CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NC_003911	Ruegeria pomeroyi DSS-3, complete sequence	1 crisprs	RT,csa3,DEDDh,WYL,cas3	4	20	1	0
NC_006569	Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence	0 crisprs	csa3	0	0	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_003911_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_003911_1

2126115-2128935

Orphan

Consensus_repeat	Method
ACGAAGGCNACGAAGGCGACGA	CRT

43 spacers

The CRISPR arrays of NC_003911_1

>merge|NC_003911|1|2126115-2128935|CRT
ACGAGGGCAATGAAGGCGACGAGACCAACGAAGGCGACGAGGGCGACGAGGACGACGAAGGCAACGAGCACGACGAAGGCAACGAAGGCAACGAAGGCAACGAAGATAACGAAGGCAACGAAGGCGACGAACAGAACGAAGCCGACGGCGGCGACGAAGGCGACGAAGGTAACGAAGGCAACGAGGGCAACGAAGGCAACGAGGACAACGAAGGCAACGAAGGCGACGAGGGTAACGAAGGCGACGAAGCCGACGAGGGCGACGAAGACAACGAGGGCAACGAGAACGACGAAGGCAACGAGGCCGACGAAGGCGACGAAGGCAACGAAGGCGAGGAAGGCAACGAGGACAACGAAGGTAACGAAGGCGACGAAGGCGACGAAGGCGACGAAGGCAACGAAGGCGACGAGGACGGCGGCGACGAAGGCGACGAAGGCGACGAGGGGAACGAAGGCAACGAGGGCAACGAGGGCAACGAGGGTAACGAAGGCAACGAGGACAACGAAGGTAACGAAGGCGACGAAGCCAACGAGGGTGACGAGGGCGACGAAGGCGACGAGGGTAACGAGGGCGACGAAGGTAACGAGGACGACGAAGGCAACGAAGGCGACGAGGGTAACGAGAACGACAACGACGAAGGCGACGAAGGCGACGAGCAAGACGAAAACGACGAAAACGACGAAGGTGACGAGGCCGACGAAGGCAACGAAGGCGACGAAGACGACGAAGGCAACGAGGACAACGAAGGCAACGAAGGCGACGAGTCCGGCGACGAAGGTGATGAGGGCGACGAAGCTGACGAAGGCAACGAAGGCGACGAAGACAACGAAGGCAACGAAGGCGACGAAGGCAACGAAGGCGACGAAGGCAACGAAGACGGCGGCGACGAAGGCGACGAAGACAACGAAGGCAACGAAAGCGACGAGGACGACGAAGGCGACGAAGGCGACGCCAGCGATCCCTATGACAATGAGGGCGACGAGGGCAACGAGGACGACGAAGGCGACGAGGACGACGAGAGCAATGAGGGCAACGAAGGCCCCCAGACCGACGATGAGGATGACGAAGGCAACGAAGGCGATGAAGGCAACGAAGAAATAGAAGGCCAGGAAGACGACGAGGACGACGAAGGCGACGAAGGCGACGAGGATAACGAGTGGGACGAGGATAACGAGGACGACGAAGGCGACGAAGCCGACGAAAACGACGAGGACGACGAAGGCAACGAAGGCGACGAAGCCGACGAGGACGACGAAGACAACGAAGACGACGAAGGCAACGAAGGCGACGAAGCCGACGAAAACGACGAAGACAACGAATTCGACGAAGGCGACGAAGGTGACGAGGGCAACGAGGGCAACGAGGGCGACGAAGACGACGAATTCGACGAGGGCGACGAAGGCGACGAAGGCGACGAGGGCGACGAAGGTAACGAGGGCGACGAGGGCCAGATCGACGGCGACGAAGACGACGAAGGCGACGAAGATGACGAAGCCGACGAAGGTGATGAAGGCGACGAAAGCGACGAAGGCAACGAAGGCGACGAAACCAATCTGAACGACGAAAACGACGAGGGTGACGAGGGTAACGAAGGCGACGAGGACGACGAGTTCGACGAAAACGACGAATTCGACGAGGGTAACGAAGGCAACGAAGGCGACGAAGACGACGAATTCGACGAAGGCGACGAGGACGACGAAGGCGACGAGTCCGACGAAAGCGACGAGCACGACGAAAACGACGAAGGCGACGAAGGCGACGAGTACGACGAAGGCGACGAAGGCGACGAGGCCGAAACCGGCACCGGCGATGACGGTGACGAGGGCAATGAAGGTGACGAAGCCGATATCGACAATCGTGGCGACGAAGGCGACGAAAACGACGAAGGTGACGAAGCCGACGAAGGCGACGAAGCCGACGAGCACGACGAAGGTGACGAAGGCAACGAAGGTGACGAAGCCGACGAAGGCGACGAGGACGACGAAGCCGACGAAGATGACGAAGGCGACGAAGACAACGAAGGTGACGAAGCTGACGAAGACGACGAAAACGACGAGCACGACGAATATGATGAAGGCGACGAATCTGACGAGGACAACGAGGACGACGAAGACAACGAAGGCAATGAAGGCAATGAGAACGACGAGCTCGACGAAGGTGACGAAGGCAACGAGGGCGATGAAAACGACGAAGGCAACGAATTCGATGAAGGCGGCATAGACGACGAGGGTGACGAAGGCGACGAAGACGACGAGGGCGACGAAAACGACGAGGACGACGAAAACAACGAAGGCGACGAAGACGACGAAAACGACGAATACGACGAAGGTGACGAAGCCGACGAAGGCGACGAAAACGACGAAGACGACGAAAACAACGAAGGCGACGAAAACAACGAGGATAACGAAAACGACGAAAACGACGAGTTCGACGAAGAAAACGAAGGCAGCGAAGGCGACGAAGACGACGAAGCCGACGAAGGCGACGAAGACGACGAAGGCGACGAAGCCGACGAGTATGACGAAGGCGACGAAGGCGACGAAGACGACGAAGGCGACGAAAACGACGAGGACGACGAAGGTAACGAAGAAAACGAGGTCCACGACGACAACGACGGCGACGAAGGCGACGAAGGCGACGAAGGCAACGAAGGAGACGAAGGAGACGAAGGCAACGAAGGCAACGAGGGCGACAGCCAGGCCGATGCCAACGAAGGAGATGAGGGAGACGAAGACAACGAAGGCAACGAAGGTGACGAAGGCGACGAAGACGACGAAGGCAATGAAAACGACGAAGGCGACGAAGGCGACGAAGGCGACGA

>NC_003911|1|1|2126115-2128935|CRT
ACGAGGGCAATGAAGGCGACGA	GACCAACGAAGGCGACGAGGGCGACGAGGACGACGAAGGCAACGAGCACGACGAAGGCAACGAAGGCAACGAAGGCAACGAAGATA
ACGAAGGCAACGAAGGCGACGA	ACAGAACGAAGCCGACGGCGGCGACGAAGGCGACGAAGGTAACGAAGGCAACGAGGGCAACGAAGGCAACGAGGACA
ACGAAGGCAACGAAGGCGACGA	GGGTAACGAAGGCGACGAAGCCGACGAGGGCGACGAAGACAACGAGGGCAACGAGAACGACGAAGGCAACGAGGCCGACGAAGGCG
ACGAAGGCAACGAAGGCGAGGA	AGGCAACGAGGACAACGAAGGTAACGAAGGCGACGAAGGCGACGAAGGCG
ACGAAGGCAACGAAGGCGACGA	GGACGGCGGCGACGAAGGCGACGAAGGCGACGAGGGGAACGAAGGCAACGAGGGCAACGAGGGCA
ACGAGGGTAACGAAGGCAACGA	GGACAACGAAGGTAACGAAGGCGACGAAGCCAACGAGGGTG
ACGAGGGCGACGAAGGCGACGA	GGGTAACGAGGGCGACGAAGGTAACGAGGACG
ACGAAGGCAACGAAGGCGACGA	GGGTAACGAGAACGACAACG
ACGAAGGCGACGAAGGCGACGA	GCAAGACGAAAACGACGAAAACGACGAAGGTGACGAGGCCG
ACGAAGGCAACGAAGGCGACGA	AGACGACGAAGGCAACGAGGACA
ACGAAGGCAACGAAGGCGACGA	GTCCGGCGACGAAGGTGATGAGGGCGACGAAGCTG
ACGAAGGCAACGAAGGCGACGA	AGACAACGAAGGCAACGAAGGCG
ACGAAGGCAACGAAGGCGACGA	AGGCAACGAAGACGGCGGCGACGAAGGCGACGAAGACA
ACGAAGGCAACGAAAGCGACGA	GGACGACGAAGGCGACGAAGGCGACGCCAGCGATCCCTATGACAATGAGGGCG
ACGAGGGCAACGAGGACGACGA	AGGCGACGAGGACGACGAGAGCAATGAGGGCAACGAAGGCCCCCAGACCGACGATGAGGATG
ACGAAGGCAACGAAGGCGATGA	AGGCAACGAAGAAATAGAAGGCCAGGAAGACGACGAGGACG
ACGAAGGCGACGAAGGCGACGA	GGATAACGAGTGGGACGAGGATAACGAGGACG
ACGAAGGCGACGAAGCCGACGA	AAACGACGAGGACGACGAAGGCA
ACGAAGGCGACGAAGCCGACGA	GGACGACGAAGACAACGAAGACGACGAAGGCA
ACGAAGGCGACGAAGCCGACGA	AAACGACGAAGACAACGAATTCG
ACGAAGGCGACGAAGGTGACGA	GGGCAACGAGGGCAACGAGGGCGACGAAGACGACGAATTCGACGAGGGCG
ACGAAGGCGACGAAGGCGACGA	GGGCGACGAAGGTAACGAGGGCGACGAGGGCCAGATCGACGGCG
ACGAAGACGACGAAGGCGACGA	AGATGACGAAGCCGACGAAGGTGATGAAGGCGACGAAAGCG
ACGAAGGCAACGAAGGCGACGA	AACCAATCTGAACGACGAAAACGACGAGGGTG
ACGAGGGTAACGAAGGCGACGA	GGACGACGAGTTCGACGAAAACGACGAATTCG
ACGAGGGTAACGAAGGCAACGA	AGGCGACGAAGACGACGAATTCGACGAAGGCG
ACGAGGACGACGAAGGCGACGA	GTCCGACGAAAGCGACGAGCACGACGAAAACGACGAAGGCGACGAAGGCG
ACGAGTACGACGAAGGCGACGA	AGGCGACGAGGCCGAAACCGGCACCGGCGATGACGGTG
ACGAGGGCAATGAAGGTGACGA	AGCCGATATCGACAATCGTGGCGACGAAGGCG
ACGAAAACGACGAAGGTGACGA	AGCCGACGAAGGCGACGAAGCCG
ACGAGCACGACGAAGGTGACGA	AGGCAACGAAGGTGACGAAGCCGACGAAGGCG
ACGAGGACGACGAAGCCGACGA	AGATGACGAAGGCGACGAAGACAACGAAGGTGACGAAGCTG
ACGAAGACGACGAAAACGACGA	GCACGACGAATATGATGAAGGCGACGAATCTGACGAGGACA
ACGAGGACGACGAAGACAACGA	AGGCAATGAAGGCAATGAGAACGACGAGCTCG
ACGAAGGTGACGAAGGCAACGA	GGGCGATGAAAACGACGAAGGCAACGAATTCGATGAAGGCGGCATAGACG
ACGAGGGTGACGAAGGCGACGA	AGACGACGAGGGCGACGAAAACGACGAGGACGACGAAAACA
ACGAAGGCGACGAAGACGACGA	AAACGACGAATACGACGAAGGTGACGAAGCCG
ACGAAGGCGACGAAAACGACGA	AGACGACGAAAACAACGAAGGCGACGAAAACAACGAGGATA
ACGAAAACGACGAAAACGACGA	GTTCGACGAAGAAAACGAAGGCAGCGAAGGCG
ACGAAGACGACGAAGCCGACGA	AGGCGACGAAGACGACGAAGGCGACGAAGCCGACGAGTATGACGAAGGCGACGAAGGCG
ACGAAGACGACGAAGGCGACGA	AAACGACGAGGACGACGAAGGTAACGAAGAAAACGAGGTCCACGACGACAACGACGGCG
ACGAAGGCGACGAAGGCGACGA	AGGCAACGAAGGAGACGAAGGAGACGAAGGCAACGAAGGCAACGAGGGCGACAGCCAGGCCGATGCCAACGAAGGAGATGAGGGAG
ACGAAGACAACGAAGGCAACGA	AGGTGACGAAGGCGACGAAGACGACGAAGGCAATGAAAACGACGAAGGCG
ACGAAGGCGACGAAGGCGACGA

Protein	Signature genes	Signature genes Name	Protein_function
NC_003911.12\|WP_044028256.1\|2124040_2124901_+\|hypothetical-protein	unknown	unknown	unknown
NC_003911.12\|WP_011047724.1\|2119879_2121193_-\|HlyD-family-type-I-secretion-periplasmic-adaptor-subunit	unknown	unknown	gnl\|CDD\|130902
NC_003911.12\|WP_011047725.1\|2121196_2123002_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|226969
NC_003911.12\|WP_011047738.1\|2137025_2137811_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224098
NC_003911.12\|WP_044029214.1\|2135832_2136972_-\|extracellular-solute-binding-protein	unknown	unknown	gnl\|CDD\|270306
NC_003911.12\|WP_011047731.1\|2129836_2130937_-\|FAD-binding-oxidoreductase	unknown	unknown	gnl\|CDD\|223737
NC_003911.12\|WP_044028249.1\|2117629_2118433_-\|DUF2059-domain-containing-protein	unknown	unknown	gnl\|CDD\|378261
NC_003911.12\|WP_011047734.1\|2132434_2133361_-\|3-keto-5-aminohexanoate-cleavage-protein	unknown	unknown	gnl\|CDD\|377562
NC_003911.12\|WP_044028246.1\|2115791_2116403_-\|LysE-family-transporter	unknown	unknown	gnl\|CDD\|224199
NC_003911.12\|WP_011047723.1\|2118432_2119272_-\|DUF2059-domain-containing-protein	unknown	unknown	gnl\|CDD\|378261
NC_003911.12\|WP_044028259.1\|2137810_2138677_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224097
NC_003911.12\|WP_011047730.1\|2129467_2129821_-\|RidA-family-protein	unknown	unknown	gnl\|CDD\|100007
NC_003911.12\|WP_044028254.1\|2123133_2123781_-\|2OG-Fe(II)-oxygenase-family-protein	unknown	unknown	gnl\|CDD\|274145
NC_003911.12\|WP_011047721.1\|2116783_2117365_-\|50S-ribosomal-protein-L21	unknown	unknown	gnl\|CDD\|237034
NC_003911.12\|WP_011047720.1\|2116502_2116772_-\|50S-ribosomal-protein-L27	unknown	unknown	gnl\|CDD\|235464
NC_003911.12\|WP_011047735.1\|2133362_2134694_-\|aspartate-aminotransferase-family-protein	unknown	unknown	gnl\|CDD\|223239
NC_003911.12\|WP_011047733.1\|2131955_2132435_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NC_003911.12\|WP_144083992.1\|2124882_2125641_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224086
NC_003911.12\|WP_011047732.1\|2130933_2131959_-\|histone-deacetylase-family-protein	unknown	unknown	gnl\|CDD\|212525
NC_003911.12\|WP_011047736.1\|2134695_2135772_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|226361

Protein	Function_ID	Function_description	E-value
NC_003911.12\|WP_011047736.1\|2134695_2135772_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|226361	COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism].	6.0852e-153
NC_003911.12\|WP_011047724.1\|2119879_2121193_-\|HlyD-family-type-I-secretion-periplasmic-adaptor-subunit	gnl\|CDD\|130902	TIGR01843, Hemolysin_secretion_protein_D_plasmid, type I secretion membrane fusion protein, HlyD family. Type I secretion is an ABC transport process that exports proteins, without cleavage of any signal sequence, from the cytosol to extracellular medium across both inner and outer membranes. The secretion signal is found in the C-terminus of the transported protein. This model represents the adaptor protein between the ATP-binding cassette (ABC) protein of the inner membrane and the outer membrane protein, and is called the membrane fusion protein. This model selects a subfamily closely related to HlyD; it is defined narrowly and excludes, for example, colicin V secretion protein CvaA and multidrug efflux proteins. [Protein fate, Protein and peptide secretion and trafficking].	5.37001e-81
NC_003911.12\|WP_011047725.1\|2121196_2123002_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|226969	COG4618, ArpD, ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only].	6.49456e-101
NC_003911.12\|WP_011047738.1\|2137025_2137811_-\|ABC-transporter-permease	gnl\|CDD\|224098	COG1177, PotC, ABC-type spermidine/putrescine transport system, permease component II [Amino acid transport and metabolism].	2.19902e-78
NC_003911.12\|WP_011047731.1\|2129836_2130937_-\|FAD-binding-oxidoreductase	gnl\|CDD\|223737	COG0665, DadA, Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism].	3.8868e-43
NC_003911.12\|WP_044028249.1\|2117629_2118433_-\|DUF2059-domain-containing-protein	gnl\|CDD\|378261	pfam09832, DUF2059, Uncharacterized protein conserved in bacteria (DUF2059). This domain, found in various prokaryotic proteins, has no known function.	1.67628e-05
NC_003911.12\|WP_011047734.1\|2132434_2133361_-\|3-keto-5-aminohexanoate-cleavage-protein	gnl\|CDD\|377562	pfam05853, BKACE, beta-keto acid cleavage enzyme. BKACE, beta-keto acid cleavage enzyme plays, a role in lysine degradation. In certain instances it catalyzes the conversion of 3-keto-5-aminohexanoate and acetyl-CoA into acetoacetate and 3-aminobutyryl-CoA. The family is found to have at least 14 slightly different potential new enzymatic activities, all of which can therefore be designated as beta-keto acid cleavage enzymes.	4.97585e-140
NC_003911.12\|WP_044028246.1\|2115791_2116403_-\|LysE-family-transporter	gnl\|CDD\|224199	COG1280, RhtB, Putative threonine efflux protein [Amino acid transport and metabolism].	1.58236e-17
NC_003911.12\|WP_011047723.1\|2118432_2119272_-\|DUF2059-domain-containing-protein	gnl\|CDD\|378261	pfam09832, DUF2059, Uncharacterized protein conserved in bacteria (DUF2059). This domain, found in various prokaryotic proteins, has no known function.	6.60758e-08
NC_003911.12\|WP_044028259.1\|2137810_2138677_-\|ABC-transporter-permease	gnl\|CDD\|224097	COG1176, PotB, ABC-type spermidine/putrescine transport system, permease component I [Amino acid transport and metabolism].	3.25261e-82
NC_003911.12\|WP_011047730.1\|2129467_2129821_-\|RidA-family-protein	gnl\|CDD\|100007	cd06150, YjgF_YER057c_UK114_like_2, This group of proteins belong to a large family of YjgF/YER057c/UK114-like proteins present in bacteria, archaea, and eukaryotes with no definitive function. The conserved domain is similar in structure to chorismate mutase but there is no sequence similarity and no functional connection. Members of this family have been implicated in isoleucine (Yeo7, Ibm1, aldR) and purine (YjgF) biosynthesis, as well as threonine anaerobic degradation (tdcF) and mitochondrial DNA maintenance (Ibm1). This domain homotrimerizes forming a distinct intersubunit cavity that may serve as a small molecule binding site.	2.11011e-55
NC_003911.12\|WP_044028254.1\|2123133_2123781_-\|2OG-Fe(II)-oxygenase-family-protein	gnl\|CDD\|274145	TIGR02466, hypothetical_protein_predicted_by_Glimmer/Critica, conserved hypothetical protein. This family consists of uncharacterized proteins in Caulobacter crescentus CB15, Bdellovibrio bacteriovorus HD100, Synechococcus sp. WH 8102, Silicibacter pomeroyi DSS-3, and Hyphomonas neptunium ATCC 15444. The context of nearby genes differs substantially between members and does point to any specific biological role. [Hypothetical proteins, Conserved].	1.28452e-101
NC_003911.12\|WP_011047721.1\|2116783_2117365_-\|50S-ribosomal-protein-L21	gnl\|CDD\|237034	PRK12278, PRK12278, 50S ribosomal protein L21.	1.0537e-70
NC_003911.12\|WP_011047720.1\|2116502_2116772_-\|50S-ribosomal-protein-L27	gnl\|CDD\|235464	PRK05435, rpmA, 50S ribosomal protein L27; Validated.	3.0349e-50
NC_003911.12\|WP_011047735.1\|2133362_2134694_-\|aspartate-aminotransferase-family-protein	gnl\|CDD\|223239	COG0161, BioA, Adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Coenzyme metabolism].	9.49251e-172
NC_003911.12\|WP_011047733.1\|2131955_2132435_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	3.07342e-10
NC_003911.12\|WP_144083992.1\|2124882_2125641_+\|hypothetical-protein	gnl\|CDD\|224086	COG1164, COG1164, Oligoendopeptidase F [Amino acid transport and metabolism].	1.29624e-06
NC_003911.12\|WP_011047732.1\|2130933_2131959_-\|histone-deacetylase-family-protein	gnl\|CDD\|212525	cd10001, HDAC_classII_APAH, Histone deacetylase class IIa. This subfamily includes bacterial acetylpolyamine amidohydrolase (APAH) as well as other Class II histone deacetylase (HDAC) and related proteins. Deacetylases of class II are Zn-dependent enzymes that catalyze hydrolysis of N(6)-acetyl-lysine residues of histones (EC 3.5.1.98) and possibly other proteins to yield deacetylated histones/other proteins. Mycoplana ramosa APAH exhibits broad substrate specificity and catalyzes the deacetylation of polyamines such as putrescine, spermidine, and spermine by cleavage of a non-peptide amide bond.	3.9928e-144
NC_003911.12\|WP_044029214.1\|2135832_2136972_-\|extracellular-solute-binding-protein	gnl\|CDD\|270306	cd13588, PBP2_polyamine_1, The periplasmic-binding component of an uncharacterized ABC transporter involved in uptake of polyamines; contains the type 2 periplasmic binding fold. This group represents the periplasmic binding domain that functions as the primary high-affinity receptor of an uncharactertized ABC-type polyamine transport system. Polyamine transport plays an essential role in the regulation of intracellular polyamine levels which are known to be elevated in rapidly proliferating cells and tumors. Natural polyamines are putrescine, spermindine, and spermine. They are polycations that play multiple roles in cell growth, survival and proliferation, and plant stress and disease resistance. They can interact with negatively charged molecules, such as nucleic acids, to modulate their functions. Members of this family belong to the type 2 periplasmic-binding fold superfamily. PBP2 is comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	1.61424e-70

>NC_003911.12|WP_144083992.1|2124882_2125641_+|hypothetical-protein
MRGTEVSSKPASTIAGWLQLNELTAGQCETLLKLAPRSLPGTGQDRQVPSPDGPALWALAADCLSETLPELASDILRTASQTRVDFAPDPRNYPRPFTLHMPVDGQVYVSCPLAGTPWDALTVAHEFGHALQLNCCSGVQLPPVLRETAAFVAEAVVAGALALRDTPLADPVCRAYARRTLTDLGPIAKRLRAALACPDTPYDDCWNYPPARQIAQALTQGDRPLRTGIAASVFRGDAQLGALVSLLCSDAE
>NC_003911.12|WP_044028256.1|2124040_2124901_+|hypothetical-protein
MTHPLRPAAPDHPARRRVHAALHNRFRNAAAALFCLCALPAVAQQRPPPFDNTAGTVFDIIRADDPTTFVCLDELGRAERQIWDKRVDGEPVVLAYLFQSQYADGTSIEIAINPEFGSDEMAREQAELYAPALGRLPTALRAGIKRFSVHEGRRGYHAGTGGIVVYAQTTENRLSYDHLEESLFHEAVHASWDRDHRLAPEWIAAQQSDGMFLTRYGQKSPEREDLAETALFAFAILHHPDRFPPVDTQVTRHAVPARIAYVAELLPVDRPLIWQIGPPQGCAAQK
>NC_003911.12|WP_044028254.1|2123133_2123781_-|2OG-Fe(II)-oxygenase-family-protein
MSQKDLGFVRRSYFPTMIFQIDVPEPEDLNKKLLASIYAERERDKKGISRSNIPALGGWHSHNDLYKSKEYAELVGLIGQATSKMSEDLGYADSHTIRIGTMWSIINPPGCVNRAHVHPGCLWSGVYYIQAPENCGNIEFIEPRTVHLMNQAKFQPNKKRSRENWTKVRYTPVAGRMIIFPAWLYHAVDPNETKETGDAGNRVIISFNLNQVKKS
>NC_003911.12|WP_011047725.1|2121196_2123002_-|ATP-binding-cassette-domain-containing-protein
MNSAKALRGSARRAVRKGGLILSAAFLLSFAVNLLRLGGPFFMILVYDRVLTSRSMETLIALFSLLIVLLLVLGTLDYARKRLLARFGAQFQEQMEETLLRNSGRNHVFQHNKSKPAVGLDEVDGLRGFFHSGSLIAVFDFIWTPMFLTVVFFLHPLLGWACLGGVAVIGLLALAKAMFIGGRRERAKDSAGAVNNLRNILIASRETVRGQDMGVGFRPRWQQAREDARDEAIALKDWTGWFDSMSKVTVMVVRYSVLATGAYLTLNGALTVGVMVAATFMVTRILGPVDRFFTQIPQMFLARDHWRHLNSILASRAEELEDDYAEQPGALHQLVLDNVSVRSPITNNLILRSVSLVADAGEIIEINGLSSQGKTVLLETILGMWSTSSGSVLVEGRHSSRLTDTDARNLFGYAPDNPGFVAGTIEENISGLDPEATPDKVSLAARRARMHAAISSLPEGYKTRLDPRGNCLSSFERYQLGLARAFYGDPKLLLIDGLDSDMLVRIPKKLKATFDAFKKSGTTIILTSRDPSGLSNVDRRFQLQDGKLTLMPKAANSKRRVTEENGAESAAERPDAERSKRPNVSVLRNVNAQDPGKTGTR
>NC_003911.12|WP_011047724.1|2119879_2121193_-|HlyD-family-type-I-secretion-periplasmic-adaptor-subunit
MADPKSKRRTWTTGRPFAVTVFSLIFLLGCLAVWSTRANISGAVIGSGTIEVSTTMTAVQHPIGGVVSEINVRNGDRVRAGDILVQLDSRQFHSDLNVVEGELFEVLANIARLQAIMDNRRQMELTPVLAEAVQTKPEVKLLVERQQQQLTAHFEAITSGMHLLDEQITQVRAEIAGVEAQLAAKLDEIDLLSLEIENAEQLAERKLITMSELYKLKKDDVTIRGEIGQNEAKIAELRGKISELNLKRLVVIPDAQEKAEEELRKLRPLRVRFMEMRLSLLDDLSKLEIRAPVNGKIHESQVQGRRSVITAAKPLMMIVPDDDPYQIGVRIAAADIDQVFIGQEASIKFRAFNARDLPIILGSVSRISPDVTLDPLTKKYHYEVKVALNAGEEAKLNGRELLPGMPVEAYIATESRTAINYVVRPIKRFFDRALRDT
>NC_003911.12|WP_011047723.1|2118432_2119272_-|DUF2059-domain-containing-protein
MTRLFRGALPLVLGSLFLVLALALPLRAADRARIEAFLVTTGFDVALDSIAQASASAPGMLGLEAESFGSQWTTLTREVFDTGVMRGRALDILEQTLSDTALDHAVGFYASDLGQRLVVAENAAHMADDDLKEEAGEAIVSELVRHGSTRIESLKRMNRAIDSSGTALRALQEIQLRFLLAASAAGVIELQMETEDLRELLRSNETEMRNALQLSALASAAYTYQAFSDHEVDTYTEALEQPLMQEVYELLNAVQYSIMADRFEVLAVRMADLQPVQDL
>NC_003911.12|WP_044028249.1|2117629_2118433_-|DUF2059-domain-containing-protein
MRRGGVVLCLWLAAPVAAEQPFDDLARAMRLDEVVAILRDEGLGYGATLDAEFLGGSGGAFFTAQVDRIYAPDRMQAALSGALADHLDTEQAAAATAFFRTETGQAILTLENSARRAFADDGIEEMALERAERAGEDDTRLRQVAAYVAANDLVGQNVKGAISADFQFYRGLSDGQDLDRDDGAVLASLLEARDETEAETRRWVMGFLYFAYAPLEDAQMQANIDFSQSAAGQALNAALFDGFDRLYGEISYDLGRAVGFALKASDI
>NC_003911.12|WP_011047721.1|2116783_2117365_-|50S-ribosomal-protein-L21
MFAVLKTGGKQYKVQAGDVLRVEKLAADAGEKVQFNDVLMLGGDAPVVGAPLVDGAAVQAEVIDQIKGEKLIHFVKRRRKHSSQRTKGHRQKLTLVRITEILTSGADKTGVKAATGQAAAGAAAPAAAAPAAAGSDDLTKITGVGPAAAKKLVEAGIGSFAALAALSDEQIAAIDAVKVKPEWVEQAKELAQG
>NC_003911.12|WP_011047720.1|2116502_2116772_-|50S-ribosomal-protein-L27
MAHKKAGGSSRNGRDSIGRRLGVKKYGGEAVGAGNILVRQRGTKFWPGEGVGMGKDHTIFATVDGAVKFHKGLKKRTFISVLPVAEAAE
>NC_003911.12|WP_044028246.1|2115791_2116403_-|LysE-family-transporter
MAVATTSFLLFAAAQVGTPGPANMALLATGARYGFRAALPFVAGVALGKQLVIWPVGFGLMELADRVPLLFQALKYLCVAYICWLAWKIANLRLAPGGGGDGAAPGFGAGLLVHPLNPKAWAMIVTGFAGFVAPGTAAFQATLTVALGLLACQAVFHPLWTFAGDRIAAVVAGRPGEKYLMWMLAGLTVASVIFGVFGGGAQK
>NC_003911.12|WP_011047730.1|2129467_2129821_-|RidA-family-protein
MTDITRHHTGTRMSQIVIHGDTVYLAGQVGTAGASVAQQTQDCLNQIDALLSEAGSDRTRILQTTIWLADMADFAEMNAVWDSWVPAGHAPARACGEARLATPDYRVEFIVTAARAD
>NC_003911.12|WP_011047731.1|2129836_2130937_-|FAD-binding-oxidoreductase
MKTSDVLVIGGGIAGISAAAELAAHMSVCVLEAETVPGYHATGRSAAIFIRNYGNATLRALNAASAPFLAAPDGIGTDSLLSPRGEMLIATEDELDALDAYSAGATGLEALTPDQAVELVPILCRELIAGAIIEWDAQDIDVDRMLAGYGRLLRARGGQTVTGARVEGMRRKAGVWTVRAGDTDYQAPLVVNAAGAWADGVAGLAGLAPLGLQPMRRSAALLPAPAGHDIRTWPLFASAAEQWYAKPEAGKLMVSPADEDPVEPHDAWAEDMVLAEGLHRYEQAVTHQVTRVERTWAGLRTFAPDRSPVVGFDPRAEGLFWLAGQGGYGIQTAPGLSRLAAALVAGERVVLDTDTVAALCPARFFT
>NC_003911.12|WP_011047732.1|2130933_2131959_-|histone-deacetylase-family-protein
MKAVFDTRQWRHDPQHFMANGAVLPNPEQPRRIEVLRAGAEAAGCVFAAPGDAGLGPIAALHSPEYLTFLQTIHARWRRIPGAGAEVIPNIHPGARTDGYPKSAVGQAGYHQADTACPIAEGTWEAAYWSAQSAITGADLIIQGERSAYVLSRPPGHHAFGDLAGGFCFLNNSAIAAERLRAAGLRPAILDIDVHHGNGTQGIFYERDDVLTVSIHADPARFYPFFWGHAQERGAGRGLGYNLNLPLARGTGDDDYLDTLSVALRQVASFGSRVLVVALGLDASIDDPFQGLAITQDGFARIGAALAGTRVPVLFVQEGGYLCDSLGDTLTRVLTGFQEAL
>NC_003911.12|WP_011047733.1|2131955_2132435_-|GNAT-family-N-acetyltransferase
MDLVLRIAQQADAAALNRALQRLSDDLGDRHRARPVDLEQAGWGAMPAFRAVLAEQAGEIQGVALYSPLFSTTQGGAGLYVSDLWSAPQLRGQRIGTRLLAAALADGRQLWGARFLKLCVYDTSARARRFYDHLGFVSAGGQSNLILDEAGCAALRGEE
>NC_003911.12|WP_011047734.1|2132434_2133361_-|3-keto-5-aminohexanoate-cleavage-protein
MSRILITCAITGSIHTPSMSPYLPVTADEITQQAVDAADAGAAILHLHARDPETGRPSAEIGHFMGFLPRIKQSCEAVLNLSTGGSAVMTLDQRLAAPKQAAPEMCSLNMGTMNFALYPAADRISDWKHDWEEPFLRGSDDLVFKNTPRDMALILGEMGTKRGARFEFEVYDVGHLYMLRHFVDRGLVQGPLFIQFVFGVLGGIGPDPENLMHMKTVADKLFGQDYLFSVLAAGRHQIPLVTMAAAMGGHVRVGLEDSLMISRGVLARSNAEQVRKIRRIVEDLGREVASPGEARAMLGLKGADRTAF
>NC_003911.12|WP_011047735.1|2133362_2134694_-|aspartate-aminotransferase-family-protein
MSHLFYQGRGRKPVLDQARGVYMWDKDGKRYLDGSSGAMVCNIGHSNPNVLAAMQRQMEKSTFGYRLHFETEASEKLASKLAALAPGGLDKVFFVSGGSEAVESALKLARQYMNATGQGSRWKVISRQPSYHGSTLGALAVTGYTPLSAPFEPMLRQMPKIPAPRAYLDGRDPRDPASGHHYANMLASAIEAEGPETVAAFIVEPVGGASTGALVPPAGYMERIREICDRYGILMIADEVMTGAGRTGRFLGSDHWNARPDIIVMSKGLGAGYVPLGAMIADARLVEPVLDAGGFAHGYTYAGNPLACAAGLAVVEEIEGQALCANADRMGERLLARLRGLMQKHEVIGDVRGMGLLTAFELMSDRDSKAPLPKGLNAYQRLVDIAYDKGLIVYSRRTRDGIEGDHILVCPPLIVTDDHLDEIIEGLDAALSQFADEIAGTAG
>NC_003911.12|WP_011047736.1|2134695_2135772_-|ABC-transporter-ATP-binding-protein
MSSVTLSNIVKRFGEFTAVHPTNLDIPEGAFVTLLGPSGCGKTTNLRMIAGLLDPTEGEILIGGRRVNDVPIHRRNLGIVFQNYALFPHKTVAENVAFGLKYRDGPRAAIAGKVQAALDLVQLPDVGNRYPKELSGGQQQRIALARAIVIEPDVLLLDEPLSALDANLREDMRVELKRIQHQIGVTTVFVTHDQSEALAMSDKIVVMSAGRVEQVGTPSEVYNTPASEFVANFLGASNILTADCIRVDGQGAMLEVPLFGRVPVASTKAAGVSQGAAKLVLRAEKLTLYDTSADTSALVTAPATVETVDYQGQTVRYFVRVAQTQLQAINMIDERPFAEGSTVTVGFRPQDCAALQGV
>NC_003911.12|WP_044029214.1|2135832_2136972_-|extracellular-solute-binding-protein
MDNTTRYERLRERYMNGDIDRRGFLGLLGAAGLAYGVQSPFARYAHAAADQVRFDGWGGVVSEAFRKFAFDPYTAKTGIQVVDGTFGGGDEYLSRVKASQPGEYNIAHLSGVFDYARYHGLGLTSELNEANIPNLGLVIPKLVDVFRGVTGGKLSCVPYDYGTTGLAYNRKHISDDQMQEMGAKILIDDSLKGKIGGWSDWRTRMWYAALQTGQDPNGVTDEEAAWDAVRAHRDLALKYWTSGAELMSLLAEEEIYVTEGWSGRIYALQEQGHDIGYMDPPNGFGWQECLFVIKGSPMEACEELLNFMLAPETSIAVAEGQNYPTALDPTKVDLGDKIPTLPAFDPTGTLSGLTFADPDYWNGHEAEWSKTFGRVQKGY
>NC_003911.12|WP_011047738.1|2137025_2137811_-|ABC-transporter-permease
MGWHLIRAWSIGVYIFMFLPVAVVVLLSFNASQFGSFPMTGFSLRWFLELWNNEAILRAFRTSLVLGLMTALISTTLGVLASLALVRYKVPGANLISTLLIAPILVPEVVLAVALLLFLNFLGVNKSFGLLLFGHVIFTLPFVILVVQARLVSIKRDIEEAAMSLGATPIQTFFQITLPLMMPAVLAGGLFAFTISFDDITGTLFWKPGGVETVPTQIFAMLRNSISPEINALGTVMIVMTVGLPLLGAAIARQLARKRGT
>NC_003911.12|WP_044028259.1|2137810_2138677_-|ABC-transporter-permease
MSIETREARQPWILLSPALTAIMLLLFVPLSFIVVYSFWLRTATGADQVGFYLDNWAEALSDRFYRDILFSTLRIAAITTAVCALMGYPAAYFIARSKGNKAILLLLLMLPFWISYIIRTMSWINILGVSGAFNSVLISLGVISEPIQMLYNETTVILGLVHFLLPFMVLNIYVSLDGIDTNLEAAANSLGATKWQSFLQVTLPLSLPGLAAGGLLCFVLGAGTYITPLVLGGPRDAMFANLVFEAIITQLNWPLGSALSLMLLAVLGALVMIYNRYLGMAQLMKGLG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NC_003911_1	1.10\|2126833\|23\|NC_003911\|CRT	2126833-2126855	23	NC_006569.1	457002-457024	2	0.913
NC_003911_1	1.10\|2126833\|23\|NC_003911\|CRT	2126833-2126855	23	NC_006569.1	457989-458011	2	0.913
NC_003911_1	1.12\|2126935\|23\|NC_003911\|CRT	2126935-2126957	23	NC_006569.1	456984-457006	2	0.913
NC_003911_1	1.12\|2126935\|23\|NC_003911\|CRT	2126935-2126957	23	NC_006569.1	457674-457696	2	0.913
NC_003911_1	1.12\|2126935\|23\|NC_003911\|CRT	2126935-2126957	23	NC_006569.1	457944-457966	2	0.913
NC_003911_1	1.18\|2127316\|23\|NC_003911\|CRT	2127316-2127338	23	NC_006569.1	458187-458209	2	0.913
NC_003911_1	1.30\|2128009\|23\|NC_003911\|CRT	2128009-2128031	23	NC_006569.1	457608-457630	2	0.913
NC_003911_1	1.30\|2128009\|23\|NC_003911\|CRT	2128009-2128031	23	NC_006569.1	457674-457696	2	0.913
NC_003911_1	1.30\|2128009\|23\|NC_003911\|CRT	2128009-2128031	23	NC_006569.1	458277-458299	2	0.913

1. spacer 1.10|2126833|23|NC_003911|CRT matches to position: 457002-457024, mismatch: 2, identity: 0.913

agacgacgaaggcaacgaggaca	CRISPR spacer
aggcgacgaaggcaacgagggca	Protospacer
**.*****************.**

2. spacer 1.10|2126833|23|NC_003911|CRT matches to position: 457989-458011, mismatch: 2, identity: 0.913

agacgacgaaggcaacgaggaca	CRISPR spacer
agaggacgaaggcaacgaagaca	Protospacer
*** **************.****

3. spacer 1.12|2126935|23|NC_003911|CRT matches to position: 456984-457006, mismatch: 2, identity: 0.913

agacaacgaaggcaacgaaggcg	CRISPR spacer
agacgacgagggcaacgaaggcg	Protospacer
****.****.*************

4. spacer 1.12|2126935|23|NC_003911|CRT matches to position: 457674-457696, mismatch: 2, identity: 0.913

agacaacgaaggcaacgaaggcg	CRISPR spacer
agccgacgaaggcaacgaaggcg	Protospacer
** *.******************

5. spacer 1.12|2126935|23|NC_003911|CRT matches to position: 457944-457966, mismatch: 2, identity: 0.913

agacaacgaaggcaacgaaggcg	CRISPR spacer
agccaacgaaggcaacgagggcg	Protospacer
** ***************.****

6. spacer 1.18|2127316|23|NC_003911|CRT matches to position: 458187-458209, mismatch: 2, identity: 0.913

aaacgacgaggacgacgaaggca	CRISPR spacer
aaacaacgagggcgacgaaggca	Protospacer
****.******.***********

7. spacer 1.30|2128009|23|NC_003911|CRT matches to position: 457608-457630, mismatch: 2, identity: 0.913

agccgacgaaggcgacgaagccg	CRISPR spacer
agctgacgaaggcgacgaaggcg	Protospacer
***.**************** **

8. spacer 1.30|2128009|23|NC_003911|CRT matches to position: 457674-457696, mismatch: 2, identity: 0.913

agccgacgaaggcgacgaagccg	CRISPR spacer
agccgacgaaggcaacgaaggcg	Protospacer
*************.****** **

9. spacer 1.30|2128009|23|NC_003911|CRT matches to position: 458277-458299, mismatch: 2, identity: 0.913

agccgacgaaggcgacgaagccg	CRISPR spacer
agacgacgaaggcgacgaagacg	Protospacer
** ***************** **

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_003911_1	1.10\|2126833\|23\|NC_003911\|CRT	2126833-2126855	23	NC_006569	Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence	458232-458254	2	0.913
NC_003911_1	1.10\|2126833\|23\|NC_003911\|CRT	2126833-2126855	23	NC_006569	Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence	458250-458272	2	0.913
NC_003911_1	1.10\|2126833\|23\|NC_003911\|CRT	2126833-2126855	23	NC_006569	Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence	457002-457024	2	0.913
NC_003911_1	1.10\|2126833\|23\|NC_003911\|CRT	2126833-2126855	23	NC_006569	Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence	457989-458011	2	0.913
NC_003911_1	1.10\|2126833\|23\|NC_003911\|CRT	2126833-2126855	23	MT012730	Salmonella phage vB_SenM-1, complete genome	24762-24784	2	0.913
NC_003911_1	1.10\|2126833\|23\|NC_003911\|CRT	2126833-2126855	23	NC_048763	Salmonella phage SE13, complete genome	12252-12274	2	0.913
NC_003911_1	1.10\|2126833\|23\|NC_003911\|CRT	2126833-2126855	23	NZ_CP025552	Streptomyces rimosus strain WT5260 plasmid unnamed, complete sequence	269440-269462	2	0.913
NC_003911_1	1.10\|2126833\|23\|NC_003911\|CRT	2126833-2126855	23	MT936332	Streptomyces phage phiRKBJ001, complete genome	3674-3696	2	0.913
NC_003911_1	1.12\|2126935\|23\|NC_003911\|CRT	2126935-2126957	23	NZ_CP013104	Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence	552734-552756	2	0.913
NC_003911_1	1.12\|2126935\|23\|NC_003911\|CRT	2126935-2126957	23	NC_006569	Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence	456984-457006	2	0.913
NC_003911_1	1.12\|2126935\|23\|NC_003911\|CRT	2126935-2126957	23	NC_006569	Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence	457674-457696	2	0.913
NC_003911_1	1.12\|2126935\|23\|NC_003911\|CRT	2126935-2126957	23	NC_006569	Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence	457944-457966	2	0.913
NC_003911_1	1.18\|2127316\|23\|NC_003911\|CRT	2127316-2127338	23	NC_023606	Mycobacterium phage CRB1, complete genome	49459-49481	2	0.913
NC_003911_1	1.18\|2127316\|23\|NC_003911\|CRT	2127316-2127338	23	KT588442	Mycobacterium phage LadyBird, complete genome	49604-49626	2	0.913
NC_003911_1	1.18\|2127316\|23\|NC_003911\|CRT	2127316-2127338	23	NC_030916	Tsukamurella phage TPA4, complete genome	38348-38370	2	0.913
NC_003911_1	1.18\|2127316\|23\|NC_003911\|CRT	2127316-2127338	23	NC_006569	Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence	458187-458209	2	0.913
NC_003911_1	1.18\|2127316\|23\|NC_003911\|CRT	2127316-2127338	23	MK284521	Gordonia phage Kiko, complete genome	41513-41535	2	0.913
NC_003911_1	1.20\|2127415\|23\|NC_003911\|CRT	2127415-2127437	23	NZ_CP054028	Rhizobium sp. JKLM19E plasmid pPR19E01, complete sequence	588859-588881	2	0.913
NC_003911_1	1.30\|2128009\|23\|NC_003911\|CRT	2128009-2128031	23	NZ_CP017076	Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence	233311-233333	2	0.913
NC_003911_1	1.30\|2128009\|23\|NC_003911\|CRT	2128009-2128031	23	NZ_LR134446	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 4, complete sequence	67783-67805	2	0.913
NC_003911_1	1.30\|2128009\|23\|NC_003911\|CRT	2128009-2128031	23	NZ_CP032615	Pseudomonas sp. DY-1 plasmid p.1, complete sequence	1288-1310	2	0.913
NC_003911_1	1.30\|2128009\|23\|NC_003911\|CRT	2128009-2128031	23	NZ_CP032615	Pseudomonas sp. DY-1 plasmid p.1, complete sequence	14058-14080	2	0.913
NC_003911_1	1.30\|2128009\|23\|NC_003911\|CRT	2128009-2128031	23	MT081181	Uncultured bacterium plasmid pCu_H_1, complete sequence	4324-4346	2	0.913
NC_003911_1	1.30\|2128009\|23\|NC_003911\|CRT	2128009-2128031	23	NZ_CP025015	Rhizobium leguminosarum strain Norway plasmid pRLN3, complete sequence	85309-85331	2	0.913
NC_003911_1	1.30\|2128009\|23\|NC_003911\|CRT	2128009-2128031	23	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	1769320-1769342	2	0.913
NC_003911_1	1.30\|2128009\|23\|NC_003911\|CRT	2128009-2128031	23	NC_023285	Streptomyces sp. F8 plasmid pFRL5, complete sequence	37039-37061	2	0.913
NC_003911_1	1.30\|2128009\|23\|NC_003911\|CRT	2128009-2128031	23	NC_006569	Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence	457608-457630	2	0.913
NC_003911_1	1.30\|2128009\|23\|NC_003911\|CRT	2128009-2128031	23	NC_006569	Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence	457674-457696	2	0.913
NC_003911_1	1.30\|2128009\|23\|NC_003911\|CRT	2128009-2128031	23	NC_006569	Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence	458277-458299	2	0.913
NC_003911_1	1.30\|2128009\|23\|NC_003911\|CRT	2128009-2128031	23	NZ_CP015881	Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence	998736-998758	2	0.913
NC_003911_1	1.30\|2128009\|23\|NC_003911\|CRT	2128009-2128031	23	NZ_CP023068	Ensifer sojae CCBAU 05684 plasmid pSJ05684b, complete sequence	684571-684593	2	0.913
NC_003911_1	1.10\|2126833\|23\|NC_003911\|CRT	2126833-2126855	23	NZ_CP030864	Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence	464704-464726	3	0.87
NC_003911_1	1.18\|2127316\|23\|NC_003911\|CRT	2127316-2127338	23	NZ_CP011869	Pseudonocardia sp. HH130629-09 plasmid pLS1-1, complete sequence	61777-61799	3	0.87
NC_003911_1	1.18\|2127316\|23\|NC_003911\|CRT	2127316-2127338	23	NC_006569	Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence	457506-457528	3	0.87
NC_003911_1	1.18\|2127316\|23\|NC_003911\|CRT	2127316-2127338	23	NC_006569	Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence	458376-458398	3	0.87
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	FJ168661	Mycobacterium phage Gumball, complete genome	46433-46464	3	0.906
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	JF937107	Mycobacterium phage SirHarley, complete genome	46416-46447	3	0.906
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MH834615	Mycobacterium phage KandZ, complete genome	46105-46136	3	0.906
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	KP790011	Gordonia phage Gsput1, complete genome	5585-5616	3	0.906
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	DQ398051	Mycobacterium phage PLot, complete genome	45974-46005	3	0.906
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	JN699014	Mycobacterium phage Nova, complete genome	46444-46475	3	0.906
NC_003911_1	1.20\|2127415\|23\|NC_003911\|CRT	2127415-2127437	23	NZ_CP020900	Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5d, complete sequence	256742-256764	3	0.87
NC_003911_1	1.20\|2127415\|23\|NC_003911\|CRT	2127415-2127437	23	NZ_CP013536	Rhizobium phaseoli strain R650 plasmid pRphaR650d, complete sequence	724246-724268	3	0.87
NC_003911_1	1.20\|2127415\|23\|NC_003911\|CRT	2127415-2127437	23	NZ_CP048283	Rhizobium leguminosarum bv. viciae 248 plasmid pRle248c, complete sequence	269676-269698	3	0.87
NC_003911_1	1.20\|2127415\|23\|NC_003911\|CRT	2127415-2127437	23	NZ_CP013526	Rhizobium phaseoli strain R744 plasmid pRphaR744d, complete sequence	178857-178879	3	0.87
NC_003911_1	1.20\|2127415\|23\|NC_003911\|CRT	2127415-2127437	23	NZ_CP013556	Rhizobium phaseoli strain N931 plasmid pRphaN931d, complete sequence	178856-178878	3	0.87
NC_003911_1	1.20\|2127415\|23\|NC_003911\|CRT	2127415-2127437	23	NZ_CP013589	Rhizobium phaseoli strain N161 plasmid pRphaN161d, complete sequence	176225-176247	3	0.87
NC_003911_1	1.20\|2127415\|23\|NC_003911\|CRT	2127415-2127437	23	NZ_CP013562	Rhizobium phaseoli strain N841 plasmid pRphaN841e, complete sequence	178857-178879	3	0.87
NC_003911_1	1.20\|2127415\|23\|NC_003911\|CRT	2127415-2127437	23	NZ_CP013579	Rhizobium phaseoli strain N671 plasmid pRphaN671e, complete sequence	179506-179528	3	0.87
NC_003911_1	1.20\|2127415\|23\|NC_003911\|CRT	2127415-2127437	23	NZ_CP007050	Rhizobium leguminosarum bv. trifolii WSM1689 plasmid unnamed, complete sequence	184301-184323	3	0.87
NC_003911_1	1.20\|2127415\|23\|NC_003911\|CRT	2127415-2127437	23	NZ_CP013531	Rhizobium phaseoli strain R723 plasmid pRphaR723d, complete sequence	177349-177371	3	0.87
NC_003911_1	1.20\|2127415\|23\|NC_003911\|CRT	2127415-2127437	23	NZ_CP013541	Rhizobium phaseoli strain R630 plasmid pRphaR630d, complete sequence	182788-182810	3	0.87
NC_003911_1	1.20\|2127415\|23\|NC_003911\|CRT	2127415-2127437	23	NZ_CP013546	Rhizobium phaseoli strain R620 plasmid pRphaR620d, complete sequence	189537-189559	3	0.87
NC_003911_1	1.20\|2127415\|23\|NC_003911\|CRT	2127415-2127437	23	NZ_CP013567	Rhizobium phaseoli strain N831 plasmid pRphaN831d, complete sequence	178856-178878	3	0.87
NC_003911_1	1.20\|2127415\|23\|NC_003911\|CRT	2127415-2127437	23	NZ_CP013584	Rhizobium phaseoli strain N261 plasmid pRphaN261d, complete sequence	177349-177371	3	0.87
NC_003911_1	1.20\|2127415\|23\|NC_003911\|CRT	2127415-2127437	23	NZ_CP013573	Rhizobium phaseoli strain N771 plasmid pRphaN771e, complete sequence	179506-179528	3	0.87
NC_003911_1	1.20\|2127415\|23\|NC_003911\|CRT	2127415-2127437	23	NC_010997	Rhizobium etli CIAT 652 plasmid pC, complete sequence	170068-170090	3	0.87
NC_003911_1	1.20\|2127415\|23\|NC_003911\|CRT	2127415-2127437	23	NZ_CP030829	Neorhizobium sp. NCHU2750 plasmid pNCHU2750b, complete sequence	252768-252790	3	0.87
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP049157	Caballeronia sp. SBC1 plasmid pSBC1_1, complete sequence	438005-438036	3	0.906
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP049317	Caballeronia sp. SBC2 plasmid pSBC2-1, complete sequence	1204659-1204690	3	0.906
NC_003911_1	1.30\|2128009\|23\|NC_003911\|CRT	2128009-2128031	23	NC_010494	Arthrobacter sp. AK-1 plasmid pSI-1, complete sequence	38037-38059	3	0.87
NC_003911_1	1.30\|2128009\|23\|NC_003911\|CRT	2128009-2128031	23	NZ_AP014579	Burkholderia sp. RPE67 plasmid p1, complete sequence	934307-934329	3	0.87
NC_003911_1	1.30\|2128009\|23\|NC_003911\|CRT	2128009-2128031	23	NC_016626	Burkholderia sp. YI23 plasmid byi_1p, complete sequence	790152-790174	3	0.87
NC_003911_1	1.30\|2128009\|23\|NC_003911\|CRT	2128009-2128031	23	NC_021910	Rhizobium etli bv. mimosae str. Mim1 plasmid pRetNIM1c, complete sequence	204319-204341	3	0.87
NC_003911_1	1.36\|2128360\|41\|NC_003911\|CRT	2128360-2128400	41	NC_006569	Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence	458151-458191	3	0.927
NC_003911_1	1.10\|2126833\|23\|NC_003911\|CRT	2126833-2126855	23	NZ_AP022319	Burkholderia sp. THE68 plasmid BTHE68_p1, complete sequence	142597-142619	4	0.826
NC_003911_1	1.10\|2126833\|23\|NC_003911\|CRT	2126833-2126855	23	MN693896	Marine virus AFVG_250M448, complete genome	8468-8490	4	0.826
NC_003911_1	1.12\|2126935\|23\|NC_003911\|CRT	2126935-2126957	23	NC_006569	Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence	456930-456952	4	0.826
NC_003911_1	1.18\|2127316\|23\|NC_003911\|CRT	2127316-2127338	23	NZ_CP025188	Roseomonas mucosa strain AD2 plasmid p1-AD2, complete sequence	55444-55466	4	0.826
NC_003911_1	1.18\|2127316\|23\|NC_003911\|CRT	2127316-2127338	23	NZ_CP024582	Roseomonas sp. FDAARGOS_362 plasmid unnamed1, complete sequence	371867-371889	4	0.826
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	FJ168661	Mycobacterium phage Gumball, complete genome	46442-46473	4	0.875
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	FJ168661	Mycobacterium phage Gumball, complete genome	46451-46482	4	0.875
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	FJ168661	Mycobacterium phage Gumball, complete genome	46460-46491	4	0.875
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	FJ168661	Mycobacterium phage Gumball, complete genome	46469-46500	4	0.875
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	JF937107	Mycobacterium phage SirHarley, complete genome	46425-46456	4	0.875
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	JF937107	Mycobacterium phage SirHarley, complete genome	46434-46465	4	0.875
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	JF937107	Mycobacterium phage SirHarley, complete genome	46443-46474	4	0.875
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	JF937107	Mycobacterium phage SirHarley, complete genome	46452-46483	4	0.875
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MH834615	Mycobacterium phage KandZ, complete genome	46114-46145	4	0.875
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	DQ398051	Mycobacterium phage PLot, complete genome	45983-46014	4	0.875
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	JN699014	Mycobacterium phage Nova, complete genome	46453-46484	4	0.875
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	JN699014	Mycobacterium phage Nova, complete genome	46462-46493	4	0.875
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	JN699014	Mycobacterium phage Nova, complete genome	46471-46502	4	0.875
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	NC_006569	Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence	458259-458290	4	0.875
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	JQ807250	Environmental Halophage eHP-31, partial genome	1009-1040	4	0.875
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	JQ807250	Environmental Halophage eHP-31, partial genome	1018-1049	4	0.875
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	NC_027120	Lactococcus phage 1358, complete sequence	24798-24829	4	0.875
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	NC_027120	Lactococcus phage 1358, complete sequence	24807-24838	4	0.875
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	NC_027120	Lactococcus phage 1358, complete sequence	24816-24847	4	0.875
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MN119378	Mycobacterium phage Penelope2018, complete genome	45995-46026	4	0.875
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP013586	Rhizobium phaseoli strain N161 plasmid pRphaN161a, complete sequence	43859-43890	4	0.875
NC_003911_1	1.34\|2128234\|32\|NC_003911\|CRT	2128234-2128265	32	NC_006569	Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence	457488-457519	4	0.875
NC_003911_1	1.7\|2126674\|32\|NC_003911\|CRT	2126674-2126705	32	NC_006569	Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence	457827-457858	5	0.844
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	FJ168661	Mycobacterium phage Gumball, complete genome	46478-46509	5	0.844
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	JF937107	Mycobacterium phage SirHarley, complete genome	46461-46492	5	0.844
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	DQ398051	Mycobacterium phage PLot, complete genome	45992-46023	5	0.844
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	JN699014	Mycobacterium phage Nova, complete genome	46480-46511	5	0.844
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MH121069	Pseudomonas phage vB_PaeM_PA5oct, complete genome	152112-152143	5	0.844
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MH460460	Dickeya phage vB_DsoM_JA13, complete genome	219177-219208	5	0.844
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MH460460	Dickeya phage vB_DsoM_JA13, complete genome	219093-219124	5	0.844
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	NZ_CP029455	Bacillus cereus strain FORC087 plasmid pFORC087.1, complete sequence	401571-401602	5	0.844
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MN119378	Mycobacterium phage Penelope2018, complete genome	46019-46050	5	0.844
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	NC_049851	Burkholderia phage BcepSauron, complete genome	99243-99274	5	0.844
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	NC_049851	Burkholderia phage BcepSauron, complete genome	99417-99448	5	0.844
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	NZ_CP053953	Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence	6113-6144	5	0.844
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	NZ_CP053950	Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence	228483-228514	5	0.844
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MK524498	Mycobacterium phage Chill, complete genome	46030-46061	5	0.844
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MK524498	Mycobacterium phage Chill, complete genome	46039-46070	5	0.844
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MK494102	Mycobacterium phage WaldoWhy, complete genome	46030-46061	5	0.844
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MK494102	Mycobacterium phage WaldoWhy, complete genome	46039-46070	5	0.844
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	KJ194582	Mycobacterium phage Hawkeye, complete genome	46329-46360	5	0.844
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	KC292029	Halovirus HCTV-1, complete genome	72748-72779	5	0.844
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NC_007764	Rhizobium etli CFN 42 plasmid p42c, complete sequence	32362-32393	5	0.844
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP020908	Rhizobium etli strain NXC12 plasmid pRetNXC12b, complete sequence	42961-42992	5	0.844
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NC_021907	Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1b, complete sequence	32358-32389	5	0.844
NC_003911_1	1.31\|2128054\|32\|NC_003911\|CRT	2128054-2128085	32	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	1066489-1066520	5	0.844
NC_003911_1	1.31\|2128054\|32\|NC_003911\|CRT	2128054-2128085	32	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	153318-153349	5	0.844
NC_003911_1	1.36\|2128360\|41\|NC_003911\|CRT	2128360-2128400	41	NC_006569	Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence	458133-458173	5	0.878
NC_003911_1	1.36\|2128360\|41\|NC_003911\|CRT	2128360-2128400	41	NC_006569	Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence	458295-458335	5	0.878
NC_003911_1	1.36\|2128360\|41\|NC_003911\|CRT	2128360-2128400	41	NC_006569	Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence	458169-458209	5	0.878
NC_003911_1	1.7\|2126674\|32\|NC_003911\|CRT	2126674-2126705	32	NC_006569	Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence	457533-457564	6	0.812
NC_003911_1	1.13\|2126980\|38\|NC_003911\|CRT	2126980-2127017	38	NC_048053	Dickeya phage vB_DsoM_JA29, complete genome	243749-243786	6	0.842
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	FJ168661	Mycobacterium phage Gumball, complete genome	46487-46518	6	0.812
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	JF937107	Mycobacterium phage SirHarley, complete genome	46470-46501	6	0.812
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MH834615	Mycobacterium phage KandZ, complete genome	46123-46154	6	0.812
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	JN699014	Mycobacterium phage Nova, complete genome	46489-46520	6	0.812
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MH460460	Dickeya phage vB_DsoM_JA13, complete genome	219186-219217	6	0.812
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MH460460	Dickeya phage vB_DsoM_JA13, complete genome	244463-244494	6	0.812
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MH460460	Dickeya phage vB_DsoM_JA13, complete genome	244514-244545	6	0.812
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MH460460	Dickeya phage vB_DsoM_JA13, complete genome	244769-244800	6	0.812
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MN119378	Mycobacterium phage Penelope2018, complete genome	46028-46059	6	0.812
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	NC_049851	Burkholderia phage BcepSauron, complete genome	99408-99439	6	0.812
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	NZ_CP016589	Bacillus thuringiensis strain KNU-07 plasmid pBTKNU07-01, complete sequence	428400-428431	6	0.812
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	NC_048053	Dickeya phage vB_DsoM_JA29, complete genome	243788-243819	6	0.812
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	NC_048053	Dickeya phage vB_DsoM_JA29, complete genome	243764-243795	6	0.812
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	KJ194582	Mycobacterium phage Hawkeye, complete genome	46338-46369	6	0.812
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MK450421	Streptomyces phage Vash, complete genome	34933-34964	6	0.812
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	NZ_CP012940	Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence	836359-836390	6	0.812
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	NZ_CP012944	Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence	1058074-1058105	6	0.812
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	NC_017575	Ralstonia solanacearum Po82 megaplasmid, complete sequence	1339760-1339791	6	0.812
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	NZ_CP026308	Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence	1339704-1339735	6	0.812
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	NZ_CP051295	Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence	828094-828125	6	0.812
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	NC_010811	Ralstonia phage RSL1, complete genome	220400-220431	6	0.812
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MN094788	Achromobacter phage Motura, complete genome	27235-27266	6	0.812
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	AB366653	Ralstonia phage RSL1 DNA, complete genome	220400-220431	6	0.812
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MK305891	Streptomyces phage Gibson, complete genome	8037-8068	6	0.812
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MH248138	Erwinia phage vB_EamM_Alexandra, complete genome	255786-255817	6	0.812
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MH389777	Dickeya phage vB_DsoM_JA11, complete genome	245662-245693	6	0.812
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MH389777	Dickeya phage vB_DsoM_JA11, complete genome	245917-245948	6	0.812
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MH389777	Dickeya phage vB_DsoM_JA11, complete genome	246044-246075	6	0.812
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MH460462	Dickeya phage vB_DsoM_JA33, complete genome	245779-245810	6	0.812
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MH460462	Dickeya phage vB_DsoM_JA33, complete genome	246034-246065	6	0.812
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	NC_049850	Burkholderia phage BcepSaruman, complete genome	100504-100535	6	0.812
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	NZ_CP020952	Rhizobium sp. CIAT894 plasmid pRheCIAT894e, complete sequence	420734-420765	6	0.812
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	MH460460	Dickeya phage vB_DsoM_JA13, complete genome	219177-219208	6	0.812
NC_003911_1	1.31\|2128054\|32\|NC_003911\|CRT	2128054-2128085	32	NZ_CP013600	Rhizobium sp. N741 plasmid pRspN741e, complete sequence	723700-723731	6	0.812
NC_003911_1	1.31\|2128054\|32\|NC_003911\|CRT	2128054-2128085	32	NZ_CP013504	Rhizobium esperanzae strain N561 plasmid pRspN561d, complete sequence	723712-723743	6	0.812
NC_003911_1	1.31\|2128054\|32\|NC_003911\|CRT	2128054-2128085	32	NZ_CP013510	Rhizobium sp. N1341 plasmid pRspN1341e, complete sequence	722141-722172	6	0.812
NC_003911_1	1.31\|2128054\|32\|NC_003911\|CRT	2128054-2128085	32	NZ_CP013521	Rhizobium sp. N113 plasmid pRspN113d, complete sequence	726388-726419	6	0.812
NC_003911_1	1.31\|2128054\|32\|NC_003911\|CRT	2128054-2128085	32	NZ_CP013494	Rhizobium sp. N6212 plasmid pRspN6212d, complete sequence	713271-713302	6	0.812
NC_003911_1	1.31\|2128054\|32\|NC_003911\|CRT	2128054-2128085	32	NZ_CP013594	Rhizobium sp. N871 plasmid pRspN871d, complete sequence	723712-723743	6	0.812
NC_003911_1	1.31\|2128054\|32\|NC_003911\|CRT	2128054-2128085	32	NZ_CP027023	Streptomyces sp. WAC00288 plasmid p1, complete sequence	108434-108465	6	0.812
NC_003911_1	1.7\|2126674\|32\|NC_003911\|CRT	2126674-2126705	32	NC_006569	Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence	458187-458218	7	0.781
NC_003911_1	1.13\|2126980\|38\|NC_003911\|CRT	2126980-2127017	38	NC_010811	Ralstonia phage RSL1, complete genome	220457-220494	7	0.816
NC_003911_1	1.13\|2126980\|38\|NC_003911\|CRT	2126980-2127017	38	AB366653	Ralstonia phage RSL1 DNA, complete genome	220457-220494	7	0.816
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	JQ807250	Environmental Halophage eHP-31, partial genome	1027-1058	7	0.781
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	NC_027120	Lactococcus phage 1358, complete sequence	24789-24820	7	0.781
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MK524498	Mycobacterium phage Chill, complete genome	46048-46079	7	0.781
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MK494102	Mycobacterium phage WaldoWhy, complete genome	46048-46079	7	0.781
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	NC_010811	Ralstonia phage RSL1, complete genome	158089-158120	7	0.781
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	NC_010811	Ralstonia phage RSL1, complete genome	220262-220293	7	0.781
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	AM419438	Archaeal BJ1 virus complete genome	26652-26683	7	0.781
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	AB366653	Ralstonia phage RSL1 DNA, complete genome	158089-158120	7	0.781
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	AB366653	Ralstonia phage RSL1 DNA, complete genome	220262-220293	7	0.781
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	NC_008695	Archaeal BJ1 virus, complete genome	26652-26683	7	0.781
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	NZ_CP032230	Streptomyces seoulensis strain KCTC 9819 plasmid unnamed	63712-63743	7	0.781
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	CP011998	Ralstonia solanacearum strain YC45 plasmid, complete sequence	1089901-1089932	7	0.781
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	LN610585	Pseudomonas phage vB_PaeS_PAO1_Ab20, complete genome	39021-39052	7	0.781
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	DQ398047	Mycobacterium phage PBI1, complete genome	45916-45947	7	0.781
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MT889385	Mycobacterium phage Thoth, complete genome	45984-46015	7	0.781
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MH389777	Dickeya phage vB_DsoM_JA11, complete genome	220315-220346	7	0.781
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MH389777	Dickeya phage vB_DsoM_JA11, complete genome	245617-245648	7	0.781
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MH389777	Dickeya phage vB_DsoM_JA11, complete genome	220174-220205	7	0.781
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MK559427	Mycobacterium phage Delton, complete genome	46383-46414	7	0.781
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MH460462	Dickeya phage vB_DsoM_JA33, complete genome	220432-220463	7	0.781
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MH460462	Dickeya phage vB_DsoM_JA33, complete genome	245734-245765	7	0.781
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MH460462	Dickeya phage vB_DsoM_JA33, complete genome	220291-220322	7	0.781
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	FJ168660	Mycobacterium phage Butterscotch, complete genome	45985-46016	7	0.781
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MH460463	Dickeya phage vB_DsoM_AD1, complete genome	251040-251071	7	0.781
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MH025888	Mycobacterium phage BigMama, complete genome	46001-46032	7	0.781
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MH399788	Mycobacterium phage Visconti, complete genome	45965-45996	7	0.781
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	EU676000	Mycobacterium phage Adjutor, complete genome	45925-45956	7	0.781
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MN694796	Marine virus AFVG_250M264, complete genome	35850-35881	7	0.781
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	NZ_CP026684	Nostoc sp. 'Peltigera membranacea cyanobiont' N6 plasmid pNPM2, complete sequence	50435-50466	7	0.781
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MK203850	Alteromonas phage ZP6, complete genome	16489-16520	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	NZ_LR134450	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 8, complete sequence	116240-116271	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MH590590	Microbacterium phage Schnapsidee, complete genome	5237-5268	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MK967394	Microbacterium phage HanSolo, complete genome	5223-5254	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MT986027	Microbacterium phage Winzigespinne, complete genome	5222-5253	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MH045554	Microbacterium phage Bandik, complete genome	5223-5254	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MH513981	Microbacterium phage Papafritta, complete genome	5223-5254	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MG839022	Microbacterium phage Ludgate, complete genome	5223-5254	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MT310851	Microbacterium phage Sedgewig, complete genome	5223-5254	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MK967400	Microbacterium Phage Clancy, complete genome	5223-5254	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MG944222	Microbacterium phage StingRay, complete genome	5223-5254	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MT986026	Microbacterium phage Gubbabump, complete genome	5225-5256	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MN735430	Microbacterium phage Ioannes, complete genome	5223-5254	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MN369737	Microbacterium phage Benjalauren, complete genome	5223-5254	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MG839029	Microbacterium phage Ilzat, complete genome	5223-5254	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MT451985	Microbacterium phage Dothraki, complete genome	5223-5254	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MK757447	Microbacterium phage Greys, complete genome	5223-5254	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MK967391	Microbacterium phage BonesMcCoy, complete genome	5223-5254	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MH045562	Microbacterium phage Raptor, complete genome	5223-5254	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MT771350	Microbacterium phage TatarkaPM, complete genome	5223-5254	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MN892483	Microbacterium phage SonOfLevi, complete genome	5224-5255	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MK977697	Microbacterium phage Etta, complete genome	5226-5257	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MT498049	Microbacterium phage BigRedClifford, complete genome	5223-5254	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MN234204	Microbacterium phage ManRay, complete genome	5237-5268	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MG925352	Microbacterium phage Nattles, complete genome	5228-5259	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MG839015	Microbacterium phage Aubergine, complete genome	5237-5268	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MH045558	Microbacterium phage Dave, complete genome	5223-5254	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MG839028	Microbacterium phage Tenda, complete genome	5235-5266	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MH045559	Microbacterium phage Etna, complete genome	5238-5269	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MN062709	Microbacterium phage Stanktossa, complete genome	5223-5254	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MT310866	Microbacterium phage Pherferi, complete genome	5223-5254	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MH153802	Microbacterium phage Gargoyle, complete genome	5223-5254	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MH045560	Microbacterium phage Nagem, complete genome	5223-5254	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MT553343	Microbacterium Phage ParleG, complete genome	5223-5254	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MG944219	Microbacterium phage PuppyEggo, complete genome	5223-5254	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MN234163	Microbacterium phage Calix, complete genome	5222-5253	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MG839020	Microbacterium phage Kale, complete genome	5239-5270	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MH045564	Microbacterium phage TeddyBear, complete genome	5237-5268	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MN807246	Microbacterium phage Chamuel, complete genome	5224-5255	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MH153805	Microbacterium phage Martin, complete genome	5223-5254	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MT952846	Microbacterium phage MaeLinda, complete genome	5223-5254	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MG839018	Microbacterium phage Espinosa, complete genome	5235-5266	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MT553341	Microbacterium phage Kurt1, complete genome	5223-5254	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MT310856	Microbacterium phage Zada, complete genome	5223-5254	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MT498062	Microbacterium phage Leafus, complete genome	5385-5416	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MN234222	Microbacterium phage Christoph, complete genome	5235-5266	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MK620902	Microbacterium phage Phriends, complete genome	5223-5254	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MG920061	Microbacterium phage Bonino, complete genome	5222-5253	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MH153806	Microbacterium phage Oats, complete genome	5237-5268	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MG839030	Microbacterium phage Balsa, complete genome	5247-5278	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MK620895	Microbacterium phage Riyhil, complete genome	5223-5254	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MH479922	Microbacterium phage Redfield, complete genome	5246-5277	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MK620905	Microbacterium phage TinSulphur, complete genome	5223-5254	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MN735435	Microbacterium phage Renzie, complete genome	5223-5254	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MN062702	Microbacterium phage Den3, complete genome	5227-5258	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MG944216	Microbacterium phage Pajaza, complete genome	5655-5686	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MG944226	Microbacterium phage Casey, complete genome	5655-5686	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MG839017	Microbacterium phage Baines, complete genome	5223-5254	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MG962360	Microbacterium phage AlexAdler, complete genome	5223-5254	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MT553339	Microbacterium phage Lovelyunicorn, complete genome	5223-5254	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MT310873	Microbacterium phage Convict, complete genome	5223-5254	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MG839024	Microbacterium phage Peppino, complete genome	5238-5269	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MT310861	Microbacterium phage BeautPeep30, complete genome	5223-5254	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MG839023	Microbacterium phage Peep, complete genome	5223-5254	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MG839021	Microbacterium phage Knox, complete genome	5223-5254	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MG839025	Microbacterium phage Raccoon, complete genome	5244-5275	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MK919471	Microbacterium phage Shee, complete genome	5220-5251	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MN234181	Microbacterium phage Pocket, complete genome	5222-5253	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MH153811	Microbacterium phage Teagan, complete genome	5223-5254	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MH045565	Microbacterium phage Antoinette, complete genome	5223-5254	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MH045563	Microbacterium phage Robinson, complete genome	5223-5254	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MG839016	Microbacterium phage AxiPup, complete genome	5223-5254	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MN234177	Microbacterium phage Gershwin, complete genome	5237-5268	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MK620903	Microbacterium phage MillyPhilly, complete genome	5223-5254	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MH045555	Microbacterium phage BeeBee8, complete genome	5413-5444	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MG944218	Microbacterium phage Pikmin, complete genome	5655-5686	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MN062713	Microbacterium phage Alyxandracam, complete genome	5223-5254	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	NC_042110	Microbacterium phage Hamlet, complete genome	5247-5278	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MT024864	Microbacterium phage Oxtober96, complete genome	5223-5254	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MG962367	Microbacterium phage Gelo, complete genome	5226-5257	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MG839026	Microbacterium phage Superfresh, complete genome	5223-5254	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MK967388	Microbacterium phage Velene, complete genome	5223-5254	7	0.781
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MN617840	Microbacterium phage Klimt, complete genome	5224-5255	7	0.781
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	MH121069	Pseudomonas phage vB_PaeM_PA5oct, complete genome	152112-152143	7	0.781
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	CP006880	Rhizobium gallicum bv. gallicum R602 plasmid pRgalR602c, complete sequence	2429423-2429454	7	0.781
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NC_047815	Erwinia phage vB_EamM_Yoloswag, complete genome	215660-215691	7	0.781
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	MK016493	Brevibacterium phage Cantare, complete genome	52565-52596	7	0.781
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	MK967394	Microbacterium phage HanSolo, complete genome	24192-24223	7	0.781
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	MT986027	Microbacterium phage Winzigespinne, complete genome	24191-24222	7	0.781
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	MH045554	Microbacterium phage Bandik, complete genome	24503-24534	7	0.781
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	MH513981	Microbacterium phage Papafritta, complete genome	24207-24238	7	0.781
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	MG839022	Microbacterium phage Ludgate, complete genome	24503-24534	7	0.781
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NC_048053	Dickeya phage vB_DsoM_JA29, complete genome	243788-243819	7	0.781
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	MT310851	Microbacterium phage Sedgewig, complete genome	24190-24221	7	0.781
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	MK967400	Microbacterium Phage Clancy, complete genome	24237-24268	7	0.781
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	MG944222	Microbacterium phage StingRay, complete genome	24208-24239	7	0.781
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	MT986026	Microbacterium phage Gubbabump, complete genome	24194-24225	7	0.781
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	MN735430	Microbacterium phage Ioannes, complete genome	24507-24538	7	0.781
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	MN369737	Microbacterium phage Benjalauren, complete genome	24208-24239	7	0.781
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	MG839029	Microbacterium phage Ilzat, complete genome	24208-24239	7	0.781
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NC_007766	Rhizobium etli CFN 42 plasmid p42f, complete sequence	637548-637579	7	0.781
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	AP013510	Uncultured Mediterranean phage uvMED DNA, complete genome, group G20, isolate: uvMED-CGR-C101A-MedDCM-OCT-S30-C6	15704-15735	7	0.781
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	AP013876	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C101A-MedDCM-OCT-S39-C9, * SEQUENCING IN PROGRESS *	24876-24907	7	0.781
NC_003911_1	1.31\|2128054\|32\|NC_003911\|CRT	2128054-2128085	32	MT028492	Ochrobactrum phage vB_OspP_OH, complete genome	34804-34835	7	0.781
NC_003911_1	1.34\|2128234\|32\|NC_003911\|CRT	2128234-2128265	32	NZ_CP016356	Lactobacillus paracasei subsp. paracasei strain TMW 1.1434 plasmid pL11434-1, complete sequence	8414-8445	7	0.781
NC_003911_1	1.34\|2128234\|32\|NC_003911\|CRT	2128234-2128265	32	NZ_CP035564	Lactobacillus paracasei strain SRCM103299 plasmid unnamed1	2396-2427	7	0.781
NC_003911_1	1.34\|2128234\|32\|NC_003911\|CRT	2128234-2128265	32	NZ_CP013462	Burkholderia ubonensis strain MSMB1471WGS plasmid pMSMB1471, complete sequence	12883-12914	7	0.781
NC_003911_1	1.11\|2126878\|35\|NC_003911\|CRT	2126878-2126912	35	NC_034248	Rhizobium phage RHEph10, complete genome	98587-98621	8	0.771
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	NC_027120	Lactococcus phage 1358, complete sequence	22636-22667	8	0.75
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	NC_049851	Burkholderia phage BcepSauron, complete genome	99234-99265	8	0.75
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	NC_049851	Burkholderia phage BcepSauron, complete genome	99315-99346	8	0.75
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	NC_048053	Dickeya phage vB_DsoM_JA29, complete genome	244043-244074	8	0.75
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	DQ398047	Mycobacterium phage PBI1, complete genome	45907-45938	8	0.75
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MT889385	Mycobacterium phage Thoth, complete genome	45975-46006	8	0.75
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MT776806	Mycobacterium phage MrMiyagi, complete genome	47798-47829	8	0.75
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MT776806	Mycobacterium phage MrMiyagi, complete genome	47789-47820	8	0.75
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MK559427	Mycobacterium phage Delton, complete genome	46374-46405	8	0.75
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	FJ168660	Mycobacterium phage Butterscotch, complete genome	45976-46007	8	0.75
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MH025888	Mycobacterium phage BigMama, complete genome	45992-46023	8	0.75
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MH399788	Mycobacterium phage Visconti, complete genome	45956-45987	8	0.75
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	EU676000	Mycobacterium phage Adjutor, complete genome	45916-45947	8	0.75
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MK373789	Escherichia phage vB_EcoS_PTXU06, complete genome	38808-38839	8	0.75
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MN850575	Escherichia phage rolling, complete genome	8840-8871	8	0.75
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MT478993	Escherichia phage vB_EcoS_011D5, complete genome	4572-4603	8	0.75
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	NZ_CP045548	Streptomyces sp. SYP-A7193 plasmid unnamed1, complete sequence	15053-15084	8	0.75
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	NC_019724	Enterobacteria phage HK578, complete genome	32027-32058	8	0.75
NC_003911_1	1.24\|2127661\|32\|NC_003911\|CRT	2127661-2127692	32	NZ_CP044550	Hydrogenophaga sp. BPS33 plasmid pBPS33-1, complete sequence	238540-238571	8	0.75
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	NZ_CP033074	Buttiauxella sp. 3AFRM03 plasmid pBTX_120, complete sequence	46522-46553	8	0.75
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	NZ_CP050101	Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b6, complete sequence	41898-41929	8	0.75
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	NZ_CP053442	Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eD, complete sequence	41750-41781	8	0.75
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	NZ_CP020331	Martelella mediterranea DSM 17316 strain MACL11 plasmid pMM593, complete sequence	517241-517272	8	0.75
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP022220	Bradyrhizobium guangxiense strain CCBAU 53363 plasmid p53363, complete sequence	12845-12876	8	0.75
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP021029	Rhizobium sp. TAL182 plasmid pRetTAL182e, complete sequence	261626-261657	8	0.75
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP013632	Rhizobium sp. N324 plasmid pRspN324b, complete sequence	373855-373886	8	0.75
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP029452	Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence	1112284-1112315	8	0.75
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NC_011368	Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG201, complete sequence	989234-989265	8	0.75
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP020331	Martelella mediterranea DSM 17316 strain MACL11 plasmid pMM593, complete sequence	517250-517281	8	0.75
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP023071	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence	1075880-1075911	8	0.75
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP030052	Bradyrhizobium guangdongense strain CCBAU 51649 plasmid unnamed, complete sequence	604880-604911	8	0.75
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP030054	Bradyrhizobium guangzhouense strain CCBAU 51670 plasmid unnamed1, complete sequence	784473-784504	8	0.75
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NC_009620	Sinorhizobium medicae WSM419 plasmid pSMED01, complete sequence	892444-892475	8	0.75
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP029232	Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence	995252-995283	8	0.75
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP013110	Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence	2138303-2138334	8	0.75
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP024310	Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3c, complete sequence	68127-68158	8	0.75
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP013054	Sinorhizobium americanum CCGM7 plasmid C, complete sequence	2214756-2214787	8	0.75
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP023064	Sinorhizobium sp. CCBAU 05631 plasmid pSS05631b, complete sequence	71690-71721	8	0.75
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP050081	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b5, complete sequence	637223-637254	8	0.75
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NC_012586	Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence	1805692-1805723	8	0.75
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP049731	Rhizobium leguminosarum strain A1 plasmid pRL12, complete sequence	671454-671485	8	0.75
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NC_018516	Bacillus thuringiensis HD-789 plasmid pBTHD789-1, complete sequence	234169-234200	8	0.75
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP015737	Shinella sp. HZN7 plasmid pShin-01, complete sequence	426545-426576	8	0.75
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP053970	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed2, complete sequence	196277-196308	8	0.75
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	CP036360	Agrobacterium sp. 33MFTa1.1 plasmid p_JBx_073812, complete sequence	185076-185107	8	0.75
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP053979	Bacillus thuringiensis strain FDAARGOS_795 plasmid unnamed3, complete sequence	104489-104520	8	0.75
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP016078	Actinoalloteichus sp. GBA129-24 plasmid pGBA129-24a, complete sequence	14693-14724	8	0.75
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP013277	Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-2-350K, complete sequence	322811-322842	8	0.75
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NC_018701	Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence	348613-348644	8	0.75
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP039723	Bacillus thuringiensis strain BT-59 plasmid p2, complete sequence	90212-90243	8	0.75
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP021802	Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence	967521-967552	8	0.75
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP023068	Ensifer sojae CCBAU 05684 plasmid pSJ05684b, complete sequence	1656215-1656246	8	0.75
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP021810	Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence	1137407-1137438	8	0.75
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP009348	Bacillus thuringiensis HD1002 plasmid 2, complete sequence	322813-322844	8	0.75
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP010858	Marinovum algicola DG 898 plasmid pMaD3	185522-185553	8	0.75
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP009334	Bacillus thuringiensis strain HD1011 plasmid 2, complete sequence	168366-168397	8	0.75
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP019484	Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence	1505487-1505518	8	0.75
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP053206	Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1D, complete sequence	672645-672676	8	0.75
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP045024	Bacillus thuringiensis strain JW-1 plasmid p2, complete sequence	322423-322454	8	0.75
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP019487	Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence	1281879-1281910	8	0.75
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	MT657343	Microbacterium phage GaeCeo, complete genome	24768-24799	8	0.75
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	MN310543	Microbacterium phage ChickenKing, complete genome	24532-24563	8	0.75
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	MH389777	Dickeya phage vB_DsoM_JA11, complete genome	220315-220346	8	0.75
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	MH389777	Dickeya phage vB_DsoM_JA11, complete genome	245617-245648	8	0.75
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	MH460462	Dickeya phage vB_DsoM_JA33, complete genome	220432-220463	8	0.75
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	MH460462	Dickeya phage vB_DsoM_JA33, complete genome	245734-245765	8	0.75
NC_003911_1	1.29\|2127955\|32\|NC_003911\|CRT	2127955-2127986	32	KU594606	Cyanophage S-RIM32 isolate RW_108_0702, complete genome	6535-6566	8	0.75
NC_003911_1	1.31\|2128054\|32\|NC_003911\|CRT	2128054-2128085	32	NC_006569	Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence	458466-458497	8	0.75
NC_003911_1	1.31\|2128054\|32\|NC_003911\|CRT	2128054-2128085	32	NZ_CP016452	Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence	1192954-1192985	8	0.75
NC_003911_1	1.31\|2128054\|32\|NC_003911\|CRT	2128054-2128085	32	NZ_CP017750	Cupriavidus sp. USMAA2-4 plasmid unnamed1, complete sequence	249692-249723	8	0.75
NC_003911_1	1.31\|2128054\|32\|NC_003911\|CRT	2128054-2128085	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	3384083-3384114	8	0.75
NC_003911_1	1.31\|2128054\|32\|NC_003911\|CRT	2128054-2128085	32	NZ_CP053953	Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence	6212-6243	8	0.75
NC_003911_1	1.31\|2128054\|32\|NC_003911\|CRT	2128054-2128085	32	NZ_CP053950	Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence	228582-228613	8	0.75
NC_003911_1	1.37\|2128423\|32\|NC_003911\|CRT	2128423-2128454	32	NZ_AP014686	Bradyrhizobium diazoefficiens strain NK6 plasmid pNK6b, complete sequence	34658-34689	8	0.75
NC_003911_1	1.37\|2128423\|32\|NC_003911\|CRT	2128423-2128454	32	NZ_AP014686	Bradyrhizobium diazoefficiens strain NK6 plasmid pNK6b, complete sequence	207769-207800	8	0.75
NC_003911_1	1.37\|2128423\|32\|NC_003911\|CRT	2128423-2128454	32	NZ_AP014688	Bradyrhizobium diazoefficiens strain NK6 plasmid pNK6d, complete sequence	129743-129774	8	0.75
NC_003911_1	1.38\|2128477\|41\|NC_003911\|CRT	2128477-2128517	41	NC_006569	Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence	458160-458200	8	0.805
NC_003911_1	1.11\|2126878\|35\|NC_003911\|CRT	2126878-2126912	35	NC_006569	Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence	457734-457768	9	0.743
NC_003911_1	1.11\|2126878\|35\|NC_003911\|CRT	2126878-2126912	35	NC_048053	Dickeya phage vB_DsoM_JA29, complete genome	243815-243849	9	0.743
NC_003911_1	1.13\|2126980\|38\|NC_003911\|CRT	2126980-2127017	38	MH389777	Dickeya phage vB_DsoM_JA11, complete genome	241857-241894	9	0.763
NC_003911_1	1.13\|2126980\|38\|NC_003911\|CRT	2126980-2127017	38	MH460462	Dickeya phage vB_DsoM_JA33, complete genome	241974-242011	9	0.763
NC_003911_1	1.13\|2126980\|38\|NC_003911\|CRT	2126980-2127017	38	MH460460	Dickeya phage vB_DsoM_JA13, complete genome	240718-240755	9	0.763
NC_003911_1	1.13\|2126980\|38\|NC_003911\|CRT	2126980-2127017	38	NC_006569	Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence	458451-458488	9	0.763
NC_003911_1	1.13\|2126980\|38\|NC_003911\|CRT	2126980-2127017	38	AF440695	Virus PhiCh1, complete genome	8973-9010	9	0.763
NC_003911_1	1.13\|2126980\|38\|NC_003911\|CRT	2126980-2127017	38	NC_004084	Natrialba phage PhiCh1, complete genome	8973-9010	9	0.763
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MH460460	Dickeya phage vB_DsoM_JA13, complete genome	219045-219076	9	0.719
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	NC_049851	Burkholderia phage BcepSauron, complete genome	99279-99310	9	0.719
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	CP011998	Ralstonia solanacearum strain YC45 plasmid, complete sequence	1089910-1089941	9	0.719
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	KY984068	Erwinia phage vB_EamM_Y3, complete genome	198713-198744	9	0.719
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	FJ168662	Mycobacterium phage Troll4, complete genome	46106-46137	9	0.719
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MN284908	Mycobacterium phage Helpful, complete genome	46305-46336	9	0.719
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MN234227	Mycobacterium phage Giuseppe, complete genome	45944-45975	9	0.719
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	NC_010070	Burkholderia multivorans ATCC 17616 plasmid pBMUL01, complete sequence	92780-92811	9	0.719
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	NZ_AP022602	Mycobacterium gallinarum strain JCM 6399 plasmid pJCM6399	45063-45094	9	0.719
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	NC_014310	Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence	1019202-1019233	9	0.719
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	NC_010802	Burkholderia multivorans ATCC 17616 plasmid pTGL1, complete sequence	20675-20706	9	0.719
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	NZ_CP022760	Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence	920879-920910	9	0.719
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	NZ_CP022789	Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence	920869-920900	9	0.719
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	NZ_CP017105	Rhizobium gallicum strain IE4872 plasmid pRgalIE4872d, complete sequence	2346116-2346147	9	0.719
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	CP006880	Rhizobium gallicum bv. gallicum R602 plasmid pRgalR602c, complete sequence	2428009-2428040	9	0.719
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MK016493	Brevibacterium phage Cantare, complete genome	86105-86136	9	0.719
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MT774407	CrAssphage cr125_1, complete genome	45937-45968	9	0.719
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	NC_019500	Enterobacteria phage Bp7, complete genome	136269-136300	9	0.719
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MT682711	Escherichia phage vB_EcoM_FB, complete genome	103914-103945	9	0.719
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	KU878968	Escherichia phage WG01, complete genome	101555-101586	9	0.719
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MT150133	Enterobacteria phage vB_EcoM_IME540, complete genome	148997-149028	9	0.719
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	NC_028847	Enterobacteria phage QL01, complete genome	101666-101697	9	0.719
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MT478993	Escherichia phage vB_EcoS_011D5, complete genome	4635-4666	9	0.719
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MT478993	Escherichia phage vB_EcoS_011D5, complete genome	4644-4675	9	0.719
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MH051913	Enterobacteria phage vB_EcoM_IME281, complete genome	71212-71243	9	0.719
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	KU878969	Escherichia phage MX01, complete genome	101959-101990	9	0.719
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	NZ_CP049245	Rhizobium pseudoryzae strain DSM 19479 plasmid unnamed4, complete sequence	59807-59838	9	0.719
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	NZ_CP015745	Shinella sp. HZN7 plasmid pShin-09, complete sequence	36352-36383	9	0.719
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	NC_018022	Mycolicibacterium chubuense NBB4 plasmid pMYCCH.01, complete sequence	199157-199188	9	0.719
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	LN881731	Escherichia phage slur06, complete genome	27325-27356	9	0.719
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	LN881730	Escherichia phage slur05, complete genome	37253-37284	9	0.719
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MN901521	Halorubrum coriense virus Serpecor1, complete genome	48308-48339	9	0.719
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	LR597646	Escherichia phage Gluttony_ev152 genome assembly, chromosome: 1	11916-11947	9	0.719
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	NZ_CP011771	Croceicoccus naphthovorans strain PQ-2 plasmid p1, complete sequence	64562-64593	9	0.719
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	NZ_CP041045	Paracoccus sp. AK26 plasmid pAK1, complete sequence	329828-329859	9	0.719
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	NZ_CP019735	Lactobacillus brevis strain TMW 1.2108 plasmid pl12108-1, complete sequence	25081-25112	9	0.719
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	NZ_CP016289	Rhizobium leguminosarum strain Vaf10 plasmid unnamed2, complete sequence	548897-548928	9	0.719
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	NZ_CP046774	Vibrio alginolyticus strain 2014V-1011 plasmid unnamed1, complete sequence	133354-133385	9	0.719
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	NZ_CP019744	Lactobacillus brevis strain TMW 1.2111 plasmid pl12111-1, complete sequence	98877-98908	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP050094	Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b4, complete sequence	325002-325033	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP050082	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b4, complete sequence	563581-563612	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP050083	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b3, complete sequence	296563-296594	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP050106	Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b5, complete sequence	75906-75937	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP021033	Rhizobium sp. NXC14 plasmid pRspNXC14c, complete sequence	329697-329728	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP025014	Rhizobium leguminosarum strain Norway plasmid pRLN2, complete sequence	442142-442173	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP025016	Rhizobium leguminosarum strain Norway plasmid pRLN4, complete sequence	179559-179590	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP049732	Rhizobium leguminosarum strain A1 plasmid pRL11, complete sequence	505033-505064	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NC_008379	Rhizobium leguminosarum bv. viciae 3841 plasmid pRL9, complete sequence	308123-308154	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NC_007763	Rhizobium etli CFN 42 plasmid p42b, complete sequence	163937-163968	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP021025	Rhizobium sp. TAL182 plasmid pRetTAL182a, complete sequence	146024-146055	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP020907	Rhizobium etli strain NXC12 plasmid pRetNXC12a, complete sequence	162010-162041	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP020952	Rhizobium sp. CIAT894 plasmid pRheCIAT894e, complete sequence	420743-420774	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP018229	Rhizobium leguminosarum strain Vaf-108 plasmid unnamed1, complete sequence	1119596-1119627	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP018233	Rhizobium leguminosarum strain Vaf-108 plasmid unnamed5, complete sequence	130245-130276	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP025506	Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvE, complete sequence	66842-66873	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP016287	Rhizobium leguminosarum strain Vaf10 plasmid unnamed1, complete sequence	693807-693838	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP016293	Rhizobium leguminosarum strain Vaf10 plasmid unnamed5, complete sequence	232145-232176	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP029452	Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence	1816226-1816257	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	5980821-5980852	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP013600	Rhizobium sp. N741 plasmid pRspN741e, complete sequence	251840-251871	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP013600	Rhizobium sp. N741 plasmid pRspN741e, complete sequence	412464-412495	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP013577	Rhizobium phaseoli strain N671 plasmid pRphaN671c, complete sequence	310958-310989	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP013549	Rhizobium phaseoli strain R611 plasmid pRetR611b, complete sequence	311328-311359	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP013534	Rhizobium phaseoli strain R650 plasmid pRphaR650b, complete sequence	311328-311359	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP013545	Rhizobium phaseoli strain R620 plasmid pRphaR620c, complete sequence	311320-311351	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NC_021906	Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1a, complete sequence	160912-160943	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP013504	Rhizobium esperanzae strain N561 plasmid pRspN561d, complete sequence	251840-251871	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP013504	Rhizobium esperanzae strain N561 plasmid pRspN561d, complete sequence	412464-412495	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NC_012852	Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132504, complete sequence	154737-154768	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP050111	Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b1, complete sequence	76090-76121	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP030763	Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed3, complete sequence	521643-521674	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP013510	Rhizobium sp. N1341 plasmid pRspN1341e, complete sequence	250281-250312	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP013510	Rhizobium sp. N1341 plasmid pRspN1341e, complete sequence	410905-410936	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP013521	Rhizobium sp. N113 plasmid pRspN113d, complete sequence	254528-254559	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP013521	Rhizobium sp. N113 plasmid pRspN113d, complete sequence	415152-415183	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP013571	Rhizobium phaseoli strain N771 plasmid pRphaN771c, complete sequence	310958-310989	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP013494	Rhizobium sp. N6212 plasmid pRspN6212d, complete sequence	248646-248677	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP013494	Rhizobium sp. N6212 plasmid pRspN6212d, complete sequence	409270-409301	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP013512	Rhizobium sp. N1314 plasmid pRspN1314a, complete sequence	141972-142003	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP013515	Rhizobium sp. N1314 plasmid pRspN1314d, complete sequence	257160-257191	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP054025	Rhizobium sp. JKLM12A2 plasmid pPR12A204, complete sequence	87548-87579	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP054028	Rhizobium sp. JKLM19E plasmid pPR19E01, complete sequence	1588551-1588582	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP013594	Rhizobium sp. N871 plasmid pRspN871d, complete sequence	251840-251871	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP013594	Rhizobium sp. N871 plasmid pRspN871d, complete sequence	412464-412495	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP022668	Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR3, complete sequence	519590-519621	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP023071	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence	281269-281300	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP054034	Rhizobium sp. JKLM13E plasmid pPR13E03, complete sequence	50425-50456	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP030830	Neorhizobium sp. NCHU2750 plasmid pNCHU2750c, complete sequence	154004-154035	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP013605	Rhizobium sp. N731 plasmid pRspN731d, complete sequence	257154-257185	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP022569	Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK05, complete sequence	152641-152672	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP053207	Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1C, complete sequence	318353-318384	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP053208	Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1B, complete sequence	461426-461457	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP035002	Rhizobium acidisoli strain FH23 plasmid pRapFH23d, complete sequence	254379-254410	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP050088	Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b6, complete sequence	201095-201126	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP013110	Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence	1336215-1336246	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NC_010625	Paraburkholderia phymatum STM815 plasmid pBPHY01, complete sequence	1897816-1897847	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP013054	Sinorhizobium americanum CCGM7 plasmid C, complete sequence	1075169-1075200	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	KF114876	Leptospira phage LalZ_80412, complete genome	49890-49921	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP025013	Rhizobium leguminosarum strain Norway plasmid pRLN1, complete sequence	942154-942185	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP020900	Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5d, complete sequence	1041868-1041899	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP006990	Rhizobium sp. IE4771 plasmid pRetIE4771d, complete sequence	310808-310839	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP013526	Rhizobium phaseoli strain R744 plasmid pRphaR744d, complete sequence	534593-534624	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP013556	Rhizobium phaseoli strain N931 plasmid pRphaN931d, complete sequence	546068-546099	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP013589	Rhizobium phaseoli strain N161 plasmid pRphaN161d, complete sequence	533363-533394	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NC_011371	Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG204, complete sequence	198159-198190	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP013562	Rhizobium phaseoli strain N841 plasmid pRphaN841e, complete sequence	574157-574188	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP013579	Rhizobium phaseoli strain N671 plasmid pRphaN671e, complete sequence	530543-530574	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP013531	Rhizobium phaseoli strain R723 plasmid pRphaR723d, complete sequence	560467-560498	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP013536	Rhizobium phaseoli strain R650 plasmid pRphaR650d, complete sequence	371048-371079	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP013541	Rhizobium phaseoli strain R630 plasmid pRphaR630d, complete sequence	547267-547298	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP013546	Rhizobium phaseoli strain R620 plasmid pRphaR620d, complete sequence	544965-544996	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP013567	Rhizobium phaseoli strain N831 plasmid pRphaN831d, complete sequence	546068-546099	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP048281	Rhizobium leguminosarum bv. viciae 248 plasmid pRle248e, complete sequence	596713-596744	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP013584	Rhizobium phaseoli strain N261 plasmid pRphaN261d, complete sequence	560467-560498	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP013573	Rhizobium phaseoli strain N771 plasmid pRphaN771e, complete sequence	530543-530574	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP021127	Rhizobium sp. Kim5 plasmid pRetKim5c, complete sequence	295061-295092	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NC_012848	Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132501, complete sequence	466964-466995	9	0.719
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NC_010997	Rhizobium etli CIAT 652 plasmid pC, complete sequence	532499-532530	9	0.719
NC_003911_1	1.29\|2127955\|32\|NC_003911\|CRT	2127955-2127986	32	NZ_CP015744	Shinella sp. HZN7 plasmid pShin-08, complete sequence	5436-5467	9	0.719
NC_003911_1	1.31\|2128054\|32\|NC_003911\|CRT	2128054-2128085	32	NC_006569	Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence	457782-457813	9	0.719
NC_003911_1	1.31\|2128054\|32\|NC_003911\|CRT	2128054-2128085	32	NC_019500	Enterobacteria phage Bp7, complete genome	136269-136300	9	0.719
NC_003911_1	1.31\|2128054\|32\|NC_003911\|CRT	2128054-2128085	32	MT682711	Escherichia phage vB_EcoM_FB, complete genome	103914-103945	9	0.719
NC_003911_1	1.31\|2128054\|32\|NC_003911\|CRT	2128054-2128085	32	KU878968	Escherichia phage WG01, complete genome	101555-101586	9	0.719
NC_003911_1	1.31\|2128054\|32\|NC_003911\|CRT	2128054-2128085	32	MT150133	Enterobacteria phage vB_EcoM_IME540, complete genome	148997-149028	9	0.719
NC_003911_1	1.31\|2128054\|32\|NC_003911\|CRT	2128054-2128085	32	NC_028847	Enterobacteria phage QL01, complete genome	101666-101697	9	0.719
NC_003911_1	1.31\|2128054\|32\|NC_003911\|CRT	2128054-2128085	32	MH051913	Enterobacteria phage vB_EcoM_IME281, complete genome	71212-71243	9	0.719
NC_003911_1	1.31\|2128054\|32\|NC_003911\|CRT	2128054-2128085	32	KU878969	Escherichia phage MX01, complete genome	101959-101990	9	0.719
NC_003911_1	1.31\|2128054\|32\|NC_003911\|CRT	2128054-2128085	32	NZ_CP049244	Rhizobium pseudoryzae strain DSM 19479 plasmid unnamed3, complete sequence	801720-801751	9	0.719
NC_003911_1	1.36\|2128360\|41\|NC_003911\|CRT	2128360-2128400	41	MK433268	Streptomyces phage Popy, complete genome	9725-9765	9	0.78
NC_003911_1	1.36\|2128360\|41\|NC_003911\|CRT	2128360-2128400	41	MF467948	Streptomyces phage DrGrey, complete genome	9725-9765	9	0.78
NC_003911_1	1.36\|2128360\|41\|NC_003911\|CRT	2128360-2128400	41	MN586054	Streptomyces phage FrodoSwaggins, complete genome	9725-9765	9	0.78
NC_003911_1	1.37\|2128423\|32\|NC_003911\|CRT	2128423-2128454	32	NZ_CP054023	Rhizobium sp. JKLM12A2 plasmid pPR12A202, complete sequence	244017-244048	9	0.719
NC_003911_1	1.37\|2128423\|32\|NC_003911\|CRT	2128423-2128454	32	NZ_CP054033	Rhizobium sp. JKLM13E plasmid pPR13E02, complete sequence	403701-403732	9	0.719
NC_003911_1	1.37\|2128423\|32\|NC_003911\|CRT	2128423-2128454	32	MN694232	Marine virus AFVG_250M183, complete genome	33132-33163	9	0.719
NC_003911_1	1.37\|2128423\|32\|NC_003911\|CRT	2128423-2128454	32	KC117377	Halovirus HVTV-1, complete genome	26803-26834	9	0.719
NC_003911_1	1.39\|2128540\|32\|NC_003911\|CRT	2128540-2128571	32	NZ_CP038031	Rhodococcus ruber strain R1 plasmid unnamed1, complete sequence	149628-149659	9	0.719
NC_003911_1	1.39\|2128540\|32\|NC_003911\|CRT	2128540-2128571	32	NZ_CP024892	Rhodococcus ruber strain YYL plasmid pYYL1.1, complete sequence	76826-76857	9	0.719
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	KY984068	Erwinia phage vB_EamM_Y3, complete genome	198644-198675	10	0.688
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MH389777	Dickeya phage vB_DsoM_JA11, complete genome	220165-220196	10	0.688
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MH460462	Dickeya phage vB_DsoM_JA33, complete genome	220282-220313	10	0.688
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MN478374	Bacteriophage Phobos, complete genome	9341-9372	10	0.688
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MN101225	Klebsiella phage KPN1, complete genome	44288-44319	10	0.688
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MH316562	Mycobacterium phage Erk16, complete genome	46042-46073	10	0.688
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MN101230	Klebsiella phage KPN6, complete genome	7640-7671	10	0.688
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	KY000080	Klebsiella phage KPV15, complete genome	112043-112074	10	0.688
NC_003911_1	1.24\|2127661\|32\|NC_003911\|CRT	2127661-2127692	32	NZ_CP032348	Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence	230887-230918	10	0.688
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	NZ_CP016879	Xanthomonas hortorum strain B07-007 plasmid pB07007, complete sequence	41738-41769	10	0.688
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	NZ_CP018733	Xanthomonas gardneri strain ICMP 7383 plasmid pICMP7383.2, complete sequence	31298-31329	10	0.688
NC_003911_1	1.25\|2127715\|32\|NC_003911\|CRT	2127715-2127746	32	MN694356	Marine virus AFVG_250M50, complete genome	26082-26113	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP020948	Rhizobium sp. CIAT894 plasmid pRheCIAT894a, complete sequence	179065-179096	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP050101	Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b6, complete sequence	41889-41920	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP021033	Rhizobium sp. NXC14 plasmid pRspNXC14c, complete sequence	492446-492477	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP020899	Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5c, complete sequence	331507-331538	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NC_007765	Rhizobium etli CFN 42 plasmid p42e, complete sequence	411760-411791	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP053442	Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eD, complete sequence	41741-41772	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP021028	Rhizobium sp. TAL182 plasmid pRetTAL182d, complete sequence	420683-420714	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP013525	Rhizobium phaseoli strain R744 plasmid pRphaR744c, complete sequence	310768-310799	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP013554	Rhizobium phaseoli strain N931 plasmid pRphaN931b, complete sequence	331927-331958	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP020909	Rhizobium etli strain NXC12 plasmid pRetNXC12c, complete sequence	412215-412246	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP013588	Rhizobium phaseoli strain N161 plasmid pRphaN161c, complete sequence	306025-306056	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP013529	Rhizobium phaseoli strain R723 plasmid pRphaR723b, complete sequence	325109-325140	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP013565	Rhizobium phaseoli strain N831 plasmid pRphaN831b, complete sequence	331927-331958	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP013503	Rhizobium esperanzae strain N561 plasmid pRspN561c, complete sequence	419510-419541	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP013582	Rhizobium phaseoli strain N261 plasmid pRphaN261b, complete sequence	325109-325140	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP013509	Rhizobium sp. N1341 plasmid pRspN1341d, complete sequence	419510-419541	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP013520	Rhizobium sp. N113 plasmid pRspN113c, complete sequence	419510-419541	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP013493	Rhizobium sp. N6212 plasmid pRspN6212c, complete sequence	419510-419541	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP054028	Rhizobium sp. JKLM19E plasmid pPR19E01, complete sequence	588859-588890	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NC_009620	Sinorhizobium medicae WSM419 plasmid pSMED01, complete sequence	601072-601103	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP050099	Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b5, complete sequence	313781-313812	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP013110	Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence	988765-988796	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP030764	Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed4, complete sequence	392262-392293	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP021373	Rhizobium sp. ACO-34A plasmid pRACO34Ac, complete sequence	38430-38461	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP024310	Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3c, complete sequence	1078471-1078502	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP013054	Sinorhizobium americanum CCGM7 plasmid C, complete sequence	1400867-1400898	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP023064	Sinorhizobium sp. CCBAU 05631 plasmid pSS05631b, complete sequence	897318-897349	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NC_048053	Dickeya phage vB_DsoM_JA29, complete genome	244043-244074	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP050092	Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b6, complete sequence	717939-717970	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP050104	Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b2, complete sequence	129920-129951	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP050105	Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b6, complete sequence	542746-542777	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NC_012586	Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence	1299616-1299647	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NC_019849	Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence	53576-53607	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NC_003078	Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence	5427-5458	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP020900	Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5d, complete sequence	256742-256773	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP053441	Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eE, complete sequence	339963-339994	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP019586	Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence	5427-5458	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP006989	Rhizobium sp. IE4771 plasmid pRetIE4771c, complete sequence	377227-377258	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP013526	Rhizobium phaseoli strain R744 plasmid pRphaR744d, complete sequence	178848-178879	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP013556	Rhizobium phaseoli strain N931 plasmid pRphaN931d, complete sequence	178847-178878	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NC_017326	Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence	53348-53379	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP025507	Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvA, complete sequence	1110538-1110569	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP025508	Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvB, complete sequence	452015-452046	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP013589	Rhizobium phaseoli strain N161 plasmid pRphaN161d, complete sequence	176216-176247	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP021799	Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence	72964-72995	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NC_017323	Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence	1295805-1295836	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP013562	Rhizobium phaseoli strain N841 plasmid pRphaN841e, complete sequence	178848-178879	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP013579	Rhizobium phaseoli strain N671 plasmid pRphaN671e, complete sequence	179497-179528	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP007050	Rhizobium leguminosarum bv. trifolii WSM1689 plasmid unnamed, complete sequence	184292-184323	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP013531	Rhizobium phaseoli strain R723 plasmid pRphaR723d, complete sequence	177340-177371	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP013536	Rhizobium phaseoli strain R650 plasmid pRphaR650d, complete sequence	724246-724277	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP013541	Rhizobium phaseoli strain R630 plasmid pRphaR630d, complete sequence	182779-182810	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP013546	Rhizobium phaseoli strain R620 plasmid pRphaR620d, complete sequence	189528-189559	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP009146	Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence	53638-53669	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NC_018701	Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence	53572-53603	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP013567	Rhizobium phaseoli strain N831 plasmid pRphaN831d, complete sequence	178847-178878	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP050109	Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b2, complete sequence	129920-129951	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP050110	Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b4, complete sequence	542748-542779	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP048283	Rhizobium leguminosarum bv. viciae 248 plasmid pRle248c, complete sequence	269676-269707	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP013584	Rhizobium phaseoli strain N261 plasmid pRphaN261d, complete sequence	177340-177371	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP030761	Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed1, complete sequence	477595-477626	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP013573	Rhizobium phaseoli strain N771 plasmid pRphaN771e, complete sequence	179497-179528	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP021828	Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence	1251059-1251090	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP021126	Rhizobium sp. Kim5 plasmid pRetKim5b, complete sequence	383773-383804	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP013516	Rhizobium sp. N1314 plasmid pRspN1314e, complete sequence	419997-420028	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP054022	Rhizobium sp. JKLM12A2 plasmid pPR12A201, complete sequence	527518-527549	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP021802	Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence	319664-319695	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP022666	Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR1, complete sequence	534075-534106	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP022667	Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR2, complete sequence	185558-185589	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP021820	Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence	383601-383632	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP021831	Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence	305625-305656	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP021823	Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence	1371839-1371870	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP021814	Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence	1617867-1617898	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	CP007642	Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803a, complete sequence	352889-352920	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NC_010997	Rhizobium etli CIAT 652 plasmid pC, complete sequence	170059-170090	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP021795	Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence	917125-917156	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP021810	Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence	842365-842396	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP021806	Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence	961252-961283	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP021218	Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence	206831-206862	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP054616	Azospirillum oryzae strain KACC 14407 plasmid unnamed2, complete sequence	572665-572696	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP026527	Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence	56259-56290	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP022565	Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK01, complete sequence	814368-814399	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP022567	Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK03, complete sequence	79110-79141	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP019484	Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence	214721-214752	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP019487	Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence	5475-5506	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NC_020560	Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence	5427-5458	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP050086	Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b7, complete sequence	129990-130021	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP050087	Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b5, complete sequence	450799-450830	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	MK757446	Mycobacterium phage Candle, complete genome	9864-9895	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	KY969628	Mycobacterium phage Zenon, complete genome	9866-9897	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	MH001447	Mycobacterium phage Nilo, complete genome	9861-9892	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	MH926059	Mycobacterium phage Riparian, complete genome	9322-9353	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	JF704112	Mycobacterium phage Send513, complete sequence	9864-9895	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	MT684602	Mycobacterium phage Rope, complete genome	9514-9545	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NC_022053	Mycobacterium phage Papyrus, complete genome	9523-9554	10	0.688
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	KT591076	Mycobacterium phage Weiss13, complete genome	9553-9584	10	0.688
NC_003911_1	1.28\|2127895\|38\|NC_003911\|CRT	2127895-2127932	38	NC_006569	Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence	449118-449155	10	0.737
NC_003911_1	1.29\|2127955\|32\|NC_003911\|CRT	2127955-2127986	32	NC_015060	Granulicella tundricola MP5ACTX9 plasmid pACIX905, complete sequence	3937-3968	10	0.688
NC_003911_1	1.29\|2127955\|32\|NC_003911\|CRT	2127955-2127986	32	NC_020062	Rhizobium tropici CIAT 899 plasmid pRtrCIAT899c, complete sequence	372043-372074	10	0.688
NC_003911_1	1.31\|2128054\|32\|NC_003911\|CRT	2128054-2128085	32	NZ_CP032341	Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence	443082-443113	10	0.688
NC_003911_1	1.31\|2128054\|32\|NC_003911\|CRT	2128054-2128085	32	NZ_CP012916	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence	605526-605557	10	0.688
NC_003911_1	1.11\|2126878\|35\|NC_003911\|CRT	2126878-2126912	35	NC_006569	Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence	457317-457351	11	0.686
NC_003911_1	1.13\|2126980\|38\|NC_003911\|CRT	2126980-2127017	38	NZ_CP049244	Rhizobium pseudoryzae strain DSM 19479 plasmid unnamed3, complete sequence	330176-330213	11	0.711
NC_003911_1	1.13\|2126980\|38\|NC_003911\|CRT	2126980-2127017	38	NZ_CP007795	Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence	56499-56536	11	0.711
NC_003911_1	1.13\|2126980\|38\|NC_003911\|CRT	2126980-2127017	38	NC_013856	Azospirillum sp. B510 plasmid pAB510b, complete sequence	347303-347340	11	0.711
NC_003911_1	1.13\|2126980\|38\|NC_003911\|CRT	2126980-2127017	38	NC_013856	Azospirillum sp. B510 plasmid pAB510b, complete sequence	485850-485887	11	0.711
NC_003911_1	1.13\|2126980\|38\|NC_003911\|CRT	2126980-2127017	38	NZ_CP032323	Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence	108177-108214	11	0.711
NC_003911_1	1.19\|2127361\|32\|NC_003911\|CRT	2127361-2127392	32	MG757156	Mycobacterium phage Cuke, complete genome	44901-44932	11	0.656
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NC_012858	Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132502, complete sequence	59713-59744	11	0.656
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP050093	Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b5, complete sequence	358609-358640	11	0.656
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NC_008384	Rhizobium leguminosarum bv. viciae 3841 plasmid pRL11, complete sequence	525400-525431	11	0.656
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP013634	Rhizobium sp. N324 plasmid pRspN324d, complete sequence	357376-357407	11	0.656
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP054023	Rhizobium sp. JKLM12A2 plasmid pPR12A202, complete sequence	120240-120271	11	0.656
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NC_010998	Rhizobium etli CIAT 652 plasmid pA, complete sequence	316951-316982	11	0.656
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP054033	Rhizobium sp. JKLM13E plasmid pPR13E02, complete sequence	277511-277542	11	0.656
NC_003911_1	1.26\|2127769\|32\|NC_003911\|CRT	2127769-2127800	32	NZ_CP035001	Rhizobium acidisoli strain FH23 plasmid pRapFH23c, complete sequence	59314-59345	11	0.656
NC_003911_1	1.34\|2128234\|32\|NC_003911\|CRT	2128234-2128265	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	3171560-3171591	11	0.656
NC_003911_1	1.39\|2128540\|32\|NC_003911\|CRT	2128540-2128571	32	NZ_CP045296	Paenibacillus cellulositrophicus strain KACC 16577 plasmid unnamed1, complete sequence	446760-446791	11	0.656

1. spacer 1.10|2126833|23|NC_003911|CRT matches to NC_006569 (Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence) position: , mismatch: 2, identity: 0.913

agacgacgaaggcaacgaggaca	CRISPR spacer
agaagacgaaggcaacgaggacg	Protospacer
*** ******************.

2. spacer 1.10|2126833|23|NC_003911|CRT matches to NC_006569 (Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence) position: , mismatch: 2, identity: 0.913

agacgacgaaggcaacgaggaca	CRISPR spacer
ggacgacgaaggcgacgaggaca	Protospacer
.************.*********

3. spacer 1.10|2126833|23|NC_003911|CRT matches to NC_006569 (Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence) position: , mismatch: 2, identity: 0.913

agacgacgaaggcaacgaggaca	CRISPR spacer
aggcgacgaaggcaacgagggca	Protospacer
**.*****************.**

4. spacer 1.10|2126833|23|NC_003911|CRT matches to NC_006569 (Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence) position: , mismatch: 2, identity: 0.913

agacgacgaaggcaacgaggaca	CRISPR spacer
agaggacgaaggcaacgaagaca	Protospacer
*** **************.****

5. spacer 1.10|2126833|23|NC_003911|CRT matches to MT012730 (Salmonella phage vB_SenM-1, complete genome) position: , mismatch: 2, identity: 0.913

agacgacgaaggcaacgaggaca	CRISPR spacer
agacgacgaaggcaacgagtact	Protospacer
******************* **

6. spacer 1.10|2126833|23|NC_003911|CRT matches to NC_048763 (Salmonella phage SE13, complete genome) position: , mismatch: 2, identity: 0.913

agacgacgaaggcaacgaggaca	CRISPR spacer
agacgacgaaggcaacgagtact	Protospacer
******************* **

7. spacer 1.10|2126833|23|NC_003911|CRT matches to NZ_CP025552 (Streptomyces rimosus strain WT5260 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.913

agacgacgaaggcaacgaggaca	CRISPR spacer
aggcgacgaaggcaacgacgaca	Protospacer
**.*************** ****

8. spacer 1.10|2126833|23|NC_003911|CRT matches to MT936332 (Streptomyces phage phiRKBJ001, complete genome) position: , mismatch: 2, identity: 0.913

agacgacgaaggcaacgaggaca	CRISPR spacer
agacgacgaaggcaacgagtcca	Protospacer
*******************  **

9. spacer 1.12|2126935|23|NC_003911|CRT matches to NZ_CP013104 (Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.913

agacaacgaaggcaacgaaggcg	CRISPR spacer
aggcaacgaaggccacgaaggcg	Protospacer
**.********** *********

10. spacer 1.12|2126935|23|NC_003911|CRT matches to NC_006569 (Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence) position: , mismatch: 2, identity: 0.913

agacaacgaaggcaacgaaggcg	CRISPR spacer
agacgacgagggcaacgaaggcg	Protospacer
****.****.*************

11. spacer 1.12|2126935|23|NC_003911|CRT matches to NC_006569 (Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence) position: , mismatch: 2, identity: 0.913

agacaacgaaggcaacgaaggcg	CRISPR spacer
agccgacgaaggcaacgaaggcg	Protospacer
** *.******************

12. spacer 1.12|2126935|23|NC_003911|CRT matches to NC_006569 (Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence) position: , mismatch: 2, identity: 0.913

agacaacgaaggcaacgaaggcg	CRISPR spacer
agccaacgaaggcaacgagggcg	Protospacer
** ***************.****

13. spacer 1.18|2127316|23|NC_003911|CRT matches to NC_023606 (Mycobacterium phage CRB1, complete genome) position: , mismatch: 2, identity: 0.913

aaacgacgaggacgacgaaggca	CRISPR spacer
caccgacgaggacgacgaaggca	Protospacer
 * ********************

14. spacer 1.18|2127316|23|NC_003911|CRT matches to KT588442 (Mycobacterium phage LadyBird, complete genome) position: , mismatch: 2, identity: 0.913

aaacgacgaggacgacgaaggca	CRISPR spacer
gaccgacgaggacgacgaaggca	Protospacer
.* ********************

15. spacer 1.18|2127316|23|NC_003911|CRT matches to NC_030916 (Tsukamurella phage TPA4, complete genome) position: , mismatch: 2, identity: 0.913

aaacgacgaggacgacgaaggca	CRISPR spacer
caacgacgaggacgacgacggca	Protospacer
 ***************** ****

16. spacer 1.18|2127316|23|NC_003911|CRT matches to NC_006569 (Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence) position: , mismatch: 2, identity: 0.913

aaacgacgaggacgacgaaggca	CRISPR spacer
aaacaacgagggcgacgaaggca	Protospacer
****.******.***********

17. spacer 1.18|2127316|23|NC_003911|CRT matches to MK284521 (Gordonia phage Kiko, complete genome) position: , mismatch: 2, identity: 0.913

aaacgacgaggacgacgaaggca	CRISPR spacer
agacgacgaggacgacgacggca	Protospacer
*.**************** ****

18. spacer 1.20|2127415|23|NC_003911|CRT matches to NZ_CP054028 (Rhizobium sp. JKLM19E plasmid pPR19E01, complete sequence) position: , mismatch: 2, identity: 0.913

aaacgacgaagacaacgaattcg	CRISPR spacer
gaccgacgaagacaacgaattcg	Protospacer
.* ********************

19. spacer 1.30|2128009|23|NC_003911|CRT matches to NZ_CP017076 (Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence) position: , mismatch: 2, identity: 0.913

agccgacgaaggcgacgaagccg	CRISPR spacer
cgccgacgatggcgacgaagccg	Protospacer
 ******** *************

20. spacer 1.30|2128009|23|NC_003911|CRT matches to NZ_LR134446 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 4, complete sequence) position: , mismatch: 2, identity: 0.913

agccgacgaaggcgacgaagccg	CRISPR spacer
agccgacgacggcgacggagccg	Protospacer
********* *******.*****

21. spacer 1.30|2128009|23|NC_003911|CRT matches to NZ_CP032615 (Pseudomonas sp. DY-1 plasmid p.1, complete sequence) position: , mismatch: 2, identity: 0.913

agccgacgaaggcgacgaagccg	CRISPR spacer
agccgacgtaggtgacgaagccg	Protospacer
******** ***.**********

22. spacer 1.30|2128009|23|NC_003911|CRT matches to NZ_CP032615 (Pseudomonas sp. DY-1 plasmid p.1, complete sequence) position: , mismatch: 2, identity: 0.913

agccgacgaaggcgacgaagccg	CRISPR spacer
agccgacgtaggtgacgaagccg	Protospacer
******** ***.**********

23. spacer 1.30|2128009|23|NC_003911|CRT matches to MT081181 (Uncultured bacterium plasmid pCu_H_1, complete sequence) position: , mismatch: 2, identity: 0.913

agccgacgaaggcgacgaagccg	CRISPR spacer
agccgacgaaggcgatgacgccg	Protospacer
***************.** ****

24. spacer 1.30|2128009|23|NC_003911|CRT matches to NZ_CP025015 (Rhizobium leguminosarum strain Norway plasmid pRLN3, complete sequence) position: , mismatch: 2, identity: 0.913

agccgacgaaggcgacgaagccg	CRISPR spacer
agccgacgaagacgacgaagacg	Protospacer
***********.******** **

25. spacer 1.30|2128009|23|NC_003911|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 2, identity: 0.913

agccgacgaaggcgacgaagccg	CRISPR spacer
agccgaggaaggcgacgatgccg	Protospacer
****** *********** ****

26. spacer 1.30|2128009|23|NC_003911|CRT matches to NC_023285 (Streptomyces sp. F8 plasmid pFRL5, complete sequence) position: , mismatch: 2, identity: 0.913

agccgacgaaggcgacgaagccg	CRISPR spacer
agccggcgaaggcgccgaagccg	Protospacer
*****.******** ********

27. spacer 1.30|2128009|23|NC_003911|CRT matches to NC_006569 (Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence) position: , mismatch: 2, identity: 0.913

agccgacgaaggcgacgaagccg	CRISPR spacer
agctgacgaaggcgacgaaggcg	Protospacer
***.**************** **

28. spacer 1.30|2128009|23|NC_003911|CRT matches to NC_006569 (Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence) position: , mismatch: 2, identity: 0.913

agccgacgaaggcgacgaagccg	CRISPR spacer
agccgacgaaggcaacgaaggcg	Protospacer
*************.****** **

29. spacer 1.30|2128009|23|NC_003911|CRT matches to NC_006569 (Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence) position: , mismatch: 2, identity: 0.913

agccgacgaaggcgacgaagccg	CRISPR spacer
agacgacgaaggcgacgaagacg	Protospacer
** ***************** **

30. spacer 1.30|2128009|23|NC_003911|CRT matches to NZ_CP015881 (Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence) position: , mismatch: 2, identity: 0.913

agccgacgaaggcgacgaagccg	CRISPR spacer
agtcgacgacggcgacgaagccg	Protospacer
**.****** *************

31. spacer 1.30|2128009|23|NC_003911|CRT matches to NZ_CP023068 (Ensifer sojae CCBAU 05684 plasmid pSJ05684b, complete sequence) position: , mismatch: 2, identity: 0.913

agccgacgaaggcgacgaagccg	CRISPR spacer
agccgacggcggcgacgaagccg	Protospacer
********. *************

32. spacer 1.10|2126833|23|NC_003911|CRT matches to NZ_CP030864 (Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.87

agacgacgaaggcaacgaggaca	CRISPR spacer
ggacgacgaaggcgacgaggacc	Protospacer
.************.********

33. spacer 1.18|2127316|23|NC_003911|CRT matches to NZ_CP011869 (Pseudonocardia sp. HH130629-09 plasmid pLS1-1, complete sequence) position: , mismatch: 3, identity: 0.87

aaacgacgaggacgacgaaggca	CRISPR spacer
ctacgacgaggacgacgaaggcc	Protospacer
  ********************

34. spacer 1.18|2127316|23|NC_003911|CRT matches to NC_006569 (Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence) position: , mismatch: 3, identity: 0.87

aaacgacgaggacgacgaaggca	CRISPR spacer
gaacgacgagaacgacgaaggcg	Protospacer
.*********.***********.

35. spacer 1.18|2127316|23|NC_003911|CRT matches to NC_006569 (Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence) position: , mismatch: 3, identity: 0.87

aaacgacgaggacgacgaaggca	CRISPR spacer
aggcgacgaggacgacgaaggcg	Protospacer
*..*******************.

36. spacer 1.19|2127361|32|NC_003911|CRT matches to FJ168661 (Mycobacterium phage Gumball, complete genome) position: , mismatch: 3, identity: 0.906

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
ggacgacgaagacgacgaagacgacgaagacg	Protospacer
*************.***************.*.

37. spacer 1.19|2127361|32|NC_003911|CRT matches to JF937107 (Mycobacterium phage SirHarley, complete genome) position: , mismatch: 3, identity: 0.906

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
ggacgacgaagacgacgaagacgacgaagacg	Protospacer
*************.***************.*.

38. spacer 1.19|2127361|32|NC_003911|CRT matches to MH834615 (Mycobacterium phage KandZ, complete genome) position: , mismatch: 3, identity: 0.906

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
ggacgacgaagacgacgaagacgacgaagacg	Protospacer
*************.***************.*.

39. spacer 1.19|2127361|32|NC_003911|CRT matches to KP790011 (Gordonia phage Gsput1, complete genome) position: , mismatch: 3, identity: 0.906

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
cgacgacgaagacaacgaagacgacgaggcca	Protospacer
 **************************.* **

40. spacer 1.19|2127361|32|NC_003911|CRT matches to DQ398051 (Mycobacterium phage PLot, complete genome) position: , mismatch: 3, identity: 0.906

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
ggacgacgaagacgacgaagacgacgaagacg	Protospacer
*************.***************.*.

41. spacer 1.19|2127361|32|NC_003911|CRT matches to JN699014 (Mycobacterium phage Nova, complete genome) position: , mismatch: 3, identity: 0.906

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
ggacgacgaagacgacgaagacgacgaagacg	Protospacer
*************.***************.*.

42. spacer 1.20|2127415|23|NC_003911|CRT matches to NZ_CP020900 (Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5d, complete sequence) position: , mismatch: 3, identity: 0.87

aaacgacgaagacaacgaattcg	CRISPR spacer
ggccgacgaagacaacgaattcg	Protospacer
.. ********************

43. spacer 1.20|2127415|23|NC_003911|CRT matches to NZ_CP013536 (Rhizobium phaseoli strain R650 plasmid pRphaR650d, complete sequence) position: , mismatch: 3, identity: 0.87

aaacgacgaagacaacgaattcg	CRISPR spacer
ggccgacgaagacaacgaattcg	Protospacer
.. ********************

44. spacer 1.20|2127415|23|NC_003911|CRT matches to NZ_CP048283 (Rhizobium leguminosarum bv. viciae 248 plasmid pRle248c, complete sequence) position: , mismatch: 3, identity: 0.87

aaacgacgaagacaacgaattcg	CRISPR spacer
ggccgacgaagacaacgaattcg	Protospacer
.. ********************

45. spacer 1.20|2127415|23|NC_003911|CRT matches to NZ_CP013526 (Rhizobium phaseoli strain R744 plasmid pRphaR744d, complete sequence) position: , mismatch: 3, identity: 0.87

aaacgacgaagacaacgaattcg	CRISPR spacer
ggccgacgaagacaacgaattcg	Protospacer
.. ********************

46. spacer 1.20|2127415|23|NC_003911|CRT matches to NZ_CP013556 (Rhizobium phaseoli strain N931 plasmid pRphaN931d, complete sequence) position: , mismatch: 3, identity: 0.87

aaacgacgaagacaacgaattcg	CRISPR spacer
ggccgacgaagacaacgaattcg	Protospacer
.. ********************

47. spacer 1.20|2127415|23|NC_003911|CRT matches to NZ_CP013589 (Rhizobium phaseoli strain N161 plasmid pRphaN161d, complete sequence) position: , mismatch: 3, identity: 0.87

aaacgacgaagacaacgaattcg	CRISPR spacer
ggccgacgaagacaacgaattcg	Protospacer
.. ********************

48. spacer 1.20|2127415|23|NC_003911|CRT matches to NZ_CP013562 (Rhizobium phaseoli strain N841 plasmid pRphaN841e, complete sequence) position: , mismatch: 3, identity: 0.87

aaacgacgaagacaacgaattcg	CRISPR spacer
ggccgacgaagacaacgaattcg	Protospacer
.. ********************

49. spacer 1.20|2127415|23|NC_003911|CRT matches to NZ_CP013579 (Rhizobium phaseoli strain N671 plasmid pRphaN671e, complete sequence) position: , mismatch: 3, identity: 0.87

aaacgacgaagacaacgaattcg	CRISPR spacer
ggccgacgaagacaacgaattcg	Protospacer
.. ********************

50. spacer 1.20|2127415|23|NC_003911|CRT matches to NZ_CP007050 (Rhizobium leguminosarum bv. trifolii WSM1689 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.87

aaacgacgaagacaacgaattcg	CRISPR spacer
ggccgacgaagacaacgaattcg	Protospacer
.. ********************

51. spacer 1.20|2127415|23|NC_003911|CRT matches to NZ_CP013531 (Rhizobium phaseoli strain R723 plasmid pRphaR723d, complete sequence) position: , mismatch: 3, identity: 0.87

aaacgacgaagacaacgaattcg	CRISPR spacer
ggccgacgaagacaacgaattcg	Protospacer
.. ********************

52. spacer 1.20|2127415|23|NC_003911|CRT matches to NZ_CP013541 (Rhizobium phaseoli strain R630 plasmid pRphaR630d, complete sequence) position: , mismatch: 3, identity: 0.87

aaacgacgaagacaacgaattcg	CRISPR spacer
ggccgacgaagacaacgaattcg	Protospacer
.. ********************

53. spacer 1.20|2127415|23|NC_003911|CRT matches to NZ_CP013546 (Rhizobium phaseoli strain R620 plasmid pRphaR620d, complete sequence) position: , mismatch: 3, identity: 0.87

aaacgacgaagacaacgaattcg	CRISPR spacer
ggccgacgaagacaacgaattcg	Protospacer
.. ********************

54. spacer 1.20|2127415|23|NC_003911|CRT matches to NZ_CP013567 (Rhizobium phaseoli strain N831 plasmid pRphaN831d, complete sequence) position: , mismatch: 3, identity: 0.87

aaacgacgaagacaacgaattcg	CRISPR spacer
ggccgacgaagacaacgaattcg	Protospacer
.. ********************

55. spacer 1.20|2127415|23|NC_003911|CRT matches to NZ_CP013584 (Rhizobium phaseoli strain N261 plasmid pRphaN261d, complete sequence) position: , mismatch: 3, identity: 0.87

aaacgacgaagacaacgaattcg	CRISPR spacer
ggccgacgaagacaacgaattcg	Protospacer
.. ********************

56. spacer 1.20|2127415|23|NC_003911|CRT matches to NZ_CP013573 (Rhizobium phaseoli strain N771 plasmid pRphaN771e, complete sequence) position: , mismatch: 3, identity: 0.87

aaacgacgaagacaacgaattcg	CRISPR spacer
ggccgacgaagacaacgaattcg	Protospacer
.. ********************

57. spacer 1.20|2127415|23|NC_003911|CRT matches to NC_010997 (Rhizobium etli CIAT 652 plasmid pC, complete sequence) position: , mismatch: 3, identity: 0.87

aaacgacgaagacaacgaattcg	CRISPR spacer
ggccgacgaagacaacgaattcg	Protospacer
.. ********************

58. spacer 1.20|2127415|23|NC_003911|CRT matches to NZ_CP030829 (Neorhizobium sp. NCHU2750 plasmid pNCHU2750b, complete sequence) position: , mismatch: 3, identity: 0.87

aaacgacgaagacaacgaattcg	CRISPR spacer
tcacgacgaagagaacgaattcg	Protospacer
  ********** **********

59. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP049157 (Caballeronia sp. SBC1 plasmid pSBC1_1, complete sequence) position: , mismatch: 3, identity: 0.906

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
aggtgacgaagacgacgaattcgacgaattcg	Protospacer
***.************************  **

60. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP049317 (Caballeronia sp. SBC2 plasmid pSBC2-1, complete sequence) position: , mismatch: 3, identity: 0.906

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
aggtgacgaagacgacgaattcgacgaattcg	Protospacer
***.************************  **

61. spacer 1.30|2128009|23|NC_003911|CRT matches to NC_010494 (Arthrobacter sp. AK-1 plasmid pSI-1, complete sequence) position: , mismatch: 3, identity: 0.87

agccgacgaaggcgacgaagccg	CRISPR spacer
ctccgacgaaggcgacgcagccg	Protospacer
  *************** *****

62. spacer 1.30|2128009|23|NC_003911|CRT matches to NZ_AP014579 (Burkholderia sp. RPE67 plasmid p1, complete sequence) position: , mismatch: 3, identity: 0.87

agccgacgaaggcgacgaagccg	CRISPR spacer
cgccgacgaaggcgacgaaacca	Protospacer
 ******************.**.

63. spacer 1.30|2128009|23|NC_003911|CRT matches to NC_016626 (Burkholderia sp. YI23 plasmid byi_1p, complete sequence) position: , mismatch: 3, identity: 0.87

agccgacgaaggcgacgaagccg	CRISPR spacer
cgccgacgaaggcgacgaaacca	Protospacer
 ******************.**.

64. spacer 1.30|2128009|23|NC_003911|CRT matches to NC_021910 (Rhizobium etli bv. mimosae str. Mim1 plasmid pRetNIM1c, complete sequence) position: , mismatch: 3, identity: 0.87

agccgacgaaggcgacgaagccg	CRISPR spacer
tgccgacgaaggcgaagaagcct	Protospacer
 ************** ******

65. spacer 1.36|2128360|41|NC_003911|CRT matches to NC_006569 (Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence) position: , mismatch: 3, identity: 0.927

agacgacgagggcgacgaaaacgacgaggacgacgaaaaca	CRISPR spacer
aaacgacgagggcaacgaaaacgacgagggcgacgaaaaca	Protospacer
*.***********.***************.***********

66. spacer 1.10|2126833|23|NC_003911|CRT matches to NZ_AP022319 (Burkholderia sp. THE68 plasmid BTHE68_p1, complete sequence) position: , mismatch: 4, identity: 0.826

agacgacgaaggcaacgaggaca	CRISPR spacer
tgacgacgaaggcaacgaggttg	Protospacer
 ******************* ..

67. spacer 1.10|2126833|23|NC_003911|CRT matches to MN693896 (Marine virus AFVG_250M448, complete genome) position: , mismatch: 4, identity: 0.826

agacgacgaaggcaacgaggaca	CRISPR spacer
agacgacgaaggcaacgagacgg	Protospacer
*******************.  .

68. spacer 1.12|2126935|23|NC_003911|CRT matches to NC_006569 (Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence) position: , mismatch: 4, identity: 0.826

agacaacgaaggcaacgaaggcg	CRISPR spacer
tcacaacgaaggcaacgaaggaa	Protospacer
  ******************* .

69. spacer 1.18|2127316|23|NC_003911|CRT matches to NZ_CP025188 (Roseomonas mucosa strain AD2 plasmid p1-AD2, complete sequence) position: , mismatch: 4, identity: 0.826

aaacgacgaggacgacgaaggca	CRISPR spacer
ggccgacgaggacgacgaaggcg	Protospacer
.. *******************.

70. spacer 1.18|2127316|23|NC_003911|CRT matches to NZ_CP024582 (Roseomonas sp. FDAARGOS_362 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.826

aaacgacgaggacgacgaaggca	CRISPR spacer
ggccgacgaggacgacgaaggcg	Protospacer
.. *******************.

71. spacer 1.19|2127361|32|NC_003911|CRT matches to FJ168661 (Mycobacterium phage Gumball, complete genome) position: , mismatch: 4, identity: 0.875

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
agacgacgaagacgacgaagacgacgaagacg	Protospacer
.************.***************.*.

72. spacer 1.19|2127361|32|NC_003911|CRT matches to FJ168661 (Mycobacterium phage Gumball, complete genome) position: , mismatch: 4, identity: 0.875

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
agacgacgaagacgacgaagacgacgaagacg	Protospacer
.************.***************.*.

73. spacer 1.19|2127361|32|NC_003911|CRT matches to FJ168661 (Mycobacterium phage Gumball, complete genome) position: , mismatch: 4, identity: 0.875

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
agacgacgaagacgacgaagacgacgaagacg	Protospacer
.************.***************.*.

74. spacer 1.19|2127361|32|NC_003911|CRT matches to FJ168661 (Mycobacterium phage Gumball, complete genome) position: , mismatch: 4, identity: 0.875

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
agacgacgaagacgacgaagacgacgaagacg	Protospacer
.************.***************.*.

75. spacer 1.19|2127361|32|NC_003911|CRT matches to JF937107 (Mycobacterium phage SirHarley, complete genome) position: , mismatch: 4, identity: 0.875

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
agacgacgaagacgacgaagacgacgaagacg	Protospacer
.************.***************.*.

76. spacer 1.19|2127361|32|NC_003911|CRT matches to JF937107 (Mycobacterium phage SirHarley, complete genome) position: , mismatch: 4, identity: 0.875

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
agacgacgaagacgacgaagacgacgaagacg	Protospacer
.************.***************.*.

77. spacer 1.19|2127361|32|NC_003911|CRT matches to JF937107 (Mycobacterium phage SirHarley, complete genome) position: , mismatch: 4, identity: 0.875

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
agacgacgaagacgacgaagacgacgaagacg	Protospacer
.************.***************.*.

78. spacer 1.19|2127361|32|NC_003911|CRT matches to JF937107 (Mycobacterium phage SirHarley, complete genome) position: , mismatch: 4, identity: 0.875

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
agacgacgaagacgacgaagacgacgaagacg	Protospacer
.************.***************.*.

79. spacer 1.19|2127361|32|NC_003911|CRT matches to MH834615 (Mycobacterium phage KandZ, complete genome) position: , mismatch: 4, identity: 0.875

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
agacgacgaagacgacgaagacgacgaagacg	Protospacer
.************.***************.*.

80. spacer 1.19|2127361|32|NC_003911|CRT matches to DQ398051 (Mycobacterium phage PLot, complete genome) position: , mismatch: 4, identity: 0.875

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
agacgacgaagacgacgaagacgacgaagacg	Protospacer
.************.***************.*.

81. spacer 1.19|2127361|32|NC_003911|CRT matches to JN699014 (Mycobacterium phage Nova, complete genome) position: , mismatch: 4, identity: 0.875

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
agacgacgaagacgacgaagacgacgaagacg	Protospacer
.************.***************.*.

82. spacer 1.19|2127361|32|NC_003911|CRT matches to JN699014 (Mycobacterium phage Nova, complete genome) position: , mismatch: 4, identity: 0.875

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
agacgacgaagacgacgaagacgacgaagacg	Protospacer
.************.***************.*.

83. spacer 1.19|2127361|32|NC_003911|CRT matches to JN699014 (Mycobacterium phage Nova, complete genome) position: , mismatch: 4, identity: 0.875

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
agacgacgaagacgacgaagacgacgaagacg	Protospacer
.************.***************.*.

84. spacer 1.19|2127361|32|NC_003911|CRT matches to NC_006569 (Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence) position: , mismatch: 4, identity: 0.875

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
aggcgacgaggacaacgaagacgacgaaggcg	Protospacer
.*.******.*********************.

85. spacer 1.19|2127361|32|NC_003911|CRT matches to JQ807250 (Environmental Halophage eHP-31, partial genome) position: , mismatch: 4, identity: 0.875

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
cgacgacgaagacgacgaagacgacgaagacg	Protospacer
 ************.***************.*.

86. spacer 1.19|2127361|32|NC_003911|CRT matches to JQ807250 (Environmental Halophage eHP-31, partial genome) position: , mismatch: 4, identity: 0.875

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
agacgacgaagacgacgaagacgacgaagacg	Protospacer
.************.***************.*.

87. spacer 1.19|2127361|32|NC_003911|CRT matches to NC_027120 (Lactococcus phage 1358, complete sequence) position: , mismatch: 4, identity: 0.875

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
agacgacgaagacgacgaagacgacgaagacg	Protospacer
.************.***************.*.

88. spacer 1.19|2127361|32|NC_003911|CRT matches to NC_027120 (Lactococcus phage 1358, complete sequence) position: , mismatch: 4, identity: 0.875

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
agacgacgaagacgacgaagacgacgaagacg	Protospacer
.************.***************.*.

89. spacer 1.19|2127361|32|NC_003911|CRT matches to NC_027120 (Lactococcus phage 1358, complete sequence) position: , mismatch: 4, identity: 0.875

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
agacgacgaagacgacgaagacgacgaagtct	Protospacer
.************.*************** *

90. spacer 1.19|2127361|32|NC_003911|CRT matches to MN119378 (Mycobacterium phage Penelope2018, complete genome) position: , mismatch: 4, identity: 0.875

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
ggacgacgaagacgacgaagacgacgaggacg	Protospacer
*************.*************.*.*.

91. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP013586 (Rhizobium phaseoli strain N161 plasmid pRphaN161a, complete sequence) position: , mismatch: 4, identity: 0.875

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaattcgccggaggcg	Protospacer
.* ******************** **.*****

92. spacer 1.34|2128234|32|NC_003911|CRT matches to NC_006569 (Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence) position: , mismatch: 4, identity: 0.875

aggcaatgaaggcaatgagaacgacgagctcg	CRISPR spacer
aggcaacgaaggcaacgagaacgacgagaacg	Protospacer
******.********.************  **

93. spacer 1.7|2126674|32|NC_003911|CRT matches to NC_006569 (Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence) position: , mismatch: 5, identity: 0.844

gggtaacgagggcgacgaaggtaacgaggacg	CRISPR spacer
gggcaacgagggcgacgaaggcaacgagggta	Protospacer
***.*****************.*******...

94. spacer 1.19|2127361|32|NC_003911|CRT matches to FJ168661 (Mycobacterium phage Gumball, complete genome) position: , mismatch: 5, identity: 0.844

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
agacgacgaagacgacgaagacgacgaggacg	Protospacer
.************.*************.*.*.

95. spacer 1.19|2127361|32|NC_003911|CRT matches to JF937107 (Mycobacterium phage SirHarley, complete genome) position: , mismatch: 5, identity: 0.844

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
agacgacgaagacgacgaagacgacgaggacg	Protospacer
.************.*************.*.*.

96. spacer 1.19|2127361|32|NC_003911|CRT matches to DQ398051 (Mycobacterium phage PLot, complete genome) position: , mismatch: 5, identity: 0.844

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
agacgacgaagacgacgaagacgacgaggacg	Protospacer
.************.*************.*.*.

97. spacer 1.19|2127361|32|NC_003911|CRT matches to JN699014 (Mycobacterium phage Nova, complete genome) position: , mismatch: 5, identity: 0.844

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
agacgacgaagacgacgaagacgacgaggacg	Protospacer
.************.*************.*.*.

98. spacer 1.19|2127361|32|NC_003911|CRT matches to MH121069 (Pseudomonas phage vB_PaeM_PA5oct, complete genome) position: , mismatch: 5, identity: 0.844

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
cgacgacgaagacgacgaagacgacgaagatc	Protospacer
 ************.***************..

99. spacer 1.19|2127361|32|NC_003911|CRT matches to MH460460 (Dickeya phage vB_DsoM_JA13, complete genome) position: , mismatch: 5, identity: 0.844

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
cgacgacgaagacgacgaagacgacgaagagg	Protospacer
 ************.***************. .

100. spacer 1.19|2127361|32|NC_003911|CRT matches to MH460460 (Dickeya phage vB_DsoM_JA13, complete genome) position: , mismatch: 5, identity: 0.844

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
ggacgacgaagacgaagaagacgacgaagatg	Protospacer
*************.* *************...

101. spacer 1.19|2127361|32|NC_003911|CRT matches to NZ_CP029455 (Bacillus cereus strain FORC087 plasmid pFORC087.1, complete sequence) position: , mismatch: 5, identity: 0.844

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
ggacgacgaagacgacgaagacgaagaagaag	Protospacer
*************.********** ****. .

102. spacer 1.19|2127361|32|NC_003911|CRT matches to MN119378 (Mycobacterium phage Penelope2018, complete genome) position: , mismatch: 5, identity: 0.844

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
cgaggacgaagacgacgaagacgacgaagacg	Protospacer
 ** *********.***************.*.

103. spacer 1.19|2127361|32|NC_003911|CRT matches to NC_049851 (Burkholderia phage BcepSauron, complete genome) position: , mismatch: 5, identity: 0.844

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
tgacgacgaagacgaagaagacgacgaagacg	Protospacer
 ************.* *************.*.

104. spacer 1.19|2127361|32|NC_003911|CRT matches to NC_049851 (Burkholderia phage BcepSauron, complete genome) position: , mismatch: 5, identity: 0.844

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
agaagacgaagacgacgaagacgacgaagacg	Protospacer
.** *********.***************.*.

105. spacer 1.19|2127361|32|NC_003911|CRT matches to NZ_CP053953 (Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.844

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
agacgaagaagagaacgaagacgacgaagacg	Protospacer
.***** ***** ****************.*.

106. spacer 1.19|2127361|32|NC_003911|CRT matches to NZ_CP053950 (Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.844

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
agacgaagaagagaacgaagacgacgaagacg	Protospacer
.***** ***** ****************.*.

107. spacer 1.19|2127361|32|NC_003911|CRT matches to MK524498 (Mycobacterium phage Chill, complete genome) position: , mismatch: 5, identity: 0.844

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
cgaagacgaagacgacgaagacgacgaagacg	Protospacer
 ** *********.***************.*.

108. spacer 1.19|2127361|32|NC_003911|CRT matches to MK524498 (Mycobacterium phage Chill, complete genome) position: , mismatch: 5, identity: 0.844

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
agacgacgaagacgacgaagacgacgaggacg	Protospacer
.************.*************.*.*.

109. spacer 1.19|2127361|32|NC_003911|CRT matches to MK494102 (Mycobacterium phage WaldoWhy, complete genome) position: , mismatch: 5, identity: 0.844

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
cgaagacgaagacgacgaagacgacgaagacg	Protospacer
 ** *********.***************.*.

110. spacer 1.19|2127361|32|NC_003911|CRT matches to MK494102 (Mycobacterium phage WaldoWhy, complete genome) position: , mismatch: 5, identity: 0.844

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
agacgacgaagacgacgaagacgacgaggacg	Protospacer
.************.*************.*.*.

111. spacer 1.19|2127361|32|NC_003911|CRT matches to KJ194582 (Mycobacterium phage Hawkeye, complete genome) position: , mismatch: 5, identity: 0.844

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
agacgaggaagacgacgaagacgacgaagacg	Protospacer
.***** ******.***************.*.

112. spacer 1.19|2127361|32|NC_003911|CRT matches to KC292029 (Halovirus HCTV-1, complete genome) position: , mismatch: 5, identity: 0.844

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
cgacaacgacgacaacgaagacgacgaagacg	Protospacer
 ***.**** *******************.*.

113. spacer 1.26|2127769|32|NC_003911|CRT matches to NC_007764 (Rhizobium etli CFN 42 plasmid p42c, complete sequence) position: , mismatch: 5, identity: 0.844

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaattcgccggaggca	Protospacer
.* ******************** **.****.

114. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP020908 (Rhizobium etli strain NXC12 plasmid pRetNXC12b, complete sequence) position: , mismatch: 5, identity: 0.844

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaattcgccggaggca	Protospacer
.* ******************** **.****.

115. spacer 1.26|2127769|32|NC_003911|CRT matches to NC_021907 (Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1b, complete sequence) position: , mismatch: 5, identity: 0.844

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaattcgccggaggca	Protospacer
.* ******************** **.****.

116. spacer 1.31|2128054|32|NC_003911|CRT matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 5, identity: 0.844

aggcaacgaaggtgacgaagccgacgaaggcg	CRISPR spacer
tggacacgccggtgacgaagccgacgaaggcg	Protospacer
 **  ***  **********************

117. spacer 1.31|2128054|32|NC_003911|CRT matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 5, identity: 0.844

aggcaacgaaggtgacgaagccgacgaaggcg	CRISPR spacer
tggacacgccggtgacgaagccgacgaaggcg	Protospacer
 **  ***  **********************

118. spacer 1.36|2128360|41|NC_003911|CRT matches to NC_006569 (Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence) position: , mismatch: 5, identity: 0.878

agacgacgagggcgacgaaaacgacgaggacgacgaaaaca	CRISPR spacer
gggcgacgagggcgacgaaaacgacgagggcaacgaaaacg	Protospacer
.*.**************************.*.********.

119. spacer 1.36|2128360|41|NC_003911|CRT matches to NC_006569 (Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence) position: , mismatch: 5, identity: 0.878

agacgacgagggcgacgaaaacgacgaggacgacgaaaaca	CRISPR spacer
agacgacgagggcgacgaagacgacgagggcgacgaatccc	Protospacer
*******************.*********.*******  *

120. spacer 1.36|2128360|41|NC_003911|CRT matches to NC_006569 (Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence) position: , mismatch: 5, identity: 0.878

agacgacgagggcgacgaaaacgacgaggacgacgaaaaca	CRISPR spacer
aaacgacgagggcgacgaaaacaacgagggcgacgaaggca	Protospacer
*.********************.******.*******..**

121. spacer 1.7|2126674|32|NC_003911|CRT matches to NC_006569 (Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence) position: , mismatch: 6, identity: 0.812

gggtaacgagggcgacgaaggtaacgaggacg	CRISPR spacer
gaataacgaagccgacgaaggtaacgagttcg	Protospacer
*..******.* ****************  **

122. spacer 1.13|2126980|38|NC_003911|CRT matches to NC_048053 (Dickeya phage vB_DsoM_JA29, complete genome) position: , mismatch: 6, identity: 0.842

aggcaacgaagacggcggcgacgaaggcgacgaagaca	CRISPR spacer
cgacgacgaagacggcgacgacgaagacgacgaagacg	Protospacer
 *.*.************.********.**********.

123. spacer 1.19|2127361|32|NC_003911|CRT matches to FJ168661 (Mycobacterium phage Gumball, complete genome) position: , mismatch: 6, identity: 0.812

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
agacgacgaagacgacgaggacgacgaggacg	Protospacer
.************.****.********.*.*.

124. spacer 1.19|2127361|32|NC_003911|CRT matches to JF937107 (Mycobacterium phage SirHarley, complete genome) position: , mismatch: 6, identity: 0.812

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
agacgacgaagacgacgaggacgacgaggacg	Protospacer
.************.****.********.*.*.

125. spacer 1.19|2127361|32|NC_003911|CRT matches to MH834615 (Mycobacterium phage KandZ, complete genome) position: , mismatch: 6, identity: 0.812

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
agacgacgaagacgacgaagacgaagacgacg	Protospacer
.************.********** ** *.*.

126. spacer 1.19|2127361|32|NC_003911|CRT matches to JN699014 (Mycobacterium phage Nova, complete genome) position: , mismatch: 6, identity: 0.812

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
agacgacgaagacgacgaggacgacgaggacg	Protospacer
.************.****.********.*.*.

127. spacer 1.19|2127361|32|NC_003911|CRT matches to MH460460 (Dickeya phage vB_DsoM_JA13, complete genome) position: , mismatch: 6, identity: 0.812

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
agacgacgaagacgacgaagaggacgaagagg	Protospacer
.************.******* *******. .

128. spacer 1.19|2127361|32|NC_003911|CRT matches to MH460460 (Dickeya phage vB_DsoM_JA13, complete genome) position: , mismatch: 6, identity: 0.812

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
cgacgacgaagacgacgaagacgaagacgacg	Protospacer
 ************.********** ** *.*.

129. spacer 1.19|2127361|32|NC_003911|CRT matches to MH460460 (Dickeya phage vB_DsoM_JA13, complete genome) position: , mismatch: 6, identity: 0.812

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
cgacgacgaagacgacgaagacggcgacgacg	Protospacer
 ************.*********.*** *.*.

130. spacer 1.19|2127361|32|NC_003911|CRT matches to MH460460 (Dickeya phage vB_DsoM_JA13, complete genome) position: , mismatch: 6, identity: 0.812

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
cgacgacgaagacgacgaagacgaagacgacg	Protospacer
 ************.********** ** *.*.

131. spacer 1.19|2127361|32|NC_003911|CRT matches to MN119378 (Mycobacterium phage Penelope2018, complete genome) position: , mismatch: 6, identity: 0.812

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
agacgacgaagacgacgaagacgaggacgacg	Protospacer
.************.********** ** *.*.

132. spacer 1.19|2127361|32|NC_003911|CRT matches to NC_049851 (Burkholderia phage BcepSauron, complete genome) position: , mismatch: 6, identity: 0.812

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
agacgacgaagacgacgaagacgacgaaccgg	Protospacer
.************.**************   .

133. spacer 1.19|2127361|32|NC_003911|CRT matches to NZ_CP016589 (Bacillus thuringiensis strain KNU-07 plasmid pBTKNU07-01, complete sequence) position: , mismatch: 6, identity: 0.812

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
agacgacgaagacgaagaagacgacgaagagg	Protospacer
.************.* *************. .

134. spacer 1.19|2127361|32|NC_003911|CRT matches to NC_048053 (Dickeya phage vB_DsoM_JA29, complete genome) position: , mismatch: 6, identity: 0.812

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
cgacgacgaagacgacgaagacgacgacgaag	Protospacer
 ************.************* *. .

135. spacer 1.19|2127361|32|NC_003911|CRT matches to NC_048053 (Dickeya phage vB_DsoM_JA29, complete genome) position: , mismatch: 6, identity: 0.812

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
cgacgacgaagacgacgaagacggcgacgacg	Protospacer
 ************.*********.*** *.*.

136. spacer 1.19|2127361|32|NC_003911|CRT matches to KJ194582 (Mycobacterium phage Hawkeye, complete genome) position: , mismatch: 6, identity: 0.812

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
agacgacgaagacgacgaagacgaggaagagg	Protospacer
.************.********** ****. .

137. spacer 1.19|2127361|32|NC_003911|CRT matches to MK450421 (Streptomyces phage Vash, complete genome) position: , mismatch: 6, identity: 0.812

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
cgacgacgaagaccacgaagaccacgaagaag	Protospacer
 ************ ******** ******. .

138. spacer 1.19|2127361|32|NC_003911|CRT matches to NZ_CP012940 (Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
agacgacgaagacgacgaagacgaggaggacg	Protospacer
.************.********** **.*.*.

139. spacer 1.19|2127361|32|NC_003911|CRT matches to NZ_CP012944 (Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
agacgacgaagacgacgaagacgaggaggacg	Protospacer
.************.********** **.*.*.

140. spacer 1.19|2127361|32|NC_003911|CRT matches to NC_017575 (Ralstonia solanacearum Po82 megaplasmid, complete sequence) position: , mismatch: 6, identity: 0.812

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
agacgacgaagacgacgaagacgaggaggacg	Protospacer
.************.********** **.*.*.

141. spacer 1.19|2127361|32|NC_003911|CRT matches to NZ_CP026308 (Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
agacgacgaagacgacgaagacgaggaggacg	Protospacer
.************.********** **.*.*.

142. spacer 1.19|2127361|32|NC_003911|CRT matches to NZ_CP051295 (Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence) position: , mismatch: 6, identity: 0.812

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
agacgacgaagacgacgaagacgaggaggacg	Protospacer
.************.********** **.*.*.

143. spacer 1.19|2127361|32|NC_003911|CRT matches to NC_010811 (Ralstonia phage RSL1, complete genome) position: , mismatch: 6, identity: 0.812

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
ggacgacgaagacgacgaagacggcgatgatg	Protospacer
*************.*********.*** *...

144. spacer 1.19|2127361|32|NC_003911|CRT matches to MN094788 (Achromobacter phage Motura, complete genome) position: , mismatch: 6, identity: 0.812

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
cgacgacgaagacgacgaagacgaggatgacg	Protospacer
 ************.********** ** *.*.

145. spacer 1.19|2127361|32|NC_003911|CRT matches to AB366653 (Ralstonia phage RSL1 DNA, complete genome) position: , mismatch: 6, identity: 0.812

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
ggacgacgaagacgacgaagacggcgatgatg	Protospacer
*************.*********.*** *...

146. spacer 1.19|2127361|32|NC_003911|CRT matches to MK305891 (Streptomyces phage Gibson, complete genome) position: , mismatch: 6, identity: 0.812

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
ggacgacgaagacgacgatgacgacgacgagg	Protospacer
*************.**** ******** *. .

147. spacer 1.19|2127361|32|NC_003911|CRT matches to MH248138 (Erwinia phage vB_EamM_Alexandra, complete genome) position: , mismatch: 6, identity: 0.812

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
ggacgacgaagacgacgaagacggcgacgatg	Protospacer
*************.*********.*** *...

148. spacer 1.19|2127361|32|NC_003911|CRT matches to MH389777 (Dickeya phage vB_DsoM_JA11, complete genome) position: , mismatch: 6, identity: 0.812

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
cgacgacgaagacgacgaagacggcgacgacg	Protospacer
 ************.*********.*** *.*.

149. spacer 1.19|2127361|32|NC_003911|CRT matches to MH389777 (Dickeya phage vB_DsoM_JA11, complete genome) position: , mismatch: 6, identity: 0.812

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
cgacgacgaagacgacgaagacgaagacgacg	Protospacer
 ************.********** ** *.*.

150. spacer 1.19|2127361|32|NC_003911|CRT matches to MH389777 (Dickeya phage vB_DsoM_JA11, complete genome) position: , mismatch: 6, identity: 0.812

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
cgacgacgaagacgacgaagacgaagacgacg	Protospacer
 ************.********** ** *.*.

151. spacer 1.19|2127361|32|NC_003911|CRT matches to MH460462 (Dickeya phage vB_DsoM_JA33, complete genome) position: , mismatch: 6, identity: 0.812

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
cgacgacgaagacgacgaagacggcgacgacg	Protospacer
 ************.*********.*** *.*.

152. spacer 1.19|2127361|32|NC_003911|CRT matches to MH460462 (Dickeya phage vB_DsoM_JA33, complete genome) position: , mismatch: 6, identity: 0.812

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
cgacgacgaagacgacgaagacgaagacgacg	Protospacer
 ************.********** ** *.*.

153. spacer 1.19|2127361|32|NC_003911|CRT matches to NC_049850 (Burkholderia phage BcepSaruman, complete genome) position: , mismatch: 6, identity: 0.812

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
cgacgacgaagacgacgaagaagacgaggacg	Protospacer
 ************.******* *****.*.*.

154. spacer 1.25|2127715|32|NC_003911|CRT matches to NZ_CP020952 (Rhizobium sp. CIAT894 plasmid pRheCIAT894e, complete sequence) position: , mismatch: 6, identity: 0.812

----ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
atccggacg----gtccgacgaagacgacgaattcg	Protospacer
    *****    **.*******.************

155. spacer 1.26|2127769|32|NC_003911|CRT matches to MH460460 (Dickeya phage vB_DsoM_JA13, complete genome) position: , mismatch: 6, identity: 0.812

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
cgacgacgaagacgacgaagacgacgaagagg	Protospacer
 *.****************  ********. *

156. spacer 1.31|2128054|32|NC_003911|CRT matches to NZ_CP013600 (Rhizobium sp. N741 plasmid pRspN741e, complete sequence) position: , mismatch: 6, identity: 0.812

aggcaacgaaggtgacgaagccgacgaaggcg	CRISPR spacer
agagagcgaaggtgacgaagacgacgatggcc	Protospacer
**. *.************** ****** ***

157. spacer 1.31|2128054|32|NC_003911|CRT matches to NZ_CP013504 (Rhizobium esperanzae strain N561 plasmid pRspN561d, complete sequence) position: , mismatch: 6, identity: 0.812

aggcaacgaaggtgacgaagccgacgaaggcg	CRISPR spacer
agagagcgaaggtgacgaagacgacgatggcc	Protospacer
**. *.************** ****** ***

158. spacer 1.31|2128054|32|NC_003911|CRT matches to NZ_CP013510 (Rhizobium sp. N1341 plasmid pRspN1341e, complete sequence) position: , mismatch: 6, identity: 0.812

aggcaacgaaggtgacgaagccgacgaaggcg	CRISPR spacer
agagagcgaaggtgacgaagacgacgatggcc	Protospacer
**. *.************** ****** ***

159. spacer 1.31|2128054|32|NC_003911|CRT matches to NZ_CP013521 (Rhizobium sp. N113 plasmid pRspN113d, complete sequence) position: , mismatch: 6, identity: 0.812

aggcaacgaaggtgacgaagccgacgaaggcg	CRISPR spacer
agagagcgaaggtgacgaagacgacgatggcc	Protospacer
**. *.************** ****** ***

160. spacer 1.31|2128054|32|NC_003911|CRT matches to NZ_CP013494 (Rhizobium sp. N6212 plasmid pRspN6212d, complete sequence) position: , mismatch: 6, identity: 0.812

aggcaacgaaggtgacgaagccgacgaaggcg	CRISPR spacer
agagagcgaaggtgacgaagacgacgatggcc	Protospacer
**. *.************** ****** ***

161. spacer 1.31|2128054|32|NC_003911|CRT matches to NZ_CP013594 (Rhizobium sp. N871 plasmid pRspN871d, complete sequence) position: , mismatch: 6, identity: 0.812

aggcaacgaaggtgacgaagccgacgaaggcg	CRISPR spacer
agagagcgaaggtgacgaagacgacgatggcc	Protospacer
**. *.************** ****** ***

162. spacer 1.31|2128054|32|NC_003911|CRT matches to NZ_CP027023 (Streptomyces sp. WAC00288 plasmid p1, complete sequence) position: , mismatch: 6, identity: 0.812

---aggcaacgaaggtgacgaagccgacgaaggcg	CRISPR spacer
tccagg---ccaagctgacgaagctgacgaaggcg	Protospacer
   ***   * *** *********.**********

163. spacer 1.7|2126674|32|NC_003911|CRT matches to NC_006569 (Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence) position: , mismatch: 7, identity: 0.781

gggtaacgagggcgacgaaggtaacgaggacg	CRISPR spacer
aaacaacgagggcgacgaaggcaacgaggata	Protospacer
....*****************.********..

164. spacer 1.13|2126980|38|NC_003911|CRT matches to NC_010811 (Ralstonia phage RSL1, complete genome) position: , mismatch: 7, identity: 0.816

aggcaacgaagacggcggcgacgaaggcgacgaagaca	CRISPR spacer
tgatgacgaagacggcgacgacgaagacgacgaagacg	Protospacer
 *...************.********.**********.

165. spacer 1.13|2126980|38|NC_003911|CRT matches to AB366653 (Ralstonia phage RSL1 DNA, complete genome) position: , mismatch: 7, identity: 0.816

aggcaacgaagacggcggcgacgaaggcgacgaagaca	CRISPR spacer
tgatgacgaagacggcgacgacgaagacgacgaagacg	Protospacer
 *...************.********.**********.

166. spacer 1.19|2127361|32|NC_003911|CRT matches to JQ807250 (Environmental Halophage eHP-31, partial genome) position: , mismatch: 7, identity: 0.781

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
agacgacgaagacgacgaagacgacatggacg	Protospacer
.************.***********. .*.*.

167. spacer 1.19|2127361|32|NC_003911|CRT matches to NC_027120 (Lactococcus phage 1358, complete sequence) position: , mismatch: 7, identity: 0.781

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
aatcgaagaagacgacgaagacgacgaagacg	Protospacer
.. *** ******.***************.*.

168. spacer 1.19|2127361|32|NC_003911|CRT matches to MK524498 (Mycobacterium phage Chill, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
agacgacgaagacgacgaggacgacgacgaag	Protospacer
.************.****.******** *. .

169. spacer 1.19|2127361|32|NC_003911|CRT matches to MK494102 (Mycobacterium phage WaldoWhy, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
agacgacgaagacgacgaggacgacgacgaag	Protospacer
.************.****.******** *. .

170. spacer 1.19|2127361|32|NC_003911|CRT matches to NC_010811 (Ralstonia phage RSL1, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
tgacgacgaagacgacgaagacggcgacgatg	Protospacer
 ************.*********.*** *...

171. spacer 1.19|2127361|32|NC_003911|CRT matches to NC_010811 (Ralstonia phage RSL1, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
cgagtccgacgacaacgaagacgacgaagacg	Protospacer
 **   *** *******************.*.

172. spacer 1.19|2127361|32|NC_003911|CRT matches to AM419438 (Archaeal BJ1 virus complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
ggacgacgaggacgacgaagacgacgagcagg	Protospacer
*********.***.*************. . .

173. spacer 1.19|2127361|32|NC_003911|CRT matches to AB366653 (Ralstonia phage RSL1 DNA, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
tgacgacgaagacgacgaagacggcgacgatg	Protospacer
 ************.*********.*** *...

174. spacer 1.19|2127361|32|NC_003911|CRT matches to AB366653 (Ralstonia phage RSL1 DNA, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
cgagtccgacgacaacgaagacgacgaagacg	Protospacer
 **   *** *******************.*.

175. spacer 1.19|2127361|32|NC_003911|CRT matches to NC_008695 (Archaeal BJ1 virus, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
ggacgacgaggacgacgaagacgacgagcagg	Protospacer
*********.***.*************. . .

176. spacer 1.19|2127361|32|NC_003911|CRT matches to NZ_CP032230 (Streptomyces seoulensis strain KCTC 9819 plasmid unnamed) position: , mismatch: 7, identity: 0.781

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
cgacgacgaggacgacgaagacgacgactgag	Protospacer
 ********.***.*************  * .

177. spacer 1.19|2127361|32|NC_003911|CRT matches to CP011998 (Ralstonia solanacearum strain YC45 plasmid, complete sequence) position: , mismatch: 7, identity: 0.781

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
agacgacgaggacgacgaagacgacgatcacg	Protospacer
.********.***.*************  .*.

178. spacer 1.19|2127361|32|NC_003911|CRT matches to LN610585 (Pseudomonas phage vB_PaeS_PAO1_Ab20, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
cgacgacgaagacaacgacgacaacgacgagt	Protospacer
 ***************** ***.**** *.

179. spacer 1.19|2127361|32|NC_003911|CRT matches to DQ398047 (Mycobacterium phage PBI1, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
agacgacgaagacgacgaggacgacgacgagg	Protospacer
.************.****.******** *. .

180. spacer 1.19|2127361|32|NC_003911|CRT matches to MT889385 (Mycobacterium phage Thoth, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
agacgacgaagacgacgaggacgacgacgagg	Protospacer
.************.****.******** *. .

181. spacer 1.19|2127361|32|NC_003911|CRT matches to MH389777 (Dickeya phage vB_DsoM_JA11, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
cgaagacgaagacgacgaagacgacgacgaag	Protospacer
 ** *********.************* *. .

182. spacer 1.19|2127361|32|NC_003911|CRT matches to MH389777 (Dickeya phage vB_DsoM_JA11, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
cgaggacgaagacgacgaagacgacgaggatg	Protospacer
 ** *********.*************.*...

183. spacer 1.19|2127361|32|NC_003911|CRT matches to MH389777 (Dickeya phage vB_DsoM_JA11, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
cgacgacgaagacgacgaagacgattacgacg	Protospacer
 ************.**********. * *.*.

184. spacer 1.19|2127361|32|NC_003911|CRT matches to MK559427 (Mycobacterium phage Delton, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
agacgacgaagacgacgaggacgacgacgagg	Protospacer
.************.****.******** *. .

185. spacer 1.19|2127361|32|NC_003911|CRT matches to MH460462 (Dickeya phage vB_DsoM_JA33, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
cgaagacgaagacgacgaagacgacgacgaag	Protospacer
 ** *********.************* *. .

186. spacer 1.19|2127361|32|NC_003911|CRT matches to MH460462 (Dickeya phage vB_DsoM_JA33, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
cgaggacgaagacgacgaagacgacgaggatg	Protospacer
 ** *********.*************.*...

187. spacer 1.19|2127361|32|NC_003911|CRT matches to MH460462 (Dickeya phage vB_DsoM_JA33, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
cgacgacgaagacgacgaagacgattacgacg	Protospacer
 ************.**********. * *.*.

188. spacer 1.19|2127361|32|NC_003911|CRT matches to FJ168660 (Mycobacterium phage Butterscotch, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
agacgacgaagacgacgaggacgacgacgagg	Protospacer
.************.****.******** *. .

189. spacer 1.19|2127361|32|NC_003911|CRT matches to MH460463 (Dickeya phage vB_DsoM_AD1, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
agacgacgaagacgacgaagacgaagatgaag	Protospacer
.************.********** ** *. .

190. spacer 1.19|2127361|32|NC_003911|CRT matches to MH025888 (Mycobacterium phage BigMama, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
agacgacgaagacgacgaggacgacgacgagg	Protospacer
.************.****.******** *. .

191. spacer 1.19|2127361|32|NC_003911|CRT matches to MH399788 (Mycobacterium phage Visconti, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
agacgacgaagacgacgaggacgacgacgagg	Protospacer
.************.****.******** *. .

192. spacer 1.19|2127361|32|NC_003911|CRT matches to EU676000 (Mycobacterium phage Adjutor, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
agacgacgaagacgacgaggacgacgacgagg	Protospacer
.************.****.******** *. .

193. spacer 1.19|2127361|32|NC_003911|CRT matches to MN694796 (Marine virus AFVG_250M264, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
ctacgccgaagacaacgaagccgacgatgtct	Protospacer
  *** ************** ****** * *

194. spacer 1.19|2127361|32|NC_003911|CRT matches to NZ_CP026684 (Nostoc sp. 'Peltigera membranacea cyanobiont' N6 plasmid pNPM2, complete sequence) position: , mismatch: 7, identity: 0.781

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
tgattacgaagacgaagaagacgacgaaaaca	Protospacer
 **. ********.* ************..**

195. spacer 1.19|2127361|32|NC_003911|CRT matches to MK203850 (Alteromonas phage ZP6, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
ggccagccaagacgacgaagacgaggaaggcc	Protospacer
** *..* *****.********** ******

196. spacer 1.25|2127715|32|NC_003911|CRT matches to NZ_LR134450 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 8, complete sequence) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
cgacgacgagtccgacgaagacgacgacaacc	Protospacer
 **********.*******.*******   *

197. spacer 1.25|2127715|32|NC_003911|CRT matches to MH590590 (Microbacterium phage Schnapsidee, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtgaacgtggccttca	Protospacer
***************** .****  *  ***.

198. spacer 1.25|2127715|32|NC_003911|CRT matches to MK967394 (Microbacterium phage HanSolo, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

199. spacer 1.25|2127715|32|NC_003911|CRT matches to MT986027 (Microbacterium phage Winzigespinne, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

200. spacer 1.25|2127715|32|NC_003911|CRT matches to MH045554 (Microbacterium phage Bandik, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

201. spacer 1.25|2127715|32|NC_003911|CRT matches to MH513981 (Microbacterium phage Papafritta, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

202. spacer 1.25|2127715|32|NC_003911|CRT matches to MG839022 (Microbacterium phage Ludgate, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

203. spacer 1.25|2127715|32|NC_003911|CRT matches to MT310851 (Microbacterium phage Sedgewig, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

204. spacer 1.25|2127715|32|NC_003911|CRT matches to MK967400 (Microbacterium Phage Clancy, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

205. spacer 1.25|2127715|32|NC_003911|CRT matches to MG944222 (Microbacterium phage StingRay, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

206. spacer 1.25|2127715|32|NC_003911|CRT matches to MT986026 (Microbacterium phage Gubbabump, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

207. spacer 1.25|2127715|32|NC_003911|CRT matches to MN735430 (Microbacterium phage Ioannes, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

208. spacer 1.25|2127715|32|NC_003911|CRT matches to MN369737 (Microbacterium phage Benjalauren, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

209. spacer 1.25|2127715|32|NC_003911|CRT matches to MG839029 (Microbacterium phage Ilzat, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

210. spacer 1.25|2127715|32|NC_003911|CRT matches to MT451985 (Microbacterium phage Dothraki, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

211. spacer 1.25|2127715|32|NC_003911|CRT matches to MK757447 (Microbacterium phage Greys, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

212. spacer 1.25|2127715|32|NC_003911|CRT matches to MK967391 (Microbacterium phage BonesMcCoy, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

213. spacer 1.25|2127715|32|NC_003911|CRT matches to MH045562 (Microbacterium phage Raptor, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

214. spacer 1.25|2127715|32|NC_003911|CRT matches to MT771350 (Microbacterium phage TatarkaPM, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

215. spacer 1.25|2127715|32|NC_003911|CRT matches to MN892483 (Microbacterium phage SonOfLevi, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

216. spacer 1.25|2127715|32|NC_003911|CRT matches to MK977697 (Microbacterium phage Etta, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

217. spacer 1.25|2127715|32|NC_003911|CRT matches to MT498049 (Microbacterium phage BigRedClifford, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

218. spacer 1.25|2127715|32|NC_003911|CRT matches to MN234204 (Microbacterium phage ManRay, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

219. spacer 1.25|2127715|32|NC_003911|CRT matches to MG925352 (Microbacterium phage Nattles, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

220. spacer 1.25|2127715|32|NC_003911|CRT matches to MG839015 (Microbacterium phage Aubergine, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

221. spacer 1.25|2127715|32|NC_003911|CRT matches to MH045558 (Microbacterium phage Dave, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

222. spacer 1.25|2127715|32|NC_003911|CRT matches to MG839028 (Microbacterium phage Tenda, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

223. spacer 1.25|2127715|32|NC_003911|CRT matches to MH045559 (Microbacterium phage Etna, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtgaacgtggccttca	Protospacer
***************** .****  *  ***.

224. spacer 1.25|2127715|32|NC_003911|CRT matches to MN062709 (Microbacterium phage Stanktossa, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

225. spacer 1.25|2127715|32|NC_003911|CRT matches to MT310866 (Microbacterium phage Pherferi, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

226. spacer 1.25|2127715|32|NC_003911|CRT matches to MH153802 (Microbacterium phage Gargoyle, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

227. spacer 1.25|2127715|32|NC_003911|CRT matches to MH045560 (Microbacterium phage Nagem, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

228. spacer 1.25|2127715|32|NC_003911|CRT matches to MT553343 (Microbacterium Phage ParleG, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

229. spacer 1.25|2127715|32|NC_003911|CRT matches to MG944219 (Microbacterium phage PuppyEggo, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

230. spacer 1.25|2127715|32|NC_003911|CRT matches to MN234163 (Microbacterium phage Calix, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

231. spacer 1.25|2127715|32|NC_003911|CRT matches to MG839020 (Microbacterium phage Kale, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

232. spacer 1.25|2127715|32|NC_003911|CRT matches to MH045564 (Microbacterium phage TeddyBear, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

233. spacer 1.25|2127715|32|NC_003911|CRT matches to MN807246 (Microbacterium phage Chamuel, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

234. spacer 1.25|2127715|32|NC_003911|CRT matches to MH153805 (Microbacterium phage Martin, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

235. spacer 1.25|2127715|32|NC_003911|CRT matches to MT952846 (Microbacterium phage MaeLinda, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

236. spacer 1.25|2127715|32|NC_003911|CRT matches to MG839018 (Microbacterium phage Espinosa, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

237. spacer 1.25|2127715|32|NC_003911|CRT matches to MT553341 (Microbacterium phage Kurt1, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

238. spacer 1.25|2127715|32|NC_003911|CRT matches to MT310856 (Microbacterium phage Zada, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

239. spacer 1.25|2127715|32|NC_003911|CRT matches to MT498062 (Microbacterium phage Leafus, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtgaacgtggccttca	Protospacer
***************** .****  *  ***.

240. spacer 1.25|2127715|32|NC_003911|CRT matches to MN234222 (Microbacterium phage Christoph, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

241. spacer 1.25|2127715|32|NC_003911|CRT matches to MK620902 (Microbacterium phage Phriends, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

242. spacer 1.25|2127715|32|NC_003911|CRT matches to MG920061 (Microbacterium phage Bonino, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

243. spacer 1.25|2127715|32|NC_003911|CRT matches to MH153806 (Microbacterium phage Oats, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

244. spacer 1.25|2127715|32|NC_003911|CRT matches to MG839030 (Microbacterium phage Balsa, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtgaacgtggccttca	Protospacer
***************** .****  *  ***.

245. spacer 1.25|2127715|32|NC_003911|CRT matches to MK620895 (Microbacterium phage Riyhil, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

246. spacer 1.25|2127715|32|NC_003911|CRT matches to MH479922 (Microbacterium phage Redfield, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtgaacgtggccttca	Protospacer
***************** .****  *  ***.

247. spacer 1.25|2127715|32|NC_003911|CRT matches to MK620905 (Microbacterium phage TinSulphur, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

248. spacer 1.25|2127715|32|NC_003911|CRT matches to MN735435 (Microbacterium phage Renzie, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

249. spacer 1.25|2127715|32|NC_003911|CRT matches to MN062702 (Microbacterium phage Den3, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

250. spacer 1.25|2127715|32|NC_003911|CRT matches to MG944216 (Microbacterium phage Pajaza, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtgaacgcggccttca	Protospacer
***************** .****  *  ***.

251. spacer 1.25|2127715|32|NC_003911|CRT matches to MG944226 (Microbacterium phage Casey, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtgaacgtggccttca	Protospacer
***************** .****  *  ***.

252. spacer 1.25|2127715|32|NC_003911|CRT matches to MG839017 (Microbacterium phage Baines, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

253. spacer 1.25|2127715|32|NC_003911|CRT matches to MG962360 (Microbacterium phage AlexAdler, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

254. spacer 1.25|2127715|32|NC_003911|CRT matches to MT553339 (Microbacterium phage Lovelyunicorn, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

255. spacer 1.25|2127715|32|NC_003911|CRT matches to MT310873 (Microbacterium phage Convict, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

256. spacer 1.25|2127715|32|NC_003911|CRT matches to MG839024 (Microbacterium phage Peppino, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtgaacgtggccttca	Protospacer
***************** .****  *  ***.

257. spacer 1.25|2127715|32|NC_003911|CRT matches to MT310861 (Microbacterium phage BeautPeep30, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

258. spacer 1.25|2127715|32|NC_003911|CRT matches to MG839023 (Microbacterium phage Peep, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

259. spacer 1.25|2127715|32|NC_003911|CRT matches to MG839021 (Microbacterium phage Knox, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

260. spacer 1.25|2127715|32|NC_003911|CRT matches to MG839025 (Microbacterium phage Raccoon, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtgaacgtggccttca	Protospacer
***************** .****  *  ***.

261. spacer 1.25|2127715|32|NC_003911|CRT matches to MK919471 (Microbacterium phage Shee, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

262. spacer 1.25|2127715|32|NC_003911|CRT matches to MN234181 (Microbacterium phage Pocket, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

263. spacer 1.25|2127715|32|NC_003911|CRT matches to MH153811 (Microbacterium phage Teagan, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

264. spacer 1.25|2127715|32|NC_003911|CRT matches to MH045565 (Microbacterium phage Antoinette, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

265. spacer 1.25|2127715|32|NC_003911|CRT matches to MH045563 (Microbacterium phage Robinson, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

266. spacer 1.25|2127715|32|NC_003911|CRT matches to MG839016 (Microbacterium phage AxiPup, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

267. spacer 1.25|2127715|32|NC_003911|CRT matches to MN234177 (Microbacterium phage Gershwin, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

268. spacer 1.25|2127715|32|NC_003911|CRT matches to MK620903 (Microbacterium phage MillyPhilly, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

269. spacer 1.25|2127715|32|NC_003911|CRT matches to MH045555 (Microbacterium phage BeeBee8, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtgaacgtggccttca	Protospacer
***************** .****  *  ***.

270. spacer 1.25|2127715|32|NC_003911|CRT matches to MG944218 (Microbacterium phage Pikmin, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtgaacgtggccttca	Protospacer
***************** .****  *  ***.

271. spacer 1.25|2127715|32|NC_003911|CRT matches to MN062713 (Microbacterium phage Alyxandracam, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

272. spacer 1.25|2127715|32|NC_003911|CRT matches to NC_042110 (Microbacterium phage Hamlet, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtgaacgtggccttca	Protospacer
***************** .****  *  ***.

273. spacer 1.25|2127715|32|NC_003911|CRT matches to MT024864 (Microbacterium phage Oxtober96, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

274. spacer 1.25|2127715|32|NC_003911|CRT matches to MG962367 (Microbacterium phage Gelo, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

275. spacer 1.25|2127715|32|NC_003911|CRT matches to MG839026 (Microbacterium phage Superfresh, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

276. spacer 1.25|2127715|32|NC_003911|CRT matches to MK967388 (Microbacterium phage Velene, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

277. spacer 1.25|2127715|32|NC_003911|CRT matches to MN617840 (Microbacterium phage Klimt, complete genome) position: , mismatch: 7, identity: 0.781

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ggacgacgagttcgacgtcaacgtggccttca	Protospacer
*****************  ****  *  ***.

278. spacer 1.26|2127769|32|NC_003911|CRT matches to MH121069 (Pseudomonas phage vB_PaeM_PA5oct, complete genome) position: , mismatch: 7, identity: 0.781

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
cgacgacgaagacgacgaagacgacgaagatc	Protospacer
 *.****************  ********..

279. spacer 1.26|2127769|32|NC_003911|CRT matches to CP006880 (Rhizobium gallicum bv. gallicum R602 plasmid pRgalR602c, complete sequence) position: , mismatch: 7, identity: 0.781

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaattcgccgtccgca	Protospacer
.* ******************** **   **.

280. spacer 1.26|2127769|32|NC_003911|CRT matches to NC_047815 (Erwinia phage vB_EamM_Yoloswag, complete genome) position: , mismatch: 7, identity: 0.781

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
tgaggacgaagatgacgacttcgacgaagagg	Protospacer
 *. ********.***** **********. *

281. spacer 1.26|2127769|32|NC_003911|CRT matches to MK016493 (Brevibacterium phage Cantare, complete genome) position: , mismatch: 7, identity: 0.781

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
cgacgacgaagacgacgacatcgacgacgaag	Protospacer
 *.***************  ******* *. *

282. spacer 1.26|2127769|32|NC_003911|CRT matches to MK967394 (Microbacterium phage HanSolo, complete genome) position: , mismatch: 7, identity: 0.781

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
cgacgaggaagacgacgagttcgacgacgagg	Protospacer
 *.*** ***********.******** *. *

283. spacer 1.26|2127769|32|NC_003911|CRT matches to MT986027 (Microbacterium phage Winzigespinne, complete genome) position: , mismatch: 7, identity: 0.781

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
cgacgaggaagacgacgagttcgacgacgagg	Protospacer
 *.*** ***********.******** *. *

284. spacer 1.26|2127769|32|NC_003911|CRT matches to MH045554 (Microbacterium phage Bandik, complete genome) position: , mismatch: 7, identity: 0.781

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
cgacgaggaagacgacgagttcgacgacgagg	Protospacer
 *.*** ***********.******** *. *

285. spacer 1.26|2127769|32|NC_003911|CRT matches to MH513981 (Microbacterium phage Papafritta, complete genome) position: , mismatch: 7, identity: 0.781

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
cgacgaggaagacgacgagttcgacgacgagg	Protospacer
 *.*** ***********.******** *. *

286. spacer 1.26|2127769|32|NC_003911|CRT matches to MG839022 (Microbacterium phage Ludgate, complete genome) position: , mismatch: 7, identity: 0.781

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
cgacgaggaagacgacgagttcgacgacgagg	Protospacer
 *.*** ***********.******** *. *

287. spacer 1.26|2127769|32|NC_003911|CRT matches to NC_048053 (Dickeya phage vB_DsoM_JA29, complete genome) position: , mismatch: 7, identity: 0.781

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
cgacgacgaagacgacgaagacgacgacgaag	Protospacer
 *.****************  ****** *. *

288. spacer 1.26|2127769|32|NC_003911|CRT matches to MT310851 (Microbacterium phage Sedgewig, complete genome) position: , mismatch: 7, identity: 0.781

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
cgacgaggaagacgacgagttcgacgacgagg	Protospacer
 *.*** ***********.******** *. *

289. spacer 1.26|2127769|32|NC_003911|CRT matches to MK967400 (Microbacterium Phage Clancy, complete genome) position: , mismatch: 7, identity: 0.781

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
cgacgaggaagacgacgagttcgacgacgagg	Protospacer
 *.*** ***********.******** *. *

290. spacer 1.26|2127769|32|NC_003911|CRT matches to MG944222 (Microbacterium phage StingRay, complete genome) position: , mismatch: 7, identity: 0.781

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
cgacgaggaagacgacgagttcgacgacgagg	Protospacer
 *.*** ***********.******** *. *

291. spacer 1.26|2127769|32|NC_003911|CRT matches to MT986026 (Microbacterium phage Gubbabump, complete genome) position: , mismatch: 7, identity: 0.781

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
cgacgaggaagacgacgagttcgacgacgagg	Protospacer
 *.*** ***********.******** *. *

292. spacer 1.26|2127769|32|NC_003911|CRT matches to MN735430 (Microbacterium phage Ioannes, complete genome) position: , mismatch: 7, identity: 0.781

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
cgacgaggaagacgacgagttcgacgacgagg	Protospacer
 *.*** ***********.******** *. *

293. spacer 1.26|2127769|32|NC_003911|CRT matches to MN369737 (Microbacterium phage Benjalauren, complete genome) position: , mismatch: 7, identity: 0.781

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
cgacgaggaagacgacgagttcgacgacgagg	Protospacer
 *.*** ***********.******** *. *

294. spacer 1.26|2127769|32|NC_003911|CRT matches to MG839029 (Microbacterium phage Ilzat, complete genome) position: , mismatch: 7, identity: 0.781

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
cgacgaggaagacgacgagttcgacgacgagg	Protospacer
 *.*** ***********.******** *. *

295. spacer 1.26|2127769|32|NC_003911|CRT matches to NC_007766 (Rhizobium etli CFN 42 plasmid p42f, complete sequence) position: , mismatch: 7, identity: 0.781

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgaccaagacgacgaattcgccgtcgccg	Protospacer
.* **** *************** **  * **

296. spacer 1.26|2127769|32|NC_003911|CRT matches to AP013510 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G20, isolate: uvMED-CGR-C101A-MedDCM-OCT-S30-C6) position: , mismatch: 7, identity: 0.781

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
tgactacgaagaagacgaattctacgaatgag	Protospacer
 *.* ******* ********* ***** * *

297. spacer 1.26|2127769|32|NC_003911|CRT matches to AP013876 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C101A-MedDCM-OCT-S39-C9, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 7, identity: 0.781

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
tgactacgaagaagacgaattctacgaatgag	Protospacer
 *.* ******* ********* ***** * *

298. spacer 1.31|2128054|32|NC_003911|CRT matches to MT028492 (Ochrobactrum phage vB_OspP_OH, complete genome) position: , mismatch: 7, identity: 0.781

aggcaacgaaggtgacgaagccgacgaaggcg	CRISPR spacer
caacgaagatggtgacgaagccgacgagggcg	Protospacer
 ..*.* ** *****************.****

299. spacer 1.34|2128234|32|NC_003911|CRT matches to NZ_CP016356 (Lactobacillus paracasei subsp. paracasei strain TMW 1.1434 plasmid pL11434-1, complete sequence) position: , mismatch: 7, identity: 0.781

aggcaatgaaggcaatgagaacgacgagctcg	CRISPR spacer
gcgcaatgacggcaattagaacgacgaaatgg	Protospacer
. ******* ****** **********. * *

300. spacer 1.34|2128234|32|NC_003911|CRT matches to NZ_CP035564 (Lactobacillus paracasei strain SRCM103299 plasmid unnamed1) position: , mismatch: 7, identity: 0.781

aggcaatgaaggcaatgagaacgacgagctcg	CRISPR spacer
gcgcaatgacggcaattagaacgacgaaatgg	Protospacer
. ******* ****** **********. * *

301. spacer 1.34|2128234|32|NC_003911|CRT matches to NZ_CP013462 (Burkholderia ubonensis strain MSMB1471WGS plasmid pMSMB1471, complete sequence) position: , mismatch: 7, identity: 0.781

aggcaatgaaggcaatgagaacgacgagctcg	CRISPR spacer
cacccacgaatgcaatgagaacgccgagctcg	Protospacer
 . * *.*** ************ ********

302. spacer 1.11|2126878|35|NC_003911|CRT matches to NC_034248 (Rhizobium phage RHEph10, complete genome) position: , mismatch: 8, identity: 0.771

gtccgg---cgacgaaggtgatgagggcgacgaagctg	CRISPR spacer
---cggagcagacgaagatgatgaaggcgacgaaggcg	Protospacer
   ***    *******.******.********** .*

303. spacer 1.19|2127361|32|NC_003911|CRT matches to NC_027120 (Lactococcus phage 1358, complete sequence) position: , mismatch: 8, identity: 0.75

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
cgtcgacgaagaaaacgaagacgaagacgaag	Protospacer
 * ********* *********** ** *. .

304. spacer 1.19|2127361|32|NC_003911|CRT matches to NC_049851 (Burkholderia phage BcepSauron, complete genome) position: , mismatch: 8, identity: 0.75

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
agacgaagaagacgacgaagacgacggcgagt	Protospacer
.***** ******.************. *.

305. spacer 1.19|2127361|32|NC_003911|CRT matches to NC_049851 (Burkholderia phage BcepSauron, complete genome) position: , mismatch: 8, identity: 0.75

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
agaagacgaagacgacgaagacgacggcgagt	Protospacer
.** *********.************. *.

306. spacer 1.19|2127361|32|NC_003911|CRT matches to NC_048053 (Dickeya phage vB_DsoM_JA29, complete genome) position: , mismatch: 8, identity: 0.75

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
cgaagacgaagacgacgaagacgacgagtaat	Protospacer
 ** *********.*************. .

307. spacer 1.19|2127361|32|NC_003911|CRT matches to DQ398047 (Mycobacterium phage PBI1, complete genome) position: , mismatch: 8, identity: 0.75

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
ttcggacgaagacgacgaagacgacgaggacg	Protospacer
    *********.*************.*.*.

308. spacer 1.19|2127361|32|NC_003911|CRT matches to MT889385 (Mycobacterium phage Thoth, complete genome) position: , mismatch: 8, identity: 0.75

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
ttcggacgaagacgacgaagacgacgaggacg	Protospacer
    *********.*************.*.*.

309. spacer 1.19|2127361|32|NC_003911|CRT matches to MT776806 (Mycobacterium phage MrMiyagi, complete genome) position: , mismatch: 8, identity: 0.75

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
tgacgacgaagacgacgaagacgaagagacgt	Protospacer
 ************.********** **..

310. spacer 1.19|2127361|32|NC_003911|CRT matches to MT776806 (Mycobacterium phage MrMiyagi, complete genome) position: , mismatch: 8, identity: 0.75

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
tttggacgatgacgacgaagacgacgaagacg	Protospacer
    ***** ***.***************.*.

311. spacer 1.19|2127361|32|NC_003911|CRT matches to MK559427 (Mycobacterium phage Delton, complete genome) position: , mismatch: 8, identity: 0.75

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
ttcggacgaagacgacgaagacgacgaggacg	Protospacer
    *********.*************.*.*.

312. spacer 1.19|2127361|32|NC_003911|CRT matches to FJ168660 (Mycobacterium phage Butterscotch, complete genome) position: , mismatch: 8, identity: 0.75

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
ttcggacgaagacgacgaagacgacgaggacg	Protospacer
    *********.*************.*.*.

313. spacer 1.19|2127361|32|NC_003911|CRT matches to MH025888 (Mycobacterium phage BigMama, complete genome) position: , mismatch: 8, identity: 0.75

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
ttcggacgaagacgacgaagacgacgaggacg	Protospacer
    *********.*************.*.*.

314. spacer 1.19|2127361|32|NC_003911|CRT matches to MH399788 (Mycobacterium phage Visconti, complete genome) position: , mismatch: 8, identity: 0.75

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
ttcggacgaagacgacgaagacgacgaggacg	Protospacer
    *********.*************.*.*.

315. spacer 1.19|2127361|32|NC_003911|CRT matches to EU676000 (Mycobacterium phage Adjutor, complete genome) position: , mismatch: 8, identity: 0.75

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
ttcggacgaagacgacgaagacgacgaggacg	Protospacer
    *********.*************.*.*.

316. spacer 1.19|2127361|32|NC_003911|CRT matches to MK373789 (Escherichia phage vB_EcoS_PTXU06, complete genome) position: , mismatch: 8, identity: 0.75

ggacgacgaagacaacgaagacgacgaaggca----	CRISPR spacer
tgaggacgaagacgacgaagacg----aagcaccac	Protospacer
 ** *********.*********    *.***

317. spacer 1.19|2127361|32|NC_003911|CRT matches to MN850575 (Escherichia phage rolling, complete genome) position: , mismatch: 8, identity: 0.75

ggacgacgaagacaacgaagacgacgaaggca----	CRISPR spacer
tgaggacgaagacgacgaagacg----aagcaccac	Protospacer
 ** *********.*********    *.***

318. spacer 1.19|2127361|32|NC_003911|CRT matches to MT478993 (Escherichia phage vB_EcoS_011D5, complete genome) position: , mismatch: 8, identity: 0.75

ggacgacgaagacaacgaagacgacgaaggca----	CRISPR spacer
tgaggacgaagacgacgaagacg----aagcaccac	Protospacer
 ** *********.*********    *.***

319. spacer 1.19|2127361|32|NC_003911|CRT matches to NZ_CP045548 (Streptomyces sp. SYP-A7193 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
agacgacgaagacaccgcagacgaacacgcaa	Protospacer
.************* ** ******  * *  *

320. spacer 1.19|2127361|32|NC_003911|CRT matches to NC_019724 (Enterobacteria phage HK578, complete genome) position: , mismatch: 8, identity: 0.75

ggacgacgaagacaacgaagacgacgaaggca----	CRISPR spacer
tgaggacgaagacgacgaagacg----aagcaccac	Protospacer
 ** *********.*********    *.***

321. spacer 1.24|2127661|32|NC_003911|CRT matches to NZ_CP044550 (Hydrogenophaga sp. BPS33 plasmid pBPS33-1, complete sequence) position: , mismatch: 8, identity: 0.75

aaccaatctgaacgacgaaaacg-----acgagggtg	CRISPR spacer
aaccgatctgaacgacgacaacgcgtacacaa-----	Protospacer
****.************* ****     **.*

322. spacer 1.25|2127715|32|NC_003911|CRT matches to NZ_CP033074 (Buttiauxella sp. 3AFRM03 plasmid pBTX_120, complete sequence) position: , mismatch: 8, identity: 0.75

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
cagaaaagagtgcgacgaaaacgacgcattcg	Protospacer
 .. .* **** ************** *****

323. spacer 1.25|2127715|32|NC_003911|CRT matches to NZ_CP050101 (Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b6, complete sequence) position: , mismatch: 8, identity: 0.75

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
agccggaaggtccgacgaagacgacgaattcg	Protospacer
.* **. ..**.*******.************

324. spacer 1.25|2127715|32|NC_003911|CRT matches to NZ_CP053442 (Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eD, complete sequence) position: , mismatch: 8, identity: 0.75

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
agccggaaggtccgacgaagacgacgaattcg	Protospacer
.* **. ..**.*******.************

325. spacer 1.25|2127715|32|NC_003911|CRT matches to NZ_CP020331 (Martelella mediterranea DSM 17316 strain MACL11 plasmid pMM593, complete sequence) position: , mismatch: 8, identity: 0.75

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
agccggaaggtccgacgaagacgacgaattcg	Protospacer
.* **. ..**.*******.************

326. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP022220 (Bradyrhizobium guangxiense strain CCBAU 53363 plasmid p53363, complete sequence) position: , mismatch: 8, identity: 0.75

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gcccgacgaagacgacgaattcgccgtgatcg	Protospacer
.  ******************** ** .. **

327. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP021029 (Rhizobium sp. TAL182 plasmid pRetTAL182e, complete sequence) position: , mismatch: 8, identity: 0.75

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gaccgacgaagacgacgaattcgccgtcctcg	Protospacer
.. ******************** **    **

328. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP013632 (Rhizobium sp. N324 plasmid pRspN324b, complete sequence) position: , mismatch: 8, identity: 0.75

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaattcgccgtccttg	Protospacer
.* ******************** **    .*

329. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP029452 (Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence) position: , mismatch: 8, identity: 0.75

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaattcgccgttcttg	Protospacer
.* ******************** **    .*

330. spacer 1.26|2127769|32|NC_003911|CRT matches to NC_011368 (Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG201, complete sequence) position: , mismatch: 8, identity: 0.75

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaattcgccgtccttg	Protospacer
.* ******************** **    .*

331. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP020331 (Martelella mediterranea DSM 17316 strain MACL11 plasmid pMM593, complete sequence) position: , mismatch: 8, identity: 0.75

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gtccgacgaagacgacgaattcgccgtcctcg	Protospacer
.  ******************** **    **

332. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP023071 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence) position: , mismatch: 8, identity: 0.75

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaattcgccgttcttg	Protospacer
.* ******************** **    .*

333. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP030052 (Bradyrhizobium guangdongense strain CCBAU 51649 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gcccgacgaagacgacgaattcgccgtgatcg	Protospacer
.  ******************** ** .. **

334. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP030054 (Bradyrhizobium guangzhouense strain CCBAU 51670 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gcccgacgaagacgacgaattcgccgtgatcg	Protospacer
.  ******************** ** .. **

335. spacer 1.26|2127769|32|NC_003911|CRT matches to NC_009620 (Sinorhizobium medicae WSM419 plasmid pSMED01, complete sequence) position: , mismatch: 8, identity: 0.75

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gaccgacgaagacgacgaattcgccgtcctcg	Protospacer
.. ******************** **    **

336. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP029232 (Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence) position: , mismatch: 8, identity: 0.75

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaattcgccgttcttg	Protospacer
.* ******************** **    .*

337. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP013110 (Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence) position: , mismatch: 8, identity: 0.75

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaactcgccggacttg	Protospacer
.* ****************.*** **.*  .*

338. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP024310 (Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3c, complete sequence) position: , mismatch: 8, identity: 0.75

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaactcgccggacttg	Protospacer
.* ****************.*** **.*  .*

339. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP013054 (Sinorhizobium americanum CCGM7 plasmid C, complete sequence) position: , mismatch: 8, identity: 0.75

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaactcgccggacttg	Protospacer
.* ****************.*** **.*  .*

340. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP023064 (Sinorhizobium sp. CCBAU 05631 plasmid pSS05631b, complete sequence) position: , mismatch: 8, identity: 0.75

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaactcgccggacttg	Protospacer
.* ****************.*** **.*  .*

341. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP050081 (Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b5, complete sequence) position: , mismatch: 8, identity: 0.75

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaactcgccgtccgtg	Protospacer
.* ****************.*** **   *.*

342. spacer 1.26|2127769|32|NC_003911|CRT matches to NC_012586 (Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence) position: , mismatch: 8, identity: 0.75

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gaccgacgaaaacgacgaattcgccgttgtcg	Protospacer
.. *******.************ **  * **

343. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP049731 (Rhizobium leguminosarum strain A1 plasmid pRL12, complete sequence) position: , mismatch: 8, identity: 0.75

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaactcgccgtccgtg	Protospacer
.* ****************.*** **   *.*

344. spacer 1.26|2127769|32|NC_003911|CRT matches to NC_018516 (Bacillus thuringiensis HD-789 plasmid pBTHD789-1, complete sequence) position: , mismatch: 8, identity: 0.75

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
cgaagacgaagacgaggaatttgacgatgatg	Protospacer
 *. *********** *****.***** *..*

345. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP015737 (Shinella sp. HZN7 plasmid pShin-01, complete sequence) position: , mismatch: 8, identity: 0.75

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaactcgccgtcctcg	Protospacer
.* ****************.*** **    **

346. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP053970 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
cgaagacgaagacgaggaatttgacgatgatg	Protospacer
 *. *********** *****.***** *..*

347. spacer 1.26|2127769|32|NC_003911|CRT matches to CP036360 (Agrobacterium sp. 33MFTa1.1 plasmid p_JBx_073812, complete sequence) position: , mismatch: 8, identity: 0.75

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gcccgacgaggacgacgaattcgccgtcgccg	Protospacer
.  ******.************* **  * **

348. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP053979 (Bacillus thuringiensis strain FDAARGOS_795 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.75

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
cgaagacgaagacgaggaatttgacgatgatg	Protospacer
 *. *********** *****.***** *..*

349. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP016078 (Actinoalloteichus sp. GBA129-24 plasmid pGBA129-24a, complete sequence) position: , mismatch: 8, identity: 0.75

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggaagacgaggacgacgacttcgacgacgagg	Protospacer
.*. *****.******** ******** *. *

350. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP013277 (Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-2-350K, complete sequence) position: , mismatch: 8, identity: 0.75

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
cgaagacgaagacgaggaatttgacgatgatg	Protospacer
 *. *********** *****.***** *..*

351. spacer 1.26|2127769|32|NC_003911|CRT matches to NC_018701 (Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence) position: , mismatch: 8, identity: 0.75

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaactcgccgtcctcg	Protospacer
.* ****************.*** **    **

352. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP039723 (Bacillus thuringiensis strain BT-59 plasmid p2, complete sequence) position: , mismatch: 8, identity: 0.75

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
cgaagacgaagacgaggaatttgacgatgatg	Protospacer
 *. *********** *****.***** *..*

353. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP021802 (Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaactcgccgtcctcg	Protospacer
.* ****************.*** **    **

354. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP023068 (Ensifer sojae CCBAU 05684 plasmid pSJ05684b, complete sequence) position: , mismatch: 8, identity: 0.75

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gtccgacgaagacggcgaattcgccggggtcg	Protospacer
.  ***********.******** **..* **

355. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP021810 (Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaactcgccgtcctcg	Protospacer
.* ****************.*** **    **

356. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP009348 (Bacillus thuringiensis HD1002 plasmid 2, complete sequence) position: , mismatch: 8, identity: 0.75

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
cgaagacgaagacgaggaatttgacgatgatg	Protospacer
 *. *********** *****.***** *..*

357. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP010858 (Marinovum algicola DG 898 plasmid pMaD3) position: , mismatch: 8, identity: 0.75

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaactcgccgtcctcg	Protospacer
.* ****************.*** **    **

358. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP009334 (Bacillus thuringiensis strain HD1011 plasmid 2, complete sequence) position: , mismatch: 8, identity: 0.75

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
cgaagacgaagacgaggaatttgacgatgatg	Protospacer
 *. *********** *****.***** *..*

359. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP019484 (Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaactcgccgtcctcg	Protospacer
.* ****************.*** **    **

360. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP053206 (Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1D, complete sequence) position: , mismatch: 8, identity: 0.75

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaactcgccgtccgtg	Protospacer
.* ****************.*** **   *.*

361. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP045024 (Bacillus thuringiensis strain JW-1 plasmid p2, complete sequence) position: , mismatch: 8, identity: 0.75

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
cgaagacgaagacgaggaatttgacgatgatg	Protospacer
 *. *********** *****.***** *..*

362. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP019487 (Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence) position: , mismatch: 8, identity: 0.75

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaactcgccgtcctcg	Protospacer
.* ****************.*** **    **

363. spacer 1.26|2127769|32|NC_003911|CRT matches to MT657343 (Microbacterium phage GaeCeo, complete genome) position: , mismatch: 8, identity: 0.75

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
cgaggacgaggacgacgacttcgacgacgagg	Protospacer
 *. *****.******** ******** *. *

364. spacer 1.26|2127769|32|NC_003911|CRT matches to MN310543 (Microbacterium phage ChickenKing, complete genome) position: , mismatch: 8, identity: 0.75

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
cgaggacgaggacgacgacttcgacgacgagg	Protospacer
 *. *****.******** ******** *. *

365. spacer 1.26|2127769|32|NC_003911|CRT matches to MH389777 (Dickeya phage vB_DsoM_JA11, complete genome) position: , mismatch: 8, identity: 0.75

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
cgaagacgaagacgacgaagacgacgacgaag	Protospacer
 *. ***************  ****** *. *

366. spacer 1.26|2127769|32|NC_003911|CRT matches to MH389777 (Dickeya phage vB_DsoM_JA11, complete genome) position: , mismatch: 8, identity: 0.75

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
cgaggacgaagacgacgaagacgacgaggatg	Protospacer
 *. ***************  ******.*..*

367. spacer 1.26|2127769|32|NC_003911|CRT matches to MH460462 (Dickeya phage vB_DsoM_JA33, complete genome) position: , mismatch: 8, identity: 0.75

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
cgaagacgaagacgacgaagacgacgacgaag	Protospacer
 *. ***************  ****** *. *

368. spacer 1.26|2127769|32|NC_003911|CRT matches to MH460462 (Dickeya phage vB_DsoM_JA33, complete genome) position: , mismatch: 8, identity: 0.75

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
cgaggacgaagacgacgaagacgacgaggatg	Protospacer
 *. ***************  ******.*..*

369. spacer 1.29|2127955|32|NC_003911|CRT matches to KU594606 (Cyanophage S-RIM32 isolate RW_108_0702, complete genome) position: , mismatch: 8, identity: 0.75

agccgatatcgacaatcgtggcgacgaaggcg	CRISPR spacer
attggatattgacaatcgtcgcgacgatgatg	Protospacer
* . *****.********* ******* *..*

370. spacer 1.31|2128054|32|NC_003911|CRT matches to NC_006569 (Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence) position: , mismatch: 8, identity: 0.75

aggcaacgaaggtgacgaagccgacgaaggcg	CRISPR spacer
cggcaacgaaggcgacgaagacgacaaccttg	Protospacer
 ***********.******* ****.*   .*

371. spacer 1.31|2128054|32|NC_003911|CRT matches to NZ_CP016452 (Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence) position: , mismatch: 8, identity: 0.75

aggcaacgaaggtgacgaagccgacgaaggcg	CRISPR spacer
tgcgcttgaaggtgacgatgccgacgatggcg	Protospacer
 *    .*********** ******** ****

372. spacer 1.31|2128054|32|NC_003911|CRT matches to NZ_CP017750 (Cupriavidus sp. USMAA2-4 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

aggcaacgaaggtgacgaagccgacgaaggcg	CRISPR spacer
cggtcgcgaaggggacgaagccgaagaaggtt	Protospacer
 **. .****** *********** *****.

373. spacer 1.31|2128054|32|NC_003911|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 8, identity: 0.75

aggcaacgaaggtgacgaagccgacgaaggcg	CRISPR spacer
cgcccgagagggtgacgaagccgacgatggca	Protospacer
 * * . **.***************** ***.

374. spacer 1.31|2128054|32|NC_003911|CRT matches to NZ_CP053953 (Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

aggcaacgaaggtgacgaagccgacgaaggcg	CRISPR spacer
cgaagacgaagatgacgaagacgacgaagagg	Protospacer
 *. .******.******** ********. *

375. spacer 1.31|2128054|32|NC_003911|CRT matches to NZ_CP053950 (Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

aggcaacgaaggtgacgaagccgacgaaggcg	CRISPR spacer
cgaagacgaagatgacgaagacgacgaagagg	Protospacer
 *. .******.******** ********. *

376. spacer 1.37|2128423|32|NC_003911|CRT matches to NZ_AP014686 (Bradyrhizobium diazoefficiens strain NK6 plasmid pNK6b, complete sequence) position: , mismatch: 8, identity: 0.75

aaacgacgaatacgacgaaggtgacgaagccg	CRISPR spacer
cagcgacgaaatcgacgaaggtgacggcctcg	Protospacer
 *.*******  **************.  .**

377. spacer 1.37|2128423|32|NC_003911|CRT matches to NZ_AP014686 (Bradyrhizobium diazoefficiens strain NK6 plasmid pNK6b, complete sequence) position: , mismatch: 8, identity: 0.75

aaacgacgaatacgacgaaggtgacgaagccg	CRISPR spacer
cagcgacgaaatcgacgaaggtgacggcctcg	Protospacer
 *.*******  **************.  .**

378. spacer 1.37|2128423|32|NC_003911|CRT matches to NZ_AP014688 (Bradyrhizobium diazoefficiens strain NK6 plasmid pNK6d, complete sequence) position: , mismatch: 8, identity: 0.75

aaacgacgaatacgacgaaggtgacgaagccg	CRISPR spacer
cagcgacgaaatcgacgaaggtgacggcctcg	Protospacer
 *.*******  **************.  .**

379. spacer 1.38|2128477|41|NC_003911|CRT matches to NC_006569 (Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence) position: , mismatch: 8, identity: 0.805

agacgacgaaaacaacgaaggcgacgaaaacaacgaggata	CRISPR spacer
gggcaacgaaaacgacgagggcgacgaaaacaacgagggcg	Protospacer
.*.*.********.****.*******************...

380. spacer 1.11|2126878|35|NC_003911|CRT matches to NC_006569 (Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence) position: , mismatch: 9, identity: 0.743

gtccggcgacgaaggtgatgagggcgacgaagctg	CRISPR spacer
cgagggcgacgaaggtgacgagggcgacgagagtc	Protospacer
    **************.***********.. *

381. spacer 1.11|2126878|35|NC_003911|CRT matches to NC_048053 (Dickeya phage vB_DsoM_JA29, complete genome) position: , mismatch: 9, identity: 0.743

gtccggcgacgaaggtgatgagggcgacgaagctg	CRISPR spacer
cgaagacgacgaagatgatgaggacgacgaagacg	Protospacer
    *.********.********.******** .*

382. spacer 1.13|2126980|38|NC_003911|CRT matches to MH389777 (Dickeya phage vB_DsoM_JA11, complete genome) position: , mismatch: 9, identity: 0.763

aggcaacgaagacggcggcgacgaaggcgacgaagaca	CRISPR spacer
agattccgaagatgacggcgacgaaggcgacgatgccg	Protospacer
**..  ******.*.****************** * *.

383. spacer 1.13|2126980|38|NC_003911|CRT matches to MH460462 (Dickeya phage vB_DsoM_JA33, complete genome) position: , mismatch: 9, identity: 0.763

aggcaacgaagacggcggcgacgaaggcgacgaagaca	CRISPR spacer
agattccgaagatgacggcgacgaaggcgacgatgccg	Protospacer
**..  ******.*.****************** * *.

384. spacer 1.13|2126980|38|NC_003911|CRT matches to MH460460 (Dickeya phage vB_DsoM_JA13, complete genome) position: , mismatch: 9, identity: 0.763

aggcaacgaagacggcggcgacgaaggcgacgaagaca	CRISPR spacer
agattccgaagatgacggcgacgaaggcgacgatgccg	Protospacer
**..  ******.*.****************** * *.

385. spacer 1.13|2126980|38|NC_003911|CRT matches to NC_006569 (Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence) position: , mismatch: 9, identity: 0.763

aggcaacgaagacggcggcgacgaaggcgacgaagaca	CRISPR spacer
ggacgagaatgacgacggcaacgaaggcgacgaagacg	Protospacer
.*.*.* .* ****.****.*****************.

386. spacer 1.13|2126980|38|NC_003911|CRT matches to AF440695 (Virus PhiCh1, complete genome) position: , mismatch: 9, identity: 0.763

aggcaacgaagacggcggcgacgaaggcgacgaagaca	CRISPR spacer
cggcgacgaagacggcggcgacgagggcagctacgagt	Protospacer
 ***.*******************.***..* * **

387. spacer 1.13|2126980|38|NC_003911|CRT matches to NC_004084 (Natrialba phage PhiCh1, complete genome) position: , mismatch: 9, identity: 0.763

aggcaacgaagacggcggcgacgaaggcgacgaagaca	CRISPR spacer
cggcgacgaagacggcggcgacgagggcagctacgagt	Protospacer
 ***.*******************.***..* * **

388. spacer 1.19|2127361|32|NC_003911|CRT matches to MH460460 (Dickeya phage vB_DsoM_JA13, complete genome) position: , mismatch: 9, identity: 0.719

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
agacgacgaagacgacgaagatgattacgatg	Protospacer
.************.*******.**. * *...

389. spacer 1.19|2127361|32|NC_003911|CRT matches to NC_049851 (Burkholderia phage BcepSauron, complete genome) position: , mismatch: 9, identity: 0.719

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
agacgacgaggacgacgaagacgacaccgaag	Protospacer
.********.***.***********.  *. .

390. spacer 1.19|2127361|32|NC_003911|CRT matches to CP011998 (Ralstonia solanacearum strain YC45 plasmid, complete sequence) position: , mismatch: 9, identity: 0.719

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
atcgcacgaagacgacgaggacgacgaagacg	Protospacer
.    ********.****.**********.*.

391. spacer 1.19|2127361|32|NC_003911|CRT matches to KY984068 (Erwinia phage vB_EamM_Y3, complete genome) position: , mismatch: 9, identity: 0.719

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
caaagacgatgacgacgaagacgacgaggatg	Protospacer
 .* ***** ***.*************.*...

392. spacer 1.19|2127361|32|NC_003911|CRT matches to FJ168662 (Mycobacterium phage Troll4, complete genome) position: , mismatch: 9, identity: 0.719

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
ttcggacgaagacgacgaggacgacgaggacg	Protospacer
    *********.****.********.*.*.

393. spacer 1.19|2127361|32|NC_003911|CRT matches to MN284908 (Mycobacterium phage Helpful, complete genome) position: , mismatch: 9, identity: 0.719

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
ttcggacgaagacgacgaggacgacgaggacg	Protospacer
    *********.****.********.*.*.

394. spacer 1.19|2127361|32|NC_003911|CRT matches to MN234227 (Mycobacterium phage Giuseppe, complete genome) position: , mismatch: 9, identity: 0.719

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
ttcggacgaagacgacgaggacgacgaggacg	Protospacer
    *********.****.********.*.*.

395. spacer 1.19|2127361|32|NC_003911|CRT matches to NC_010070 (Burkholderia multivorans ATCC 17616 plasmid pBMUL01, complete sequence) position: , mismatch: 9, identity: 0.719

ggacgacgaagacaacgaagacgacgaaggca---	CRISPR spacer
---cgacgacgacgacgacgaagacgaagccgaag	Protospacer
   ****** ***.**** ** ******* *.

396. spacer 1.19|2127361|32|NC_003911|CRT matches to NZ_AP022602 (Mycobacterium gallinarum strain JCM 6399 plasmid pJCM6399) position: , mismatch: 9, identity: 0.719

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
cgacgacgaagacagcgacgacgacaccttcg	Protospacer
 *************.*** ******.    *.

397. spacer 1.19|2127361|32|NC_003911|CRT matches to NC_014310 (Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence) position: , mismatch: 9, identity: 0.719

ggacgacgaagacaacgaagacga-----cgaaggca	CRISPR spacer
agacgacgaagaaaaagaagacgaagccccgg-----	Protospacer
.*********** ** ********     **.

398. spacer 1.19|2127361|32|NC_003911|CRT matches to NC_010802 (Burkholderia multivorans ATCC 17616 plasmid pTGL1, complete sequence) position: , mismatch: 9, identity: 0.719

ggacgacgaagacaacgaagacgacgaaggca---	CRISPR spacer
---cgacgacgacgacgacgaagacgaagccgaag	Protospacer
   ****** ***.**** ** ******* *.

399. spacer 1.19|2127361|32|NC_003911|CRT matches to NZ_CP022760 (Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

ggacgacgaagacaacgaagacga-----cgaaggca	CRISPR spacer
agacgacgaagaaaaagaagacgaagccccgg-----	Protospacer
.*********** ** ********     **.

400. spacer 1.19|2127361|32|NC_003911|CRT matches to NZ_CP022789 (Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

ggacgacgaagacaacgaagacga-----cgaaggca	CRISPR spacer
agacgacgaagaaaaagaagacgaagccccgg-----	Protospacer
.*********** ** ********     **.

401. spacer 1.19|2127361|32|NC_003911|CRT matches to NZ_CP017105 (Rhizobium gallicum strain IE4872 plasmid pRgalIE4872d, complete sequence) position: , mismatch: 9, identity: 0.719

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
gaatgacgcagagaacgaagacgacgagcagg	Protospacer
*.*.**** *** **************. . .

402. spacer 1.19|2127361|32|NC_003911|CRT matches to CP006880 (Rhizobium gallicum bv. gallicum R602 plasmid pRgalR602c, complete sequence) position: , mismatch: 9, identity: 0.719

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
gaatgacgcagagaacgaagacgacgagcagg	Protospacer
*.*.**** *** **************. . .

403. spacer 1.19|2127361|32|NC_003911|CRT matches to MK016493 (Brevibacterium phage Cantare, complete genome) position: , mismatch: 9, identity: 0.719

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
gatgcccgaagacaccgaagacggcgaaggat	Protospacer
*.    ******** ********.******

404. spacer 1.19|2127361|32|NC_003911|CRT matches to MT774407 (CrAssphage cr125_1, complete genome) position: , mismatch: 9, identity: 0.719

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
caaatacgaagacgacgaagaagacgaagaat	Protospacer
 .*  ********.******* *******.

405. spacer 1.19|2127361|32|NC_003911|CRT matches to NC_019500 (Enterobacteria phage Bp7, complete genome) position: , mismatch: 9, identity: 0.719

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
agctgacgaagatgacgaagacgacgaaaaat	Protospacer
.* .********..**************..

406. spacer 1.19|2127361|32|NC_003911|CRT matches to MT682711 (Escherichia phage vB_EcoM_FB, complete genome) position: , mismatch: 9, identity: 0.719

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
agctgacgaagatgacgaagacgacgaaaaat	Protospacer
.* .********..**************..

407. spacer 1.19|2127361|32|NC_003911|CRT matches to KU878968 (Escherichia phage WG01, complete genome) position: , mismatch: 9, identity: 0.719

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
agctgacgaagatgacgaagacgacgaaaaat	Protospacer
.* .********..**************..

408. spacer 1.19|2127361|32|NC_003911|CRT matches to MT150133 (Enterobacteria phage vB_EcoM_IME540, complete genome) position: , mismatch: 9, identity: 0.719

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
agctgacgaagatgacgaagacgacgaaaaat	Protospacer
.* .********..**************..

409. spacer 1.19|2127361|32|NC_003911|CRT matches to NC_028847 (Enterobacteria phage QL01, complete genome) position: , mismatch: 9, identity: 0.719

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
agctgacgaagatgacgaagacgacgaaaaat	Protospacer
.* .********..**************..

410. spacer 1.19|2127361|32|NC_003911|CRT matches to MT478993 (Escherichia phage vB_EcoS_011D5, complete genome) position: , mismatch: 9, identity: 0.719

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
tgacgacgaagacgacgaagatgagaaacctc	Protospacer
 ************.*******.** .**  .

411. spacer 1.19|2127361|32|NC_003911|CRT matches to MT478993 (Escherichia phage vB_EcoS_011D5, complete genome) position: , mismatch: 9, identity: 0.719

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
gcgccgcgatgacgacgaagacgacgaagatg	Protospacer
* .* .*** ***.***************...

412. spacer 1.19|2127361|32|NC_003911|CRT matches to MH051913 (Enterobacteria phage vB_EcoM_IME281, complete genome) position: , mismatch: 9, identity: 0.719

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
agctgacgaagatgacgaagacgacgaaaaat	Protospacer
.* .********..**************..

413. spacer 1.19|2127361|32|NC_003911|CRT matches to KU878969 (Escherichia phage MX01, complete genome) position: , mismatch: 9, identity: 0.719

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
agctgacgaagatgacgaagacgacgaaaaat	Protospacer
.* .********..**************..

414. spacer 1.19|2127361|32|NC_003911|CRT matches to NZ_CP049245 (Rhizobium pseudoryzae strain DSM 19479 plasmid unnamed4, complete sequence) position: , mismatch: 9, identity: 0.719

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
cgacgacgaagacagcgacgacgagtagaggg	Protospacer
 *************.*** *****  *..* .

415. spacer 1.19|2127361|32|NC_003911|CRT matches to NZ_CP015745 (Shinella sp. HZN7 plasmid pShin-09, complete sequence) position: , mismatch: 9, identity: 0.719

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
cgacgacgaagacagcgacgacgagcagaggg	Protospacer
 *************.*** *****  *..* .

416. spacer 1.19|2127361|32|NC_003911|CRT matches to NC_018022 (Mycolicibacterium chubuense NBB4 plasmid pMYCCH.01, complete sequence) position: , mismatch: 9, identity: 0.719

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
cgacgacgaagacagcgacgacgatgccttcg	Protospacer
 *************.*** *****.*    *.

417. spacer 1.19|2127361|32|NC_003911|CRT matches to LN881731 (Escherichia phage slur06, complete genome) position: , mismatch: 9, identity: 0.719

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
cgacgacgaagacgccgaagacgaaaaaccgg	Protospacer
 ************. ********* .**   .

418. spacer 1.19|2127361|32|NC_003911|CRT matches to LN881730 (Escherichia phage slur05, complete genome) position: , mismatch: 9, identity: 0.719

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
cgacgacgaagacgccgaagacgaaaaaccgg	Protospacer
 ************. ********* .**   .

419. spacer 1.19|2127361|32|NC_003911|CRT matches to MN901521 (Halorubrum coriense virus Serpecor1, complete genome) position: , mismatch: 9, identity: 0.719

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
cgaccacgaaggcaacgaagacgaagcggctg	Protospacer
 *** ******.************ * .* ..

420. spacer 1.19|2127361|32|NC_003911|CRT matches to LR597646 (Escherichia phage Gluttony_ev152 genome assembly, chromosome: 1) position: , mismatch: 9, identity: 0.719

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
cgacgacgaagacgccgaagacgaaaaaccgg	Protospacer
 ************. ********* .**   .

421. spacer 1.25|2127715|32|NC_003911|CRT matches to NZ_CP011771 (Croceicoccus naphthovorans strain PQ-2 plasmid p1, complete sequence) position: , mismatch: 9, identity: 0.719

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
ttgcgacgtgttcgacgaaaacgacgccaagg	Protospacer
  .***** *****************     *

422. spacer 1.25|2127715|32|NC_003911|CRT matches to NZ_CP041045 (Paracoccus sp. AK26 plasmid pAK1, complete sequence) position: , mismatch: 9, identity: 0.719

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
cgacgaagagttcggcgaaaacgactggtggt	Protospacer
 ***** *******.********** ..*

423. spacer 1.25|2127715|32|NC_003911|CRT matches to NZ_CP019735 (Lactobacillus brevis strain TMW 1.2108 plasmid pl12108-1, complete sequence) position: , mismatch: 9, identity: 0.719

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
atgcttctagttcgacgaaaacgtctaattca	Protospacer
. .*  * *************** * *****.

424. spacer 1.25|2127715|32|NC_003911|CRT matches to NZ_CP016289 (Rhizobium leguminosarum strain Vaf10 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
agcccgacggtccgacgaaaacgacgaactcg	Protospacer
.* * .  .**.****************.***

425. spacer 1.25|2127715|32|NC_003911|CRT matches to NZ_CP046774 (Vibrio alginolyticus strain 2014V-1011 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
atcctacgagtacgacgagaacgacgaagatg	Protospacer
.  * ****** ******.*********  .*

426. spacer 1.25|2127715|32|NC_003911|CRT matches to NZ_CP019744 (Lactobacillus brevis strain TMW 1.2111 plasmid pl12111-1, complete sequence) position: , mismatch: 9, identity: 0.719

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
atgcttctagttcgacgaaaacgtctaattca	Protospacer
. .*  * *************** * *****.

427. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP050094 (Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b4, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaattcgccgtccttc	Protospacer
.* ******************** **    .

428. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP050082 (Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b4, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaattcgccgttcttc	Protospacer
.* ******************** **    .

429. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP050083 (Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b3, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaattcgccgtccttc	Protospacer
.* ******************** **    .

430. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP050106 (Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b5, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaattcgccgtccttc	Protospacer
.* ******************** **    .

431. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP021033 (Rhizobium sp. NXC14 plasmid pRspNXC14c, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaattcgccgtccttc	Protospacer
.* ******************** **    .

432. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP025014 (Rhizobium leguminosarum strain Norway plasmid pRLN2, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaattcgccgttcttc	Protospacer
.* ******************** **    .

433. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP025016 (Rhizobium leguminosarum strain Norway plasmid pRLN4, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaattcgccgtccttc	Protospacer
.* ******************** **    .

434. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP049732 (Rhizobium leguminosarum strain A1 plasmid pRL11, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaattcgccgttcttc	Protospacer
.* ******************** **    .

435. spacer 1.26|2127769|32|NC_003911|CRT matches to NC_008379 (Rhizobium leguminosarum bv. viciae 3841 plasmid pRL9, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaattcgccgtccttc	Protospacer
.* ******************** **    .

436. spacer 1.26|2127769|32|NC_003911|CRT matches to NC_007763 (Rhizobium etli CFN 42 plasmid p42b, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaattcgccgtccttc	Protospacer
.* ******************** **    .

437. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP021025 (Rhizobium sp. TAL182 plasmid pRetTAL182a, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaattcgccgtccttc	Protospacer
.* ******************** **    .

438. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP020907 (Rhizobium etli strain NXC12 plasmid pRetNXC12a, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaattcgccgtccttc	Protospacer
.* ******************** **    .

439. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP020952 (Rhizobium sp. CIAT894 plasmid pRheCIAT894e, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gtccgacgaagacgacgaattcgccgtccttg	Protospacer
.  ******************** **    .*

440. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP018229 (Rhizobium leguminosarum strain Vaf-108 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaactcgccgtcattg	Protospacer
.* ****************.*** **  . .*

441. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP018233 (Rhizobium leguminosarum strain Vaf-108 plasmid unnamed5, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaattcgccgtccttc	Protospacer
.* ******************** **    .

442. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP025506 (Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvE, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaattcgccgtccttc	Protospacer
.* ******************** **    .

443. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP016287 (Rhizobium leguminosarum strain Vaf10 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gaccgacgaagacgacgaattcgccgtccttg	Protospacer
.. ******************** **    .*

444. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP016293 (Rhizobium leguminosarum strain Vaf10 plasmid unnamed5, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaattcgccgtccttc	Protospacer
.* ******************** **    .

445. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP029452 (Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gcccgacgaagacgacgaactcgccggatttg	Protospacer
.  ****************.*** **.*  .*

446. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
cgcattcgaagtcgaggaattcgacgaagttg	Protospacer
 *    ***** *** ************* .*

447. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP013600 (Rhizobium sp. N741 plasmid pRspN741e, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaattcgccgtccttc	Protospacer
.* ******************** **    .

448. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP013600 (Rhizobium sp. N741 plasmid pRspN741e, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gaccgacgaagacgacgaattcgccgtccttg	Protospacer
.. ******************** **    .*

449. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP013577 (Rhizobium phaseoli strain N671 plasmid pRphaN671c, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gcccgacgaagacgacgaattcgccgttcctg	Protospacer
.  ******************** **    .*

450. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP013549 (Rhizobium phaseoli strain R611 plasmid pRetR611b, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gcccgacgaagacgacgaattcgccgttcctg	Protospacer
.  ******************** **    .*

451. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP013534 (Rhizobium phaseoli strain R650 plasmid pRphaR650b, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gcccgacgaagacgacgaattcgccgttcctg	Protospacer
.  ******************** **    .*

452. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP013545 (Rhizobium phaseoli strain R620 plasmid pRphaR620c, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gcccgacgaagacgacgaattcgccgttcctg	Protospacer
.  ******************** **    .*

453. spacer 1.26|2127769|32|NC_003911|CRT matches to NC_021906 (Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1a, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaattcgccgtccttc	Protospacer
.* ******************** **    .

454. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP013504 (Rhizobium esperanzae strain N561 plasmid pRspN561d, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaattcgccgtccttc	Protospacer
.* ******************** **    .

455. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP013504 (Rhizobium esperanzae strain N561 plasmid pRspN561d, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gaccgacgaagacgacgaattcgccgtccttg	Protospacer
.. ******************** **    .*

456. spacer 1.26|2127769|32|NC_003911|CRT matches to NC_012852 (Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132504, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaattcgccgtccttc	Protospacer
.* ******************** **    .

457. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP050111 (Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b1, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaattcgccgtccttc	Protospacer
.* ******************** **    .

458. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP030763 (Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaattcgccgtccttc	Protospacer
.* ******************** **    .

459. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP013510 (Rhizobium sp. N1341 plasmid pRspN1341e, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaattcgccgtccttc	Protospacer
.* ******************** **    .

460. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP013510 (Rhizobium sp. N1341 plasmid pRspN1341e, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gaccgacgaagacgacgaattcgccgtccttg	Protospacer
.. ******************** **    .*

461. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP013521 (Rhizobium sp. N113 plasmid pRspN113d, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaattcgccgtccttc	Protospacer
.* ******************** **    .

462. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP013521 (Rhizobium sp. N113 plasmid pRspN113d, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gaccgacgaagacgacgaattcgccgtccttg	Protospacer
.. ******************** **    .*

463. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP013571 (Rhizobium phaseoli strain N771 plasmid pRphaN771c, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gcccgacgaagacgacgaattcgccgttcctg	Protospacer
.  ******************** **    .*

464. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP013494 (Rhizobium sp. N6212 plasmid pRspN6212d, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaattcgccgtccttc	Protospacer
.* ******************** **    .

465. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP013494 (Rhizobium sp. N6212 plasmid pRspN6212d, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gaccgacgaagacgacgaattcgccgtccttg	Protospacer
.. ******************** **    .*

466. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP013512 (Rhizobium sp. N1314 plasmid pRspN1314a, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaattcgccgtccttc	Protospacer
.* ******************** **    .

467. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP013515 (Rhizobium sp. N1314 plasmid pRspN1314d, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gaccgacgaagacgacgaattcgccgtccttg	Protospacer
.. ******************** **    .*

468. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP054025 (Rhizobium sp. JKLM12A2 plasmid pPR12A204, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaattcgccgtccttc	Protospacer
.* ******************** **    .

469. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP054028 (Rhizobium sp. JKLM19E plasmid pPR19E01, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaattcgccgtccttc	Protospacer
.* ******************** **    .

470. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP013594 (Rhizobium sp. N871 plasmid pRspN871d, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaattcgccgtccttc	Protospacer
.* ******************** **    .

471. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP013594 (Rhizobium sp. N871 plasmid pRspN871d, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gaccgacgaagacgacgaattcgccgtccttg	Protospacer
.. ******************** **    .*

472. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP022668 (Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR3, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaattcgccgtccttc	Protospacer
.* ******************** **    .

473. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP023071 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gcccgacgaagacgacgaactcgccggatttg	Protospacer
.  ****************.*** **.*  .*

474. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP054034 (Rhizobium sp. JKLM13E plasmid pPR13E03, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaattcgccgtccttc	Protospacer
.* ******************** **    .

475. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP030830 (Neorhizobium sp. NCHU2750 plasmid pNCHU2750c, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
aggcgacgatgacgacgaactcggagagatgt	Protospacer
********* *********.***. **..

476. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP013605 (Rhizobium sp. N731 plasmid pRspN731d, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gaccgacgaagacgacgaattcgccgtccttg	Protospacer
.. ******************** **    .*

477. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP022569 (Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK05, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaattcgccgtccttc	Protospacer
.* ******************** **    .

478. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP053207 (Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1C, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaattcgccgtccttc	Protospacer
.* ******************** **    .

479. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP053208 (Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1B, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaattcgccgttcttc	Protospacer
.* ******************** **    .

480. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP035002 (Rhizobium acidisoli strain FH23 plasmid pRapFH23d, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaattcgccgtccttc	Protospacer
.* ******************** **    .

481. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP050088 (Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b6, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaattcgccgtccttc	Protospacer
.* ******************** **    .

482. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP013110 (Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gaccgacgaagacggcgaattcgccgggatcg	Protospacer
.. ***********.******** **... **

483. spacer 1.26|2127769|32|NC_003911|CRT matches to NC_010625 (Paraburkholderia phymatum STM815 plasmid pBPHY01, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ttacgacgaatacgacgaattcggcgatgttc	Protospacer
  .******* ************.*** * .

484. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP013054 (Sinorhizobium americanum CCGM7 plasmid C, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gaccgacgaagacggcgaattcgccgggatcg	Protospacer
.. ***********.******** **... **

485. spacer 1.26|2127769|32|NC_003911|CRT matches to KF114876 (Leptospira phage LalZ_80412, complete genome) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
tgaaaacgaagacgacgaagtggacgaagaaa	Protospacer
 *. .************** * *******. .

486. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP025013 (Rhizobium leguminosarum strain Norway plasmid pRLN1, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaactcgccgtccttg	Protospacer
.* ****************.*** **    .*

487. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP020900 (Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5d, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaactcgccgtccttg	Protospacer
.* ****************.*** **    .*

488. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP006990 (Rhizobium sp. IE4771 plasmid pRetIE4771d, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaactcgccgtccttg	Protospacer
.* ****************.*** **    .*

489. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP013526 (Rhizobium phaseoli strain R744 plasmid pRphaR744d, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaactcgccgtccttg	Protospacer
.* ****************.*** **    .*

490. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP013556 (Rhizobium phaseoli strain N931 plasmid pRphaN931d, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaactcgccgtccttg	Protospacer
.* ****************.*** **    .*

491. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP013589 (Rhizobium phaseoli strain N161 plasmid pRphaN161d, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaactcgccgtccttg	Protospacer
.* ****************.*** **    .*

492. spacer 1.26|2127769|32|NC_003911|CRT matches to NC_011371 (Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG204, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaaaacgacgaattcgccgtccttg	Protospacer
.* *******.************ **    .*

493. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP013562 (Rhizobium phaseoli strain N841 plasmid pRphaN841e, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaactcgccgtccttg	Protospacer
.* ****************.*** **    .*

494. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP013579 (Rhizobium phaseoli strain N671 plasmid pRphaN671e, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaactcgccgtccttg	Protospacer
.* ****************.*** **    .*

495. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP013531 (Rhizobium phaseoli strain R723 plasmid pRphaR723d, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaactcgccgtccttg	Protospacer
.* ****************.*** **    .*

496. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP013536 (Rhizobium phaseoli strain R650 plasmid pRphaR650d, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaactcgccgtccttg	Protospacer
.* ****************.*** **    .*

497. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP013541 (Rhizobium phaseoli strain R630 plasmid pRphaR630d, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaactcgccgtccttg	Protospacer
.* ****************.*** **    .*

498. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP013546 (Rhizobium phaseoli strain R620 plasmid pRphaR620d, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaactcgccgtccttg	Protospacer
.* ****************.*** **    .*

499. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP013567 (Rhizobium phaseoli strain N831 plasmid pRphaN831d, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaactcgccgtccttg	Protospacer
.* ****************.*** **    .*

500. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP048281 (Rhizobium leguminosarum bv. viciae 248 plasmid pRle248e, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaactcgccgtcactg	Protospacer
.* ****************.*** **  . .*

501. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP013584 (Rhizobium phaseoli strain N261 plasmid pRphaN261d, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaactcgccgtccttg	Protospacer
.* ****************.*** **    .*

502. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP013573 (Rhizobium phaseoli strain N771 plasmid pRphaN771e, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaactcgccgtccttg	Protospacer
.* ****************.*** **    .*

503. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP021127 (Rhizobium sp. Kim5 plasmid pRetKim5c, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaactcgccgtccttg	Protospacer
.* ****************.*** **    .*

504. spacer 1.26|2127769|32|NC_003911|CRT matches to NC_012848 (Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132501, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gcccgacgaagacgacgaactcgccgtccgtg	Protospacer
.  ****************.*** **   *.*

505. spacer 1.26|2127769|32|NC_003911|CRT matches to NC_010997 (Rhizobium etli CIAT 652 plasmid pC, complete sequence) position: , mismatch: 9, identity: 0.719

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaactcgccgtccttg	Protospacer
.* ****************.*** **    .*

506. spacer 1.29|2127955|32|NC_003911|CRT matches to NZ_CP015744 (Shinella sp. HZN7 plasmid pShin-08, complete sequence) position: , mismatch: 9, identity: 0.719

agccgatatcgacaatcgtggcgacgaaggcg	CRISPR spacer
ggccgagatcgacgatcgtggcgatgtgatgg	Protospacer
.***** ******.**********.* ..  *

507. spacer 1.31|2128054|32|NC_003911|CRT matches to NC_006569 (Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence) position: , mismatch: 9, identity: 0.719

aggcaacgaaggtgacgaagccgacgaaggcg	CRISPR spacer
gggtgacgagggtgacgaaggcgacgaactga	Protospacer
.**..****.********** *******   .

508. spacer 1.31|2128054|32|NC_003911|CRT matches to NC_019500 (Enterobacteria phage Bp7, complete genome) position: , mismatch: 9, identity: 0.719

aggcaacgaaggtgacgaagccgacgaaggcg	CRISPR spacer
agctgacgaagatgacgaagacgacgaaaaat	Protospacer
** ..******.******** *******..

509. spacer 1.31|2128054|32|NC_003911|CRT matches to MT682711 (Escherichia phage vB_EcoM_FB, complete genome) position: , mismatch: 9, identity: 0.719

aggcaacgaaggtgacgaagccgacgaaggcg	CRISPR spacer
agctgacgaagatgacgaagacgacgaaaaat	Protospacer
** ..******.******** *******..

510. spacer 1.31|2128054|32|NC_003911|CRT matches to KU878968 (Escherichia phage WG01, complete genome) position: , mismatch: 9, identity: 0.719

aggcaacgaaggtgacgaagccgacgaaggcg	CRISPR spacer
agctgacgaagatgacgaagacgacgaaaaat	Protospacer
** ..******.******** *******..

511. spacer 1.31|2128054|32|NC_003911|CRT matches to MT150133 (Enterobacteria phage vB_EcoM_IME540, complete genome) position: , mismatch: 9, identity: 0.719

aggcaacgaaggtgacgaagccgacgaaggcg	CRISPR spacer
agctgacgaagatgacgaagacgacgaaaaat	Protospacer
** ..******.******** *******..

512. spacer 1.31|2128054|32|NC_003911|CRT matches to NC_028847 (Enterobacteria phage QL01, complete genome) position: , mismatch: 9, identity: 0.719

aggcaacgaaggtgacgaagccgacgaaggcg	CRISPR spacer
agctgacgaagatgacgaagacgacgaaaaat	Protospacer
** ..******.******** *******..

513. spacer 1.31|2128054|32|NC_003911|CRT matches to MH051913 (Enterobacteria phage vB_EcoM_IME281, complete genome) position: , mismatch: 9, identity: 0.719

aggcaacgaaggtgacgaagccgacgaaggcg	CRISPR spacer
agctgacgaagatgacgaagacgacgaaaaat	Protospacer
** ..******.******** *******..

514. spacer 1.31|2128054|32|NC_003911|CRT matches to KU878969 (Escherichia phage MX01, complete genome) position: , mismatch: 9, identity: 0.719

aggcaacgaaggtgacgaagccgacgaaggcg	CRISPR spacer
agctgacgaagatgacgaagacgacgaaaaat	Protospacer
** ..******.******** *******..

515. spacer 1.31|2128054|32|NC_003911|CRT matches to NZ_CP049244 (Rhizobium pseudoryzae strain DSM 19479 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.719

aggcaacgaaggtgacgaagccgacgaaggcg	CRISPR spacer
aaccgtaataggtgacgaagccgatgaagacg	Protospacer
*. *.  . ***************.****.**

516. spacer 1.36|2128360|41|NC_003911|CRT matches to MK433268 (Streptomyces phage Popy, complete genome) position: , mismatch: 9, identity: 0.78

agacgacgagggcgacgaaaacgacgaggacgacgaaaaca	CRISPR spacer
cgccgacgaggacgacgagaacgacgaggacgacgagctgc	Protospacer
 * ********.******.*****************.

517. spacer 1.36|2128360|41|NC_003911|CRT matches to MF467948 (Streptomyces phage DrGrey, complete genome) position: , mismatch: 9, identity: 0.78

agacgacgagggcgacgaaaacgacgaggacgacgaaaaca	CRISPR spacer
cgccgacgaggacgacgagaacgacgaggacgacgagctgc	Protospacer
 * ********.******.*****************.

518. spacer 1.36|2128360|41|NC_003911|CRT matches to MN586054 (Streptomyces phage FrodoSwaggins, complete genome) position: , mismatch: 9, identity: 0.78

agacgacgagggcgacgaaaacgacgaggacgacgaaaaca	CRISPR spacer
cgccgacgaggacgacgagaacgacgaggacgacgagctgc	Protospacer
 * ********.******.*****************.

519. spacer 1.37|2128423|32|NC_003911|CRT matches to NZ_CP054023 (Rhizobium sp. JKLM12A2 plasmid pPR12A202, complete sequence) position: , mismatch: 9, identity: 0.719

aaacgacgaatacgacgaaggtgacgaagccg	CRISPR spacer
cgccgatgaatgcgacgaaggtgacggcgaca	Protospacer
 . ***.****.**************. * *.

520. spacer 1.37|2128423|32|NC_003911|CRT matches to NZ_CP054033 (Rhizobium sp. JKLM13E plasmid pPR13E02, complete sequence) position: , mismatch: 9, identity: 0.719

aaacgacgaatacgacgaaggtgacgaagccg	CRISPR spacer
cgccgatgaatgcgacgaaggtgacggcgaca	Protospacer
 . ***.****.**************. * *.

521. spacer 1.37|2128423|32|NC_003911|CRT matches to MN694232 (Marine virus AFVG_250M183, complete genome) position: , mismatch: 9, identity: 0.719

aaacgacgaatacgacgaaggtgacgaagccg	CRISPR spacer
gacagacgaatacgacgagggtgaggagatca	Protospacer
.*  **************.***** **...*.

522. spacer 1.37|2128423|32|NC_003911|CRT matches to KC117377 (Halovirus HVTV-1, complete genome) position: , mismatch: 9, identity: 0.719

aaacgacgaatacgacgaaggtgacgaagccg	CRISPR spacer
cgccgacgaagacgacgacggtgacggtggtg	Protospacer
 . ******* ******* *******. * .*

523. spacer 1.39|2128540|32|NC_003911|CRT matches to NZ_CP038031 (Rhodococcus ruber strain R1 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

gttcgacgaagaaaacgaaggcagcgaaggcg	CRISPR spacer
cttcgacgtagaaaccgaaggcagtgtggaaa	Protospacer
 ******* ***** *********.* .*. .

524. spacer 1.39|2128540|32|NC_003911|CRT matches to NZ_CP024892 (Rhodococcus ruber strain YYL plasmid pYYL1.1, complete sequence) position: , mismatch: 9, identity: 0.719

gttcgacgaagaaaacgaaggcagcgaaggcg	CRISPR spacer
cttcgacgtagaaaccgaaggcagtgtggaaa	Protospacer
 ******* ***** *********.* .*. .

525. spacer 1.19|2127361|32|NC_003911|CRT matches to KY984068 (Erwinia phage vB_EamM_Y3, complete genome) position: , mismatch: 10, identity: 0.688

ggacgacgaagacaacgaagacgacgaaggca---	CRISPR spacer
---tgacgacgaagacgacgatgacgatggcatgt	Protospacer
   .***** ** .**** **.***** ****

526. spacer 1.19|2127361|32|NC_003911|CRT matches to MH389777 (Dickeya phage vB_DsoM_JA11, complete genome) position: , mismatch: 10, identity: 0.688

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
tcgttgcgacgacgacgaagacgacgaagacg	Protospacer
  .. .*** ***.***************.*.

527. spacer 1.19|2127361|32|NC_003911|CRT matches to MH460462 (Dickeya phage vB_DsoM_JA33, complete genome) position: , mismatch: 10, identity: 0.688

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
tcgttgcgacgacgacgaagacgacgaagacg	Protospacer
  .. .*** ***.***************.*.

528. spacer 1.19|2127361|32|NC_003911|CRT matches to MN478374 (Bacteriophage Phobos, complete genome) position: , mismatch: 10, identity: 0.688

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
ggacgacgaagacgaagaagacggtctgatct	Protospacer
*************.* *******..  .. *

529. spacer 1.19|2127361|32|NC_003911|CRT matches to MN101225 (Klebsiella phage KPN1, complete genome) position: , mismatch: 10, identity: 0.688

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
taaagacgaagacgacgaagaggacgagtaat	Protospacer
 .* *********.******* *****. .

530. spacer 1.19|2127361|32|NC_003911|CRT matches to MH316562 (Mycobacterium phage Erk16, complete genome) position: , mismatch: 10, identity: 0.688

---ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
ttcggacgaagacgacgaagacgatgacgagg---	Protospacer
   ****** ** ***.* ** **.*****.*

531. spacer 1.19|2127361|32|NC_003911|CRT matches to MN101230 (Klebsiella phage KPN6, complete genome) position: , mismatch: 10, identity: 0.688

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
taaagacgaagacgacgaagaggacgagtaat	Protospacer
 .* *********.******* *****. .

532. spacer 1.19|2127361|32|NC_003911|CRT matches to KY000080 (Klebsiella phage KPV15, complete genome) position: , mismatch: 10, identity: 0.688

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
taaagacgaagacgacgaagaggacgagtaat	Protospacer
 .* *********.******* *****. .

533. spacer 1.24|2127661|32|NC_003911|CRT matches to NZ_CP032348 (Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence) position: , mismatch: 10, identity: 0.688

aaccaatctgaacgacgaaaacgacgagggtg	CRISPR spacer
gtgcaatctgaacgacgaaagcgccgccctgg	Protospacer
.  *****************.** **     *

534. spacer 1.25|2127715|32|NC_003911|CRT matches to NZ_CP016879 (Xanthomonas hortorum strain B07-007 plasmid pB07007, complete sequence) position: , mismatch: 10, identity: 0.688

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
agacgacgagttcgacgacgacgaccgcccgc	Protospacer
.***************** .***** . ..

535. spacer 1.25|2127715|32|NC_003911|CRT matches to NZ_CP018733 (Xanthomonas gardneri strain ICMP 7383 plasmid pICMP7383.2, complete sequence) position: , mismatch: 10, identity: 0.688

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
agacgacgagttcgacgacgacgaccgcccgc	Protospacer
.***************** .***** . ..

536. spacer 1.25|2127715|32|NC_003911|CRT matches to MN694356 (Marine virus AFVG_250M50, complete genome) position: , mismatch: 10, identity: 0.688

ggacgacgagttcgacgaaaacgacgaattcg	CRISPR spacer
tgacgccgagatcgacgaaaacgagatcgctg	Protospacer
 **** **** ************* .   ..*

537. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP020948 (Rhizobium sp. CIAT894 plasmid pRheCIAT894a, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gaccgacgaagacgacgaattcgccgtccttc	Protospacer
.. ******************** **    .

538. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP050101 (Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b6, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gtccgacgaagacgacgaattcgccgtccttc	Protospacer
.  ******************** **    .

539. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP021033 (Rhizobium sp. NXC14 plasmid pRspNXC14c, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gaccgacgaagacgacgaactcgccgtccttg	Protospacer
.. ****************.*** **    .*

540. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP020899 (Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5c, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gcccgacgaagacgacgaattcgccgttcttc	Protospacer
.  ******************** **    .

541. spacer 1.26|2127769|32|NC_003911|CRT matches to NC_007765 (Rhizobium etli CFN 42 plasmid p42e, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gcccgacgaagacgacgaattcgccgttctta	Protospacer
.  ******************** **    ..

542. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP053442 (Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eD, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gtccgacgaagacgacgaattcgccgtccttc	Protospacer
.  ******************** **    .

543. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP021028 (Rhizobium sp. TAL182 plasmid pRetTAL182d, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gcccgacgaagacgacgaattcgccgttcttt	Protospacer
.  ******************** **    .

544. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP013525 (Rhizobium phaseoli strain R744 plasmid pRphaR744c, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gcccgacgaagacgacgaattcgccgttcttc	Protospacer
.  ******************** **    .

545. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP013554 (Rhizobium phaseoli strain N931 plasmid pRphaN931b, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gcccgacgaagacgacgaattcgccgttcttc	Protospacer
.  ******************** **    .

546. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP020909 (Rhizobium etli strain NXC12 plasmid pRetNXC12c, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gcccgacgaagacgacgaattcgccgttctta	Protospacer
.  ******************** **    ..

547. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP013588 (Rhizobium phaseoli strain N161 plasmid pRphaN161c, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gcccgacgaagacgacgaattcgccgttcttc	Protospacer
.  ******************** **    .

548. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP013529 (Rhizobium phaseoli strain R723 plasmid pRphaR723b, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gcccgacgaagacgacgaattcgccgttcttc	Protospacer
.  ******************** **    .

549. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP013565 (Rhizobium phaseoli strain N831 plasmid pRphaN831b, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gcccgacgaagacgacgaattcgccgttcttc	Protospacer
.  ******************** **    .

550. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP013503 (Rhizobium esperanzae strain N561 plasmid pRspN561c, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gcccgacgaagacgacgaattcgccgttcttc	Protospacer
.  ******************** **    .

551. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP013582 (Rhizobium phaseoli strain N261 plasmid pRphaN261b, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gcccgacgaagacgacgaattcgccgttcttc	Protospacer
.  ******************** **    .

552. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP013509 (Rhizobium sp. N1341 plasmid pRspN1341d, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gcccgacgaagacgacgaattcgccgttcttc	Protospacer
.  ******************** **    .

553. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP013520 (Rhizobium sp. N113 plasmid pRspN113c, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gcccgacgaagacgacgaattcgccgttcttc	Protospacer
.  ******************** **    .

554. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP013493 (Rhizobium sp. N6212 plasmid pRspN6212c, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gcccgacgaagacgacgaattcgccgttcttc	Protospacer
.  ******************** **    .

555. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP054028 (Rhizobium sp. JKLM19E plasmid pPR19E01, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gaccgacgaagacaacgaattcgccgtccttg	Protospacer
.. **********.********* **    .*

556. spacer 1.26|2127769|32|NC_003911|CRT matches to NC_009620 (Sinorhizobium medicae WSM419 plasmid pSMED01, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gcccgacgaagacgacgaactcgccggatttt	Protospacer
.  ****************.*** **.*  .

557. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP050099 (Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b5, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaactcgccgttcttc	Protospacer
.* ****************.*** **    .

558. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP013110 (Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagaccacgaattcgccgttcttc	Protospacer
.* ********** ********* **    .

559. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP030764 (Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed4, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaactcgccgttcttc	Protospacer
.* ****************.*** **    .

560. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP021373 (Rhizobium sp. ACO-34A plasmid pRACO34Ac, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gtccgacgatgacgacgaattcgccgggccgg	Protospacer
.  ****** ************* **..   *

561. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP024310 (Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3c, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagaccacgaattcgccgttcttc	Protospacer
.* ********** ********* **    .

562. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP013054 (Sinorhizobium americanum CCGM7 plasmid C, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagaccacgaattcgccgttcttc	Protospacer
.* ********** ********* **    .

563. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP023064 (Sinorhizobium sp. CCBAU 05631 plasmid pSS05631b, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagaccacgaattcgccgttcttc	Protospacer
.* ********** ********* **    .

564. spacer 1.26|2127769|32|NC_003911|CRT matches to NC_048053 (Dickeya phage vB_DsoM_JA29, complete genome) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
cgaagacgaagacgacgaagacgacgagtaat	Protospacer
 *. ***************  ******. .

565. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP050092 (Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b6, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gaccgacgaagacgacgaactcgccgtcttgg	Protospacer
.. ****************.*** **     *

566. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP050104 (Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b2, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gaccgacgaagacgacgaactcgccgtccttg	Protospacer
.. ****************.*** **    .*

567. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP050105 (Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b6, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaactcgccgttcctc	Protospacer
.* ****************.*** **    .

568. spacer 1.26|2127769|32|NC_003911|CRT matches to NC_012586 (Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gaccgacgaacacgacgaattcgccgttcttg	Protospacer
.. ******* ************ **    .*

569. spacer 1.26|2127769|32|NC_003911|CRT matches to NC_019849 (Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gtccgacgaagacgacgaactcgccggacttt	Protospacer
.  ****************.*** **.*  .

570. spacer 1.26|2127769|32|NC_003911|CRT matches to NC_003078 (Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gtccgacgaagacgacgaactcgccggacttt	Protospacer
.  ****************.*** **.*  .

571. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP020900 (Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5d, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacaacgaattcgccgtccttc	Protospacer
.* **********.********* **    .

572. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP053441 (Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eE, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaactcgccgttcttc	Protospacer
.* ****************.*** **    .

573. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP019586 (Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gtccgacgaagacgacgaactcgccggacttt	Protospacer
.  ****************.*** **.*  .

574. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP006989 (Rhizobium sp. IE4771 plasmid pRetIE4771c, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaactcgccgttcttc	Protospacer
.* ****************.*** **    .

575. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP013526 (Rhizobium phaseoli strain R744 plasmid pRphaR744d, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacaacgaattcgccgtccttc	Protospacer
.* **********.********* **    .

576. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP013556 (Rhizobium phaseoli strain N931 plasmid pRphaN931d, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacaacgaattcgccgtccttc	Protospacer
.* **********.********* **    .

577. spacer 1.26|2127769|32|NC_003911|CRT matches to NC_017326 (Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gtccgacgaagacgacgaactcgccggacttt	Protospacer
.  ****************.*** **.*  .

578. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP025507 (Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvA, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gaccgacgaagacgacgaactcgccgtccttg	Protospacer
.. ****************.*** **    .*

579. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP025508 (Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvB, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaactcgccgttcctc	Protospacer
.* ****************.*** **    .

580. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP013589 (Rhizobium phaseoli strain N161 plasmid pRphaN161d, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacaacgaattcgccgtccttc	Protospacer
.* **********.********* **    .

581. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP021799 (Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gtccgacgaagacgacgaactcgccggacttt	Protospacer
.  ****************.*** **.*  .

582. spacer 1.26|2127769|32|NC_003911|CRT matches to NC_017323 (Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gtccgacgaagacgacgaactcgccggacttt	Protospacer
.  ****************.*** **.*  .

583. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP013562 (Rhizobium phaseoli strain N841 plasmid pRphaN841e, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacaacgaattcgccgtccttc	Protospacer
.* **********.********* **    .

584. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP013579 (Rhizobium phaseoli strain N671 plasmid pRphaN671e, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacaacgaattcgccgtccttc	Protospacer
.* **********.********* **    .

585. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP007050 (Rhizobium leguminosarum bv. trifolii WSM1689 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacaacgaattcgccgtccttc	Protospacer
.* **********.********* **    .

586. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP013531 (Rhizobium phaseoli strain R723 plasmid pRphaR723d, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacaacgaattcgccgtccttc	Protospacer
.* **********.********* **    .

587. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP013536 (Rhizobium phaseoli strain R650 plasmid pRphaR650d, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacaacgaattcgccgtccttc	Protospacer
.* **********.********* **    .

588. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP013541 (Rhizobium phaseoli strain R630 plasmid pRphaR630d, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacaacgaattcgccgtccttc	Protospacer
.* **********.********* **    .

589. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP013546 (Rhizobium phaseoli strain R620 plasmid pRphaR620d, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacaacgaattcgccgtccttc	Protospacer
.* **********.********* **    .

590. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP009146 (Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gtccgacgaagacgacgaactcgccggacttt	Protospacer
.  ****************.*** **.*  .

591. spacer 1.26|2127769|32|NC_003911|CRT matches to NC_018701 (Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gtccgacgaagacgacgaactcgccggacttt	Protospacer
.  ****************.*** **.*  .

592. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP013567 (Rhizobium phaseoli strain N831 plasmid pRphaN831d, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacaacgaattcgccgtccttc	Protospacer
.* **********.********* **    .

593. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP050109 (Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b2, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gaccgacgaagacgacgaactcgccgtccttg	Protospacer
.. ****************.*** **    .*

594. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP050110 (Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b4, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaactcgccgttcctc	Protospacer
.* ****************.*** **    .

595. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP048283 (Rhizobium leguminosarum bv. viciae 248 plasmid pRle248c, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacaacgaattcgccgtccttc	Protospacer
.* **********.********* **    .

596. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP013584 (Rhizobium phaseoli strain N261 plasmid pRphaN261d, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacaacgaattcgccgtccttc	Protospacer
.* **********.********* **    .

597. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP030761 (Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gaccgacgaagacgacgaactcgccgtccttg	Protospacer
.. ****************.*** **    .*

598. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP013573 (Rhizobium phaseoli strain N771 plasmid pRphaN771e, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacaacgaattcgccgtccttc	Protospacer
.* **********.********* **    .

599. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP021828 (Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gtccgacgaagacgacgaactcgccggacttt	Protospacer
.  ****************.*** **.*  .

600. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP021126 (Rhizobium sp. Kim5 plasmid pRetKim5b, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaactcgccgttcttc	Protospacer
.* ****************.*** **    .

601. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP013516 (Rhizobium sp. N1314 plasmid pRspN1314e, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaactcgccgttcttc	Protospacer
.* ****************.*** **    .

602. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP054022 (Rhizobium sp. JKLM12A2 plasmid pPR12A201, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gaccgacgaagacgacgaactcgccgtcttgg	Protospacer
.. ****************.*** **     *

603. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP021802 (Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gtccgacgaagacgacgaactcggcggacttt	Protospacer
.  ****************.***.**.*  .

604. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP022666 (Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR1, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gaccgacgaagacgacgaactcgccgtccttg	Protospacer
.. ****************.*** **    .*

605. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP022667 (Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR2, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaactcgccgttcctc	Protospacer
.* ****************.*** **    .

606. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP021820 (Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gtccgacgaagacgacgaactcgccggacttt	Protospacer
.  ****************.*** **.*  .

607. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP021831 (Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gtccgacgaagacgacgaactcgccggacttt	Protospacer
.  ****************.*** **.*  .

608. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP021823 (Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gtccgacgaagacgacgaactcgccggacttt	Protospacer
.  ****************.*** **.*  .

609. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP021814 (Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gtccgacgaagacgacgaactcgccggacttt	Protospacer
.  ****************.*** **.*  .

610. spacer 1.26|2127769|32|NC_003911|CRT matches to CP007642 (Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803a, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaactcgccgttcttc	Protospacer
.* ****************.*** **    .

611. spacer 1.26|2127769|32|NC_003911|CRT matches to NC_010997 (Rhizobium etli CIAT 652 plasmid pC, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacaacgaattcgccgtccttc	Protospacer
.* **********.********* **    .

612. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP021795 (Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gtccgacgaagacgacgaactcgccggacttt	Protospacer
.  ****************.*** **.*  .

613. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP021810 (Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gtccgacgaagacgacgaactcgccggacttt	Protospacer
.  ****************.*** **.*  .

614. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP021806 (Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gtccgacgaagacgacgaactcgccggacttt	Protospacer
.  ****************.*** **.*  .

615. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP021218 (Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gtccgacgaagacgacgaactcgccggacttt	Protospacer
.  ****************.*** **.*  .

616. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP054616 (Azospirillum oryzae strain KACC 14407 plasmid unnamed2, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gtgcgacgatgacgacgaatgcgaccgtgcgc	Protospacer
. ******* ********** **** . *

617. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP026527 (Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gtccgacgaagacgacgaactcgccggacttt	Protospacer
.  ****************.*** **.*  .

618. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP022565 (Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK01, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gaccgacgaagacgacgaactcgccgtcttgg	Protospacer
.. ****************.*** **     *

619. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP022567 (Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK03, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gcccgacgaagatgacgaattcgccgtccttg	Protospacer
.  *********.********** **    .*

620. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP019484 (Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gtccgacgaagacgacgaactcgccggacttt	Protospacer
.  ****************.*** **.*  .

621. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP019487 (Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gtccgacgaagacgacgaactcgccggacttt	Protospacer
.  ****************.*** **.*  .

622. spacer 1.26|2127769|32|NC_003911|CRT matches to NC_020560 (Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gtccgacgaagacgacgaactcgccggacttt	Protospacer
.  ****************.*** **.*  .

623. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP050086 (Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b7, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gaccgacgaagacgacgaactcgccgtccttg	Protospacer
.. ****************.*** **    .*

624. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP050087 (Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b5, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
ggccgacgaagacgacgaactcgccgttcctc	Protospacer
.* ****************.*** **    .

625. spacer 1.26|2127769|32|NC_003911|CRT matches to MK757446 (Mycobacterium phage Candle, complete genome) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
cgacgacgatgacgacgaattcgccggcttga	Protospacer
 *.****** ************* **.    .

626. spacer 1.26|2127769|32|NC_003911|CRT matches to KY969628 (Mycobacterium phage Zenon, complete genome) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
cgacgacgatgacgacgaattcgccggcttga	Protospacer
 *.****** ************* **.    .

627. spacer 1.26|2127769|32|NC_003911|CRT matches to MH001447 (Mycobacterium phage Nilo, complete genome) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
cgacgacgatgacgacgaattcgccggcttga	Protospacer
 *.****** ************* **.    .

628. spacer 1.26|2127769|32|NC_003911|CRT matches to MH926059 (Mycobacterium phage Riparian, complete genome) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
cgacgacgatgacgacgaattcgccggcttga	Protospacer
 *.****** ************* **.    .

629. spacer 1.26|2127769|32|NC_003911|CRT matches to JF704112 (Mycobacterium phage Send513, complete sequence) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
cgacgacgatgacgacgaattcgccggcttga	Protospacer
 *.****** ************* **.    .

630. spacer 1.26|2127769|32|NC_003911|CRT matches to MT684602 (Mycobacterium phage Rope, complete genome) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
cgacgacgatgacgacgaattcgccggcttga	Protospacer
 *.****** ************* **.    .

631. spacer 1.26|2127769|32|NC_003911|CRT matches to NC_022053 (Mycobacterium phage Papyrus, complete genome) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
cgacgacgatgacgacgaattcgccggcttga	Protospacer
 *.****** ************* **.    .

632. spacer 1.26|2127769|32|NC_003911|CRT matches to KT591076 (Mycobacterium phage Weiss13, complete genome) position: , mismatch: 10, identity: 0.688

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
cgacgacgatgacgacgaattcgccggcttga	Protospacer
 *.****** ************* **.    .

633. spacer 1.28|2127895|38|NC_003911|CRT matches to NC_006569 (Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence) position: , mismatch: 10, identity: 0.737

aggcgacgaggccgaaaccggcaccggcgatgacggtg	CRISPR spacer
aaagggcattaccgaaaacggcaccggctatgacggtg	Protospacer
*.. *.*.  .****** ********** *********

634. spacer 1.29|2127955|32|NC_003911|CRT matches to NC_015060 (Granulicella tundricola MP5ACTX9 plasmid pACIX905, complete sequence) position: , mismatch: 10, identity: 0.688

agccgatatcgacaatcgtggcgacgaaggcg	CRISPR spacer
actcgatatcgagaatcctggcgacgttcaac	Protospacer
* .********* **** ********   .

635. spacer 1.29|2127955|32|NC_003911|CRT matches to NC_020062 (Rhizobium tropici CIAT 899 plasmid pRtrCIAT899c, complete sequence) position: , mismatch: 10, identity: 0.688

agccgatatcgacaatcgtggcgacgaaggcg	CRISPR spacer
gaacctcctcgacaatcttgtcgacgaaggcc	Protospacer
.. *  . ********* ** **********

636. spacer 1.31|2128054|32|NC_003911|CRT matches to NZ_CP032341 (Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence) position: , mismatch: 10, identity: 0.688

aggcaacgaaggtgacgaagccgacgaaggcg	CRISPR spacer
tcagaaagaaggtgacgaagccgaggaacaga	Protospacer
  . ** ***************** *** . .

637. spacer 1.31|2128054|32|NC_003911|CRT matches to NZ_CP012916 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence) position: , mismatch: 10, identity: 0.688

aggcaacgaaggtgacgaagccgacgaaggcg	CRISPR spacer
tcagaaagaaggtgacgaagccgaggaacaga	Protospacer
  . ** ***************** *** . .

638. spacer 1.11|2126878|35|NC_003911|CRT matches to NC_006569 (Ruegeria pomeroyi DSS-3 megaplasmid, complete sequence) position: , mismatch: 11, identity: 0.686

gtccggcgacgaaggtgatgagggcgacgaagctg	CRISPR spacer
cgaaggcgacgagggtgacgagggcgacgagaaca	Protospacer
    ********.*****.***********.. ..

639. spacer 1.13|2126980|38|NC_003911|CRT matches to NZ_CP049244 (Rhizobium pseudoryzae strain DSM 19479 plasmid unnamed3, complete sequence) position: , mismatch: 11, identity: 0.711

aggcaacgaagacggcggcgacgaaggcgacgaagaca	CRISPR spacer
agtgctcgaagccggcggcgacgaaggcggcgatcggc	Protospacer
**    ***** *****************.***  .

640. spacer 1.13|2126980|38|NC_003911|CRT matches to NZ_CP007795 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence) position: , mismatch: 11, identity: 0.711

aggcaacgaagacggcggcgacgaaggcgacgaagaca	CRISPR spacer
agtgttcgaagccggcggcgacgaaggcggcgaccggc	Protospacer
**    ***** *****************.***  .

641. spacer 1.13|2126980|38|NC_003911|CRT matches to NC_013856 (Azospirillum sp. B510 plasmid pAB510b, complete sequence) position: , mismatch: 11, identity: 0.711

aggcaacgaagacggcggcgacgaaggcgacgaagaca	CRISPR spacer
agtgctcgaagccggcggcgacgaaggcggcgaccggg	Protospacer
**    ***** *****************.***  . .

642. spacer 1.13|2126980|38|NC_003911|CRT matches to NC_013856 (Azospirillum sp. B510 plasmid pAB510b, complete sequence) position: , mismatch: 11, identity: 0.711

aggcaacgaagacggcggcgacgaaggcgacgaagaca	CRISPR spacer
agtgctcgaagccggcggcgacgaaggcggcgaccggc	Protospacer
**    ***** *****************.***  .

643. spacer 1.13|2126980|38|NC_003911|CRT matches to NZ_CP032323 (Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence) position: , mismatch: 11, identity: 0.711

aggcaacgaagacggcggcgacgaaggcgacgaagaca	CRISPR spacer
agtgttcgaagccggcggcgacgaaggcggcgactggc	Protospacer
**    ***** *****************.***  .

644. spacer 1.19|2127361|32|NC_003911|CRT matches to MG757156 (Mycobacterium phage Cuke, complete genome) position: , mismatch: 11, identity: 0.656

ggacgacgaagacaacgaagacgacgaaggca	CRISPR spacer
cgaagacgaagacgacgaagacgagtcgtttg	Protospacer
 ** *********.**********   .  ..

645. spacer 1.26|2127769|32|NC_003911|CRT matches to NC_012858 (Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132502, complete sequence) position: , mismatch: 11, identity: 0.656

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gaccgacgaagacgacgaactcgccgttcttc	Protospacer
.. ****************.*** **    .

646. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP050093 (Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b5, complete sequence) position: , mismatch: 11, identity: 0.656

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gaccgacgaagacgacgaactcgccgttcttc	Protospacer
.. ****************.*** **    .

647. spacer 1.26|2127769|32|NC_003911|CRT matches to NC_008384 (Rhizobium leguminosarum bv. viciae 3841 plasmid pRL11, complete sequence) position: , mismatch: 11, identity: 0.656

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gaccgacgaagacgacgaactcgccgttcttc	Protospacer
.. ****************.*** **    .

648. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP013634 (Rhizobium sp. N324 plasmid pRspN324d, complete sequence) position: , mismatch: 11, identity: 0.656

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gcccgacgaagacgacgaactcgccgttcctc	Protospacer
.  ****************.*** **    .

649. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP054023 (Rhizobium sp. JKLM12A2 plasmid pPR12A202, complete sequence) position: , mismatch: 11, identity: 0.656

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gcccgacgaagacgacgaactcgccgttcttc	Protospacer
.  ****************.*** **    .

650. spacer 1.26|2127769|32|NC_003911|CRT matches to NC_010998 (Rhizobium etli CIAT 652 plasmid pA, complete sequence) position: , mismatch: 11, identity: 0.656

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gcccgacgaagacgacgaactcgccgttcttc	Protospacer
.  ****************.*** **    .

651. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP054033 (Rhizobium sp. JKLM13E plasmid pPR13E02, complete sequence) position: , mismatch: 11, identity: 0.656

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gcccgacgaagacgacgaactcgccgttcttc	Protospacer
.  ****************.*** **    .

652. spacer 1.26|2127769|32|NC_003911|CRT matches to NZ_CP035001 (Rhizobium acidisoli strain FH23 plasmid pRapFH23c, complete sequence) position: , mismatch: 11, identity: 0.656

aggcgacgaagacgacgaattcgacgaaggcg	CRISPR spacer
gcccgacgaagacgacgaactcgccgttcttc	Protospacer
.  ****************.*** **    .

653. spacer 1.34|2128234|32|NC_003911|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 11, identity: 0.656

aggcaatgaaggcaatgagaacgacgagctcg	CRISPR spacer
cagcaatgaaggcaatgaggaggactgatgaa	Protospacer
 .*****************.* *** ...  .

654. spacer 1.39|2128540|32|NC_003911|CRT matches to NZ_CP045296 (Paenibacillus cellulositrophicus strain KACC 16577 plasmid unnamed1, complete sequence) position: , mismatch: 11, identity: 0.656

gttcgacgaagaaaacgaaggcagcgaaggcg	CRISPR spacer
tgaacacgaaggaaacgatggcagcgaactac	Protospacer
     ******.****** *********

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

2367559 : 2407200

Roseobacter_phage(21.43%)

tail,portal,protease,tRNA,head,capsid

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011047948.1\|2367559_2368609_-\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
WP_011047949.1\|2368678_2372101_-	hypothetical protein	NA	NA	NA	NA
WP_011047950.1\|2372162_2372624_+	peroxiredoxin	NA	NA	NA	NA
WP_044029236.1\|2372641_2373457_+	ferritin-like domain-containing protein	NA	NA	NA	NA
WP_044028323.1\|2373645_2374974_+	peptidoglycan DD-metalloendopeptidase family protein	G9BW84	Planktothrix_phage	4.2e-20	41.4
WP_011047953.1\|2374963_2375479_+	polymer-forming cytoskeletal protein	NA	NA	NA	NA
WP_044028325.1\|2375613_2376579_-	DUF3179 domain-containing protein	NA	NA	NA	NA
WP_011047955.1\|2376700_2377246_-	peptidylprolyl isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	3.3e-40	56.2
WP_011047956.1\|2377238_2377745_-	peptidylprolyl isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	5.6e-42	55.6
WP_011047957.1\|2377877_2379074_+	phosphoglycerate kinase	NA	NA	NA	NA
WP_158454170.1\|2379086_2379251_-	hypothetical protein	NA	NA	NA	NA
WP_158454191.1\|2379250_2379466_-	DUF465 domain-containing protein	NA	NA	NA	NA
WP_011047960.1\|2379643_2380576_+	hydrogen peroxide-inducible genes activator	NA	NA	NA	NA
WP_011047961.1\|2380700_2381000_+	septum formation initiator family protein	NA	NA	NA	NA
WP_011047962.1\|2381175_2382168_+	pyruvate dehydrogenase (acetyl-transferring) E1 component subunit alpha	NA	NA	NA	NA
WP_011047963.1\|2382182_2383562_+	pyruvate dehydrogenase complex E1 component subunit beta	NA	NA	NA	NA
WP_011047964.1\|2383574_2384888_+	pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase	NA	NA	NA	NA
WP_144083994.1\|2385034_2386510_-	hypothetical protein	NA	NA	NA	NA
WP_044028331.1\|2389538_2390369_+	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_011047968.1\|2390627_2391692_-	pyridoxal-phosphate dependent enzyme	A0A1X9I5K7	Streptococcus_phage	6.2e-67	45.8
WP_011047969.1\|2391971_2392784_-	serine O-acetyltransferase	NA	NA	NA	NA
WP_044028332.1\|2392850_2393207_+	TraR/DksA C4-type zinc finger protein	NA	NA	NA	NA
WP_011047971.1\|2393187_2393484_-	hypothetical protein	NA	NA	NA	NA
WP_011047972.1\|2393487_2397414_-	glycoside hydrolase TIM-barrel-like domain-containing protein	F4YXU5	Roseobacter_phage	8.7e-223	37.5
WP_011047973.1\|2397413_2397860_-	peptidase	F4YXU4	Roseobacter_phage	2.4e-28	46.2
WP_011047974.1\|2397856_2398744_-	DUF2163 domain-containing protein	A0A0K0PVK1	Roseobacter_phage	9.2e-56	39.9
WP_011047975.1\|2398743_2399376_-	DUF2460 domain-containing protein	A0A0B5A2K3	Paracoccus_phage	3.2e-63	53.8
WP_044028333.1\|2399391_2400054_-\|tail	phage tail tape measure protein	D6PFD6	uncultured_phage	5.1e-11	35.2
WP_011047976.1\|2400040_2400250_-\|tail	phage tail assembly chaperone	NA	NA	NA	NA
WP_011047977.1\|2400246_2400567_-	gene transfer agent family protein	NA	NA	NA	NA
WP_011047978.1\|2400569_2400983_-\|tail	phage major tail protein, TP901-1 family	A0A1J0GVL1	Pseudoalteromonas_phage	7.6e-05	31.0
WP_011047979.1\|2401007_2401421_-	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_011047980.1\|2401417_2401756_-\|head	phage head closure protein	NA	NA	NA	NA
WP_044028335.1\|2401752_2402352_-	hypothetical protein	NA	NA	NA	NA
WP_011047982.1\|2402516_2403695_-\|capsid	phage major capsid protein	A0A2D1GNH4	Pseudomonas_phage	1.5e-66	39.5
WP_011047983.1\|2403728_2404286_-\|head,protease	HK97 family phage prohead protease	A0A0U2BX10	Paracoccus_phage	1.4e-33	49.4
WP_044029238.1\|2404314_2404539_-	hypothetical protein	NA	NA	NA	NA
WP_011047985.1\|2404531_2405704_-\|portal	phage portal protein	W8ECU7	Geobacillus_phage	1.3e-60	37.6
WP_193385764.1\|2405829_2407200_-	DNA-packaging protein	A0A0K1LMR9	Caulobacter_phage	2.3e-74	42.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NC_006569

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_003911

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NC_006569

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection