CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NC_009614	Bacteroides vulgatus ATCC 8482, complete sequence	1 crisprs	PrimPol,RT,DEDDh,PD-DExK,DinG,cas3,csa3	0	0	4	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_009614_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_009614_1

1421911-1422018

Orphan

Consensus_repeat	Method
TTATACCCTCATGCCCTCACTACAT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_009614_1

>merge|NC_009614|1|1421911-1422018|CRISPRCasFinder
TTATACCCTCATGCCCTCACTACATATATAACAAGTTAATTATAAGATATTTATGTAGTGATGATAAAAAAAATTGCTCTCACTTATACCCTCATGCCCTCACTACAT

>NC_009614|1|1|1421911-1422018|CRISPRCasFinder
TTATACCCTCATGCCCTCACTACAT	ATATAACAAGTTAATTATAAGATATTTATGTAGTGATGATAAAAAAAATTGCTCTCAC
TTATACCCTCATGCCCTCACTACAT

Protein	Signature genes	Signature genes Name	Protein_function
NC_009614.1\|WP_008666580.1\|1427127_1428117_+\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|366154
NC_009614.1\|WP_011965027.1\|1425565_1426882_-\|glycosyltransferase	unknown	unknown	gnl\|CDD\|274425
NC_009614.1\|WP_005850120.1\|1412896_1413928_+\|glycosyltransferase-family-9-protein	unknown	unknown	gnl\|CDD\|340821
NC_009614.1\|WP_080510726.1\|1422341_1422464_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377541
NC_009614.1\|WP_005844241.1\|1418670_1419582_+\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|372681
NC_009614.1\|WP_005844224.1\|1423669_1425508_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224055
NC_009614.1\|WP_008666589.1\|1414854_1415961_+\|UDP-galactopyranose-mutase	unknown	unknown	gnl\|CDD\|223636
NC_009614.1\|WP_008666588.1\|1416044_1416761_+\|hypothetical-protein	unknown	unknown	unknown
NC_009614.1\|WP_005850093.1\|1431337_1431712_-\|GtrA-family-protein	unknown	unknown	gnl\|CDD\|377229
NC_009614.1\|WP_011965029.1\|1431798_1433523_+\|glycosyltransferase-family-39-protein	unknown	unknown	gnl\|CDD\|224720
NC_009614.1\|WP_005844238.1\|1419581_1420475_+\|glycosyl-transferase	unknown	unknown	gnl\|CDD\|367100
NC_009614.1\|WP_005844227.1\|1422735_1423668_-\|glycosyltransferase	unknown	unknown	gnl\|CDD\|133039
NC_009614.1\|WP_005850095.1\|1428295_1430323_+\|LTA-synthase-family-protein	unknown	unknown	gnl\|CDD\|293739
NC_009614.1\|WP_005844246.1\|1416776_1417529_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|234975
NC_009614.1\|WP_011965030.1\|1433606_1435433_-\|alkaline-phosphatase-family-protein	unknown	unknown	gnl\|CDD\|293739
NC_009614.1\|WP_005844253.1\|1413928_1414852_+\|lysophospholipid-acyltransferase-family-protein	unknown	unknown	gnl\|CDD\|153246
NC_009614.1\|WP_005844256.1\|1411766_1412792_-\|4-phosphoerythronate-dehydrogenase-PdxB	unknown	unknown	gnl\|CDD\|166874
NC_009614.1\|WP_008666582.1\|1420471_1421650_+\|glycosyltransferase	unknown	unknown	gnl\|CDD\|340847
NC_009614.1\|WP_008672428.1\|1430353_1431301_-\|glycosyltransferase	unknown	unknown	gnl\|CDD\|133030
NC_009614.1\|WP_005844244.1\|1417543_1418443_+\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|133028

Protein	Function_ID	Function_description	E-value
NC_009614.1\|WP_008666580.1\|1427127_1428117_+\|glycosyltransferase-family-2-protein	gnl\|CDD\|366154	pfam00535, Glycos_transf_2, Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.	2.68752e-24
NC_009614.1\|WP_011965027.1\|1425565_1426882_-\|glycosyltransferase	gnl\|CDD\|274425	TIGR03087, stp1, sugar transferase, PEP-CTERM/EpsH1 system associated. Members of this family include a match to the pfam00534 Glycosyl transferases group 1 domain. Nearly all are found in species that encode the PEP-CTERM/exosortase system predicted to act in protein sorting in a number of Gram-negative bacteria. In particular, these transferases are found proximal to a particular variant of exosortase, EpsH1, which appears to travel with a conserved group of genes summarized by Genome Property GenProp0652. The nature of the sugar transferase reaction catalyzed by members of this clade is unknown and may conceivably be variable with respect to substrate by species, but we hypothesize a conserved substrate.	6.4352e-22
NC_009614.1\|WP_005850120.1\|1412896_1413928_+\|glycosyltransferase-family-9-protein	gnl\|CDD\|340821	cd03789, GT9_LPS_heptosyltransferase, lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.	3.4134e-45
NC_009614.1\|WP_080510726.1\|1422341_1422464_-\|hypothetical-protein	gnl\|CDD\|377541	pfam05658, YadA_head, Head domain of trimeric autotransporter adhesin. This seven residue repeat makes up the majority sequence of a family of bacterial haemagglutinins and invasins. The representative alignment contains four repeats.	0.00491387
NC_009614.1\|WP_005844241.1\|1418670_1419582_+\|glycosyltransferase-family-2-protein	gnl\|CDD\|372681	pfam13704, Glyco_tranf_2_4, Glycosyl transferase family 2. Members of this family of prokaryotic proteins include putative glucosyltransferases,.	1.10082e-12
NC_009614.1\|WP_005844224.1\|1423669_1425508_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	2.05596e-155
NC_009614.1\|WP_008666589.1\|1414854_1415961_+\|UDP-galactopyranose-mutase	gnl\|CDD\|223636	COG0562, Glf, UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane].	2.11368e-168
NC_009614.1\|WP_005850093.1\|1431337_1431712_-\|GtrA-family-protein	gnl\|CDD\|377229	pfam04138, GtrA, GtrA-like protein. Members of this family are predicted to be integral membrane proteins with three or four transmembrane spans. They are involved in the synthesis of cell surface polysaccharides. The GtrA family are a subset of this family. GtrA is predicted to be an integral membrane protein with 4 transmembrane spans. It is involved is in O antigen modification by Shigella flexneri bacteriophage X (SfX), but does not determine the specificity of glucosylation. Its function remains unknown, but it may play a role in translocation of undecaprenyl phosphate linked glucose (UndP-Glc) across the cytoplasmic membrane. Another member of this family is a DTDP-glucose-4-keto-6-deoxy-D-glucose reductase, which catalyzes the conversion of dTDP-4-keto-6-deoxy-D-glucose to dTDP-D-fucose, which is involved in the biosynthesis of the serotype-specific polysaccharide antigen of Actinobacillus actinomycetemcomitans Y4 (serotype b). This family also includes the teichoic acid glycosylation protein, GtcA, which is a serotype-specific protein in some Listeria innocua and monocytogenes strains. Its exact function is not known, but it is essential for decoration of cell wall teichoic acids with glucose and galactose.	9.55407e-13
NC_009614.1\|WP_011965029.1\|1431798_1433523_+\|glycosyltransferase-family-39-protein	gnl\|CDD\|224720	COG1807, ArnT, 4-amino-4-deoxy-L-arabinose transferase and related glycosyltransferases of PMT family [Cell envelope biogenesis, outer membrane].	1.37763e-35
NC_009614.1\|WP_005844238.1\|1419581_1420475_+\|glycosyl-transferase	gnl\|CDD\|367100	pfam02485, Branch, Core-2/I-Branching enzyme. This is a family of two different beta-1,6-N-acetylglucosaminyltransferase enzymes, I-branching enzyme and core-2 branching enzyme. I-branching enzyme is responsible for the production of the blood group I-antigen during embryonic development. Core-2 branching enzyme forms crucial side-chain branches in O-glycans. This is a fmmily of glycosyl-transferases that are Type II membrane proteins that are found in the endoplasmic reticulum (ER) and Golgi apparatus.	9.14326e-20
NC_009614.1\|WP_005844227.1\|1422735_1423668_-\|glycosyltransferase	gnl\|CDD\|133039	cd04196, GT_2_like_d, Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.	7.03785e-10
NC_009614.1\|WP_005850095.1\|1428295_1430323_+\|LTA-synthase-family-protein	gnl\|CDD\|293739	cd16015, LTA_synthase, Lipoteichoic acid synthase like. Lipoteichoic acid (LTA) is an important cell wall polymer found in Gram-positive bacteria. It may contain long chains of ribitol or glycerol phosphate. LTA synthase catalyzes the reaction to extend the polymer by the repeated addition of glycerolphosphate (GroP) subunits to the end of the growing chain.	1.72019e-66
NC_009614.1\|WP_005844246.1\|1416776_1417529_+\|hypothetical-protein	gnl\|CDD\|234975	PRK01723, PRK01723, 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed.	3.42089e-05
NC_009614.1\|WP_011965030.1\|1433606_1435433_-\|alkaline-phosphatase-family-protein	gnl\|CDD\|293739	cd16015, LTA_synthase, Lipoteichoic acid synthase like. Lipoteichoic acid (LTA) is an important cell wall polymer found in Gram-positive bacteria. It may contain long chains of ribitol or glycerol phosphate. LTA synthase catalyzes the reaction to extend the polymer by the repeated addition of glycerolphosphate (GroP) subunits to the end of the growing chain.	1.19969e-65
NC_009614.1\|WP_005844253.1\|1413928_1414852_+\|lysophospholipid-acyltransferase-family-protein	gnl\|CDD\|153246	cd07984, LPLAT_LABLAT-like, Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: LABLAT-like. Lysophospholipid acyltransferase (LPLAT) superfamily member: acyltransferases of de novo and remodeling pathways of glycerophospholipid biosynthesis which catalyze the incorporation of an acyl group from either acylCoAs or acyl-acyl carrier proteins (acylACPs) into acceptors such as glycerol 3-phosphate, dihydroxyacetone phosphate or lyso-phosphatidic acid. Included in this subgroup are such LPLATs as lipid A biosynthesis lauroyl/myristoyl (LABLAT, HtrB) acyltransferases and similar proteins.	6.34601e-44
NC_009614.1\|WP_005844256.1\|1411766_1412792_-\|4-phosphoerythronate-dehydrogenase-PdxB	gnl\|CDD\|166874	PRK00257, PRK00257, 4-phosphoerythronate dehydrogenase PdxB.	0
NC_009614.1\|WP_008666582.1\|1420471_1421650_+\|glycosyltransferase	gnl\|CDD\|340847	cd03820, GT4_AmsD-like, amylovoran biosynthesis glycosyltransferase AmsD and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. AmSD in Erwinia amylovora has been shown to be involved in the biosynthesis of amylovoran, the acidic exopolysaccharide acting as a virulence factor. This enzyme may be responsible for the formation of galactose alpha-1,6 linkages in amylovoran.	2.70006e-59
NC_009614.1\|WP_008672428.1\|1430353_1431301_-\|glycosyltransferase	gnl\|CDD\|133030	cd04187, DPM1_like_bac, Bacterial DPM1_like enzymes are related to eukaryotic DPM1. A family of bacterial enzymes related to eukaryotic DPM1; Although the mechanism of eukaryotic enzyme is well studied, the mechanism of the bacterial enzymes is not well understood. The eukaryotic DPM1 is the catalytic subunit of eukaryotic Dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. The enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. This protein family belongs to Glycosyltransferase 2 superfamily.	2.88387e-84
NC_009614.1\|WP_005844244.1\|1417543_1418443_+\|glycosyltransferase-family-2-protein	gnl\|CDD\|133028	cd04185, GT_2_like_b, Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.	1.0812e-71

>NC_009614.1|WP_008666582.1|1420471_1421650_+|glycosyltransferase
MNILFYTTNEVAPQYGGVERVTANIANALTTFYNVNCYSAYKYNIDKSFIKQQFVNTIKINSYHNLNNLIQFIEQNKIDVIINQGEHKLTKSLRLALNQSQNKKCKLMFALHVSPATEINFITLDNPKKELKEGKNIRKNISKFLSFPYQKIRKIIKLPILYRESYHFADKVILLSSHFKKPFLEYSHLKDDSKIRIIHNALSFHSFYDLANYNHKKKEVLIVSRLEEEPKRISLALKIWKEIETDHTLSEWKLKIVGHGKMESWYKSLVIHYGLQRVFFEGTKNPEPYYNEASIFMMTSSFEGWGLTLTEAQQYGCVPLAFHSFASLTDIITDKVNGFAIPNDDISLYIKQMKLLMTDEKLRKSMSANAIESSKQFSIEIIIKKWMEVINE
>NC_009614.1|WP_005844238.1|1419581_1420475_+|glycosyl-transferase
MKHAFLIIAHNEYPVLEVLLSMLDDERNDIYLHIDKRATELFQQIKKVKMQKAGFYLIENPIKVYWGDISQVQVEYLLFETALSHGPYAYYHLLSGTDLPIKSQDYIHAFFQQNAGKEFVGFWQDAAHQRDLERKVFRYYFFTKRLKDKEHLLHGITALIRNLILAVQKISHYRRKQTFEFKKGGNWISITENAVKYLLQYKEIVLNRMKYTLCADEIFIQTILWNSPFRERMHCTNNANTGSMREIDWEHGSPYIWQDHDYQTLINSNKIFARKFNSNQMGVVYKIQKLYLKQVPK
>NC_009614.1|WP_005844241.1|1418670_1419582_+|glycosyltransferase-family-2-protein
MSNLLLSKIGHVISEFPLAFKQTKEVKLFMTLLVKNEEGMLEENLQFHKAMGVDGFIITDNNSTDSTPDIIRKYKQKGWIKEVIEEKATNYEQKDWVDRMIWKAKTIYKADWIINADADELWYAPTGNLKDELYATNANVLNCEMRSVYPEEEKPFWQWDKTVKAVTEPEKYDLSLYSLFERQNKKVIHRTAGYLQISMGNHKVTMFPQNSADSHIHVYHYNIRGKQQFMEKMINGGKQLEQHKGRHGGRHWRYFYQLHKEGKLEAEYERVIGSAYFEALRKDGFIIPDVTIPNFFKRLKPDI
>NC_009614.1|WP_005844244.1|1417543_1418443_+|glycosyltransferase-family-2-protein
MNIIAVVVTYNRMELLKRNIRCLQQNKPISSIVIVNNGSTDGTTEWLAAQEGLTVINQTNVGGAGGFYTGIQYAYQAGADWIWCMDDDVFPRADCLEQLLPYTGKKDIGILAPRRLLEGEIFTHDFQAYNLSNPFVSMYSKKLAGRHITSPTEIMGTAFEGPFIRREVVEKIGLPNKDLFIFCDDTDYCLRTIRAGYKILYIPDALMDKEKFFSNDTWNERSKKKKWKRFYQIRNSTYLNHHYGRNIAVKYLRGFNGVMGYIFIALFTSPFAKAYQWKDIPRLWKAYCDGIHEKLGIMS
>NC_009614.1|WP_005844246.1|1416776_1417529_+|hypothetical-protein
MSKTERLFHPRTLVIHPDFKNLEEFIVSIPERFQRNEGTVIHQGRNELRKMEYNGKEYVIKSFHSPHLINRFVYGIFRPSKAKRSYDHAEMLLKIGVGTPQPVGYMNIRSGLLFDKSYYISLLSTCPYIYDNLFTQQFDYAEEVFRAIGKVTARLHEHGYAHKDYGRANILFQKTPNGITIEIVDLNRMYIGPIDMKTGCKNFERLPATPQMHRWMAEEYAKARNFDVEKCFELMRAYRSVQPGKIDNLY
>NC_009614.1|WP_008666588.1|1416044_1416761_+|hypothetical-protein
MKCLHIITPVKDSIDSTLETVKAIMESDILVPFTYTVYNDFSTEENTHRLEEAARQWNFRLVNLSDLTDHPSPNYLLVLQTAQKEAIEADAGLLIVESDVIVKKNTLQSLYNGALQQKQCGIAAAVTTDEKGVINYPYLHAKGHENQVYPEKKHCSFCCSLLTPGLLKAFDFQTLDPSKNWYDVTISHESLKRGFQNYLFTTLPVWHRPHSSRPWKQLKYKNPLKYYWLKYTKGLDKI
>NC_009614.1|WP_008666589.1|1414854_1415961_+|UDP-galactopyranose-mutase
MEKYDYLIVGAGLFGAVFAHEAKRVGKHCLVIDKRNHRGGNIYCEDIEGIHVHKYGAHIFHTDNKEVWDYVNSFVEFNRYTNSPLAYFDGKLYNLPFNMNTFYQLWGVKTPAEAKAKIEEQRKEFDHIATPANLEEQALKLCGKDIYHRLIKGYTEKQWGRSAKELPAFIIKRIPFRFIYDNNYFNDSYQGIPKGGYNALIDALLEGTEVRLNTNYFNNRNELDALANNILFTGCIDQFFDYQCGHLEYRSLRFEHKQLETEDFQGNAVVNYTEREVPYTRIIEHKHFEFGTQPTTVITYEYPDDFAPGKEPYYPINDKRNTEMMSQYKKLASERKDVLFGGRLAQYAYADMDDTVAAALALCKKTFK
>NC_009614.1|WP_005844253.1|1413928_1414852_+|lysophospholipid-acyltransferase-family-protein
MKQINLIYYSVFFLWYLLSLLPLRFLYFISDLLFYPLYYCIRYRRKIIRNNLSNSFPEKDLKEIVQIEKQFYSFFCDYIVETLKLFSISKKQLMRRMTFEGLDEIVESMNKKNKDFCFIYLGHYCNWEWIASLPYWISKDISCGQIYHPLYNQAFDKLFLRLRNQFGGECIPMKTTLRRIIELKRTKQKAIIGFISDQAPKWNSIHHWTEFLNQETPVFIGTEKIGKQVDALIYYADVTRVKRGYYHCRLKPLCDTPRQVPDFELTDLFTRELEQTIKAHPQYWLWSHNRWKRTKEEWLRRQQEETK
>NC_009614.1|WP_005850120.1|1412896_1413928_+|glycosyltransferase-family-9-protein
MSKILVICFSSINNVAMAIPVIHSLATQYAQHQIMVLSIDTFSPLFENVPDNVIFRGADFRGEHAGLMGLGWLYNDLKEEKFDAVAAFQPTFRSRFLCWRFRLAGIKAAHIKQNRRELQKLIRRKHKIYTEQDSFFQRCAHTLSQIGYPIRLSFLSLFGKNKGNISSLAPLTGEKNQETWIGIAPFATHVGKIYPLSKQEQILKHLSARDHTKIFLFGGGKKEIKVLEEWAQHFPNVISTAGKLTINMELALMSNMDVMLVMDAANMHLASLVNIPVVSIWGATHPCAGFAGWNQSAANTIQIDLPCRPCSLSGEKHCYRKDYACLQGITPEMVIEHINKVIS
>NC_009614.1|WP_005844256.1|1411766_1412792_-|4-phosphoerythronate-dehydrogenase-PdxB
MKIIVDNKIPYIHEAVEQIADEVVYLPGSGFTAGDVRDADALVIRTRTRCNRELLEGSKVKFIATATIGFDHIDVDYCDEAGIVWKNCPGCNAGSVEQYLHSVLLLLKRRKGVRLEESCLGIVGVGHVGSRIQRMAEALGMRVLLNDPPRADRGETEFVDLSVLARECDIITFHTPLNRNGKYKTFHLADADFFAGLQRKPFIVNTSRGEVIETLALLDALKTGRIRDAVIDTWENEPDIHPDLLQKVFLGTPHIAGYSADGKSNATRMALEELCNFFHIQADFKIVPPALPYMDYSSDPEEAFLQVYDPTRDSDALKRHPEEFEHLRGNYPLRREISFLP
>NC_009614.1|WP_080510726.1|1422341_1422464_-|hypothetical-protein
MFVLSPQAFGVNSIVLGDNSKAYGDNSKGYGDRIDAYKKV
>NC_009614.1|WP_005844227.1|1422735_1423668_-|glycosyltransferase
MEQIKKLAIVIPAYKGRFLKETLDSIAVQAHKDEFVLYIGDDASPERLDKIVESYQNKVNLVYHRFSENMGGKDLVAHWERCIQLSAEPFIWLFSDDDLMPADGVERVMEVLSRPHHQRGYFFRFPLAVIDGENKRIRANRPLEEGSVSCYRLLLDKLQGKIDSAAVEYVFSREIWQSAGGFVHFPMAWCSDDATWAAFARHAGGVISLPGQPVCWRNVEGANISNSAGHDKDKLHATILFLRWMRNMFSDYVDDPELISALQCYIHTILRISLHKHYNICGLWGVSMALGRFNKRAAFTTFFRNFRLFS
>NC_009614.1|WP_005844224.1|1423669_1425508_-|ABC-transporter-ATP-binding-protein
MLKQFFSLLKRYILPYRKYLTWALILNFLSQWLNVFSFMAIVPILNILFKIDTKSYEYIPMDIHNLDKDVLINNAYYFVSNFVATNGAFYTLAMMGGILIFMTMLKTAGYFASAAVMVPLRTGIVRDIRIQVYNKVLSLPLSFFSEERKGDIIARMSADVTVVENSLTSSIDMLIRNPIALLVCFVTLFSVSWQMTLFVIFILPLTGWIMGVVSRKLKRQSSTAQAQWGDIMSQLDETLGGLRVIKAFIAESKMSARFSKTNNDFRDAMNEMIIRQSSAHPMSEFLGTCVIVTVLLFGGALILNTNYAPMDAATFIFYLIILYSIINPLKEFSRAFYNIPQGLASMERIDMILKAENHIVEPEQPLPLDAFTDKLEFKNVSFSYVEGRPVLNHINLTVPKGKTIALVGQSGSGKSTLVDLVPRYHDVSEGALLIDGKNVKDVSIHSLRSLIGNVNQEAILFNDTFYNNITFGVENATMEQVIEAAKIANAHDFIMETEKGYDTMIGDRGGRLSGGQRQRVSIARAILKNPPILILDEATSALDTESERLVQEALERLMKSRTTIAIAHRLSTIKNADEICVLYEGDIVERGTHDELIALNGYYKKLNDMQSL
>NC_009614.1|WP_011965027.1|1425565_1426882_-|glycosyltransferase
MRKKILFIIPYIPYPLDSGGNQAFFNMVEYLRHKMAVSVLLYPETGRRMQDVESLKKIWDNVDFFIYTPKTKTVRLPKIKHPFYYKWLQKIHASVTRKMNRQQIWTDETGEVVDLVRGKSTLFSSCFQPLDQGYVEYVSQVAHSGFDIIQVEFYELLSLGFLLPENVQTIFVHHELRYIRNEKEITLFREQTAGDRMLFHIAKDFERSALLKYKDVIVLTEVDRKIMEDFIGRKDHIYTSPAVVQVGDRLEQPFVPVQSGRLTFVGSEDHFPNLDAVAWFCHEVIPHLRKRHFSFTLQVIGKWRGECINRLQSEYPELKLAGYMEDLGSFLKGSVAVVPIRIGSGMRMKILDAVLSKVPFVTTAKGVEGIDFKDGEDCLIVDDPAGFAEAVIALSSNPQLQRQLVTHAEDSLRQVYNPGQMQERRLAVYEQILGDKVG
>NC_009614.1|WP_008666580.1|1427127_1428117_+|glycosyltransferase-family-2-protein
MNALPLVSVVVPNYNYKRYLNLRIQSILQQTYQNIELILLDDASTDGSEEVLSDYQDHAKVSHILLNEHNTGNPFKQWFKGMQLAKGKYIWIAEADDLCELTFLEKVVPLMEKYQQAAVCFAGSKYIDKDGNVLSYDMNKWKSAIPPYAVFNGKTYAEHNLYWRSYIANASSAIFRKSMVNAQNMEQCLQMRYSGDWLFWFYMAMQGDIIERYEVLNYFRQHNQKVTVKAENNGGGKSEDIEIVRIMEQHLTHLSRYKRCIRRGMLYNRIAKLSTTDRVKLQLWELLRQKLNGTRKDGRLERLNRIARLFCPFVLTMKRDRLTPSREIG
>NC_009614.1|WP_005850095.1|1428295_1430323_+|LTA-synthase-family-protein
MKYLRSLMQQSVTACKNQAKLIQQFTLSLLYLLIIHIVALLFFFLFRLVLFTSIDYQFPPDIQNNFLMQATAFIKGLWFDNVIACYILLLPLVILWITALCNYHSKWVFRFISIFFILFYSLSFIISAANIPYFSYFFKTINSSIYNWFGYGATTAGMVLGETSFYFPIFLGLISILLLSGSVLRLSSYFYHLINSKSTSISPINRLCIFAAGAVCIGLCLFGIRGRMGYNPIRVSQAYYCTDPFLNQLGVNPVFNLLTSTLDDNRKENRYLHLMPEQEAITNMQSILQRKGIEGISPIAREVKCAAVPTQKNVVLIFMESMSANLMEHFGSTKKLTPFLDSLYLESLSFDHFYSAGIHTNHGMYATLYSFPAIMKRNAMKGAVVPVYSGLPTVLKDNGYRNLFFMTHESQYDNMNAFLRTNGFDEIYAQENYPKDKVVNSFGVQDDFLYQYALPILNKRAEERQPFFTVLLSISNHPSYVIPDYFKPHSTKLEDQIVEYADWAIRQFMQEARKQPWFENTIFVLLGDHGKLVGSPDCEIPQSYNHVPLMIYGKGIKPEIRQEPGGQTDVAPTLLGLLNMSYTQNDFGINLLTEQRPYVYFSADNLIAATDTTHLYIYSPHDRQEFKYKKQGNALQLVTGEDSTFYVMKKYCFSTLQSAEYLVKEHKTVNKATGQ
>NC_009614.1|WP_008672428.1|1430353_1431301_-|glycosyltransferase
MKKVTLLIPVYNEEAMLPTLYQRLIELVNRNAVYEWEILFVNDGSSDTTLECLRRLRQQDKRVNYVNLSRNFGKEVAMLAGFDYATGDCCVVMDADLQDPPELVDQMLEYWEEGYDDIYAKRRTRGEESWLRRQFSLAFYGILQRMSRIDILPNVGDFRLLDRRCVLTLRRLRECERYTKGLFCWIGYQKKSIEFDRGDRLMGHSSWNFLKLLNLAVEGITSFSIAPLRIATVCGVLCSISSFIYAIYFLIKTVLYGDETAGFPTLIIVMLFLGGIQLFSLGIIGEYVGRIFKETKGRPTYIASDYNEEKLGYDR
>NC_009614.1|WP_005850093.1|1431337_1431712_-|GtrA-family-protein
MNKLKQIPEFLRFVMVGLFATGLHYGIYFVLQKFIQVNVAYTLGYVLSFVANFYLTAYFTFGQPPSWKKAFGFGGAHLTNYLIHIGLLNLFLRLGFSRPLAPIPVFLIAIPVNFLLVRFVFKQK
>NC_009614.1|WP_011965029.1|1431798_1433523_+|glycosyltransferase-family-39-protein
MSDKKKAFWFIALLSTLVIIPFLGETIFYSKGEPREAIVAYSMLESGNWILPLNYGTDIAYKPPFLYWSIAAISAIFGGVSEFSSRLPSAIAFLAMQFVFFGFVARYKDTKTALITSLLLLTSFEVHRAAVACRLDMLQVSFIVISLCLLFRWDEKGCKGIPWTAVVLMACGTLTKGPVGSIFPCMCIGIYQLIRGRSFGKTFLSLFGIGLLSLIPLGIWFYAAWLQGGQPFMDLMLEENTGRFVGKMSYPSHHNPLWYNFLTIIWGWTPWTLVLLISLFGLKWNEMHLLPAGNSFTGRIRKVWDNIRSQSPIQLFIWIVIIAIFVFYCIPKSKRSVYLLPIYPFMAVLIAQYLEALMQKGAKVFKISAYIFASLCLLLTVVFFAVRCQMIPDSIWGNGRHAAENIAFMQALESTSFSISKWLIIVLPVVAAICTLRLVIKKSSTGSLLYGITGCVLCLFVALDGVYQPTILAVKSDKHLAEDIRKQVPEGVVYSYTDRMIRFYCTNYYMNNQMRNFTLENPQEGYVILSANAQEEFLKNYNAKYQLEEVFHTDYRSCDLRNTVIMYKFNEKRK
>NC_009614.1|WP_011965030.1|1433606_1435433_-|alkaline-phosphatase-family-protein
MKKRIAYISLYFFTVLLIFILQKPLFMLYNGSIEKGFGFADYMQVMVHGASLDAATAGYLTAFPFLLVLISIWFRKFPLKKILYGYYILAAALISIIFVVDMALYTFWGFKLDASVFLYIDSPKEALASVSVGFILLRVLAILLLIALNSWVLLKITPSVLTATRKRIAGTAGMLLLGGVLFIIIRGGVTESTSNIGQVYFSNEPFLNHSAVNPDFSLLSSMGKSQDFASEFNFFDEEKRAALFDGLYPTTDGDSIIQVLNTKRPNILIILMEGFGGAFVEPLGGLPDVTPHFNRLSKEGIFFTNCYANSFRTDRGTVCTFSGYLGLPTASVMKIPAKSRTLPAIAEGLSKAGYKTDFLYGGDINFTNMKSYLLSTGYQRLTANTDFSLAEQTSNAWGVNDDITFEYLYNQLRNRKEEGPWHTAFLTLSSHEPFEVPYHRLEDKIPNAFAYTDECLGKFVDRLKQTPAWKDLLVICLPDHGFYYPREGSNAMPRFYHIPLLWLGGAVKQPMQVDKIMNQTDLAATLLGQLGLEHTAFTFSRNVLGSDYKYPFAFYSFNNGFSFRDSTGVTVFDNNSGSILFDEPEADESRLDKGKAILQTVYDDLGNR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1933890 : 2002016

Staphylococcus_phage(28.57%)

transposase,tRNA

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011965154.1\|1933890_1935546_-\|transposase	IS1182 family transposase	A0A146ICT8	Staphylococcus_phage	1.1e-70	38.3
WP_016270147.1\|1935904_1936810_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_011965194.1\|1937490_1939128_-	B12-binding domain-containing radical SAM protein	NA	NA	NA	NA
WP_005845436.1\|1939143_1939665_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_008668335.1\|1939682_1940114_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_005849540.1\|1940218_1940704_+	N-acetyltransferase	NA	NA	NA	NA
WP_011965195.1\|1940777_1941134_+	DUF488 family protein	NA	NA	NA	NA
WP_005849536.1\|1941310_1942822_+	acetyl-CoA carboxylase biotin carboxylase subunit	NA	NA	NA	NA
WP_011965196.1\|1942846_1943362_+	acetyl-CoA carboxylase biotin carboxyl carrier protein subunit	NA	NA	NA	NA
WP_005845448.1\|1943364_1944897_+	acyl-CoA carboxylase subunit beta	NA	NA	NA	NA
WP_008668332.1\|1945027_1946338_-	tripeptidyl aminopeptidase	NA	NA	NA	NA
WP_011965197.1\|1946442_1947066_+	hypothetical protein	NA	NA	NA	NA
WP_005845453.1\|1947074_1947638_+	cob(I)yrinic acid a,c-diamide adenosyltransferase	NA	NA	NA	NA
WP_002558131.1\|1947709_1947931_+	DUF2795 domain-containing protein	NA	NA	NA	NA
WP_011965198.1\|1948094_1948694_+	porin family protein	NA	NA	NA	NA
WP_005845458.1\|1948766_1951229_+	primosomal protein N'	NA	NA	NA	NA
WP_005845460.1\|1951276_1951987_+	phosphatase	NA	NA	NA	NA
WP_005845462.1\|1951994_1952465_+	low molecular weight phosphotyrosine protein phosphatase	NA	NA	NA	NA
WP_005845464.1\|1952439_1954497_-	HDIG domain-containing protein	NA	NA	NA	NA
WP_005845466.1\|1954578_1956096_+\|tRNA	glutamate--tRNA ligase	NA	NA	NA	NA
WP_011965199.1\|1956108_1957329_+	3-deoxy-D-manno-octulosonic acid transferase	NA	NA	NA	NA
WP_110506603.1\|1957865_1957988_+	hypothetical protein	NA	NA	NA	NA
WP_005845470.1\|1958530_1959019_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_011965200.1\|1959096_1961955_+	hypothetical protein	NA	NA	NA	NA
WP_005845475.1\|1962093_1962750_+	hypothetical protein	NA	NA	NA	NA
WP_016271508.1\|1962700_1963591_+	NUDIX domain-containing protein	NA	NA	NA	NA
WP_011965202.1\|1963598_1964441_+	polysaccharide biosynthesis protein	A0A2K9L4W2	Tupanvirus	7.0e-13	25.9
WP_011965203.1\|1964547_1964925_+	hypothetical protein	NA	NA	NA	NA
WP_011965204.1\|1964930_1965995_-	M20 family metallo-hydrolase	NA	NA	NA	NA
WP_005849510.1\|1966208_1968014_+	long-chain fatty acid--CoA ligase	NA	NA	NA	NA
WP_005845487.1\|1968071_1969187_+	peptide chain release factor 2	NA	NA	NA	NA
WP_005845492.1\|1969481_1969952_+	CYTH domain-containing protein	NA	NA	NA	NA
WP_011965205.1\|1970041_1972516_+	TonB-dependent receptor	NA	NA	NA	NA
WP_011965206.1\|1972684_1973188_+	RNA polymerase sigma factor	A0A0F6TH34	Sinorhizobium_phage	1.4e-13	34.6
WP_005845500.1\|1973268_1973655_-	VanZ family protein	NA	NA	NA	NA
WP_008668319.1\|1973750_1975115_+	sodium-dependent transporter	NA	NA	NA	NA
WP_005849503.1\|1975122_1976025_+	helix-hairpin-helix domain-containing protein	NA	NA	NA	NA
WP_008667781.1\|1976169_1977528_+\|transposase	transposase	NA	NA	NA	NA
WP_005845506.1\|1977711_1979130_-	alkaline phosphatase	NA	NA	NA	NA
WP_005845508.1\|1979433_1979934_+	hypothetical protein	NA	NA	NA	NA
WP_011965207.1\|1980541_1982197_+\|transposase	IS1182 family transposase	A0A146ICT8	Staphylococcus_phage	7.9e-69	39.4
WP_011965208.1\|1982490_1983687_-	hypothetical protein	NA	NA	NA	NA
WP_005845035.1\|1983699_1984047_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_011965209.1\|1984091_1985477_-	putative DNA binding domain-containing protein	A0A088F7M4	Mycobacterium_phage	1.4e-26	25.7
WP_005845038.1\|1985554_1986394_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_005845040.1\|1986504_1987101_+	sugar O-acetyltransferase	NA	NA	NA	NA
WP_005845042.1\|1987105_1987744_+	HAD hydrolase-like protein	NA	NA	NA	NA
WP_005636783.1\|1988889_1991292_-	S8 family peptidase	NA	NA	NA	NA
WP_005636785.1\|1991305_1992265_-	ATP-binding protein	U5XGM6	Phormidium_phage	2.0e-11	24.2
WP_005636787.1\|1992588_1993452_+	toprim domain-containing protein	NA	NA	NA	NA
WP_032558345.1\|1993548_1994328_-	DUF4121 family protein	NA	NA	NA	NA
WP_005636793.1\|1994744_1996043_+	ATP-binding protein	NA	NA	NA	NA
WP_171030713.1\|1996054_1998910_+	DEAD/DEAH box helicase family protein	E5ES65	Bathycoccus_sp._RCC1105_virus	9.6e-30	27.8
WP_011965213.1\|1999129_2000209_-	hypothetical protein	NA	NA	NA	NA
WP_005636798.1\|2000225_2000552_-	hypothetical protein	NA	NA	NA	NA
WP_005645980.1\|2000650_2001001_+\|transposase	transposase family protein	NA	NA	NA	NA
WP_011964719.1\|2001011_2002016_+\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_2

3580012 : 3614433

Bacteroides_phage(25.0%)

capsid,terminase,portal,integrase,tail

attL 3580386:3580401|attR 3599354:3599369

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011965738.1\|3580012_3581194_+\|integrase	site-specific integrase	NA	NA	NA	NA
3580386:3580401	attL	NA	NA	NA	NA
WP_172773460.1\|3581303_3581465_+	hypothetical protein	NA	NA	NA	NA
WP_011965739.1\|3581505_3581928_+	DUF5053 domain-containing protein	NA	NA	NA	NA
WP_041174460.1\|3582203_3582428_+	hypothetical protein	NA	NA	NA	NA
WP_011965740.1\|3582705_3585210_+	hypothetical protein	NA	NA	NA	NA
WP_011965741.1\|3585381_3585627_-	hypothetical protein	NA	NA	NA	NA
WP_011965742.1\|3585722_3586256_-	hypothetical protein	NA	NA	NA	NA
WP_011965743.1\|3586259_3586658_-	peptidase M15	H2A0C2	Bacteroides_phage	1.1e-35	59.1
WP_005846666.1\|3586654_3587041_-	hypothetical protein	NA	NA	NA	NA
WP_011965744.1\|3587322_3588546_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_011965745.1\|3588656_3588896_+	hypothetical protein	NA	NA	NA	NA
WP_041174461.1\|3588932_3589328_+	hypothetical protein	NA	NA	NA	NA
WP_041174549.1\|3589713_3589956_-	hypothetical protein	NA	NA	NA	NA
WP_011965748.1\|3590019_3590592_-	hypothetical protein	NA	NA	NA	NA
WP_005853467.1\|3590604_3591102_-	hypothetical protein	NA	NA	NA	NA
WP_005853470.1\|3591103_3591376_-	hypothetical protein	NA	NA	NA	NA
WP_011965750.1\|3595469_3596297_-	hypothetical protein	NA	NA	NA	NA
WP_011965751.1\|3596300_3598979_-	hypothetical protein	NA	NA	NA	NA
WP_011965752.1\|3599139_3599472_-	DUF2693 domain-containing protein	NA	NA	NA	NA
3599354:3599369	attR	NA	NA	NA	NA
WP_011965753.1\|3599577_3600063_-	RNA polymerase sigma factor	NA	NA	NA	NA
WP_011965754.1\|3600059_3600329_-	hypothetical protein	NA	NA	NA	NA
WP_011965755.1\|3600429_3600999_-	hypothetical protein	NA	NA	NA	NA
WP_011965756.1\|3600995_3604859_-\|tail	phage tail tape measure protein	H7BUR2	unidentified_phage	4.7e-88	53.6
WP_041174462.1\|3604861_3605050_-	hypothetical protein	NA	NA	NA	NA
WP_011965757.1\|3605057_3605579_-	hypothetical protein	NA	NA	NA	NA
WP_169757510.1\|3605620_3605797_-	hypothetical protein	NA	NA	NA	NA
WP_011965758.1\|3605793_3606627_-	hypothetical protein	NA	NA	NA	NA
WP_011965759.1\|3606626_3607193_-	hypothetical protein	NA	NA	NA	NA
WP_041174463.1\|3607189_3607705_-	hypothetical protein	NA	NA	NA	NA
WP_011965761.1\|3607713_3608136_-	hypothetical protein	NA	NA	NA	NA
WP_011965762.1\|3608141_3609830_-\|capsid	phage major capsid protein	NA	NA	NA	NA
WP_049764323.1\|3609855_3610905_-	hypothetical protein	S0A1Q4	Cellulophaga_phage	1.2e-25	38.5
WP_011965764.1\|3610858_3612286_-\|portal	phage portal protein	NA	NA	NA	NA
WP_011965765.1\|3612414_3614433_-\|terminase	PBSX family phage terminase large subunit	A0A0S2SXL6	Bacillus_phage	1.0e-22	29.9

DBSCAN-SWA_3

3647439 : 3735512

Cellulophaga_phage(25.0%)

integrase,transposase,protease,tRNA

attL 3653036:3653052|attR 3744802:3744818

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016270741.1\|3647439_3648360_+\|transposase	transposase	NA	NA	NA	NA
WP_005847890.1\|3650057_3652526_-	ferrous iron transport protein B	NA	NA	NA	NA
WP_022509096.1\|3652646_3653951_+\|tRNA	tRNA lysidine(34) synthetase TilS	A0A1J0F9X6	Only_Syngen_Nebraska_virus	1.7e-13	27.5
3653036:3653052	attL	NA	NA	NA	NA
WP_011965800.1\|3654089_3655790_-\|protease	serine protease	NA	NA	NA	NA
WP_005847884.1\|3655826_3656594_-	23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB	NA	NA	NA	NA
WP_005843444.1\|3656644_3658306_-	DNA repair protein RecN	NA	NA	NA	NA
WP_005847882.1\|3658437_3659634_-	bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC	Q9HH70	Methanothermobacter_phage	7.1e-35	31.7
WP_005843449.1\|3659630_3660407_-	3'-5' exonuclease	A0A1B0WLV5	Flavobacterium_phage	2.1e-43	40.3
WP_005843451.1\|3660458_3661583_-	DNA polymerase III subunit beta	A0A2I6UG80	Salinibacter_virus	5.1e-35	28.8
WP_005843453.1\|3661736_3662114_+	DUF3127 domain-containing protein	S0A1J4	Cellulophaga_phage	4.8e-14	35.1
WP_011965802.1\|3662363_3663794_-	DUF4270 domain-containing protein	NA	NA	NA	NA
WP_005843457.1\|3663813_3664638_-	glycogen/starch synthase	NA	NA	NA	NA
WP_005843459.1\|3664989_3665838_+	pantoate--beta-alanine ligase	NA	NA	NA	NA
WP_005843461.1\|3665859_3666210_+	aspartate 1-decarboxylase	NA	NA	NA	NA
WP_011965174.1\|3666456_3667815_-\|transposase	transposase	NA	NA	NA	NA
WP_005844705.1\|3668031_3670032_-	fructose-1,6-bisphosphatase	NA	NA	NA	NA
WP_005847874.1\|3670041_3671703_-	putative transporter	NA	NA	NA	NA
WP_011965803.1\|3671779_3672577_-	NAD(+) diphosphatase	NA	NA	NA	NA
WP_011965804.1\|3672599_3674729_-	RNA-binding transcriptional accessory protein	NA	NA	NA	NA
WP_041174472.1\|3674903_3675125_+	hypothetical protein	NA	NA	NA	NA
WP_011965805.1\|3675250_3676369_+	DUF1016 family protein	Q9JMP5	Wolbachia_phage	6.5e-75	40.9
WP_011965810.1\|3679646_3682271_+	glycoside hydrolase family 2	B9U1V4	Vaccinia_virus	9.4e-32	28.7
WP_011965811.1\|3682396_3686800_+	response regulator	A0A1V0SGX0	Hokovirus	2.4e-24	24.5
WP_011965812.1\|3686965_3687850_+	sugar phosphate isomerase/epimerase	NA	NA	NA	NA
WP_011965813.1\|3687879_3691335_+	TonB-dependent receptor	NA	NA	NA	NA
WP_008667374.1\|3691355_3693365_+	RagB/SusD family nutrient uptake outer membrane protein	NA	NA	NA	NA
WP_005847858.1\|3693533_3695267_+	hypothetical protein	S0A0V0	Cellulophaga_phage	9.0e-23	27.7
WP_005844681.1\|3695291_3695960_+	DUF3826 domain-containing protein	NA	NA	NA	NA
WP_011965814.1\|3696158_3697841_+	polysaccharide lyase	S0A0V0	Cellulophaga_phage	2.3e-23	28.2
WP_011965815.1\|3697842_3700929_+	hypothetical protein	NA	NA	NA	NA
WP_005844675.1\|3701115_3701670_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_032938975.1\|3701718_3702003_+	hypothetical protein	NA	NA	NA	NA
WP_005844670.1\|3702037_3705238_+	TonB-dependent receptor	NA	NA	NA	NA
WP_005844668.1\|3705262_3707233_+	RagB/SusD family nutrient uptake outer membrane protein	NA	NA	NA	NA
WP_011965817.1\|3707325_3708981_-\|transposase	IS1182 family transposase	A0A146ICT8	Staphylococcus_phage	7.9e-69	38.1
WP_005840245.1\|3709508_3712613_+	TonB-dependent receptor	NA	NA	NA	NA
WP_005840243.1\|3712627_3714493_+	RagB/SusD family nutrient uptake outer membrane protein	NA	NA	NA	NA
WP_008667781.1\|3714769_3716128_-\|transposase	transposase	NA	NA	NA	NA
WP_005840312.1\|3716361_3717372_+	methylcobamide--CoM methyltransferase	NA	NA	NA	NA
WP_005840314.1\|3717364_3718051_+	methionine synthase	NA	NA	NA	NA
WP_011965818.1\|3718342_3719914_-	sodium/solute symporter	NA	NA	NA	NA
WP_011965819.1\|3719947_3721750_-	cobalamin-binding protein	NA	NA	NA	NA
WP_011965820.1\|3721755_3724002_-	alpha-xylosidase	NA	NA	NA	NA
WP_172773455.1\|3724012_3725893_-	right-handed parallel beta-helix repeat-containing protein	NA	NA	NA	NA
WP_005840325.1\|3726113_3728123_-	transcription termination factor Rho	NA	NA	NA	NA
WP_005840327.1\|3728550_3728928_+	RidA family protein	NA	NA	NA	NA
WP_005840329.1\|3729090_3730281_+	hypothetical protein	NA	NA	NA	NA
WP_005847828.1\|3730290_3731082_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_005840337.1\|3731099_3731477_+	VOC family protein	NA	NA	NA	NA
WP_011965822.1\|3731519_3732353_+	DUF3805 domain-containing protein	NA	NA	NA	NA
WP_011965823.1\|3732360_3734226_+	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	1.1e-55	31.6
WP_005840344.1\|3734309_3735512_+\|integrase	site-specific integrase	NA	NA	NA	NA
3744802:3744818	attR	NA	NA	NA	NA

DBSCAN-SWA_4

4549700 : 4609949

unidentified_phage(33.33%)

integrase,transposase

attL 4554105:4554120|attR 4612259:4612274

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012055816.1\|4549700_4550627_-\|integrase	site-specific integrase	A0A0U4JNS1	Bacillus_phage	3.1e-22	28.3
WP_005635862.1\|4551578_4551935_+	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_005678154.1\|4551918_4552287_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_005678155.1\|4552362_4553976_+\|transposase	IS66-like element ISBvu3 family transposase	A0A0P0ZBS5	Stx2-converting_phage	2.0e-56	33.2
4554105:4554120	attL	NA	NA	NA	NA
WP_005785678.1\|4554362_4554884_-	restriction endonuclease subunit S	NA	NA	NA	NA
WP_041174585.1\|4554948_4555542_+	restriction endonuclease subunit S	NA	NA	NA	NA
WP_012055821.1\|4555534_4556611_-	restriction endonuclease subunit S	NA	NA	NA	NA
WP_012055822.1\|4556619_4558032_-	virulence RhuM family protein	Q9JMN3	Wolbachia_phage	2.2e-88	49.8
WP_012055823.1\|4558050_4559604_-	type I restriction-modification system subunit M	A0A2H4PQP4	Staphylococcus_phage	4.0e-163	56.2
WP_012055824.1\|4559610_4562439_-	type I restriction endonuclease subunit R	NA	NA	NA	NA
WP_005785666.1\|4562555_4562765_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_012055825.1\|4562869_4564234_+	hypothetical protein	NA	NA	NA	NA
WP_012055826.1\|4564236_4564587_+	STAS-like domain-containing protein	NA	NA	NA	NA
WP_041174489.1\|4564589_4565183_+	hypothetical protein	NA	NA	NA	NA
WP_041174490.1\|4565285_4565489_+	antitoxin VbhA family protein	NA	NA	NA	NA
WP_012055828.1\|4565619_4566549_-	HipA domain-containing protein	NA	NA	NA	NA
WP_012055829.1\|4566541_4566880_-	HipA N-terminal domain-containing protein	NA	NA	NA	NA
WP_012055830.1\|4566876_4567083_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_012055834.1\|4569477_4570494_-	hypothetical protein	NA	NA	NA	NA
WP_012055835.1\|4570535_4572872_-	TonB-dependent receptor	NA	NA	NA	NA
WP_005798034.1\|4573408_4573930_-	ParB-like nuclease domain-containing protein	A0A220GKT8	Streptococcus_phage	6.8e-59	67.7
WP_012055836.1\|4573935_4575216_-	DUF3440 domain-containing protein	A0A220GKF8	Streptococcus_phage	3.9e-140	53.3
WP_005798039.1\|4575212_4575617_-	hypothetical protein	NA	NA	NA	NA
WP_009291524.1\|4576029_4577634_-	RagB/SusD family nutrient uptake outer membrane protein	NA	NA	NA	NA
WP_012055839.1\|4580738_4581203_-	DUF4425 family protein	NA	NA	NA	NA
WP_011964977.1\|4582037_4582229_+	hypothetical protein	NA	NA	NA	NA
WP_012055840.1\|4582461_4585557_+	TonB-dependent receptor	NA	NA	NA	NA
WP_011964979.1\|4585585_4587223_+	RagB/SusD family nutrient uptake outer membrane protein	NA	NA	NA	NA
WP_011964980.1\|4587389_4587794_+	hypothetical protein	NA	NA	NA	NA
WP_012055841.1\|4587799_4589155_+	hypothetical protein	NA	NA	NA	NA
WP_012055842.1\|4589293_4592536_+	hypothetical protein	NA	NA	NA	NA
WP_012055843.1\|4592559_4592880_+	hypothetical protein	NA	NA	NA	NA
WP_012055844.1\|4592947_4594552_+	type IV secretion system DNA-binding domain-containing protein	NA	NA	NA	NA
WP_041174586.1\|4594837_4595146_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_012055846.1\|4595240_4595600_-	hypothetical protein	NA	NA	NA	NA
WP_041174492.1\|4595612_4596848_-\|integrase	site-specific integrase	H7BUI8	unidentified_phage	1.2e-24	31.8
WP_012055848.1\|4597191_4598097_+	hypothetical protein	NA	NA	NA	NA
WP_012055849.1\|4598466_4599192_+	hypothetical protein	NA	NA	NA	NA
WP_012055850.1\|4599505_4600405_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_012055851.1\|4600530_4601616_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_004315354.1\|4602020_4602647_+	Type 1 glutamine amidotransferase-like domain-containing protein	NA	NA	NA	NA
WP_012055852.1\|4602940_4603696_-	hypothetical protein	NA	NA	NA	NA
WP_012055853.1\|4603731_4604682_-	relaxase/mobilization nuclease domain-containing protein	NA	NA	NA	NA
WP_012055854.1\|4604678_4605092_-	plasmid mobilization relaxosome protein MobC	NA	NA	NA	NA
WP_012055855.1\|4605276_4605768_-	DUF3408 domain-containing protein	NA	NA	NA	NA
WP_008628599.1\|4606165_4606477_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_012055857.1\|4606559_4606868_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_012055858.1\|4607096_4607459_-	hypothetical protein	NA	NA	NA	NA
WP_012055859.1\|4607455_4608679_-\|integrase	site-specific integrase	H7BUI8	unidentified_phage	2.1e-18	28.4
WP_012055860.1\|4608710_4609949_-\|integrase	site-specific integrase	H7BUI8	unidentified_phage	2.4e-22	31.4
4612259:4612274	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr_ID: NC_009614.1|WP_012055680.1|4239815_4240247_+|PcfK-like-family-protein

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

NC_009614.1|WP_012055680.1|4239815_4240247_+|PcfK-like-family-protein

4239815_4240247_+

143 aa aa

hit_Aca_id	identity	query_coverage	hit_coverage
gnl\|BL_ORD_ID\|40	0.5611510791366906	0.972027972027972	0.9858156028368794

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_009614

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

Click the colored protein region to show detailed information