * **

68. spacer 1.10|816685|31|NC_006270|CRT matches to NZ_CP053966 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence) position: , mismatch: 7, identity: 0.774

gacaggtccgaccggagcaacgggagcgaca	CRISPR spacer
aacaggtcctaccggagcaacaggccctact	Protospacer
.******** ***********.**  * **

69. spacer 1.10|816685|31|NC_006270|CRT matches to NZ_CP053966 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence) position: , mismatch: 7, identity: 0.774

gacaggtccgaccggagcaacgggagcgaca	CRISPR spacer
aacaggtcctaccggagcaacaggtcctacc	Protospacer
.******** ***********.**  * **

70. spacer 1.10|816685|31|NC_006270|CRT matches to NZ_CP053966 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence) position: , mismatch: 7, identity: 0.774

gacaggtccgaccggagcaacgggagcgaca	CRISPR spacer
aacaggtcctaccggagcaacaggtcctact	Protospacer
.******** ***********.**  * **

71. spacer 1.17|817189|31|NC_006270|CRT matches to KJ019142 (Synechococcus phage ACG-2014f isolate Syn7803C11, complete genome) position: , mismatch: 7, identity: 0.774

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
gagccaccccaccggagccaccggagccacc	Protospacer
 * * .*** ***************** **

72. spacer 1.17|817189|31|NC_006270|CRT matches to NC_022043 (Paracoccus aminophilus JCM 7686 plasmid pAMI5, complete sequence) position: , mismatch: 7, identity: 0.774

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
aaccggcccgaccggacccacgggtccgacc	Protospacer
 *************** **** **  *.**

73. spacer 1.19|817288|31|NC_006270|CRT matches to KJ019142 (Synechococcus phage ACG-2014f isolate Syn7803C11, complete genome) position: , mismatch: 7, identity: 0.774

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
gagccaccccaccggagccaccggagccacc	Protospacer
 * * .*** ***************** **

74. spacer 1.19|817288|31|NC_006270|CRT matches to NC_022043 (Paracoccus aminophilus JCM 7686 plasmid pAMI5, complete sequence) position: , mismatch: 7, identity: 0.774

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
aaccggcccgaccggacccacgggtccgacc	Protospacer
 *************** **** **  *.**

75. spacer 1.28|817720|31|NC_006270|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 7, identity: 0.774

caccggtccgaccggtccaacaggagcgaca	CRISPR spacer
aaccggtccaaccgggccaacaggactaact	Protospacer
 ********.***** ********* ..**

76. spacer 1.30|817819|31|NC_006270|CRT matches to NZ_CP021213 (Sinorhizobium meliloti RU11/001 plasmid pSmeRU11a, complete sequence) position: , mismatch: 7, identity: 0.774

gaccggcccgacaggagcaacaggagcgacc	CRISPR spacer
ccctaccccgacaggagcaacaggaccggcc	Protospacer
  *.. ******************* **.**

77. spacer 1.30|817819|31|NC_006270|CRT matches to NZ_CP053933 (Bacillus thuringiensis strain FDAARGOS_794 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.774

gaccggcccgacaggagcaacaggagcgacc	CRISPR spacer
aaccggaccgacgggagcaacaggaataaca	Protospacer
.***** *****.************...**

78. spacer 1.30|817819|31|NC_006270|CRT matches to NZ_CP053936 (Bacillus thuringiensis strain FDAARGOS_794 plasmid unnamed4, complete sequence) position: , mismatch: 7, identity: 0.774

gaccggcccgacaggagcaacaggagcgacc	CRISPR spacer
aaccggaccgacgggagcaacaggaataaca	Protospacer
.***** *****.************...**

79. spacer 1.30|817819|31|NC_006270|CRT matches to NZ_CP009718 (Bacillus thuringiensis strain HD682 plasmid pBGN_2, complete sequence) position: , mismatch: 7, identity: 0.774

gaccggcccgacaggagcaacaggagcgacc	CRISPR spacer
aaccggaccgacgggagcaacaggaataaca	Protospacer
.***** *****.************...**

80. spacer 1.30|817819|31|NC_006270|CRT matches to NZ_CP013524 (Rhizobium phaseoli strain R744 plasmid pRphaR744b, complete sequence) position: , mismatch: 7, identity: 0.774

gaccggcccgacaggagcaacaggagcgacc	CRISPR spacer
gtccggcccgacagaaggaacaggatccgca	Protospacer
* ************.** ******* * .*

81. spacer 1.30|817819|31|NC_006270|CRT matches to NZ_CP013553 (Rhizobium phaseoli strain N931 plasmid pRphaN931a, complete sequence) position: , mismatch: 7, identity: 0.774

gaccggcccgacaggagcaacaggagcgacc	CRISPR spacer
gtccggcccgacagaaggaacaggatccgca	Protospacer
* ************.** ******* * .*

82. spacer 1.30|817819|31|NC_006270|CRT matches to NZ_CP013586 (Rhizobium phaseoli strain N161 plasmid pRphaN161a, complete sequence) position: , mismatch: 7, identity: 0.774

gaccggcccgacaggagcaacaggagcgacc	CRISPR spacer
gtccggcccgacagaaggaacaggatccgca	Protospacer
* ************.** ******* * .*

83. spacer 1.30|817819|31|NC_006270|CRT matches to NZ_CP013559 (Rhizobium phaseoli strain N841 plasmid pRphaN841b, complete sequence) position: , mismatch: 7, identity: 0.774

gaccggcccgacaggagcaacaggagcgacc	CRISPR spacer
gtccggcccgacagaaggaacaggatccgca	Protospacer
* ************.** ******* * .*

84. spacer 1.30|817819|31|NC_006270|CRT matches to NZ_CP013576 (Rhizobium phaseoli strain N671 plasmid pRphaN671b, complete sequence) position: , mismatch: 7, identity: 0.774

gaccggcccgacaggagcaacaggagcgacc	CRISPR spacer
gtccggcccgacagaaggaacaggatccgca	Protospacer
* ************.** ******* * .*

85. spacer 1.30|817819|31|NC_006270|CRT matches to NZ_CP013548 (Rhizobium phaseoli strain R611 plasmid pRetR611a, complete sequence) position: , mismatch: 7, identity: 0.774

gaccggcccgacaggagcaacaggagcgacc	CRISPR spacer
gtccggcccgacagaaggaacaggatccgca	Protospacer
* ************.** ******* * .*

86. spacer 1.30|817819|31|NC_006270|CRT matches to NZ_CP013528 (Rhizobium phaseoli strain R723 plasmid pRphaR723a, complete sequence) position: , mismatch: 7, identity: 0.774

gaccggcccgacaggagcaacaggagcgacc	CRISPR spacer
gtccggcccgacagaaggaacaggatccgca	Protospacer
* ************.** ******* * .*

87. spacer 1.30|817819|31|NC_006270|CRT matches to NZ_CP013533 (Rhizobium phaseoli strain R650 plasmid pRphaR650a, complete sequence) position: , mismatch: 7, identity: 0.774

gaccggcccgacaggagcaacaggagcgacc	CRISPR spacer
gtccggcccgacagaaggaacaggatccgca	Protospacer
* ************.** ******* * .*

88. spacer 1.30|817819|31|NC_006270|CRT matches to NZ_CP013543 (Rhizobium phaseoli strain R620 plasmid pRphaR620a, complete sequence) position: , mismatch: 7, identity: 0.774

gaccggcccgacaggagcaacaggagcgacc	CRISPR spacer
gtccggcccgacagaaggaacaggatccgca	Protospacer
* ************.** ******* * .*

89. spacer 1.30|817819|31|NC_006270|CRT matches to NZ_CP013564 (Rhizobium phaseoli strain N831 plasmid pRphaN831a, complete sequence) position: , mismatch: 7, identity: 0.774

gaccggcccgacaggagcaacaggagcgacc	CRISPR spacer
gtccggcccgacagaaggaacaggatccgca	Protospacer
* ************.** ******* * .*

90. spacer 1.30|817819|31|NC_006270|CRT matches to NZ_CP013581 (Rhizobium phaseoli strain N261 plasmid pRphaN261a, complete sequence) position: , mismatch: 7, identity: 0.774

gaccggcccgacaggagcaacaggagcgacc	CRISPR spacer
gtccggcccgacagaaggaacaggatccgca	Protospacer
* ************.** ******* * .*

91. spacer 1.30|817819|31|NC_006270|CRT matches to NZ_CP013570 (Rhizobium phaseoli strain N771 plasmid pRphaN771b, complete sequence) position: , mismatch: 7, identity: 0.774

gaccggcccgacaggagcaacaggagcgacc	CRISPR spacer
gtccggcccgacagaaggaacaggatccgca	Protospacer
* ************.** ******* * .*

92. spacer 1.9|816631|31|NC_006270|CRT matches to NZ_CP013267 (Sphingobium baderi strain DE-13 plasmid pDE3, complete sequence) position: , mismatch: 8, identity: 0.742

gacaggtccgacgggagcgaccggcccgaca	CRISPR spacer
aacaggtccggcgggaccgaccggccgagac	Protospacer
.*********.***** ********* ..

93. spacer 1.9|816631|31|NC_006270|CRT matches to NC_014007 (Sphingobium japonicum UT26S plasmid pCHQ1, complete sequence) position: , mismatch: 8, identity: 0.742

gacaggtccgacgggagcgaccggcccgaca	CRISPR spacer
aacaggtccggcgggaccgaccggccgagac	Protospacer
.*********.***** ********* ..

94. spacer 1.10|816685|31|NC_006270|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gacaggtccgaccggagcaacgggagcgaca	CRISPR spacer
taatgtaccaaccggagcaacgggagcaacc	Protospacer
 *  *  **.*****************.**

95. spacer 1.17|817189|31|NC_006270|CRT matches to NZ_CP054617 (Azospirillum oryzae strain KACC 14407 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.742

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
tgctggcccggccggagccgccggagcacat	Protospacer
..*.******.********.********

96. spacer 1.17|817189|31|NC_006270|CRT matches to NZ_AP022319 (Burkholderia sp. THE68 plasmid BTHE68_p1, complete sequence) position: , mismatch: 8, identity: 0.742

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
gaccggcccgaccgcagccaccgccgcgcac	Protospacer
 ************* ********  **.

97. spacer 1.17|817189|31|NC_006270|CRT matches to NC_016585 (Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence) position: , mismatch: 8, identity: 0.742

caccggcccgaccggagccaccg-----gagcaaca	CRISPR spacer
caccggcccggccggagccgccgcccgcaag-----	Protospacer
**********.********.***     .**

98. spacer 1.17|817189|31|NC_006270|CRT matches to NZ_CP054616 (Azospirillum oryzae strain KACC 14407 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
gcccggcccgaccggccccaccggaacgtcg	Protospacer
  *************  ********.*. *.

99. spacer 1.19|817288|31|NC_006270|CRT matches to NZ_CP054617 (Azospirillum oryzae strain KACC 14407 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.742

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
tgctggcccggccggagccgccggagcacat	Protospacer
..*.******.********.********

100. spacer 1.19|817288|31|NC_006270|CRT matches to NZ_AP022319 (Burkholderia sp. THE68 plasmid BTHE68_p1, complete sequence) position: , mismatch: 8, identity: 0.742

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
gaccggcccgaccgcagccaccgccgcgcac	Protospacer
 ************* ********  **.

101. spacer 1.19|817288|31|NC_006270|CRT matches to NC_016585 (Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence) position: , mismatch: 8, identity: 0.742

caccggcccgaccggagccaccg-----gagcaaca	CRISPR spacer
caccggcccggccggagccgccgcccgcaag-----	Protospacer
**********.********.***     .**

102. spacer 1.19|817288|31|NC_006270|CRT matches to NZ_CP054616 (Azospirillum oryzae strain KACC 14407 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
gcccggcccgaccggccccaccggaacgtcg	Protospacer
  *************  ********.*. *.

103. spacer 1.28|817720|31|NC_006270|CRT matches to NC_018512 (Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence) position: , mismatch: 8, identity: 0.742

caccggtccgaccggtccaacaggagcgaca	CRISPR spacer
aaccggtccgactggtccaactggacctggt	Protospacer
 ***********.******** *** * .

104. spacer 1.28|817720|31|NC_006270|CRT matches to NC_004334 (Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence) position: , mismatch: 8, identity: 0.742

caccggtccgaccggtccaacaggagcgaca	CRISPR spacer
aaccggtccgactggtccaactggacctggt	Protospacer
 ***********.******** *** * .

105. spacer 1.30|817819|31|NC_006270|CRT matches to NZ_CP032322 (Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.742

gaccggcccgacaggagcaacaggagcgacc	CRISPR spacer
ccgccgaccgacagcagcaccaggagcgacg	Protospacer
   * * ******* **** **********

106. spacer 1.30|817819|31|NC_006270|CRT matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 8, identity: 0.742

gaccggcccgacaggagcaacaggagcgacc	CRISPR spacer
ccgccgaccgacagcagcaccaggagcgacg	Protospacer
   * * ******* **** **********

107. spacer 1.30|817819|31|NC_006270|CRT matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 8, identity: 0.742

gaccggcccgacaggagcaacaggagcgacc	CRISPR spacer
ccgccgaccgacagcagcaccaggagcgacg	Protospacer
   * * ******* **** **********

108. spacer 1.30|817819|31|NC_006270|CRT matches to NZ_CP032340 (Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.742

gaccggcccgacaggagcaacaggagcgacc	CRISPR spacer
ccgccgaccgacagcagcaccaggagcgacg	Protospacer
   * * ******* **** **********

109. spacer 1.30|817819|31|NC_006270|CRT matches to NZ_CP032346 (Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.742

gaccggcccgacaggagcaacaggagcgacc	CRISPR spacer
ccgccgaccgacagcagcaccaggagcgacg	Protospacer
   * * ******* **** **********

110. spacer 1.30|817819|31|NC_006270|CRT matches to NZ_CP012915 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence) position: , mismatch: 8, identity: 0.742

gaccggcccgacaggagcaacaggagcgacc	CRISPR spacer
ccgccgaccgacagcagcaccaggagcgacg	Protospacer
   * * ******* **** **********

111. spacer 1.9|816631|31|NC_006270|CRT matches to NC_022235 (Sphingomonas sp. ERG5 plasmid pCADAB1, complete sequence) position: , mismatch: 9, identity: 0.71

gacaggtccgacgggagcgaccggcccgaca	CRISPR spacer
agcaggtccggcgggatcgaccggcctagac	Protospacer
..********.***** *********...

112. spacer 1.9|816631|31|NC_006270|CRT matches to NZ_CP017078 (Novosphingobium resinovorum strain SA1 plasmid pSA3, complete sequence) position: , mismatch: 9, identity: 0.71

gacaggtccgacgggagcgaccggcccgaca	CRISPR spacer
agcaggtccggcgggatcgaccggcctagac	Protospacer
..********.***** *********...

113. spacer 1.9|816631|31|NC_006270|CRT matches to KX641263 (Mycobacterium phage Kalpine, complete genome) position: , mismatch: 9, identity: 0.71

gacaggtccgacgggagcgaccggcccgaca	CRISPR spacer
gcagggtccgaccggagctaccggcccacgc	Protospacer
*  .******** ***** ********.

114. spacer 1.9|816631|31|NC_006270|CRT matches to MK937594 (Gordonia phage Galadriel, complete genome) position: , mismatch: 9, identity: 0.71

gacaggtccgacgggagcgaccggcccgaca	CRISPR spacer
tgccccgccgacgggtgcggccggcccgacg	Protospacer
 .*    ******** ***.**********.

115. spacer 1.9|816631|31|NC_006270|CRT matches to NC_013190 (Candidatus Accumulibacter phosphatis clade IIA str. UW-1 plasmid pAph02, complete sequence) position: , mismatch: 9, identity: 0.71

gacaggtccgacgggagcgaccggcccgaca	CRISPR spacer
tccgccaccgacgggaccgaccgccccgact	Protospacer
  *.   ********* ****** ******

116. spacer 1.10|816685|31|NC_006270|CRT matches to NZ_CP033971 (Cupriavidus pauculus strain FDAARGOS_614 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.71

gacaggtccgaccggagcaacgggagcgaca	CRISPR spacer
gcagggtccgaccggcgcaacgggggctcag	Protospacer
*  .*********** ********.**   .

117. spacer 1.17|817189|31|NC_006270|CRT matches to NZ_CP016613 (Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

118. spacer 1.17|817189|31|NC_006270|CRT matches to NZ_CP021449 (Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

119. spacer 1.17|817189|31|NC_006270|CRT matches to NZ_CP049794 (Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

120. spacer 1.17|817189|31|NC_006270|CRT matches to NZ_CP049788 (Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

121. spacer 1.17|817189|31|NC_006270|CRT matches to NZ_CP049792 (Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

122. spacer 1.17|817189|31|NC_006270|CRT matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

123. spacer 1.17|817189|31|NC_006270|CRT matches to NZ_CP015851 (Ralstonia solanacearum strain YC40-M plasmid, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

124. spacer 1.17|817189|31|NC_006270|CRT matches to NZ_CP022781 (Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

125. spacer 1.17|817189|31|NC_006270|CRT matches to NZ_CP052111 (Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

126. spacer 1.17|817189|31|NC_006270|CRT matches to NZ_CP052113 (Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

127. spacer 1.17|817189|31|NC_006270|CRT matches to CP023013 (Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

128. spacer 1.17|817189|31|NC_006270|CRT matches to NZ_CP049790 (Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

129. spacer 1.17|817189|31|NC_006270|CRT matches to NZ_CP022766 (Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

130. spacer 1.17|817189|31|NC_006270|CRT matches to NZ_CP021763 (Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

131. spacer 1.17|817189|31|NC_006270|CRT matches to NZ_CP015116 (Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

132. spacer 1.17|817189|31|NC_006270|CRT matches to NZ_CP016555 (Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

133. spacer 1.17|817189|31|NC_006270|CRT matches to NZ_CP052069 (Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

134. spacer 1.17|817189|31|NC_006270|CRT matches to NZ_CP016915 (Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

135. spacer 1.17|817189|31|NC_006270|CRT matches to NZ_CP016905 (Ralstonia solanacearum strain KACC 10709 plasmid unnamed1) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

136. spacer 1.17|817189|31|NC_006270|CRT matches to NZ_CP022769 (Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

137. spacer 1.17|817189|31|NC_006270|CRT matches to NZ_CP022773 (Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

138. spacer 1.17|817189|31|NC_006270|CRT matches to NZ_CP022783 (Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

139. spacer 1.17|817189|31|NC_006270|CRT matches to NZ_CP022791 (Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

140. spacer 1.17|817189|31|NC_006270|CRT matches to NZ_CP022795 (Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

141. spacer 1.17|817189|31|NC_006270|CRT matches to NZ_CP052071 (Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

142. spacer 1.17|817189|31|NC_006270|CRT matches to NZ_CP009763 (Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

143. spacer 1.17|817189|31|NC_006270|CRT matches to CP023015 (Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

144. spacer 1.17|817189|31|NC_006270|CRT matches to NZ_CP022779 (Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

145. spacer 1.17|817189|31|NC_006270|CRT matches to NZ_CP052075 (Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

146. spacer 1.17|817189|31|NC_006270|CRT matches to NZ_CP052085 (Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

147. spacer 1.17|817189|31|NC_006270|CRT matches to NZ_CP052095 (Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

148. spacer 1.17|817189|31|NC_006270|CRT matches to NZ_CP052105 (Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

149. spacer 1.17|817189|31|NC_006270|CRT matches to NZ_CP021765 (Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

150. spacer 1.17|817189|31|NC_006270|CRT matches to NZ_CP052077 (Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

151. spacer 1.17|817189|31|NC_006270|CRT matches to NZ_CP052087 (Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

152. spacer 1.17|817189|31|NC_006270|CRT matches to NZ_CP052097 (Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

153. spacer 1.17|817189|31|NC_006270|CRT matches to NZ_CP052115 (Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

154. spacer 1.17|817189|31|NC_006270|CRT matches to NZ_CP052127 (Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

155. spacer 1.17|817189|31|NC_006270|CRT matches to NZ_CP052079 (Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

156. spacer 1.17|817189|31|NC_006270|CRT matches to NZ_CP052089 (Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

157. spacer 1.17|817189|31|NC_006270|CRT matches to NZ_CP052093 (Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

158. spacer 1.17|817189|31|NC_006270|CRT matches to NZ_CP052101 (Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

159. spacer 1.17|817189|31|NC_006270|CRT matches to NZ_CP052099 (Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

160. spacer 1.17|817189|31|NC_006270|CRT matches to NZ_CP052107 (Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

161. spacer 1.17|817189|31|NC_006270|CRT matches to NZ_CP052117 (Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

162. spacer 1.17|817189|31|NC_006270|CRT matches to NZ_CP052125 (Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

163. spacer 1.17|817189|31|NC_006270|CRT matches to NZ_CP022793 (Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

164. spacer 1.17|817189|31|NC_006270|CRT matches to NZ_CP022785 (Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

165. spacer 1.17|817189|31|NC_006270|CRT matches to NZ_CP022787 (Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

166. spacer 1.17|817189|31|NC_006270|CRT matches to NZ_CP022756 (Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

167. spacer 1.17|817189|31|NC_006270|CRT matches to NZ_CP052129 (Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

168. spacer 1.17|817189|31|NC_006270|CRT matches to NZ_CP052121 (Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

169. spacer 1.17|817189|31|NC_006270|CRT matches to NZ_CP052123 (Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

170. spacer 1.17|817189|31|NC_006270|CRT matches to NZ_CP052131 (Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

171. spacer 1.17|817189|31|NC_006270|CRT matches to NZ_CP052073 (Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

172. spacer 1.17|817189|31|NC_006270|CRT matches to NZ_CP052081 (Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

173. spacer 1.17|817189|31|NC_006270|CRT matches to NZ_CP052083 (Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

174. spacer 1.17|817189|31|NC_006270|CRT matches to NZ_CP052109 (Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

175. spacer 1.17|817189|31|NC_006270|CRT matches to NZ_CP052091 (Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

176. spacer 1.17|817189|31|NC_006270|CRT matches to NZ_CP052103 (Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

177. spacer 1.17|817189|31|NC_006270|CRT matches to NZ_CP052119 (Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

178. spacer 1.19|817288|31|NC_006270|CRT matches to NZ_CP016613 (Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

179. spacer 1.19|817288|31|NC_006270|CRT matches to NZ_CP021449 (Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

180. spacer 1.19|817288|31|NC_006270|CRT matches to NZ_CP049794 (Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

181. spacer 1.19|817288|31|NC_006270|CRT matches to NZ_CP049788 (Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

182. spacer 1.19|817288|31|NC_006270|CRT matches to NZ_CP049792 (Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

183. spacer 1.19|817288|31|NC_006270|CRT matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

184. spacer 1.19|817288|31|NC_006270|CRT matches to NZ_CP015851 (Ralstonia solanacearum strain YC40-M plasmid, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

185. spacer 1.19|817288|31|NC_006270|CRT matches to NZ_CP022781 (Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

186. spacer 1.19|817288|31|NC_006270|CRT matches to NZ_CP052111 (Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

187. spacer 1.19|817288|31|NC_006270|CRT matches to NZ_CP052113 (Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

188. spacer 1.19|817288|31|NC_006270|CRT matches to CP023013 (Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

189. spacer 1.19|817288|31|NC_006270|CRT matches to NZ_CP049790 (Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

190. spacer 1.19|817288|31|NC_006270|CRT matches to NZ_CP022766 (Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

191. spacer 1.19|817288|31|NC_006270|CRT matches to NZ_CP021763 (Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

192. spacer 1.19|817288|31|NC_006270|CRT matches to NZ_CP015116 (Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

193. spacer 1.19|817288|31|NC_006270|CRT matches to NZ_CP016555 (Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

194. spacer 1.19|817288|31|NC_006270|CRT matches to NZ_CP052069 (Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

195. spacer 1.19|817288|31|NC_006270|CRT matches to NZ_CP016915 (Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

196. spacer 1.19|817288|31|NC_006270|CRT matches to NZ_CP016905 (Ralstonia solanacearum strain KACC 10709 plasmid unnamed1) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

197. spacer 1.19|817288|31|NC_006270|CRT matches to NZ_CP022769 (Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

198. spacer 1.19|817288|31|NC_006270|CRT matches to NZ_CP022773 (Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

199. spacer 1.19|817288|31|NC_006270|CRT matches to NZ_CP022783 (Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

200. spacer 1.19|817288|31|NC_006270|CRT matches to NZ_CP022791 (Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

201. spacer 1.19|817288|31|NC_006270|CRT matches to NZ_CP022795 (Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

202. spacer 1.19|817288|31|NC_006270|CRT matches to NZ_CP052071 (Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

203. spacer 1.19|817288|31|NC_006270|CRT matches to NZ_CP009763 (Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

204. spacer 1.19|817288|31|NC_006270|CRT matches to CP023015 (Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

205. spacer 1.19|817288|31|NC_006270|CRT matches to NZ_CP022779 (Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

206. spacer 1.19|817288|31|NC_006270|CRT matches to NZ_CP052075 (Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

207. spacer 1.19|817288|31|NC_006270|CRT matches to NZ_CP052085 (Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

208. spacer 1.19|817288|31|NC_006270|CRT matches to NZ_CP052095 (Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

209. spacer 1.19|817288|31|NC_006270|CRT matches to NZ_CP052105 (Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

210. spacer 1.19|817288|31|NC_006270|CRT matches to NZ_CP021765 (Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

211. spacer 1.19|817288|31|NC_006270|CRT matches to NZ_CP052077 (Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

212. spacer 1.19|817288|31|NC_006270|CRT matches to NZ_CP052087 (Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

213. spacer 1.19|817288|31|NC_006270|CRT matches to NZ_CP052097 (Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

214. spacer 1.19|817288|31|NC_006270|CRT matches to NZ_CP052115 (Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

215. spacer 1.19|817288|31|NC_006270|CRT matches to NZ_CP052127 (Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

216. spacer 1.19|817288|31|NC_006270|CRT matches to NZ_CP052079 (Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

217. spacer 1.19|817288|31|NC_006270|CRT matches to NZ_CP052089 (Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

218. spacer 1.19|817288|31|NC_006270|CRT matches to NZ_CP052093 (Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

219. spacer 1.19|817288|31|NC_006270|CRT matches to NZ_CP052101 (Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

220. spacer 1.19|817288|31|NC_006270|CRT matches to NZ_CP052099 (Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

221. spacer 1.19|817288|31|NC_006270|CRT matches to NZ_CP052107 (Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

222. spacer 1.19|817288|31|NC_006270|CRT matches to NZ_CP052117 (Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

223. spacer 1.19|817288|31|NC_006270|CRT matches to NZ_CP052125 (Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

224. spacer 1.19|817288|31|NC_006270|CRT matches to NZ_CP022793 (Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

225. spacer 1.19|817288|31|NC_006270|CRT matches to NZ_CP022785 (Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

226. spacer 1.19|817288|31|NC_006270|CRT matches to NZ_CP022787 (Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

227. spacer 1.19|817288|31|NC_006270|CRT matches to NZ_CP022756 (Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

228. spacer 1.19|817288|31|NC_006270|CRT matches to NZ_CP052129 (Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

229. spacer 1.19|817288|31|NC_006270|CRT matches to NZ_CP052121 (Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

230. spacer 1.19|817288|31|NC_006270|CRT matches to NZ_CP052123 (Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

231. spacer 1.19|817288|31|NC_006270|CRT matches to NZ_CP052131 (Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

232. spacer 1.19|817288|31|NC_006270|CRT matches to NZ_CP052073 (Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

233. spacer 1.19|817288|31|NC_006270|CRT matches to NZ_CP052081 (Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

234. spacer 1.19|817288|31|NC_006270|CRT matches to NZ_CP052083 (Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

235. spacer 1.19|817288|31|NC_006270|CRT matches to NZ_CP052109 (Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

236. spacer 1.19|817288|31|NC_006270|CRT matches to NZ_CP052091 (Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

237. spacer 1.19|817288|31|NC_006270|CRT matches to NZ_CP052103 (Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

238. spacer 1.19|817288|31|NC_006270|CRT matches to NZ_CP052119 (Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence) position: , mismatch: 9, identity: 0.71

caccggcccgaccggagccaccggagcaaca	CRISPR spacer
caccggcccgaccggaaccagcgtcgtcgag	Protospacer
****************.*** **  *. . .

239. spacer 1.16|817126|40|NC_006270|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 11, identity: 0.725

aacaggagcgacaggagcaacgggagcaacgggagcgaca	CRISPR spacer
ccctgaatttttaggagcaacgggagcaacaggagcaaca	Protospacer
  * *.* .  .******************.*****.***

240. spacer 1.16|817126|40|NC_006270|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 12, identity: 0.7

---------aacaggagcgacaggagcaacgggagcaacgggagcgaca	CRISPR spacer
cgttggttaaaccggagcaacgggagcaacgggagcaacg---------	Protospacer
         *** *****.**.******************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

698890 : 708814

Synechococcus_phage(50.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003179530.1\|698890_700186_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	5.9e-19	27.1
WP_003179531.1\|700260_700977_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0E3G7P8	Synechococcus_phage	2.4e-46	42.4
WP_003179532.1\|700978_701233_+	phosphoribosylformylglycinamidine synthase subunit PurS	M4QPE7	Synechococcus_phage	8.0e-05	33.3
WP_003179533.1\|701229_701913_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_003179534.1\|701896_704125_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	4.2e-158	41.5
WP_011197612.1\|704100_705531_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.5e-52	32.9
WP_011197613.1\|705654_706695_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	2.7e-62	46.3
WP_003179538.1\|706691_707279_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.4e-28	41.1
WP_003179539.1\|707275_708814_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	4.3e-77	52.0

DBSCAN-SWA_2

1278298 : 1349171

Bacillus_phage(25.64%)

holin,terminase,tail,coat,plate,capsid,portal

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009328811.1\|1278298_1278748_-\|coat	spore coat protein	NA	NA	NA	NA
WP_011197778.1\|1278898_1279387_-\|coat	spore coat protein	NA	NA	NA	NA
WP_009328809.1\|1279518_1280031_-\|coat	spore coat protein	NA	NA	NA	NA
WP_009328808.1\|1280101_1280500_-	hypothetical protein	NA	NA	NA	NA
WP_009328807.1\|1280548_1280935_-\|coat	spore coat protein	NA	NA	NA	NA
WP_011197779.1\|1281081_1281438_+	DUF1360 domain-containing protein	NA	NA	NA	NA
WP_009328806.1\|1281724_1281934_+	hypothetical protein	NA	NA	NA	NA
WP_011197781.1\|1282013_1282145_+	YjcZ family sporulation protein	NA	NA	NA	NA
WP_009328805.1\|1282274_1282532_+	stage VI sporulation protein F	NA	NA	NA	NA
WP_011197782.1\|1282570_1284853_-	ATP-dependent helicase	A0A068EQC7	Bacillus_phage	1.0e-90	35.6
WP_009328802.1\|1284974_1285232_+	hypothetical protein	NA	NA	NA	NA
WP_009328801.1\|1285271_1285859_-	DedA family protein	NA	NA	NA	NA
WP_011197784.1\|1285954_1286941_-	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	1.6e-53	38.4
WP_161620988.1\|1286937_1287834_-	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	1.2e-84	55.6
WP_011197785.1\|1287850_1288246_-	GtrA family protein	NA	NA	NA	NA
WP_009328797.1\|1288410_1288830_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_009328796.1\|1288839_1289349_-	YjcG family protein	NA	NA	NA	NA
WP_009328793.1\|1289413_1290136_-	esterase family protein	NA	NA	NA	NA
WP_011197787.1\|1290652_1291141_-	DinB family protein	NA	NA	NA	NA
WP_009328787.1\|1291221_1292169_-	YafY family transcriptional regulator	NA	NA	NA	NA
WP_009328785.1\|1292477_1293602_+	methionine biosynthesis PLP-dependent protein	A0A0B5JD48	Pandoravirus	5.3e-16	25.6
WP_011197788.1\|1293591_1294767_+	cystathionine beta-lyase	A0A0B5JD48	Pandoravirus	6.7e-22	29.3
WP_011197789.1\|1294812_1296003_-	DUF819 domain-containing protein	NA	NA	NA	NA
WP_011197790.1\|1296176_1296746_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_009328774.1\|1296735_1297020_+	hypothetical protein	NA	NA	NA	NA
WP_011197791.1\|1297195_1298569_+	serine hydrolase	A0A1D8EXR7	Mycobacterium_phage	5.0e-08	23.9
WP_011197792.1\|1298873_1299860_-	family 43 glycosylhydrolase	NA	NA	NA	NA
WP_011197793.1\|1300983_1301163_+	hypothetical protein	NA	NA	NA	NA
WP_011197794.1\|1301197_1301776_+	maltose O-acetyltransferase	NA	NA	NA	NA
WP_016885896.1\|1301867_1302155_-	hypothetical protein	NA	NA	NA	NA
WP_003180759.1\|1302362_1303253_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_011197796.1\|1303573_1305403_+	assimilatory sulfite reductase (NADPH) flavoprotein subunit	NA	NA	NA	NA
WP_003180762.1\|1305430_1307149_+	assimilatory sulfite reductase (NADPH) hemoprotein subunit	NA	NA	NA	NA
WP_003180767.1\|1308171_1309044_+	DMT family transporter	NA	NA	NA	NA
WP_011197797.1\|1309091_1309469_+	VOC family protein	NA	NA	NA	NA
WP_009328757.1\|1309512_1310061_-	IseA DL-endopeptidase inhibitor family protein	NA	NA	NA	NA
WP_003180772.1\|1310513_1311248_+	LysM peptidoglycan-binding domain-containing protein	A0A217ER34	Bacillus_phage	4.2e-30	60.8
WP_011197798.1\|1311303_1312728_-	DHA2 family efflux MFS transporter permease subunit	A0A0M3UL24	Mycobacterium_phage	5.1e-16	24.6
WP_003180775.1\|1312743_1313322_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_003180778.1\|1313334_1313670_-	hypothetical protein	NA	NA	NA	NA
WP_003180779.1\|1313698_1314112_-	regulatory YrvL family protein	NA	NA	NA	NA
WP_003180781.1\|1314486_1314969_-	DUF600 family protein	NA	NA	NA	NA
WP_009328750.1\|1314972_1317021_-	DNA/RNA non-specific endonuclease	O64023	Bacillus_phage	1.9e-27	24.5
WP_003180784.1\|1317241_1317889_+	poly-gamma-glutamate hydrolase family protein	A0A0Y0AJU6	Bacillus_phage	4.1e-45	47.5
WP_003180785.1\|1317902_1318559_-	ImmA/IrrE family metallo-endopeptidase	A0A2H4JA43	uncultured_Caudovirales_phage	4.0e-40	49.7
WP_003180787.1\|1318747_1319101_-	helix-turn-helix transcriptional regulator	A0A2H4J6F9	uncultured_Caudovirales_phage	2.7e-19	49.6
WP_011197800.1\|1319273_1319534_+	helix-turn-helix transcriptional regulator	S5MA07	Brevibacillus_phage	2.3e-07	41.2
WP_011197801.1\|1319523_1319820_+	hypothetical protein	NA	NA	NA	NA
WP_003180792.1\|1319820_1320651_+	hypothetical protein	S6BFM4	Thermus_phage	1.3e-27	31.0
WP_011197802.1\|1320550_1321351_+	ATP-binding protein	A6XMI1	Bacillus_virus	3.6e-59	48.1
WP_003180796.1\|1321350_1321521_+	hypothetical protein	NA	NA	NA	NA
WP_011197803.1\|1321621_1321963_+	hypothetical protein	NA	NA	NA	NA
WP_003180800.1\|1321959_1322163_+	XtrA/YqaO family protein	A0A2H4J4M6	uncultured_Caudovirales_phage	1.9e-12	54.7
WP_003180803.1\|1322283_1322787_+	sigma-70 family RNA polymerase sigma factor	A0A0K2CNQ1	Brevibacillus_phage	1.4e-21	38.7
WP_003180804.1\|1322929_1323730_+\|terminase	terminase small subunit	A0A0S2MVB6	Bacillus_phage	5.7e-65	51.4
WP_009328741.1\|1323726_1325025_+\|terminase	PBSX family phage terminase large subunit	M4ZRM5	Bacillus_phage	7.2e-150	60.2
WP_003180808.1\|1325028_1326543_+\|portal	phage portal protein	A0A1B1P7C8	Bacillus_phage	3.4e-143	55.5
WP_009328740.1\|1326550_1327399_+\|portal	phage portal protein	A0A1B1P7E4	Bacillus_phage	2.1e-57	62.8
WP_009328739.1\|1327416_1328352_+\|capsid	phage major capsid protein	A0A1B1P7E3	Bacillus_phage	1.1e-102	64.1
WP_003180816.1\|1328445_1328820_+	DUF3199 family protein	NA	NA	NA	NA
WP_009328738.1\|1328816_1329173_+	YqbH/XkdH family protein	NA	NA	NA	NA
WP_003180822.1\|1329169_1329658_+	HK97 gp10 family phage protein	A0A249XXA4	Clostridium_phage	1.9e-34	44.6
WP_003180824.1\|1329670_1330111_+	hypothetical protein	NA	NA	NA	NA
WP_003180826.1\|1330111_1330336_+	hypothetical protein	NA	NA	NA	NA
WP_011197804.1\|1330335_1331682_+\|tail	phage tail sheath subtilisin-like domain-containing protein	S5MNC1	Brevibacillus_phage	1.5e-78	40.2
WP_003180830.1\|1331683_1332127_+\|tail	phage tail tube protein	A0A0K2CNG3	Brevibacillus_phage	2.1e-24	44.7
WP_003180832.1\|1332309_1332759_+\|portal	phage portal protein	A0A0A7RTY8	Clostridium_phage	4.1e-12	38.7
WP_003180833.1\|1332800_1332938_+	hypothetical protein	NA	NA	NA	NA
WP_011197805.1\|1332941_1336724_+	transglycosylase SLT domain-containing protein	A0A1L2JY60	Aeribacillus_phage	1.7e-42	45.3
WP_011197806.1\|1336716_1337373_+	LysM peptidoglycan-binding domain-containing protein	A0A090DBR9	Clostridium_phage	1.4e-24	33.2
WP_009328734.1\|1337429_1338410_+	hypothetical protein	H7BV96	unidentified_phage	9.2e-41	32.3
WP_003180843.1\|1338406_1338715_+	DUF2577 domain-containing protein	S6C459	Thermus_phage	1.0e-06	37.3
WP_003180844.1\|1338733_1339159_+	DUF2634 domain-containing protein	A0A2H4J6K5	uncultured_Caudovirales_phage	5.4e-14	39.0
WP_003180847.1\|1339151_1340195_+\|plate	baseplate J/gp47 family protein	S6AVU3	Thermus_phage	9.7e-73	44.3
WP_009328731.1\|1340181_1341102_+	YmfQ family protein	A0A0A7RTT8	Clostridium_phage	5.0e-12	28.3
WP_003180850.1\|1341115_1341502_+\|tail	phage tail protein	NA	NA	NA	NA
WP_011197807.1\|1341517_1342723_+	hypothetical protein	A0A2H4J4R1	uncultured_Caudovirales_phage	9.3e-27	48.3
WP_011197808.1\|1342767_1343727_+	hypothetical protein	A0A2H4J4R1	uncultured_Caudovirales_phage	1.2e-11	28.4
WP_011197809.1\|1343748_1344018_+	hemolysin XhlA family protein	A0A2H4JD40	uncultured_Caudovirales_phage	5.6e-25	66.3
WP_003180859.1\|1344032_1344296_+\|holin	phage holin	A0A2H4J6M0	uncultured_Caudovirales_phage	5.3e-28	67.8
WP_009328730.1\|1344346_1345411_+	N-acetylmuramoyl-L-alanine amidase	S6BFI4	Thermus_phage	2.0e-44	50.8
WP_003180863.1\|1345512_1346190_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_003180865.1\|1346212_1347229_+	zinc-binding alcohol dehydrogenase family protein	NA	NA	NA	NA
WP_003180867.1\|1347249_1348347_+	mannonate dehydratase	NA	NA	NA	NA
WP_009328728.1\|1348322_1349171_+	SDR family oxidoreductase	M1NMS3	Moumouvirus	5.6e-10	33.3

DBSCAN-SWA_3

1422748 : 1506082

107

Bacillus_phage(34.69%)

holin,terminase,tail,protease,head,capsid,portal,integrase

attL 1460292:1460307|attR 1506785:1506800

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011197835.1\|1422748_1423888_-\|integrase	site-specific integrase	S6C485	Thermus_phage	1.1e-66	39.4
WP_011197836.1\|1423919_1424399_-	ImmA/IrrE family metallo-endopeptidase	A0A2H4JA43	uncultured_Caudovirales_phage	2.0e-28	41.2
WP_011197837.1\|1424510_1424858_-	DUF4064 domain-containing protein	A0A0S2MVJ2	Bacillus_phage	8.6e-18	67.6
WP_011197838.1\|1424870_1425392_-	hypothetical protein	NA	NA	NA	NA
WP_011197839.1\|1425484_1425751_-	hypothetical protein	NA	NA	NA	NA
WP_041817016.1\|1426004_1426253_-	helix-turn-helix transcriptional regulator	A0A0A7RTK4	Clostridium_phage	9.8e-08	47.6
WP_011197840.1\|1426297_1426666_-	helix-turn-helix transcriptional regulator	A0A0B5CYL9	Listeria_phage	1.3e-11	35.6
WP_011197841.1\|1426800_1427037_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_164879362.1\|1427047_1427224_+	hypothetical protein	NA	NA	NA	NA
WP_041817017.1\|1427210_1427450_-	hypothetical protein	A0A1X9I5M1	Streptococcus_phage	1.7e-20	57.3
WP_011197842.1\|1427532_1427859_+	hypothetical protein	S6C476	Thermus_phage	2.8e-18	53.2
WP_128474863.1\|1427898_1428309_+	hypothetical protein	NA	NA	NA	NA
WP_011197844.1\|1428321_1429056_+	Rha family transcriptional regulator	A0A2I7SCU0	Paenibacillus_phage	4.5e-32	39.5
WP_009328672.1\|1429128_1429647_+	helix-turn-helix transcriptional regulator	A0A290FZK9	Caldibacillus_phage	9.8e-34	46.4
WP_011197845.1\|1429643_1429922_+	hypothetical protein	Q9ZXC9	Bacillus_phage	3.9e-21	51.7
WP_011197846.1\|1430043_1430232_+	hypothetical protein	NA	NA	NA	NA
WP_011197848.1\|1430466_1431405_+	YqaJ viral recombinase family protein	A6XMH8	Bacillus_virus	1.1e-83	49.5
WP_011197849.1\|1431422_1432244_+	recombination protein RecT	Q0H279	Geobacillus_phage	5.9e-81	58.2
WP_011197851.1\|1432950_1433931_+	ATP-binding protein	A6XMI1	Bacillus_virus	2.6e-59	50.6
WP_011197852.1\|1434025_1434238_+	XtrA/YqaO family protein	A0A2H4J4M6	uncultured_Caudovirales_phage	3.2e-15	60.6
WP_011197853.1\|1434251_1434416_+	hypothetical protein	NA	NA	NA	NA
WP_011197854.1\|1434415_1434706_+	IDEAL domain-containing protein	NA	NA	NA	NA
WP_011197856.1\|1435064_1435274_+	hypothetical protein	NA	NA	NA	NA
WP_011197857.1\|1435368_1435818_+	hypothetical protein	A0A1B1P7V7	Bacillus_phage	3.6e-08	39.6
WP_009328660.1\|1435814_1436270_+	hypothetical protein	A0A1B1P7W5	Bacillus_phage	4.9e-05	36.6
WP_009328659.1\|1436266_1436689_+	RusA family crossover junction endodeoxyribonuclease	M4ZS69	Bacillus_phage	2.5e-35	56.5
WP_009328658.1\|1436667_1436874_+	hypothetical protein	NA	NA	NA	NA
WP_009328657.1\|1436931_1437147_+	hypothetical protein	NA	NA	NA	NA
WP_011197858.1\|1437136_1437412_+	single-stranded DNA-binding protein	A0A290GHL8	Caldibacillus_phage	4.4e-17	66.1
WP_011197859.1\|1437577_1437895_+	hypothetical protein	NA	NA	NA	NA
WP_011197860.1\|1437927_1438365_+	hypothetical protein	A0A2H4J8A0	uncultured_Caudovirales_phage	1.3e-55	75.0
WP_011197861.1\|1438400_1438817_+	hypothetical protein	NA	NA	NA	NA
WP_021837350.1\|1439210_1439411_+	hypothetical protein	NA	NA	NA	NA
WP_011197863.1\|1439413_1439869_+	sigma-70 family RNA polymerase sigma factor	A0A2H4J4R7	uncultured_Caudovirales_phage	3.4e-62	78.8
WP_011197865.1\|1440192_1440423_+	hypothetical protein	NA	NA	NA	NA
WP_011197866.1\|1440658_1441366_+	hypothetical protein	A0A2P1JTW4	Anoxybacillus_phage	1.8e-62	59.1
WP_011201630.1\|1441362_1442640_+\|terminase	PBSX family phage terminase large subunit	A0A2P1JTW5	Anoxybacillus_phage	5.8e-152	68.8
WP_011197868.1\|1442636_1444052_+\|portal	phage portal protein	A0A2H4J4Q7	uncultured_Caudovirales_phage	1.1e-148	59.9
WP_009328644.1\|1444035_1444953_+\|capsid	minor capsid protein	A0A1Q1PVS0	Bacillus_phage	1.9e-88	53.7
WP_021837366.1\|1444955_1445096_+	hypothetical protein	NA	NA	NA	NA
WP_011197869.1\|1445100_1445247_+	hypothetical protein	NA	NA	NA	NA
WP_009328643.1\|1445239_1445569_+	hypothetical protein	NA	NA	NA	NA
WP_011197870.1\|1445570_1446215_+	hypothetical protein	U5PTS2	Bacillus_phage	2.2e-19	50.6
WP_011197871.1\|1446454_1447036_+	DUF4355 domain-containing protein	A0A2H4J4P4	uncultured_Caudovirales_phage	1.6e-48	52.3
WP_011197872.1\|1447051_1447972_+\|capsid	phage major capsid protein	A0A2H4JCG0	uncultured_Caudovirales_phage	7.4e-109	64.6
WP_003179319.1\|1447975_1448314_+	hypothetical protein	NA	NA	NA	NA
WP_011197873.1\|1448315_1448585_+	hypothetical protein	NA	NA	NA	NA
WP_003179325.1\|1448598_1448907_+\|head,tail	phage head-tail connector protein	A0A1W6JQJ1	Staphylococcus_phage	8.8e-14	40.2
WP_011197874.1\|1448906_1449248_+\|head	phage head closure protein	NA	NA	NA	NA
WP_011197875.1\|1449247_1449652_+	HK97 gp10 family phage protein	O48447	Bacillus_phage	2.7e-39	61.7
WP_009328634.1\|1449648_1450062_+	DUF3168 domain-containing protein	A0A0C5AEH4	Paenibacillus_phage	5.5e-11	39.3
WP_011197876.1\|1450074_1450620_+\|tail	phage major tail protein, TP901-1 family	Q597U9	Lactobacillus_virus	3.6e-18	30.9
WP_016885816.1\|1450543_1450882_+	fibronectin type III domain-containing protein	R4JF61	Bacillus_phage	2.2e-26	71.1
WP_011197878.1\|1450950_1451448_+\|tail	tail assembly chaperone	O48453	Bacillus_phage	1.3e-06	30.3
WP_011197879.1\|1451576_1451807_+	hypothetical protein	NA	NA	NA	NA
WP_011197880.1\|1451811_1454874_+	hypothetical protein	Q4ZC60	Staphylococcus_virus	5.3e-50	28.8
WP_011197881.1\|1454870_1455674_+\|tail	phage tail family protein	NA	NA	NA	NA
WP_011197882.1\|1455686_1459205_+\|tail	phage tail protein	Q5YA57	Bacillus_phage	1.1e-123	45.2
WP_011197883.1\|1459218_1459518_+	hypothetical protein	NA	NA	NA	NA
WP_009328626.1\|1459580_1459850_+	hemolysin XhlA family protein	A0A2H4JD40	uncultured_Caudovirales_phage	3.8e-21	58.4
WP_011197884.1\|1459865_1460129_+\|holin	phage holin	A0A2H4J6M0	uncultured_Caudovirales_phage	1.5e-30	74.7
WP_003185317.1\|1460176_1461130_+	LysM peptidoglycan-binding domain-containing protein	A0A141HSE6	Bacillus_phage	1.6e-58	41.7
1460292:1460307	attL	NA	NA	NA	NA
WP_003185315.1\|1461250_1461844_-	cupin domain-containing protein	Q2I8C5	Bacillus_phage	6.4e-53	67.6
WP_011201632.1\|1461999_1462851_-	DUF2202 domain-containing protein	NA	NA	NA	NA
WP_003185310.1\|1463058_1463769_+	DUF421 domain-containing protein	NA	NA	NA	NA
WP_003181020.1\|1464452_1464785_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_003181024.1\|1464977_1465133_+	hypothetical protein	NA	NA	NA	NA
WP_003181025.1\|1465239_1465419_+	hypothetical protein	NA	NA	NA	NA
WP_003181027.1\|1465591_1466053_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_003181029.1\|1466058_1467909_-	DNA ligase D	NA	NA	NA	NA
WP_003181033.1\|1467912_1468785_-	Ku protein	A0A218M9C0	Mycobacterium_phage	1.3e-38	34.4
WP_009328617.1\|1468938_1470591_-	diguanylate cyclase	NA	NA	NA	NA
WP_003181037.1\|1470880_1471522_+	DedA family protein	NA	NA	NA	NA
WP_003181039.1\|1471793_1472561_+	TerC family protein	A0A068EP98	Bacillus_phage	5.2e-31	43.4
WP_009328616.1\|1472853_1473609_+	RNA polymerase sigma factor SigI	NA	NA	NA	NA
WP_003181042.1\|1473605_1474697_+	anti-sigma factor domain-containing protein	NA	NA	NA	NA
WP_003181044.1\|1474709_1474907_-	alpha/beta-type small acid-soluble spore protein	A0A1P8CX76	Bacillus_phage	2.3e-12	62.1
WP_011197887.1\|1475037_1475757_-	DUF1836 domain-containing protein	NA	NA	NA	NA
WP_003181048.1\|1475898_1476792_+\|protease	protease HtpX	NA	NA	NA	NA
WP_003181050.1\|1476938_1478288_+	TrkH family potassium uptake protein	NA	NA	NA	NA
WP_009328614.1\|1478400_1480401_+	penicillin-binding transpeptidase domain-containing protein	NA	NA	NA	NA
WP_003181054.1\|1480448_1480664_+	hypothetical protein	NA	NA	NA	NA
WP_003181056.1\|1480660_1480849_+	hypothetical protein	NA	NA	NA	NA
WP_003181058.1\|1480901_1481927_-	acyltransferase family protein	NA	NA	NA	NA
WP_011197889.1\|1482236_1484447_+	PAS domain-containing sensor histidine kinase	NA	NA	NA	NA
WP_003181061.1\|1484454_1484952_+	methylated-DNA--[protein]-cysteine S-methyltransferase	A0A0G2Y3R2	Acanthamoeba_polyphaga_mimivirus	1.8e-21	51.4
WP_009328612.1\|1485163_1486225_-	S-methyl-5-thioribose-1-phosphate isomerase	NA	NA	NA	NA
WP_003181068.1\|1486230_1487427_-	S-methyl-5-thioribose kinase	NA	NA	NA	NA
WP_003181070.1\|1487738_1488518_-	carbon-nitrogen family hydrolase	NA	NA	NA	NA
WP_003181072.1\|1488613_1489804_+	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_003181075.1\|1490037_1491255_+	2,3-diketo-5-methylthiopentyl-1-phosphate enolase	NA	NA	NA	NA
WP_003181077.1\|1491251_1492535_+	2-hydroxy-3-keto-5-methylthiopentenyl-1- phosphate phosphatase	NA	NA	NA	NA
WP_011197890.1\|1492555_1493095_+	cupin domain-containing protein	NA	NA	NA	NA
WP_011197891.1\|1493119_1493584_-	metallothiol transferase FosB	Q2LI91	Bacillus_phage	2.0e-30	52.6
WP_011197892.1\|1493570_1493900_-	DUF1232 domain-containing protein	NA	NA	NA	NA
WP_003181085.1\|1494118_1494361_+	aspartyl-phosphate phosphatase Spo0E family protein	NA	NA	NA	NA
WP_003181087.1\|1494422_1495934_-	PAS domain-containing sensor histidine kinase	NA	NA	NA	NA
WP_003181089.1\|1496171_1496627_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_003181091.1\|1496651_1497431_-	flagellar motor protein MotB	NA	NA	NA	NA
WP_003181093.1\|1497423_1498227_-	flagellar motor stator protein MotA	NA	NA	NA	NA
WP_011197893.1\|1498425_1500522_-\|protease	ATP-dependent Clp protease ATP-binding subunit	H6X3M6	Enterobacteria_phage	2.0e-125	40.4
WP_003181096.1\|1500742_1501777_+	hypothetical protein	NA	NA	NA	NA
WP_003181098.1\|1502041_1502701_+	7-cyano-7-deazaguanine synthase QueC	A0A2H4J8Q7	uncultured_Caudovirales_phage	6.6e-67	59.9
WP_003181100.1\|1502703_1503144_+	6-carboxytetrahydropterin synthase QueD	NA	NA	NA	NA
WP_003181103.1\|1503136_1503868_+	7-carboxy-7-deazaguanine synthase QueE	A0A1U9WRB6	Streptococcus_virus	9.6e-59	48.0
WP_009328607.1\|1503889_1504387_+	NADPH-dependent 7-cyano-7-deazaguanine reductase QueF	E7DN65	Pneumococcus_phage	6.1e-57	74.1
WP_011197894.1\|1505023_1506082_+\|integrase	tyrosine-type recombinase/integrase	A0A142F1N9	Bacillus_phage	6.9e-26	26.1
1506785:1506800	attR	NA	NA	NA	NA

DBSCAN-SWA_4

1515969 : 1542669

Bacillus_phage(52.17%)

holin,terminase,tail,protease,head,capsid,portal,integrase

attL 1540033:1540046|attR 1548832:1548845

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011197904.1\|1515969_1516308_+	HNH endonuclease	A0A0K2CZH3	Paenibacillus_phage	5.6e-14	59.4
WP_011197905.1\|1516427_1516751_+\|terminase	P27 family phage terminase small subunit	A0A0K2CZN8	Paenibacillus_phage	6.8e-33	69.8
WP_011197906.1\|1516725_1518507_+\|terminase	terminase large subunit	A0A1B1P7R3	Bacillus_phage	1.3e-245	67.0
WP_011197907.1\|1518518_1519817_+\|portal	phage portal protein	A0A0U3SQF0	Bacillus_phage	5.6e-86	44.2
WP_011197908.1\|1519770_1520517_+\|protease	Clp protease ClpP	A0A0K2CYC6	Paenibacillus_phage	5.7e-59	49.6
WP_011197909.1\|1520516_1521671_+\|capsid	phage major capsid protein	A0A1B1P7R4	Bacillus_phage	1.9e-130	63.4
WP_011197910.1\|1521711_1522209_+	Ig-like domain-containing protein	NA	NA	NA	NA
WP_011197911.1\|1522211_1522451_+\|head,tail	phage gp6-like head-tail connector protein	A0A0C5ABB4	Paenibacillus_phage	7.8e-10	43.8
WP_011197912.1\|1522455_1522791_+\|head	phage head closure protein	A0A2I7SC03	Paenibacillus_phage	3.3e-22	50.5
WP_016885201.1\|1522787_1523210_+	hypothetical protein	NA	NA	NA	NA
WP_011197913.1\|1523206_1523551_+	hypothetical protein	A0A0S2SY15	Bacillus_phage	1.0e-15	40.9
WP_011197914.1\|1523559_1524141_+\|tail	phage tail protein	NA	NA	NA	NA
WP_011197915.1\|1524091_1524406_+	fibronectin type III domain-containing protein	Q0PDK9	Bacillus_phage	1.6e-23	64.6
WP_011197916.1\|1524458_1524794_+	hypothetical protein	H0USX2	Bacillus_phage	1.2e-11	40.7
WP_011201638.1\|1525036_1530337_+\|tail	phage tail tape measure protein	A0A288WG88	Bacillus_phage	1.1e-98	42.6
WP_011197917.1\|1530337_1531159_+\|tail	phage tail family protein	A6M962	Geobacillus_virus	5.9e-65	47.7
WP_011197918.1\|1531167_1532694_+\|tail	phage tail protein	A6M966	Geobacillus_virus	7.9e-47	35.0
WP_011197919.1\|1532715_1534695_+	right-handed parallel beta-helix repeat-containing protein	U5PWM6	Bacillus_phage	5.8e-50	33.4
WP_011197920.1\|1536288_1536585_+	XkdW family protein	A0A2H4JCI0	uncultured_Caudovirales_phage	3.2e-13	37.0
WP_011197921.1\|1536574_1536751_+	XkdX family protein	A0A2H4JAA1	uncultured_Caudovirales_phage	7.2e-13	57.1
WP_011197922.1\|1536779_1537607_+	glycerophosphoryl diester phosphodiesterase	I6XE30	Staphylococcus_phage	2.6e-28	32.5
WP_011197923.1\|1537675_1537879_+	hypothetical protein	A0A290GDY2	Caldibacillus_phage	1.1e-09	47.9
WP_011197924.1\|1537948_1538884_+	N-acetylmuramoyl-L-alanine amidase	Q9ZXD7	Bacillus_phage	6.9e-94	64.5
WP_011197925.1\|1538905_1539163_+\|holin	holin	A0A0U4JE55	Bacillus_phage	2.3e-20	52.9
WP_011197926.1\|1539282_1539837_+	hypothetical protein	NA	NA	NA	NA
WP_011197927.1\|1539888_1540092_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
1540033:1540046	attL	NA	NA	NA	NA
WP_011197928.1\|1540222_1541041_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_011197929.1\|1541113_1541443_+	YolD-like family protein	O64030	Bacillus_phage	8.5e-07	33.3
WP_011197930.1\|1541523_1542669_+\|integrase	site-specific integrase	A0A1B0T6A8	Bacillus_phage	4.7e-44	32.7
1548832:1548845	attR	NA	NA	NA	NA

DBSCAN-SWA_5

2402946 : 2415126

Staphylococcus_phage(55.56%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003183104.1\|2402946_2403540_-	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	3.4e-14	37.6
WP_009327962.1\|2403529_2404285_-	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	1.4e-07	23.6
WP_003183108.1\|2404467_2404563_+	YjcZ family sporulation protein	NA	NA	NA	NA
WP_003183111.1\|2404683_2405205_+	DUF309 domain-containing protein	NA	NA	NA	NA
WP_003183113.1\|2405215_2405590_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_003183115.1\|2405691_2406156_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.7e-45	70.7
WP_003183117.1\|2406190_2407387_-	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	2.1e-116	53.9
WP_003183118.1\|2407408_2408056_-	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	7.4e-39	41.5
WP_011198083.1\|2408067_2409156_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	5.1e-64	38.1
WP_003183123.1\|2409516_2409861_-	hypothetical protein	NA	NA	NA	NA
WP_011198084.1\|2410123_2412310_-	metallophosphoesterase	A0A220BYT7	Staphylococcus_phage	1.4e-150	41.3
WP_011198085.1\|2412436_2412874_-	Hsp20/alpha crystallin family protein	NA	NA	NA	NA
WP_003183128.1\|2413032_2413338_-	hypothetical protein	NA	NA	NA	NA
WP_009327959.1\|2413327_2414458_-	tetratricopeptide repeat protein	A0A1P8CWN8	Bacillus_phage	1.4e-77	43.3
WP_003183133.1\|2414688_2415126_-	peptidylprolyl isomerase	A0A2H4UTF4	Bodo_saltans_virus	5.4e-17	44.6

DBSCAN-SWA_6

2787852 : 2839992

Bacillus_phage(33.33%)

protease,coat,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011198160.1\|2787852_2788998_-\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	3.2e-85	43.2
WP_003183982.1\|2789026_2790055_-\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
WP_003183984.1\|2790095_2790296_-	DUF2905 domain-containing protein	NA	NA	NA	NA
WP_003183985.1\|2790288_2791293_-	Holliday junction branch migration DNA helicase RuvB	A0A127AWE7	Bacillus_phage	1.2e-06	30.3
WP_003183986.1\|2791302_2791908_-	Holliday junction branch migration protein RuvA	NA	NA	NA	NA
WP_003183987.1\|2792030_2792552_-	BofC C-terminal domain-containing protein	NA	NA	NA	NA
WP_003183988.1\|2792794_2793445_+	serine/threonine protein kinase	NA	NA	NA	NA
WP_003183990.1\|2793722_2793902_-	small acid-soluble spore protein H	NA	NA	NA	NA
WP_003183991.1\|2793997_2794462_-	DinB family protein	NA	NA	NA	NA
WP_003183992.1\|2794522_2795233_-	poly-gamma-glutamate hydrolase family protein	F8WQ53	Bacillus_phage	3.0e-49	55.9
WP_003183993.1\|2795646_2795826_+	hypothetical protein	A0A1P8CWV7	Bacillus_phage	1.5e-21	76.3
WP_003183994.1\|2795917_2796244_-	hypothetical protein	NA	NA	NA	NA
WP_003183995.1\|2796391_2797114_-	YebC/PmpR family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_009327770.1\|2797240_2797876_-	YhcN/YlaJ family sporulation lipoprotein	NA	NA	NA	NA
WP_003184005.1\|2798048_2799101_-\|coat	SafA/ExsA family spore coat assembly protein	NA	NA	NA	NA
WP_003184007.1\|2799216_2800326_-	quinolinate synthase NadA	NA	NA	NA	NA
WP_009327769.1\|2800347_2801187_-	carboxylating nicotinate-nucleotide diphosphorylase	NA	NA	NA	NA
WP_003184010.1\|2801167_2802742_-	L-aspartate oxidase	NA	NA	NA	NA
WP_009327768.1\|2802842_2804021_+	IscS subfamily cysteine desulfurase	A0A1X7QGF3	Faustovirus	1.2e-31	25.3
WP_003184015.1\|2803989_2804532_+	transcription repressor NadR	NA	NA	NA	NA
WP_025805050.1\|2804575_2805427_-	prephenate dehydratase	NA	NA	NA	NA
WP_003184018.1\|2805453_2805897_-	ACT domain-containing protein	NA	NA	NA	NA
WP_003184021.1\|2806010_2807297_-	GTPase ObgE	NA	NA	NA	NA
WP_003184022.1\|2807329_2807908_-	Spo0B domain-containing protein	NA	NA	NA	NA
WP_003184023.1\|2808133_2808415_-	50S ribosomal protein L27	NA	NA	NA	NA
WP_003184025.1\|2808427_2808769_-\|protease	ribosomal-processing cysteine protease Prp	NA	NA	NA	NA
WP_003184027.1\|2808781_2809090_-	50S ribosomal protein L21	NA	NA	NA	NA
WP_003184028.1\|2809246_2810113_-\|protease	site-2 protease family protein	NA	NA	NA	NA
WP_003184030.1\|2810105_2810897_-	M23 family metallopeptidase	NA	NA	NA	NA
WP_003184032.1\|2811042_2811471_+	SRPBCC domain-containing protein	NA	NA	NA	NA
WP_003184034.1\|2811470_2811791_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_003184035.1\|2811835_2812642_-	septum site-determining protein MinD	NA	NA	NA	NA
WP_011198163.1\|2812644_2813325_-	septum site-determining protein MinC	NA	NA	NA	NA
WP_003184039.1\|2813379_2813898_-	rod shape-determining protein MreD	NA	NA	NA	NA
WP_003184040.1\|2813894_2814803_-	rod shape-determining protein MreC	NA	NA	NA	NA
WP_003184042.1\|2814833_2815844_-	rod shape-determining protein	NA	NA	NA	NA
WP_003184045.1\|2815931_2816606_-	DNA repair protein RadC	NA	NA	NA	NA
WP_003184048.1\|2816660_2817233_-	septum formation inhibitor Maf	NA	NA	NA	NA
WP_003184050.1\|2817386_2818418_-	SPOR domain-containing protein	NA	NA	NA	NA
WP_011198164.1\|2818621_2819371_-	prepilin peptidase	NA	NA	NA	NA
WP_003184054.1\|2819513_2820818_-	bifunctional folylpolyglutamate synthase/dihydrofolate synthase	NA	NA	NA	NA
WP_009329289.1\|2820893_2823536_-\|tRNA	valine--tRNA ligase	A0A1V0S951	Catovirus	2.8e-161	42.3
WP_003184058.1\|2823997_2824189_+	hypothetical protein	NA	NA	NA	NA
WP_009329292.1\|2824208_2825231_-\|coat	spore coat protein YsxE	NA	NA	NA	NA
WP_011198165.1\|2825258_2826632_-	LysM peptidoglycan-binding domain-containing protein	NA	NA	NA	NA
WP_009329296.1\|2826780_2828076_-	glutamate-1-semialdehyde 2,1-aminomutase	NA	NA	NA	NA
WP_009329298.1\|2828101_2829076_-	porphobilinogen synthase	NA	NA	NA	NA
WP_009329300.1\|2829079_2829871_-	uroporphyrinogen-III synthase	NA	NA	NA	NA
WP_009329302.1\|2829860_2830802_-	hydroxymethylbilane synthase	NA	NA	NA	NA
WP_011198166.1\|2830841_2831672_-	cytochrome c biogenesis protein CcsA	NA	NA	NA	NA
WP_009329306.1\|2831677_2833039_-\|tRNA	glutamyl-tRNA reductase	NA	NA	NA	NA
WP_003184074.1\|2833227_2833713_+	hypothetical protein	NA	NA	NA	NA
WP_003184076.1\|2833761_2834349_-	YihA family ribosome biogenesis GTP-binding protein	NA	NA	NA	NA
WP_009329308.1\|2834345_2836670_-	endopeptidase La	A0A0R6PGP8	Moraxella_phage	1.0e-186	45.2
WP_003184080.1\|2836888_2838544_-\|protease	ATP-dependent protease LonB	A0A0R6PGP8	Moraxella_phage	1.4e-17	35.7
WP_003184083.1\|2838726_2839992_-\|protease	ATP-dependent protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	7.2e-147	63.5

DBSCAN-SWA_7

3412000 : 3479133

Bacillus_phage(50.0%)

holin,tail,terminase,protease,coat,head,tRNA,plate,capsid,portal,transposase,integrase

attL 3424524:3424541|attR 3469317:3469334

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009329597.1\|3412000_3412750_+\|tRNA	tRNA-dependent cyclodipeptide synthase	NA	NA	NA	NA
WP_003185271.1\|3412746_3413967_+	cytochrome P450, cyclodipeptide synthase-associated	NA	NA	NA	NA
WP_003185273.1\|3413963_3414419_-	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_003185275.1\|3414435_3414909_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_003185279.1\|3416398_3417448_+	oxidoreductase	NA	NA	NA	NA
WP_003185281.1\|3417479_3418115_-	FMN-dependent NADH-azoreductase	NA	NA	NA	NA
WP_011198286.1\|3418415_3419384_-	rhodanese-related sulfurtransferase	NA	NA	NA	NA
WP_169302180.1\|3419580_3419781_-	hypothetical protein	NA	NA	NA	NA
WP_011198288.1\|3419755_3420337_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_003185290.1\|3420493_3420643_+	YvrJ family protein	NA	NA	NA	NA
WP_011198289.1\|3420736_3421891_+	oxalate decarboxylase family bicupin	NA	NA	NA	NA
WP_003185294.1\|3421963_3422362_+	peptidase	NA	NA	NA	NA
WP_003185296.1\|3422458_3422944_+	hypothetical protein	NA	NA	NA	NA
WP_003185298.1\|3423096_3423324_+	hypothetical protein	NA	NA	NA	NA
WP_003185302.1\|3423725_3424010_+	hypothetical protein	NA	NA	NA	NA
3424524:3424541	attL	NA	NA	NA	NA
WP_011198291.1\|3424744_3424897_+	hypothetical protein	NA	NA	NA	NA
WP_011198293.1\|3425060_3425420_+	DUF4064 domain-containing protein	NA	NA	NA	NA
WP_085959889.1\|3425486_3426649_-\|transposase	IS3 family transposase	A0A2I6AZV9	Macacine_betaherpesvirus	1.5e-34	44.2
WP_011198294.1\|3426739_3426958_-	transcriptional regulator	NA	NA	NA	NA
WP_118381831.1\|3427301_3427754_+	hypothetical protein	NA	NA	NA	NA
WP_011198296.1\|3428270_3428501_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_021837703.1\|3428755_3428899_-	hypothetical protein	NA	NA	NA	NA
WP_011198298.1\|3429005_3430028_-	hypothetical protein	NA	NA	NA	NA
WP_011198299.1\|3430298_3431828_+\|transposase	transposase	NA	NA	NA	NA
WP_011198300.1\|3431843_3432182_+	hypothetical protein	NA	NA	NA	NA
WP_011198301.1\|3432238_3433318_-	N-acetylmuramoyl-L-alanine amidase	S6BFI4	Thermus_phage	4.0e-45	49.3
WP_011198302.1\|3433369_3433633_-\|holin	phage holin	A0A2H4J6M0	uncultured_Caudovirales_phage	6.7e-31	73.6
WP_009329192.1\|3433648_3433918_-	hemolysin XhlA family protein	A0A2H4JD40	uncultured_Caudovirales_phage	1.4e-20	58.4
WP_011198303.1\|3433980_3434163_-	XkdX family protein	Q4ZA85	Staphylococcus_virus	3.0e-06	49.0
WP_011198304.1\|3434159_3434474_-	hypothetical protein	M4ZR44	Bacillus_phage	3.4e-13	43.0
WP_011198305.1\|3434485_3435829_-\|plate	phage baseplate upper protein	M4ZRP1	Bacillus_phage	6.3e-48	44.1
WP_011198306.1\|3435849_3437805_-	right-handed parallel beta-helix repeat-containing protein	D7NW65	Streptomyces_phage	8.8e-43	29.0
WP_003185331.1\|3437841_3439554_-\|tail	phage tail protein	D6R400	Bacillus_phage	6.0e-221	66.6
WP_011198307.1\|3439566_3440403_-\|tail	phage tail family protein	D6R3Z9	Bacillus_phage	6.8e-109	68.2
WP_011198308.1\|3440402_3444869_-\|tail	phage tail tape measure protein	A6M961	Geobacillus_virus	3.5e-71	42.6
WP_003185339.1\|3445077_3445440_-	hypothetical protein	NA	NA	NA	NA
WP_003185341.1\|3445493_3446111_-\|tail	tail protein	NA	NA	NA	NA
WP_003185344.1\|3446125_3446509_-	hypothetical protein	NA	NA	NA	NA
WP_006637249.1\|3446505_3446904_-	HK97 gp10 family phage protein	NA	NA	NA	NA
WP_003185349.1\|3446903_3447212_-\|head	phage head closure protein	NA	NA	NA	NA
WP_003185351.1\|3447201_3447504_-\|head,tail	phage gp6-like head-tail connector protein	A0A0S2GLH6	Bacillus_phage	1.2e-12	46.3
WP_011198310.1\|3447524_3447950_-	collagen-like protein	D6R3Z0	Bacillus_phage	2.6e-16	57.2
WP_011198311.1\|3447972_3449256_-\|capsid	phage major capsid protein	A0A288WG01	Bacillus_phage	7.7e-80	44.8
WP_011201736.1\|3449295_3450027_-\|protease	Clp protease ClpP	A0A2I7SCY8	Paenibacillus_phage	8.9e-57	56.4
WP_003185359.1\|3449971_3451282_-\|portal	phage portal protein	D6R3Y6	Bacillus_phage	1.7e-106	46.9
WP_003185361.1\|3451282_3451474_-	DUF1056 family protein	NA	NA	NA	NA
WP_003185362.1\|3451485_3453195_-\|terminase	terminase large subunit	A0A0S2GLF0	Bacillus_phage	2.7e-205	62.0
WP_011198313.1\|3453191_3453707_-\|terminase	phage terminase small subunit P27 family	A6M947	Geobacillus_virus	9.8e-34	46.2
WP_011198314.1\|3453937_3454312_-	HNH endonuclease	A0A1U7Q1S7	Geobacillus_virus	9.0e-29	50.8
WP_041817053.1\|3454338_3454647_-	hypothetical protein	NA	NA	NA	NA
WP_006637235.1\|3454863_3455088_-\|coat	spore coat protein	NA	NA	NA	NA
WP_009329244.1\|3455826_3456207_-	ArpU family transcriptional regulator	Q9ZXB9	Bacillus_phage	8.8e-48	82.9
WP_011198316.1\|3456333_3456606_-	DUF5052 family protein	F8WQ63	Bacillus_phage	2.2e-29	72.5
WP_009329251.1\|3457191_3457362_-	Fur-regulated basic protein FbpA	A0A0S2SXY0	Bacillus_phage	1.1e-07	54.7
WP_009329253.1\|3457358_3457898_-	ERCC4 domain-containing protein	Q9ZXC2	Bacillus_phage	5.9e-90	91.1
WP_011198317.1\|3457894_3458332_-	hypothetical protein	Q9ZXC3	Bacillus_phage	5.5e-62	75.2
WP_011198318.1\|3458309_3458681_-	hypothetical protein	NA	NA	NA	NA
WP_011198319.1\|3459056_3461474_-	primase	D6R422	Bacillus_phage	0.0e+00	85.4
WP_009329263.1\|3461534_3461972_-	DUF669 domain-containing protein	Q9ZXC5	Bacillus_phage	8.2e-74	90.3
WP_011198320.1\|3461971_3462904_-	AAA family ATPase	Q9ZXC7	Bacillus_phage	1.9e-152	88.1
WP_011198321.1\|3462907_3463465_-	host-nuclease inhibitor Gam family protein	Q9ZXC8	Bacillus_phage	8.3e-71	73.0
WP_011198322.1\|3463557_3463800_-	hypothetical protein	NA	NA	NA	NA
WP_011198324.1\|3463887_3464154_-	hypothetical protein	Q9ZXC9	Bacillus_phage	7.8e-19	53.5
WP_011198325.1\|3464213_3464594_+	DUF2513 domain-containing protein	A0A2I7SCV0	Paenibacillus_phage	2.0e-20	41.6
WP_011198326.1\|3464585_3464756_-	hypothetical protein	NA	NA	NA	NA
WP_003185401.1\|3465099_3465654_-	hypothetical protein	A0A288WGQ2	Bacillus_phage	1.3e-31	42.7
WP_016886536.1\|3465711_3465900_-	hypothetical protein	NA	NA	NA	NA
WP_003185403.1\|3466031_3466220_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_011198327.1\|3466216_3467011_-	ORF6N domain-containing protein	A0A2I7SCV5	Paenibacillus_phage	3.7e-64	52.4
WP_011198328.1\|3467430_3468069_+	LexA family transcriptional regulator	A0A2I7SCV6	Paenibacillus_phage	4.0e-45	47.2
WP_003185410.1\|3468139_3469234_+\|integrase	site-specific integrase	A0A1B2AQ00	Phage_Wrath	2.2e-99	52.5
WP_009329604.1\|3469785_3470259_-	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	1.0e-45	61.1
3469317:3469334	attR	NA	NA	NA	NA
WP_003185414.1\|3470370_3472674_-	ribonuclease R	Q0GXV6	Lactococcus_phage	6.9e-95	41.7
WP_011198329.1\|3472687_3473434_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_003185418.1\|3473574_3473805_-	preprotein translocase subunit SecG	NA	NA	NA	NA
WP_003185421.1\|3473975_3474260_-	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	A0A2I7SC16	Paenibacillus_phage	5.8e-12	52.7
WP_085959538.1\|3474288_3474522_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_009329609.1\|3474674_3475076_+	transcriptional regulator	S6C481	Thermus_phage	4.2e-16	45.3
WP_009329610.1\|3475247_3475646_+	helix-turn-helix transcriptional regulator	S6C481	Thermus_phage	2.1e-15	50.6
WP_003185432.1\|3475693_3476371_-	ABC transporter permease	NA	NA	NA	NA
WP_009329611.1\|3476387_3477305_-	osmoprotectant ABC transporter substrate-binding lipoprotein OpuCC	NA	NA	NA	NA
WP_009329612.1\|3477318_3477972_-	ABC transporter permease	NA	NA	NA	NA
WP_003185439.1\|3477993_3479133_-\|holin	betaine/proline/choline family ABC transporter ATP-binding protein	F2Y1V5	Organic_Lake_phycodnavirus	8.6e-14	30.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage