CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number
NC_007511	Burkholderia lata chromosome 2, complete sequence	2 crisprs	csa3,PD-DExK,WYL,DinG,cas3,RT	0	2	1
NC_007509	Burkholderia lata chromosome 3, complete sequence	0 crisprs	WYL,csa3,c2c9_V-U4,RT	0	0	0
NC_007510	Burkholderia lata chromosome 1, complete sequence	2 crisprs	WYL,csa3,cas3,DEDDh,DinG,PrimPol	1	1	3

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_007511_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_007511_1

3151-3267

Orphan

Consensus_repeat	Method
AGGTGAGATTTTTCGGGA	PILER-CR

2 spacers

The CRISPR arrays of NC_007511_1

>merge|NC_007511|1|3151-3267|PILER-CR
AGGTGAGGTTTTTCGGGAGGGAAATCAGGGTTTTCCTGCCCGGAACCCGCTGAGGTGAGATTTTTCGGGGCCCAGATCACAGACTGTGATTCCAGCAACAGGTGAGACTTTTCGGGA

>NC_007511|1|1|3151-3267|PILER-CR
AGGTGAGGTTTTTCGGGA	GGGAAATCAGGGTTTTCCTGCCCGGAACCCGCTG
AGGTGAGATTTTTCGGGG	CCCAGATCACAGACTGTGATTCCAGCAAC
AGGTGAGACTTTTCGGGA

Protein	Signature genes	Signature genes Name	Protein_function
NC_007511.1\|WP_011353624.1\|9138_9738_-\|RNA-polymerase-factor-sigma-70	unknown	unknown	gnl\|CDD\|183584
NC_007511.1\|WP_011353618.1\|1193_2375_-\|DNA-binding-protein	unknown	unknown	gnl\|CDD\|378704
NC_007511.1\|WP_011353621.1\|6739_7402_-\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|349760
NC_007511.1\|WP_011353627.1\|13079_13421_-\|hypothetical-protein	unknown	unknown	unknown
NC_007511.1\|WP_011353625.1\|10105_10660_+\|NAD(P)H-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|377026
NC_007511.1\|WP_041493139.1\|10712_12971_-\|hybrid-sensor-histidine-kinase/response-regulator	unknown	unknown	gnl\|CDD\|237425
NC_007511.1\|WP_011353628.1\|13441_13810_+\|response-regulator	unknown	unknown	gnl\|CDD\|381124
NC_007511.1\|WP_011353619.1\|4196_5564_+\|replication-initiation-protein	unknown	unknown	gnl\|CDD\|376444
NC_007511.1\|WP_011353617.1\|37_1057_+\|tyrosine-type-recombinase/integrase	unknown	unknown	gnl\|CDD\|334163
NC_007511.1\|WP_011353623.1\|8939_9161_-\|zf-HC2-domain-containing-protein	unknown	unknown	gnl\|CDD\|379219
NC_007511.1\|WP_011353620.1\|5654_6716_-\|ParB/RepB/Spo0J-family-partition-protein	unknown	unknown	gnl\|CDD\|272946
NC_007511.1\|WP_011353622.1\|8492_8852_+\|arsenate-reductase-(glutaredoxin)	unknown	unknown	gnl\|CDD\|239332

Protein	Function_ID	Function_description	E-value
NC_007511.1\|WP_041493139.1\|10712_12971_-\|hybrid-sensor-histidine-kinase/response-regulator	gnl\|CDD\|237425	PRK13557, PRK13557, histidine kinase; Provisional.	3.4405e-87
NC_007511.1\|WP_011353624.1\|9138_9738_-\|RNA-polymerase-factor-sigma-70	gnl\|CDD\|183584	PRK12545, PRK12545, RNA polymerase factor sigma-70.	9.6497e-142
NC_007511.1\|WP_011353618.1\|1193_2375_-\|DNA-binding-protein	gnl\|CDD\|378704	pfam11740, KfrA_N, Plasmid replication region DNA-binding N-term. The broad host-range plasmid RK2 is able to replicate in and be inherited in a stable manner in diverse Gram-negative bacterial species. It encodes a number of co-ordinately regulated operons including a central control korF1 operon that represses the kfrA operon. The KfrA polypeptide is a site-specific DNA-binding protein whose operator overlaps the kfrA promoter. The N-terminus, containing an helix-turn-helix motif, is essential for function. Downstream from this family is an extended coiled-coil domain containing a heptad repeat segment which is probably responsible for formation of multimers, and may provide an example of a bridge to host structures required for plasmid partitioning.	9.52892e-15
NC_007511.1\|WP_011353619.1\|4196_5564_+\|replication-initiation-protein	gnl\|CDD\|376444	pfam01051, Rep_3, Initiator Replication protein. This protein is an initiator of plasmid replication. RepB possesses nicking-closing (topoisomerase I) like activity. It is also able to perform a strand transfer reaction on ssDNA that contains its target. This family also includes RepA which is an E.coli protein involved in plasmid replication. The RepA protein binds to DNA repeats that flank the repA gene.	1.70162e-18
NC_007511.1\|WP_011353621.1\|6739_7402_-\|AAA-family-ATPase	gnl\|CDD\|349760	cd02042, ParAB_family, partition proteins ParAB family. ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation. ParB binds to DNA sequences adjacent to the origin of replication and localizes to opposite cell poles shortly following the initiation of DNA replication. ParB regulates the ParA ATPase activity by promoting nucleotide exchange in a fashion reminiscent of the exchange factors of eukaryotic G proteins. ADP-bound ParA binds single-stranded DNA, whereas the ATP-bound form dissociates ParB from its DNA binding sites. Increasing the fraction of ParA-ADP in the cell inhibits cell division, suggesting that this simple nucleotide switch may regulate cytokinesis. ParA shares sequence similarity to a conserved and widespread family of ATPases which includes the repA protein of the repABC operon in Rhizobium etli symbiotic plasmid. This operon is involved in the plasmid replication and partition.	1.06754e-35
NC_007511.1\|WP_011353628.1\|13441_13810_+\|response-regulator	gnl\|CDD\|381124	cd17593, REC_CheC-like, phosphoacceptor receiver (REC) domain of uncharacterized response regulators containing a CheC domain. This subfamily is composed of uncharacterized proteins containing an N-terminal REC domain and a C-terminal CheC domain that may function as the output/effector domain of a response regulator. CheC is a CheY-P phosphatase, affecting the level of phosphorylated CheY which controls the sense of flagella rotation and determine swimming behavior of chemotactic bacteria. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays.	1.06055e-57
NC_007511.1\|WP_011353623.1\|8939_9161_-\|zf-HC2-domain-containing-protein	gnl\|CDD\|379219	pfam13490, zf-HC2, Putative zinc-finger. This is a putative zinc-finger found in some anti-sigma factor proteins.	8.09915e-06
NC_007511.1\|WP_011353620.1\|5654_6716_-\|ParB/RepB/Spo0J-family-partition-protein	gnl\|CDD\|272946	TIGR00180, Probable_chromosome-partitioning_protein_ParB, ParB/RepB/Spo0J family partition protein. This model represents the most well-conserved core of a set of chromosomal and plasmid partition proteins related to ParB, including Spo0J, RepB, and SopB. Spo0J has been shown to bind a specific DNA sequence that, when introduced into a plasmid, can serve as partition site. Study of RepB, which has nicking-closing activity, suggests that it forms a transient protein-DNA covalent intermediate during the strand transfer reaction.	1.55205e-15
NC_007511.1\|WP_011353622.1\|8492_8852_+\|arsenate-reductase-(glutaredoxin)	gnl\|CDD\|239332	cd03034, ArsC_ArsC, Arsenate Reductase (ArsC) family, ArsC subfamily; arsenic reductases similar to that encoded by arsC on the R733 plasmid of Escherichia coli. E. coli ArsC catalyzes the reduction of arsenate [As(V)] to arsenite [As(III)], the first step in the detoxification of arsenic, using reducing equivalents derived from glutathione (GSH) via glutaredoxin (GRX). ArsC contains a single catalytic cysteine, within a thioredoxin fold, that forms a covalent thiolate-As(V) intermediate, which is reduced by GRX through a mixed GSH-arsenate intermediate. This family of predominantly bacterial enzymes is unrelated to two other families of arsenate reductases which show similarity to low-molecular-weight acid phosphatases and phosphotyrosyl phosphatases.	3.12381e-53
NC_007511.1\|WP_011353625.1\|10105_10660_+\|NAD(P)H-dependent-oxidoreductase	gnl\|CDD\|377026	pfam03358, FMN_red, NADPH-dependent FMN reductase.	1.44246e-44
NC_007511.1\|WP_011353617.1\|37_1057_+\|tyrosine-type-recombinase/integrase	gnl\|CDD\|334163	pfam00589, Phage_integrase, Phage integrase family. Members of this family cleave DNA substrates by a series of staggered cuts, during which the protein becomes covalently linked to the DNA through a catalytic tyrosine residue at the carboxy end of the alignment. The catalytic site residues in CRE recombinase are Arg-173, His-289, Arg-292 and Tyr-324.	1.77964e-13

>NC_007511.1|WP_011353618.1|1193_2375_-|DNA-binding-protein
MTLDEIRHAIRDELESLRANGARRQELSLHACKRLFFDLGIRPSAANVRDLTQTGSASDIPKDIDHFWERIRSASKIRLDGAAIPKAVEEKAGALLGALYEEALKAARDSLDGDREQVRAGVADAEQRLRDATVRQETLEGALARGEAKNEQLQARVTELEVQLASQTTHGSASEATLLTTVARLEKELAAAAGRVEAEQTHNATLRDRIDTLQAELQQRTEHYAQQIKDAVAEAERRVKPMLVELDSLRSMASTYQSGLRDVQRKEFDFLQQLSSAKARADRLEEQLRSQGDELERATRDVSALRASRGMNPEIAALIRRLADAGQLDPDAFAAIGTSLDQEIPVPAHCPHCDGEPELSHSEEGFEVACPECEHASGAWPSRFEAVARFAHT
>NC_007511.1|WP_011353617.1|37_1057_+|tyrosine-type-recombinase/integrase
MSLPASPDTPARPEETDLFDRGASDWIVSPEAAFDAWLAMQDYRRSSADVYRAQWGAFLTWMRAHQKNLATVDTATIANFVGELPIRKTQRMRYLRLIERVLDHIRRTEYASTNPARFIAQDGEANWRKARDNEPTGFLAPAERAALLAYLFSPIGVSGSAYWKERRDRALVAAFLGAGIKTGEARALTISCINTSGTSLQIESTHPDFARETHLASFAIALLEAWLTERKRQDIPGELVFPASHAGRPMHKATMLRAIDAIVESAGLTSSRTARASPQTLRNTYAAELFEHDVPPERVGKWLGFMRPISSNRLHRAWKNWRDGLADSNGDASDSDETH
>NC_007511.1|WP_011353619.1|4196_5564_+|replication-initiation-protein
MATTKRAKKTDVDVVSASSAELRKAVEAIAIQPKSGKITLLTRKLFNVLLAVAQQADDSGDTYRALLSDIVANSAFDSNDTALVKEHLRRMVSVQVEWSTGTSSQKPGRKWGISTLIADAEILEDPATRRVWVEFSFAPKIKKKLLDPVQYARLSLQFQSQLRSSAGLALYEICVRYLTNPSHLTMREPWEWWRPILSGTPDTEAGDEAKREYKYFKRDYLRPAIAEVNAVTNIFVELIEHREGRRVAEIQFRVTERKQPMLALDEHPNVFDSTLVDRMVKLGIPLKEAQTLYADSEENRIRAALQMTEQRMRSTTLPPVRSAPALFKDALKKGYAPPVESVDALPAGTPSPKIAAAQPDDLKARLLSEFAAFRRKEAKVLYEEQGDAEREVARESFESEALPTMGTHLRDDWRKRGLDSKLAETAFFDWLAQRTWGEPTDGDLLSFTLNQSRAA
>NC_007511.1|WP_011353620.1|5654_6716_-|ParB/RepB/Spo0J-family-partition-protein
MKPSQFAKGFQARPDITTSEKRTALDRLNAIDGIVKSETPTPAPTKSAKKDIAPPPAPELTLDPSIDESAQYRAWRLENRYAPGQVIELSLKAIKHSPFNPRHFYLKSSIAELAVNLAKQGQQQAIHVIPDYENPGTYFVSDGGRRVRALKEANKESVKAIVIDVPIGIQSYKLGYDLNVQRDSQTVFDNAVVWRRFLDDKHFQSQKELSEHLGLDESTVAVALSIGKLPEAIMQEMVARPDRFGSNMAYQVGRYHNARGTEATLRLINKIVSDDLSTRQVSDIVKGRVAAQETPKAAGRQRYAQRLEIKLGGKSVGDLKSYGEDRIELRLRGLPKDKRDAILEQLERMLLSE
>NC_007511.1|WP_011353621.1|6739_7402_-|AAA-family-ATPase
MAAEIIAVTQQKGGVGKSTIAMHLGAAFHEKGKRVLVIDADRQNTLVHWSSASGDSDTGIPFPVVNLAEADGQIHREIKKFINDYDIIVVDCPPSITEKVSGVVLLAASIAVIPTSSSPADYWSSVGLVKLIQQAQVMNEDLRAVFLLNKTEEKRMLTRELKRALEELGFPLLKTQIPTREAYKQAMALGQTVLQMNDRGGKLAAAEIRACADEIVAMLP
>NC_007511.1|WP_011353622.1|8492_8852_+|arsenate-reductase-(glutaredoxin)
MMITIYHNPRCSKSRETLALVESLNTTGAPLNVVEYLKTPPTVEELEALHRQLGRPVRDMLRDGEEPYKELNLARADLTDAEAYAAIAAHPILLQRPIVVYRGKAAIGRPPESVQALFE
>NC_007511.1|WP_011353623.1|8939_9161_-|zf-HC2-domain-containing-protein
MLPGKCTDVTRLLSDALDRHLTLHERLQVRIHLPTCSGCRAYRGQIALLRTAAKAAAGRGPAPDDDDTSSGEG
>NC_007511.1|WP_011353624.1|9138_9738_-|RNA-polymerase-factor-sigma-70
MPSAYDDPVYLAQLRRDLLRFARLQLRDADAAEDAVQEALTAAWSHAGDFAGLSAHKTWVFGILRNKLIDVLRARQRTVSLSALDAELDGESVLDRELFKENGHWAAHAKPRPWPRPETLLQQQQFWTLFEACLDHLPEQIGRVFMMREFLDFEMTDICSELTLTTNHCSVLLYRARTRLRTCLSEQGLTTEDAAGEMY
>NC_007511.1|WP_011353625.1|10105_10660_+|NAD(P)H-dependent-oxidoreductase
MSYRIAVVVGSLRRASWNRALAHAVISLAPADFSFEFVEIGELPLYSQDYDADFPEVAKRFKQSIEAADALLFFTPEYNRSIPGVLKNALDWGSRPWGSNSWSGKPGAVLGTSPGATGTALAQQHLRNVLAYLDVKTLGQPEMFIKHDPARIDDQGQIVSEDTRKFLQGFVDRYTGWVRLLKSA
>NC_007511.1|WP_041493139.1|10712_12971_-|hybrid-sensor-histidine-kinase/response-regulator
MTSDRPADSHAPASPPADDWQDDGNYASGAPEHDFAVRRVTLIVLLVAAIVLPCIYVVVMAYNDLKTREAAASDVTMRTVRVAEEHALKVFDLSETLDARIVDLVQDMDDATVRNRESDIHEALNTIGGGYPQVAAVSIFGASGMLLANSLYYPAPYASIANRDDFAGIRDGKVIEHISRLMMGPLKLENIPVFNTGVARRHSDGSFAGMVSIALKSSYFNAFYRDLLGGASTPMTMALARSDGAVIASYPPPPALAHTDRAVTFGDARNDPRAGVVRVRHDGASSEIVAYRQVGSYPVYVTCAYRTSAIWHEWYEHLSVLFISMFAPSVALWSVIWLSLKRLKAEEEAWDRWQAEASMRRSIESAYRQSRKMQALGNLVGSVAHDFNNLLMIISSNVQIVRRRGVQHLDKELGAIERALKNGQSLTRQLLGVARKQPLHNETIDVGQWVGTCRELLKTSLGSKSSLVVAIEPGVWPIRVDVAELELAVINLAVNARDAMATGGRFTVGARNVTLRREDGFPLTGDFVQISLDDTGSGMAPDVLARAFEPLFTTKAQGMGTGLGLPQVFAFCERSGGLATIDSAVGAGTSVRLYLPRARAEDVVARPQAVVHDAGAGALAGLHVLLVEDNSEVAAGTEALLSLLGHRVTYAPTADDALRLIEGAAANDAFDLVISDIHMPGRLNGIDLAEAVEQRPEKLPVILVTGYAEELDRTRTVNVRVLSKPFDIALLDEILLGIREARDARHARHAGT
>NC_007511.1|WP_011353627.1|13079_13421_-|hypothetical-protein
MVSLALTTARRTSLGAMRSGAGNRLAAARGRRDAGARDAPRGERRRAHISVIGKARRDSLSKPEAMQLAIFTISNRIGPNTHHSENSRDHFRDKHAKFFLVYVCAAGFVAFSI
>NC_007511.1|WP_011353628.1|13441_13810_+|response-regulator
MPLPIVIADDSLLARKLLTKALPGGWDVEVTYAANGREALALYRDGKASVMFLDLTMPDMSGYQVLETLRHEDLNTFVIVVSADIQPQAQARVRELGAIAFVAKPVTSEALLPILKEYGLYA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_007511_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_007511_2

225249-225568

Orphan

Consensus_repeat	Method
ATCGGCGGCGCCATCGGCGGCGGCGC	CRISPRCasFinder

4 spacers

The CRISPR arrays of NC_007511_2

>merge|NC_007511|2|225249-225568|CRISPRCasFinder
ATCGCCCCCGCTCTCGTCGTCGCCGCGTTGACCGGCGCGACTGCACTGCCGGCTATGGCAGGTGACATGAACAACGCGCTTGGCGGCGCGCTCGGCGGGGTAGCCGGCGCAGCGGTCGGCGGTGCGCTCGGCGGCAGCACGGGCTCGGTGATCGGCGGCGCCATCGGCGGCGGCGCGGGTGGCGCGGTGACGTCGAACCGTCGCGAGCGCACCGGCGCGATCATCGGCGGCGCCCTCGGCGGCGGCGCAGGTACCGCGGCAGGCAACGCAATGGGCGGCCGCACGGGCGGCCTGCTGGGTGCGGCGGTCGGCGGCGGCGC

>NC_007511|2|1|225249-225568|CRISPRCasFinder
ATCGCCCCCGCTCTCGTCGTCGCCGC	GTTGACCGGCGCGACTGCACTGCCGGCTATGGCAGGTGACATGAACAACGCG
CTTGGCGGCGCGCTCGGCGGGGTAGC	CGGCGCAGCGGTCGGCGGTGCGCTCGGCGGCAGCACGGGCTCGGTG
ATCGGCGGCGCCATCGGCGGCGGCGC	GGGTGGCGCGGTGACGTCGAACCGTCGCGAG
CGCACCGGCGCGATCATCGGCGGCGC	CCTCGGCGGCGGCGCAGGTACCGCGGCAGGCAACGCAATGGGCGGCCGCACGGGCGGCCTG
CTGGGTGCGGCGGTCGGCGGCGGCGC

Protein	Signature genes	Signature genes Name	Protein_function
NC_007511.1\|WP_011353832.1\|233977_235066_-\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223682
NC_007511.1\|WP_011353830.1\|232630_233017_-\|lactoylglutathione-lyase	unknown	unknown	gnl\|CDD\|319924
NC_007511.1\|WP_041493444.1\|221722_222697_-\|hypothetical-protein	unknown	unknown	unknown
NC_007511.1\|WP_011353818.1\|220129_221530_-\|serine-hydrolase	unknown	unknown	gnl\|CDD\|224594
NC_007511.1\|WP_011353825.1\|226550_227387_+\|(S)-ureidoglycine-aminohydrolase	unknown	unknown	gnl\|CDD\|183011
NC_007511.1\|WP_011353827.1\|228765_229560_-\|3'-kinase	unknown	unknown	gnl\|CDD\|226100
NC_007511.1\|WP_011353821.1\|223871_224036_+\|hypothetical-protein	unknown	unknown	unknown
NC_007511.1\|WP_011353816.1\|217826_219326_+\|TIGR01777-family-protein	unknown	unknown	gnl\|CDD\|224015
NC_007511.1\|WP_011353833.1\|235081_235999_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|226928
NC_007511.1\|WP_011353817.1\|219398_220022_+\|glutathione-S-transferase	unknown	unknown	gnl\|CDD\|198289
NC_007511.1\|WP_157687225.1\|226221_226461_+\|hypothetical-protein	unknown	unknown	unknown
NC_007511.1\|WP_011353814.1\|216392_216863_+\|DUF2269-domain-containing-protein	unknown	unknown	gnl\|CDD\|370783
NC_007511.1\|WP_081436647.1\|227539_228610_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379090
NC_007511.1\|WP_011353822.1\|224198_224858_+\|isoprenylcysteine-carboxylmethyltransferase-family-protein	unknown	unknown	gnl\|CDD\|224931
NC_007511.1\|WP_011353813.1\|215088_216396_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187579
NC_007511.1\|WP_041493445.1\|223196_223616_+\|HIT-domain-containing-protein	unknown	unknown	gnl\|CDD\|238608
NC_007511.1\|WP_011353831.1\|233136_233958_-\|heme-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|184132
NC_007511.1\|WP_011353829.1\|231930_232542_+\|trimeric-intracellular-cation-channel-family-protein	unknown	unknown	gnl\|CDD\|225415
NC_007511.1\|WP_011353828.1\|229798_231922_+\|PBP1A-family-penicillin-binding-protein	unknown	unknown	gnl\|CDD\|273955
NC_007511.1\|WP_011353815.1\|216963_217830_+\|DUF393-domain-containing-protein	unknown	unknown	gnl\|CDD\|367833

Protein	Function_ID	Function_description	E-value
NC_007511.1\|WP_011353832.1\|233977_235066_-\|iron-ABC-transporter-permease	gnl\|CDD\|223682	COG0609, FepD, ABC-type Fe3+-siderophore transport system, permease component [Inorganic ion transport and metabolism].	3.15441e-78
NC_007511.1\|WP_011353830.1\|232630_233017_-\|lactoylglutathione-lyase	gnl\|CDD\|319924	cd07263, VOC_like, uncharacterized subfamily of vicinal oxygen chelate (VOC) family. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	7.32859e-05
NC_007511.1\|WP_011353818.1\|220129_221530_-\|serine-hydrolase	gnl\|CDD\|224594	COG1680, AmpC, Beta-lactamase class C and other penicillin binding proteins [Defense mechanisms].	1.81214e-40
NC_007511.1\|WP_011353825.1\|226550_227387_+\|(S)-ureidoglycine-aminohydrolase	gnl\|CDD\|183011	PRK11171, PRK11171, (S)-ureidoglycine aminohydrolase.	0
NC_007511.1\|WP_011353827.1\|228765_229560_-\|3'-kinase	gnl\|CDD\|226100	COG3570, StrB, Streptomycin 6-kinase [Defense mechanisms].	1.13409e-84
NC_007511.1\|WP_011353816.1\|217826_219326_+\|TIGR01777-family-protein	gnl\|CDD\|224015	COG1090, COG1090, Predicted nucleoside-diphosphate sugar epimerase [General function prediction only].	5.97637e-112
NC_007511.1\|WP_011353833.1\|235081_235999_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|226928	COG4558, ChuT, ABC-type hemin transport system, periplasmic component [Inorganic ion transport and metabolism].	3.96334e-77
NC_007511.1\|WP_011353817.1\|219398_220022_+\|glutathione-S-transferase	gnl\|CDD\|198289	cd03180, GST_C_2, C-terminal, alpha helical domain of an unknown subfamily 2 of Glutathione S-transferases. Glutathione S-transferase (GST) C-terminal domain family, unknown subfamily 2; composed of uncharacterized bacterial proteins, with similarity to GSTs. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain.	4.13776e-48
NC_007511.1\|WP_011353814.1\|216392_216863_+\|DUF2269-domain-containing-protein	gnl\|CDD\|370783	pfam10027, DUF2269, Predicted integral membrane protein (DUF2269). Members of this family of bacterial hypothetical integral membrane proteins have no known function.	7.25326e-58
NC_007511.1\|WP_081436647.1\|227539_228610_-\|hypothetical-protein	gnl\|CDD\|379090	pfam13248, zf-ribbon_3, zinc-ribbon domain. This family consists of a single zinc ribbon domain, ie half of a pair as in family DZR. pfam12773.	0.00522451
NC_007511.1\|WP_011353822.1\|224198_224858_+\|isoprenylcysteine-carboxylmethyltransferase-family-protein	gnl\|CDD\|224931	COG2020, STE14, Putative protein-S-isoprenylcysteine methyltransferase [Posttranslational modification, protein turnover, chaperones].	6.22497e-25
NC_007511.1\|WP_011353813.1\|215088_216396_+\|SDR-family-oxidoreductase	gnl\|CDD\|187579	cd05271, NDUFA9_like_SDR_a, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, subunit 9, 39 kDa, (NDUFA9) -like, atypical (a) SDRs. This subgroup of extended SDR-like proteins are atypical SDRs. They have a glycine-rich NAD(P)-binding motif similar to the typical SDRs, GXXGXXG, and have the YXXXK active site motif (though not the other residues of the SDR tetrad). Members identified include NDUFA9 (mitochondrial) and putative nucleoside-diphosphate-sugar epimerase. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	5.55122e-53
NC_007511.1\|WP_041493445.1\|223196_223616_+\|HIT-domain-containing-protein	gnl\|CDD\|238608	cd01277, HINT_subgroup, HINT (histidine triad nucleotide-binding protein) subgroup: Members of this CD belong to the superfamily of histidine triad hydrolases that act on alpha-phosphate of ribonucleotides. This subgroup includes members from all three forms of cellular life. Although the biochemical function has not been characterised for many of the members of this subgroup, the proteins from Yeast have been shown to be involved in secretion, peroxisome formation and gene expression.	1.2632e-48
NC_007511.1\|WP_011353831.1\|233136_233958_-\|heme-ABC-transporter-ATP-binding-protein	gnl\|CDD\|184132	PRK13547, hmuV, heme ABC transporter ATP-binding protein.	3.52933e-170
NC_007511.1\|WP_011353829.1\|231930_232542_+\|trimeric-intracellular-cation-channel-family-protein	gnl\|CDD\|225415	COG2860, COG2860, Predicted membrane protein [Function unknown].	1.70337e-62
NC_007511.1\|WP_011353828.1\|229798_231922_+\|PBP1A-family-penicillin-binding-protein	gnl\|CDD\|273955	TIGR02074, Includes:_Penicillin-insensitive_transglycosylase, penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan].	0
NC_007511.1\|WP_011353815.1\|216963_217830_+\|DUF393-domain-containing-protein	gnl\|CDD\|367833	pfam04134, DUF393, Protein of unknown function, DUF393. Members of this family have two highly conserved cysteine residues near their N-terminus. The function of these proteins is unknown.	1.8016e-20

>NC_007511.1|WP_011353822.1|224198_224858_+|isoprenylcysteine-carboxylmethyltransferase-family-protein
MTVTRKVAVVSGVSTLVYLGLAVLGSGGFAAFFSHPPLTVVVVATLAMAVVAMFTEGNLSSGERENRDNRWVLAAFGVSGFLLAYLPALTDRLDFWTFGGDAVRWIGVVLYIAGGVLRIWPVFVLGKRFSGLVAIQPGHTLVTDGIYSRIRNPSYLGLVVNSVGWALAFRSGVGLLLVVLTMVPLVARIRSKEALLRAQFGAEYDAYCARTWRLLPGVY
>NC_007511.1|WP_011353821.1|223871_224036_+|hypothetical-protein
MTRLLITLALIGGLSGCYVAPPYGYAPAPAYYGYAPAYYAPPVSVGIGGNFRIR
>NC_007511.1|WP_041493445.1|223196_223616_+|HIT-domain-containing-protein
MSYDNNNPFAKILRGELPCVKVAEDDATLAIMDLMPQADGHVLVIPKEPAAQIFELSGDAAAAGIRMTQRVAAAVRAALEPDGVFIGQFNGAAAGQTVPHVHFHVIPRWEGAELKMHAREIADAATLEALAQRIRARFV
>NC_007511.1|WP_041493444.1|221722_222697_-|hypothetical-protein
MPTNGDVNPYGIAFVPRGVPSWSTLKPGDVVVSNFNAASNAQGTGTTIVKLTPGKTPATTFFQGSNLGLTTALTVLRSGFVLVGNVPAPDGKTVVAPGSLLVIGPQGNLVTQLSSAALLDGPWDMTVIDRGQRVTAFVSNVLNGTVSRIELAIGDNGVTMLPGSRVIASGYVNRTDPNALVVGPTGLAYDPNIDVLYVASTGDNAVFAIQNAASTNRNGGVGRMIYFDAAHLHGPLALALAPNGHLVTANGDAVNADPQQPSEIVEFTVDGRFVAQMQVDTVSGAAFGLAFGHGSKGQLEFAAVDDNTNTATVWTLRSDNNNAQ
>NC_007511.1|WP_011353818.1|220129_221530_-|serine-hydrolase
MTIPFKKLILRGVALAVVAAVGYTGYMLSRLAPIATGYAAKALCSGVYVSGRPAESVIDVDIMAGVHPLLKLVHPSIDPDHHRATATFAGFAEREADFRPGLGCTLALGPSPGALPAALPPLPDPPSTQPAPATPPAGVDAQKLQTALDRAFDEPDPARPRRTRAVVVMWRGQVIAERYAPGFTADTPLPGWSMTKTVTAALVGTLVAQHKLSLDTSALLPEWRGSGDPRAAITLDELLRMTSGLQFNEDYDDPLSDVALMLYAQSDTARFASAKPLAATPGTRWSYSSGTSAIVARVMREALGGSEDDYLALPRRALFAPLGMRSAVFEPDASGTLVSPSYMYASARDWARFGQLLLQDGVWDGQRLLPEGWVRYLTRTTPQSERQEYGAQLWVKVPEPFNDRDPHAVAMPADAFHAVGHEGQFVSVVPSRQLVVVRLGLSRPESAWNHEAFLARVLDALPAPGA
>NC_007511.1|WP_011353817.1|219398_220022_+|glutathione-S-transferase
MLHILGKIPSINVRKVLWLCTELNLPFEQEDWGAGFRTTNDPAYLALNPNGLVPVIKDDDFVLWESNTIVRYLANRYGGDALYPAEPQARARVDQWIDWQGADLNRSWVGAFLGLVRKSPDHQDPAGIAQSIAGWTKHMQVLNAQLKATGAYVAGNGFTLADIPIGLSVNRWFGTPFEHPDFPAVKRYIERLATREGFQKYAGSANP
>NC_007511.1|WP_011353816.1|217826_219326_+|TIGR01777-family-protein
MNTLPAYDWALNLLIVQGAMGAFDTLYHHELTQDLPHSPRARLELGIHAVRSVLYGLVFASIANVAFHGAWVAALAAVVVVEVVLTLWDFVVEDQSRKLPSTERVLHTLLAVNGGALFGMIAMQLAVWAHEPTALQALDLGWRGWVLSLFAVGVAISGIRDGIAACRIARHAPVANPFAGQAPGSVLVTGGTGFIGETLVNQLLDAGHVVTLLARDPLRAAYLFHGRVRSVTSVEQLQPHERFDTVINLAGAPVLGARWSKRRQAVLLASRVGVTESLMRWVETAEVRPRTWIQASAIGYYGVRPSDERLDESSNAGTGFMSELCRQWEQSAQPLERHGARSVVLRLGVVFGPGGALRPMLLPHYFGMGGRFGDGKQVMSWIHRDDVLRIIARAMANPGMRGVYNAVAPAPLTQREFVQVVSKVLHRPAWLHVPAAPLRIAMGEMAEVLLDGQRVMPARLHQDGFMFRFPTAEHALRDLTNHPHADFPRTACCLPRGRV
>NC_007511.1|WP_011353815.1|216963_217830_+|DUF393-domain-containing-protein
MSSSELVLYFDGRCPLCVAEIKRLEARDARHRLAFVDIAEPGFDPAPLGVDLPALNRELHARLPDGRMLTGVDSILAAQALTGRRWLVRLLRVPVVRTALAPLYRRFARNRQAVSRWLGYRAEAPCDGAACGSGRAAEPTANRPAGDAARRIVVTWMYGAAIAHLLVGIAVPWVAGTPWLDAYHRVIELHFWAGAAPDAARAQQVWWMSLIGATVQCASVWMLALVHLGNRLRRREVWGWLLAGLLVWAPQDMLFSLQAHVSGHVAIDAAALVAMVPPLVWLWRRDTV
>NC_007511.1|WP_011353814.1|216392_216863_+|DUF2269-domain-containing-protein
MNTYLVIKALHILSSVLLVGTGFGTAFYLFFANRTRSVPAIAAVSRLVVRADWWFTTPAVIFQPASGLWLAHTAGWPWDTPWLVASIVLYAIAGACWLPVVWLQVELAAMAKLAHANGDAGLPERYWRYAKRWELLGYPAFFAMLTVYFLMVLKPM
>NC_007511.1|WP_011353813.1|215088_216396_+|SDR-family-oxidoreductase
MNAVLPSISQHDCTGARSMTVLVCGANGFIGRALCAQLEAGGHRVLRGVRHAAGPCDVAIDFAKDVDPDAWLARLEGVDVVINAVGILADQRGATLDAVHRAAPCALFTACCRAGVRRVIQISALGVERGDTRYFASKVAADRFLQTLPIDYRIVRPALVYGTTGASARFFRMLASLPVQVLPAGGHQRLRPVHVDDLAEVVARCVDAPAAGRPVIDVVGNDEVEYREMLARYRAALGFPPAVRIALPGPLAGAAATLFGMLPGAMFTRDTWTMLRGGNTGDPAAATAMLGRPPRGIDGFIGAEAAALRRDALAMWRRPLLRGALAIVWIWTAIASAFIHPLHASLALLAPAHLTGLPALIALYAASALDFAFGIATVVAPSRRLWVAQAALIVAYSAVIAVTMPGLLAEPFGPVLKNVPILAILLILFSEEEQA
>NC_007511.1|WP_157687225.1|226221_226461_+|hypothetical-protein
MESIATFNWSIANDFAIVGDARVRHRTVPLAAPRRMIASATARSPAPQAWAAASEEPDEPVAKPGRPNEGACAFKPPRQ
>NC_007511.1|WP_011353825.1|226550_227387_+|(S)-ureidoglycine-aminohydrolase
MSKTTYYAPHGGHPPQTDLLTDRAMFTEAYAVIPKGVMRDIVTSWLPFWTNTRLWVIARPLSGFAETFSQYIVEVNPGGGSDKPEQDKNAEAVLFVVEGEAELTLQGKKHVLKPGGYAFIPPGADWTLHNVSDAAVRFHWVRKHYQAVDGIPLPEAFVTNEQDVEPIPMPGTNGAWVTTRFVDMSDMRHDMHVNIVTFEPGGVIPFAETHVMEHGLYVLEGKAVYRLNQDWVEVEAGDFMWLRAFCPQACYSGGPGRFRYLLYKDVNRHMNLLLNPAR
>NC_007511.1|WP_081436647.1|227539_228610_-|hypothetical-protein
MMTSSDGLTSPARLLRLASWVIAIIFAVFLNMLGSLVIRDMAFAPRGGPPVVEQFADAPAKARLDAARRDLQAQHDTLAGKADAMEVARGRAAKEYAAEKESFRNWLATRSVTGDSARDPDILARTRKLDTLQAVVINWQHQIDAIGDQQRALASQQTQVDTQIADADAAAERRFEKADRQYELQVFGLRLALTLPILLIAIWLFMRYRKMRYWPFVYGFGLFSLSAFFIELVPYLPNFGGYVRVLVGIALTVFAGLYMMKAFQRYAERKRLELQQDQGERARTIGYEKAVRSLEKKRCPSCDKQWNLGGDDSTFCVHCGLRLFNVCGCGGRNFFFFPHCHQCGATQGNESPAASD
>NC_007511.1|WP_011353827.1|228765_229560_-|3'-kinase
MFDRYLGLWGLVPDGGPILTASGGLLPVVWQARPAMLKVATCDEERRGNALMTWWNGQGAAQVWQHDSDAVLLERARPEPTLAGFSASGHDDDAMRIACNVVARLHAHRASEPPSVVPLHDWFYALLSNDADNAALRRSAAIARQLLVAPPVDDFVLHGDIHHGNILHFGERGWRAIDPKGLRGDRAFDYANLFCNPSHDIAVDPVRFEQRVTLVASAAQLDRRRLLQWILAWSGLSAVWLIEDGLSPDTRLQVAMLAAAALGV
>NC_007511.1|WP_011353828.1|229798_231922_+|PBP1A-family-penicillin-binding-protein
MTDHTASPPPPPAPPPRRRRVWRTLAGALLGLTVACAGIGAWTIQRIWTQLPSVEHLAVYRPALPLRIFSRDGDLLAEYGVERREFVPLERIPPLMRQALLAAEDAKFYQHGAVDFNGLARATFANVVTGQPGQGGSTITMQVARNFYLTRDKVLSRKLAEILMATKLEREYSKDKLLELYMNEIYLGERAYGFAAAANVYFGKPLDALSAGEAAVLAGLPKAPSAFNPVVNPARATARRNYVLGRMHALGQLDDATYRAAVDAPIALATTPPPGIIAAPYVAERARRMMVERFHDDAYTLGLDVTTTISMRDQRAAESSLARTLSRQPRAKRDARNGLEGALISLDAATGDMLALVGGADFNRNVFDHALQAYRQPGSSFKPFVYSAALEKGYFPGVLVDDTQRTLTHEETGARPWRPRNFANNYEGFIPVRRGLMRSKNLVAVSLMQATDARYVQQHAVHFGFDAQRNPASLPLALGAGAVTPLELASAYSVFANGGTRMEPRLILSVKQRHGGAIYEATAPAGERVVSARNAFVMDSMLRDVVKSGTARGALALRRDDAAGKTGTSNGSKDVWFAGYSSGIVAVAWLGYDTPRPMGRATGASLALPVWLDYMKTAVDGRTPVEATPPQDVALVDGDFVYAEYTRGTCTADVPSYIRSRFACGGAAAVSGASDAPGNNGKPAEPMPGAVDAAERERVLDLFRTED
>NC_007511.1|WP_011353829.1|231930_232542_+|trimeric-intracellular-cation-channel-family-protein
MHTLYLIAIVAEAMSGALMGMRRGMDRFGLALVGAVTALGGGTVRDVLLGHYPLGWIAHPEYLVITLVAATVASWVARHVARMKTLFVTVDAIGLAAFTIIGCDIGASTGAVPIIVVLAGAITGVCGGMLRDLLCNEMPLILREELYASVAFVTGGLYVGMQYVGIDAGFATVVALAAGFSMRMLAVRLGWKMRTFGAADLEH
>NC_007511.1|WP_011353830.1|232630_233017_-|lactoylglutathione-lyase
MPLPMTRIILYVQDVASLKSFYQQYFDLPVIEEIENEWVVLGAGAIELALHLAGPAFRHAAPADAEARAETSHVKFVFSIGQDIGAHRGRLAGDGVTVRDLKRYDGFAYTMYDGIDPEGNVFQVMQAD
>NC_007511.1|WP_011353831.1|233136_233958_-|heme-ABC-transporter-ATP-binding-protein
MLTAHHLDVARRHHAILRNLSLSIEPGRVTALLGRNGAGKSTLLKTFAGELTGGVAPNGVRVTGDITLNGEPLARIDAPRLACLRAVLPQAAQPAFPFSVDEIVLLGRYPHARRSGATSHRDRDIAWCALERAGADALVGRDVTTLSGGELARVQFARVLAQLWPDDEAIESGPRYLLLDEPTAALDLSHQHRLLETVRAVAREWQLGVLAIVHDPNLAARHADTIAMLADGTIVAHGSPRDVMTPAHIAQCYGFAVKMVETGDGAPPVMVPA
>NC_007511.1|WP_011353832.1|233977_235066_-|iron-ABC-transporter-permease
MPAHASPFPASSPASRSGAARIGTSRRFAPFALAALACLVCAMSVVALCVGAYRIPLAEAWAALTGAAAAQQARAVLFDIRAPRVALALLVGGGFGATGAAMQALFRNPLADPGLVGVSSGAALGATTMIVLGPALFAAHVSAAALPIAAFAGALAVAALVYRLAASRGRLALPLLLLAGIAINALVGAAIGLLTFVADDAQLRSLTFWSLGSLGGAQWSALAAVAPCVAIGCVLLARERDALNALQLGETEALHLGVPVQRLKRRVLVAVALAVGALVSCAGIIGFIGLVAPHCVRLACGPDQRVVLPGAALLGALLTLAADLAARTVAAPAEIPLGVLTALLGAPFFLALLWKSRGALGG
>NC_007511.1|WP_011353833.1|235081_235999_-|ABC-transporter-substrate-binding-protein
MSARPFDPRRRAVLASAAAGALAGALPGSVLAQVAPAAPKRVVVIGGALAETAFALGGAETPRYRLVGADTTCTYPDAAKRLPKVGYQRALSAEGLLSLRPDLVLASAEAGPPTAIAQVKNAGVAVTTFDERHDVESVRAKITGVAQALDVRDAGTALLQRFDRDWQDARDAVAARAPGGAQPPRVLFVLNHTGNQALVAGQRTAADAMIRYAGARNAMQGFDHYKPLTTEALAAAAPDVVLISDEGLAAVGGRAALLATPGFGATPAGRAQRVVALDALFLLGFGPRLPLAVTTLHRRLSDALA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_007511_2	2.3\|225425\|31\|NC_007511\|CRISPRCasFinder	225425-225455	31	NZ_AP014705	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence	1073398-1073428	8	0.742
NC_007511_2	2.3\|225425\|31\|NC_007511\|CRISPRCasFinder	225425-225455	31	NZ_CP030074	Streptomyces sp. ZFG47 plasmid unnamed1, complete sequence	871327-871357	8	0.742
NC_007511_2	2.3\|225425\|31\|NC_007511\|CRISPRCasFinder	225425-225455	31	NZ_CP022193	Yangia pacifica strain YSBP01 plasmid unnamed3, complete sequence	36974-37004	9	0.71
NC_007511_2	2.3\|225425\|31\|NC_007511\|CRISPRCasFinder	225425-225455	31	NZ_CP043499	Rhizobium grahamii strain BG7 plasmid unnamed, complete sequence	433713-433743	9	0.71
NC_007511_2	2.3\|225425\|31\|NC_007511\|CRISPRCasFinder	225425-225455	31	NZ_CP014311	Burkholderia sp. PAMC 26561 plasmid unnamed4, complete sequence	174204-174234	10	0.677
NC_007511_1	1.1\|3169\|34\|NC_007511\|PILER-CR	3169-3202	34	NZ_CP030128	Indioceanicola profundi strain SCSIO 08040 plasmid unnamed2, complete sequence	312113-312146	11	0.676

1. spacer 2.3|225425|31|NC_007511|CRISPRCasFinder matches to NZ_AP014705 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence) position: , mismatch: 8, identity: 0.742

gggtggcgcggtgacgtcgaaccgtcgcgag	CRISPR spacer
accgtacgcggcgccgtcgaaccgtcgcgag	Protospacer
.    .*****.* *****************

2. spacer 2.3|225425|31|NC_007511|CRISPRCasFinder matches to NZ_CP030074 (Streptomyces sp. ZFG47 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

gggtggcgcggtgacgtcgaaccgtcgcgag	CRISPR spacer
gaagagcgcggtgacgtcgaacggccgcggt	Protospacer
*.. .***************** *.****.

3. spacer 2.3|225425|31|NC_007511|CRISPRCasFinder matches to NZ_CP022193 (Yangia pacifica strain YSBP01 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.71

gggtggcgcggtgacgtcgaaccgtcgcgag	CRISPR spacer
ccaaggcgcggagacgtcgaaccggcgctcc	Protospacer
  . ******* ************ ***

4. spacer 2.3|225425|31|NC_007511|CRISPRCasFinder matches to NZ_CP043499 (Rhizobium grahamii strain BG7 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

gggtggcgcggtgacgtcgaaccgtcgcgag	CRISPR spacer
aaaggtgacggcgacgacgaaccgtcgcgag	Protospacer
... *  .***.**** **************

5. spacer 2.3|225425|31|NC_007511|CRISPRCasFinder matches to NZ_CP014311 (Burkholderia sp. PAMC 26561 plasmid unnamed4, complete sequence) position: , mismatch: 10, identity: 0.677

gggtggcgcggtgacgtcgaaccgtcgcgag	CRISPR spacer
attctcggcggtgacgtcgaccggtcgcgac	Protospacer
.  .   ************* * *******

6. spacer 1.1|3169|34|NC_007511|PILER-CR matches to NZ_CP030128 (Indioceanicola profundi strain SCSIO 08040 plasmid unnamed2, complete sequence) position: , mismatch: 11, identity: 0.676

gggaaatcagggttttcctgcccggaacccgctg	CRISPR spacer
cctgtttcagggttttccggcacggaacccgtaa	Protospacer
   .  ************ ** *********. .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1154712 : 1159250

Burkholderia_phage(50.0%)

integrase

attL 1145859:1145872|attR 1158863:1158876

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1145859:1145872	attL	NA	NA	NA	NA
WP_011354634.1\|1154712_1155363_+	GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	4.2e-42	47.6
WP_011354635.1\|1155584_1156859_+\|integrase	site-specific integrase	C7BGE7	Burkholderia_phage	2.1e-231	90.1
WP_081436663.1\|1156803_1157085_-	AlpA family phage regulatory protein	C7BGF0	Burkholderia_phage	1.9e-31	83.5
WP_011354636.1\|1157139_1157349_+	hypothetical protein	A9YWV5	Burkholderia_phage	7.7e-22	69.1
WP_157687258.1\|1157565_1157784_+	hypothetical protein	NA	NA	NA	NA
WP_157687260.1\|1157814_1158075_+	hypothetical protein	NA	NA	NA	NA
WP_011354637.1\|1158079_1158463_-	DUF4031 domain-containing protein	Q6V7P5	Burkholderia_virus	6.6e-35	63.6
WP_041493237.1\|1158866_1159250_-	hypothetical protein	A0A076G9B4	Mycobacterium_phage	1.5e-34	54.1
1158863:1158876	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NC_007510

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_007510_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_007510_1

864043-864269

Orphan

Consensus_repeat	Method
GCACTGGGCGGCATCGGCGGCGG	CRT

3 spacers

The CRISPR arrays of NC_007510_1

>merge|NC_007510|1|864043-864269|CRT
GCACTGGGCGGCATCGGCGGCGGTTCGAACCCGCTGGCGCCGGTCCAAGGCGTCGTGAACCAAGTGACGGGCGCACTGGGCAGCGGCAACCCGGCCGGCGCACTGACGGGCGCACTCGGCACGGTCACGGGTGCACTGGGTGGTATCGGCGGCGGCTCGAGCCCGCTGGCGCCGGTCCAAGGCGTCGTGAACCAGGTCACGGGCGCACTGGGCGGCATCGGCGGCGG

>NC_007510|1|1|864043-864269|CRT
GCACTGGGCGGCATCGGCGGCGG	TTCGAACCCGCTGGCGCCGGTCCAAGGCGTCGTGAACCAAGTGACGGGC
GCACTGGGCAGCGGCAACCCGGC	CGGCGCACTGACGGGCGCACTCGGCACGGTCACGGGT
GCACTGGGTGGTATCGGCGGCGG	CTCGAGCCCGCTGGCGCCGGTCCAAGGCGTCGTGAACCAGGTCACGGGC
GCACTGGGCGGCATCGGCGGCGG

Protein	Signature genes	Signature genes Name	Protein_function
NC_007510.1\|WP_011351114.1\|849250_851341_+\|D-(-)-3-hydroxybutyrate-oligomer-hydrolase	unknown	unknown	gnl\|CDD\|313759
NC_007510.1\|WP_041492752.1\|857764_858559_-\|PAS-domain-containing-protein	unknown	unknown	gnl\|CDD\|225512
NC_007510.1\|WP_041492753.1\|867745_868378_+\|DUF1571-domain-containing-protein	unknown	unknown	gnl\|CDD\|377879
NC_007510.1\|WP_041492751.1\|856826_857558_-\|DsbA-family-oxidoreductase	unknown	unknown	gnl\|CDD\|239322
NC_007510.1\|WP_011351115.1\|851953_853789_+\|peptidase-S1	unknown	unknown	gnl\|CDD\|225490
NC_007510.1\|WP_011351129.1\|868422_868938_+\|SRPBCC-family-protein	unknown	unknown	gnl\|CDD\|176866
NC_007510.1\|WP_011351131.1\|870071_871670_-\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224099
NC_007510.1\|WP_011351133.1\|872773_874084_-\|deferrochelatase/peroxidase-EfeB	unknown	unknown	gnl\|CDD\|273606
NC_007510.1\|WP_041493018.1\|867338_867749_+\|quinol-oxidase	unknown	unknown	gnl\|CDD\|259885
NC_007510.1\|WP_011351122.1\|860744_861989_+\|FAD-binding-oxidoreductase	unknown	unknown	gnl\|CDD\|223737
NC_007510.1\|WP_011351121.1\|859897_860677_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270421
NC_007510.1\|WP_011351126.1\|866482_867265_+\|anti-sigma-factor	unknown	unknown	gnl\|CDD\|227949
NC_007510.1\|WP_011351130.1\|868993_870043_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|226361
NC_007510.1\|WP_011351116.1\|854117_854906_-\|sulfite-exporter-TauE/SafE-family-protein	unknown	unknown	gnl\|CDD\|376667
NC_007510.1\|WP_011351113.1\|848748_849114_+\|BON-domain-containing-protein	unknown	unknown	gnl\|CDD\|335963
NC_007510.1\|WP_011351132.1\|871672_872707_-\|iron-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270261
NC_007510.1\|WP_011351124.1\|865583_865943_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226765
NC_007510.1\|WP_011351120.1\|858555_859518_-\|ornithine-cyclodeaminase-family-protein	unknown	unknown	gnl\|CDD\|225280
NC_007510.1\|WP_011351117.1\|855247_856687_-\|DHA2-family-efflux-MFS-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|129794
NC_007510.1\|WP_011351125.1\|865970_866486_+\|sigma-70-family-RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|237123

Protein	Function_ID	Function_description	E-value
NC_007510.1\|WP_011351114.1\|849250_851341_+\|D-(-)-3-hydroxybutyrate-oligomer-hydrolase	gnl\|CDD\|313759	pfam10605, 3HBOH, 3HB-oligomer hydrolase (3HBOH). D-(-)-3-hydroxybutyrate oligomer hydrolase (also known as 3HB-oligomer hydrolase) functions in the degradation of poly-3-hydroxybutyrate (PHB). It catalyzes the hydrolysis of D(-)-3-hydroxybutyrate oligomers (3HB-oligomers) into 3HB-monomers.	0
NC_007510.1\|WP_041492752.1\|857764_858559_-\|PAS-domain-containing-protein	gnl\|CDD\|225512	COG2964, COG2964, Uncharacterized protein conserved in bacteria [Function unknown].	6.27511e-71
NC_007510.1\|WP_041492753.1\|867745_868378_+\|DUF1571-domain-containing-protein	gnl\|CDD\|377879	pfam07608, DUF1571, Protein of unknown function (DUF1571). A family of paralogous proteins in Rhodopirellula baltica.	1.3331e-06
NC_007510.1\|WP_041492751.1\|856826_857558_-\|DsbA-family-oxidoreductase	gnl\|CDD\|239322	cd03024, DsbA_FrnE, DsbA family, FrnE subfamily; FrnE is a DsbA-like protein containing a CXXC motif. It is presumed to be a thiol oxidoreductase involved in polyketide biosynthesis, specifically in the production of the aromatic antibiotics frenolicin and nanaomycins.	1.78778e-81
NC_007510.1\|WP_011351115.1\|851953_853789_+\|peptidase-S1	gnl\|CDD\|225490	COG2939, COG2939, Carboxypeptidase C (cathepsin A) [Amino acid transport and metabolism].	7.37805e-126
NC_007510.1\|WP_011351129.1\|868422_868938_+\|SRPBCC-family-protein	gnl\|CDD\|176866	cd07824, SRPBCC_6, Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins. Uncharacterized group of the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily. SRPBCC domains have a deep hydrophobic ligand-binding pocket and they bind diverse ligands. SRPBCC domains include the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domains of mammalian STARD1-STARD15, the C-terminal catalytic domains of the alpha oxygenase subunit of Rieske-type non-heme iron aromatic ring-hydroxylating oxygenases (RHOs_alpha_C), Class I and II phosphatidylinositol transfer proteins (PITPs), Bet v 1 (the major pollen allergen of white birch, Betula verrucosa), CoxG, CalC, and related proteins. Other members of the superfamily include PYR/PYL/RCAR plant proteins, the aromatase/cyclase (ARO/CYC) domains of proteins such as Streptomyces glaucescens tetracenomycin, and the SRPBCC domains of Streptococcus mutans Smu.440 and related proteins.	2.77819e-69
NC_007510.1\|WP_011351131.1\|870071_871670_-\|iron-ABC-transporter-permease	gnl\|CDD\|224099	COG1178, ThiP, ABC-type Fe3+ transport system, permease component [Inorganic ion transport and metabolism].	6.1294e-89
NC_007510.1\|WP_011351133.1\|872773_874084_-\|deferrochelatase/peroxidase-EfeB	gnl\|CDD\|273606	TIGR01412, Probable_deferrochelatase/peroxidase_EfeN, Tat-translocated enzyme. This model represents a small family of proteins with a typical Tat (twin-arginine translocation) signal sequence, suggesting that the family is exported in a folded state, perhaps with a bound redox cofactor. Members of this family show homology to Dyp, a dye-decolorizing peroxidase from Geotrichum candidum that lacks any typical heme-binding site.	6.74454e-148
NC_007510.1\|WP_041493018.1\|867338_867749_+\|quinol-oxidase	gnl\|CDD\|259885	cd04223, N2OR_C, The C-terminal cupredoxin domain of Nitrous-oxide reductase. Nitrous-oxide reductase participates in nitrogen metabolism and catalyzes the last step in dissimilatory nitrate reduction, the two-electron reduction of N2O to N2. It contains copper ions as cofactors in the form of a binuclear CuA center at the site of electron entry and a tetranuclear CuZ centre at the active site. The C-terminus of Nitrous-oxide reductase is a cupredoxin domain.	8.15852e-05
NC_007510.1\|WP_011351122.1\|860744_861989_+\|FAD-binding-oxidoreductase	gnl\|CDD\|223737	COG0665, DadA, Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism].	3.14038e-48
NC_007510.1\|WP_011351121.1\|859897_860677_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|270421	cd13703, PBP2_HisJ_LAO, Substrate binding domain of ABC-type histidine- and lysine/arginine/ornithine transporters; the type 2 periplasmic-binding protein fold. This subgroup includes the periplasmic-binding proteins, HisJ and LAO, that serve as initial receptors in the ABC transport of histidine and lysine-arginine-ornithine amino acids. They are belong to the type 2 periplasmic-binding fold protein (PBP2) superfamily, whose members are involved in chemotaxis and uptake of nutrients and other small molecules from the extracellular space as a primary receptor. PBP2 typically comprises of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two receptor cytoplasmically-located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.50932e-116
NC_007510.1\|WP_011351126.1\|866482_867265_+\|anti-sigma-factor	gnl\|CDD\|227949	COG5662, COG5662, Predicted transmembrane transcriptional regulator (anti-sigma factor) [Transcription].	3.60782e-23
NC_007510.1\|WP_011351130.1\|868993_870043_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|226361	COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism].	5.6428e-116
NC_007510.1\|WP_011351116.1\|854117_854906_-\|sulfite-exporter-TauE/SafE-family-protein	gnl\|CDD\|376667	pfam01925, TauE, Sulfite exporter TauE/SafE. This is a family of integral membrane proteins where the alignment appears to contain two duplicated modules of three transmembrane helices. The proteins are involved in the transport of anions across the cytoplasmic membrane during taurine metabolism as an exporter of sulfoacetate. This family used to be known as DUF81.	1.833e-24
NC_007510.1\|WP_011351113.1\|848748_849114_+\|BON-domain-containing-protein	gnl\|CDD\|335963	pfam04972, BON, BON domain. This domain is found in a family of osmotic shock protection proteins. It is also found in some Secretins and a group of potential haemolysins. Its likely function is attachment to phospholipid membranes.	3.1318e-08
NC_007510.1\|WP_011351132.1\|871672_872707_-\|iron-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270261	cd13543, PBP2_Fbp, Substrate binding domain of ferric iron transporter, a member of the type 2 periplasmic binding fold superfamily. The periplasmic iron binding protein plays an essential role in the iron uptake pathway of Gram-negative pathogenic bacteria from the Pasteurellaceae and Neisseriaceae families and is critical for survival of these pathogens within the host. This periplasmic protein (Fbp) has high affinities for ferric iron and serves as the primary receptor for transport. After binding iron with high affinity, Fbp interacts with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. The ferric iron-binding proteins belong to the PBP2 superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. They have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	3.10382e-142
NC_007510.1\|WP_011351124.1\|865583_865943_+\|hypothetical-protein	gnl\|CDD\|226765	COG4315, COG4315, Uncharacterized protein conserved in bacteria [Function unknown].	8.04758e-39
NC_007510.1\|WP_011351120.1\|858555_859518_-\|ornithine-cyclodeaminase-family-protein	gnl\|CDD\|225280	COG2423, COG2423, Predicted ornithine cyclodeaminase, mu-crystallin homolog [Amino acid transport and metabolism].	1.43223e-62
NC_007510.1\|WP_011351117.1\|855247_856687_-\|DHA2-family-efflux-MFS-transporter-permease-subunit	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	1.49627e-65
NC_007510.1\|WP_011351125.1\|865970_866486_+\|sigma-70-family-RNA-polymerase-sigma-factor	gnl\|CDD\|237123	PRK12511, PRK12511, RNA polymerase sigma factor; Provisional.	3.02365e-39

>NC_007510.1|WP_011351122.1|860744_861989_+|FAD-binding-oxidoreductase
MDFDVIVLGAGIVGVSSALHLQDRGLRVALVDRRAPGEETSHGNAGLIERSSVVPYAFPRRLGTLLRYARNRSVDLYWDYRALPAYAGWLARFWRESSPQRLAAAARDLLPLVAASVVEHDALLARTDAQPLVHDGGWIEAFRSPALFDAETRAQQRVADAHGLRMTVLDARALRAREPGVSDAFCGAFHWQDPKTVSSPGGLTKAYARLFERDGGTFALGDARTLVQVDDGWQVGTEHGPISARSAVVALGPWSDHVFEPLGYRIPLRAKRGYHMHYRPTRAPLNVPVCDTEEGFVVAPMEGGRLRLTTGVEIALRGAPPTGVQLARAEPLARDAFGIGERLDPEPWLGMRPCTPDMRPVIGPAPRHRHLWFAFGHCHHGLTLGPATGRLLAEMMTGAPTYIDPHPYRPARFG
>NC_007510.1|WP_011351121.1|859897_860677_+|ABC-transporter-substrate-binding-protein
MNWKLSLCAAAALACAAVTAHAEQTTLRFGIEAAYPPFESKTPAGQLQGFDVDIGNAVCAKLNMKCVWVENSFDGLIPALQARKFDAINSAMNITSKRRQSIDFTPAIYVVPIVMIAKHGSPLRPDVASLRGKHVGVLQGSSQEDFLKAHWATAGVAVVSYQDQDQIYADLVAGRLDAAVQEAQTAQDGFLDKPAGRDYQIVGEPLKDPATLGEGTGFGMRKNDKALQAKIVGALDALKKDGTLSALSQKYFKRDIVSK
>NC_007510.1|WP_011351120.1|858555_859518_-|ornithine-cyclodeaminase-family-protein
MTQTAPTLPLTVDEAAVRAALPSLDVLGTLRSMFASLAATRAVQPPQTLTLFPDQAGDFITYLGALADAQVFGAKLSPYVVTGGKPIVTAWTALMSMRTGQPLMWCDAGLLTVERTAGTTALAVDCLAPRDARHLAIVGAGAVGLAHLRHTAGLRDWETIRVYSPALAGDAAQQAALAQLDPRARAAASVEACVRDADVVMLCTSSGTPVLGDGMLTRPALVTSISTNVARAHEIPPAWLPDMDVYCDYRHTTPASAGEMQIAAAEHGWDAARIAGDLPALVAGTCPAPSYTRHAFFRSIGLGLEDIAIAHALYTHLARA
>NC_007510.1|WP_041492752.1|857764_858559_-|PAS-domain-containing-protein
MSGARARGRYNGATAAAAARGRTGMPANGAPARRPDALPGPRPPEMANPMRKKQSPVKNLLLTRYAPIADGIAALFFPYAEVVIHDLHDQTVLYLANNLSKREVGDDSALEEIDHSARERVIGPYEKLNWDGRRMRCVSNVLFDDEGRPAGMMCINFNIAVFDEVRATLDLFIKGAGVVAQPDELFRDDWQERINTFLHGWLRERQVGLNGLTREHRRELVEALYAEGAFRGKSAANYVANVLGMGRATVYKHLKHLKETQGDA
>NC_007510.1|WP_041492751.1|856826_857558_-|DsbA-family-oxidoreductase
MTTAPAPTARPTLTVEIWSDLICPWCWIGKRRFDEALAAFAHADRVDVALRAYRLMPGQPVEPVEAMLAGKYRMSPAQVDQMLRQVTDAAASVGLRYDLPGTLVGDTLDGHRLVKLAEATGRAHALTERLYRAYFCEHGSLFDHAELTEFAVEAGLERSAVDAVLRSDLYRNEVEADAARAAQIGGRGVPLFVFGGRYAVSGAQPADAFAQALDQAWRDGIVELDGSDAAACGPDGCALPARS
>NC_007510.1|WP_011351117.1|855247_856687_-|DHA2-family-efflux-MFS-transporter-permease-subunit
MTHGIHGEKRWYALIVLCLGVLMIVLDSTIVNVALPSISTDLHFTETALVWVVNAYLLTFGGCLLLGGRLGDLYGQRRMFLAGLVVFTLASLACGLAQSQTMLIAARAVQGIGGAVVSAVALSLIMNLFTEPGERARAMGVYGFVCAGGGSIGVLLGGLLTSSLSWHWIFLVNLPIGIAVYAMCVALLPRLRAPAGTARLDVAGAITVTASLMLAVYGIVGGNEAGWLSTQTVSLIGAAVVLLALFIAIEARAAHPLMPLSLFASRNVALANVIAVLWAAAMFAWFFLSALYMQRVLGYGPLQVGLAFLPANLIMAVFSLGLSARIVMRFGIRGPIAAGLLIAACGLALFSRAPVDGGFVWHVLPGMTLLGIGAGVAFNPMLLAAMSDVDPADSGLASGIVNTAFMMGGALGLAVLASLAAARTDALAAANAAPLDALNGGYHAAFAFGAAFAAAAALIGLALRIRRQGAVEGVGPAMH
>NC_007510.1|WP_011351116.1|854117_854906_-|sulfite-exporter-TauE/SafE-family-protein
MSLPHIDLLYSLSGLFVGILVGLTGVGGGSLMTPILVLLFGVHPATAVGTDLLYAAATKATGTLVHGLKGSIDWRITGRLAAGSVPAAAVTLWWLHTHGMNSPGTARMIQLVLGVALLLTSLALIFRPQLTAFAARNPLAPSPARTLWSTVLTGAVLGVLVSMTSVGAGAIGVTVLLLLYPALATTRIVGSDIAHAVPLTLVAGMGHWLLGSVDWSMLLSLLLGSLPGIVLGSLLSARAPERLLRNLLAATLVAVGIRLVLA
>NC_007510.1|WP_011351115.1|851953_853789_+|peptidase-S1
MTTRKSLKDGFALFGTTLSVPLAAAAAAALLVTGCGGDDGSGPAASAAAAAATSAGASTSANTNATAAAADQPYVDNDVYGTGPNDAVTDSTEGAAVVHRTVTIGGKTIKYTATTGHLTTIDPTTSAPNAKMFYVAYTQDNPDPSKPRPVTFFYNGGPGSSSVYLLLGSYGPKRLQSSFPNFTPPAPYKLLDNPDSLLDRTDLVFINPVGTGYSTAIAPAKNKDFWGTDQDARSIDRFIQRYLTKYSRWNSPKFLYGESYGTARSAVVSWVLHEDGIDLNGITLQSSILDYANALSAPGTFPTLAADAFYWKKTTLNPTPTDLDAYMIQARNYADNTLAPLAQKPNPQDGGFVNVRLNLNLQTAQQMGSYIGTDPTSLIQTFGNPAALGNVPSSDDNPPYTFFLTLVPGTQIGQYDGRANFTGKGIAPYILPNSGSNDPSITNVGGAYTVLWNSYINTDLKYTSTSSFVDLNDQVFNNWDFSHTDPTGANKGGGNTLYTAGDLASTMSVNPDLKVLSANGYFDAVTPFHQTELTLAQMPLDPTLKAQNLTIKNYPSGHMIYLNDASRTALKGDLANFYDGILANRTALQRVLKLQMRTQQLKQQKLQQQGQ
>NC_007510.1|WP_011351114.1|849250_851341_+|D-(-)-3-hydroxybutyrate-oligomer-hydrolase
MTRLGWGRRMVFGAALAAVAILGACNGDESAERNRLPGFVSGSVRTTAYDGASDDLLTAGLGKTGLGSASAPGFANAARPTSAELRRLAIWSNYRALVDMSANGGYGRFWGPNVDLDGNDTLGEGKIPGTEYLAYSDDGSGSKNVTLLVQVPAGFNPAQPCIVTATSSGSRGVYGAISAAGEWALKRGCAVAYNDKGGGNGAHELMSDTITLIDGTLANAVLAGTSSLFTANVTSGDLATFNSRFPNRYAFKHAHSQQNPEQDWGHVTLQSVEFAYWALNEQFGPLIDGSRHGVRYRAGDIMTIAASVSNGGGASLAAAEQDTRGWITAVVVGEPQINVRMAPNVVVRSGGQPVPSFGRPLADYATLANLLEPCAAASASLAGAPYLSALPVATTQSIRTQRCATLAAAGLVSGADTQSQAADALAQLHAAGYLADSDLLQAPMWDSQAIPAIAVTYANAYTRSRVTDNLCNFSFATTNPATGAVAAPATSPMPAVFGVGNGVPPTAGIDLVFNTGAGVDHRLATPDASFAGALCLRQLWTNGMLGMPANVDAVRVNANLQGKPAIIVQGRSDSLVPVNHASRAYVAQNGISEAGRSQLVFYEVTNGQHFDAFLPVPGFDTRFVPVHYYNLQALNLMWKHLKNGAPLPPSQVIRTVPRGGTPGAAPALTSANLPPISAAPGANAITVGAGAIDVPL
>NC_007510.1|WP_011351113.1|848748_849114_+|BON-domain-containing-protein
MKSIVLRALGVAAVAACLSGSVYAQSSDAAATEAPAAATSAPKAAAKTAKKANRKLGYAVRKAISKESGENVSNLVVRSKGGAITLEGTMPAQDQIDKAEAAAKGVKGVTSVTNKLTVQQQ
>NC_007510.1|WP_011351124.1|865583_865943_+|hypothetical-protein
MKRILVAAALTVAIVRPAAAEPPRAGDGKLVDEAHMTLYVFDRDAPGTSACDRACAANWPPALADAYDKATGELSLVARDDGSKQWAYRGHPLYRWKQDRKPGDAGGDGIGGMWHVARP
>NC_007510.1|WP_011351125.1|865970_866486_+|sigma-70-family-RNA-polymerase-sigma-factor
MSYESDLLVWLPHLTRYARALTGDRAWADDLVQDTLERALNRPPRDCGNLRAWLLTLLRHRFIDQLRARHEIAVDDATAPWQTMAAPAGEIGGLVLRDVQRALYRLPVEQREVLLLVALEELSYRDAAEVLGVPVGTVMSRLARARGQMRALLSDEPSAHGTASLRVIGKT
>NC_007510.1|WP_011351126.1|866482_867265_+|anti-sigma-factor
MMDDPHKPSNERDDDASAQLLSALLDGELSGQERREVLERVLADPQEAERFAHYRAQRDALQALFPLPGAAPALFVQRRAPRRRAIAYAFAGLAAGLLIGVALHVGWVTFGSEPAFAARADVAYATYAADRDHPVEVGAGDPERLVAWLSARVGRPVRAPSLDEYGYVLIGGRLLPGEAGPAAQLMYQRADGARVTLYMTAYDARRLAPQAMSAGDRYTYFWSDRGMGYALSGQGDERRLRELAIDACGDLGGPTDAWKG
>NC_007510.1|WP_041493018.1|867338_867749_+|quinol-oxidase
MLVLVLVLVALIAGSALARADGDAPVRVPVDADGVQRVAIVGGSYFFRPNHVIVRAHVPVELTVSAEPGLVPHSFEIDAPQAGIAVHTELATTPKTFRFTPAQPGRFAYYCTHRLLFFRSHRERGMEGVLDVEAAP
>NC_007510.1|WP_041492753.1|867745_868378_+|DUF1571-domain-containing-protein
MIAALLAASLIGASMTADPVTVAQAHFDHVRSYRATIRSSARSGEHTEIRYAYLKPGFVRMDFVSPHHGAVLAYDPGDGKVRLRPFGAHAPPALTLSPSNPLVRDRSGHRVDRSDVGELLRNVHALQEGGATVTEGEEAVGGRTALRVSVTGAPAHVVDGVHRYRLWLDTEDGFPLKVVSFADDDDVPLETVTLDDVEIDVAFPERFFAP
>NC_007510.1|WP_011351129.1|868422_868938_+|SRPBCC-family-protein
MAEYRFSTTWRVDAPLAVVWDAIYQVDRWPDWWKGAVSTVEIEPGDARGVGALHRYTWKGALPYRLTFDMRVRRVEPPHALEGRASGAIEGDGCWSFIADGARTIVRYDWHIRTHVRWMNRLEPLGRPLFRWNHDVVMREGAKGLARLLGAAVETEGRTFRPLSDAGCADA
>NC_007510.1|WP_011351130.1|868993_870043_-|ABC-transporter-ATP-binding-protein
MSELRIHGLSKSFGSHTVLHDIDLTVRRGSRLALLGPSGSGKTTLLRVLCGFERAERGTVEIDGRRVAAPDVHLPPEQRRIGYVPQEGALFPHLSVADNIAFGLPRAARRRHHRVDELLEMVGLPASYASRAPQQLSGGQQQRVALARALAPEPSLVILDEPFSALDTSLRHETRSAVADALAAAGATSVLVTHDQPEAMTLGDEVAVMWHGRLVQTAAPQMLYRQPVTRDVASFVGQAVLLAGHVRSMRIACALGELPLVAPLPDGPADAMLRPEQIGIVPVTHADAARGHTARVEAAQFAGQDADVLVRLDADGDVLVRARVPGHRCPAVGERVALVVDGAVMAYAR
>NC_007510.1|WP_011351131.1|870071_871670_-|iron-ABC-transporter-permease
MSDAVSPTASTARDGEHTATRRRPSRALVAAAACGPLAILLPLGFTLYRAATFGVDDAIELLWRPLVGELLVNTLSITLAATLACTLLGTALAWFIERTDLPARPLWTALAAAPLAVPPFITSYAWVSLSLDLQDFLGALIVLTSAYFPLVYLPVAAALRELDPALEESARTLGCSPWHTFFRVVLPQLRPALCGGMLLVALGVLSEFGAFQLLRFRTFTTEIYAEYRTAFDGGGASLLGCVLIALCLLCLAIEARARGHARYGHTHRAARRVAMRYPLGYLRGPVTVAFAALAAATLGVPLAMIGYWLTQQGAAAVTPADVSPELLWQATLASSGYGLMAAAVTTLLALPLAFLLVRYPGRVATLLERTAMTVQGVPGIVVALAIVSITVRLLQPLYQSAPALVGAYAILFLPLAVVSVRAALSHVQVRLEETARSLGLGWRATLTRVVLPLAAPGLGAAATMVFISVVTELNATLLLSPIGTRTLATQVWSDTATLAFAAAAPYVALLVALSLGASGLLFLLLGRASVRD
>NC_007510.1|WP_011351132.1|871672_872707_-|iron-ABC-transporter-substrate-binding-protein
MNTSPVSRPLRHLISAAAAALMLTGALHAARAHAATLTLYNAQHEQVVNQLVKDFEAQSGITVKVRSGEGPALAAQLVAEGDRTPADVYFTENSPELVLLDRKGLFAKTDAATLQSVPARFNPADGNWVGVLARENVLVYNTAKIQPQQLPASLLDLAKPEWKGKVGVAPSDADFLPLVSAVLALHGEAATLQWLKGLKANAQIFDDDEGVTAAVNRGGVLTGIINNYYWDRLHAELGDKSTRSAIYHFGKGDVGGAVNVSGAAVLKASKHQPEAQKFVAYLVSERAQKLMAGGHISFEYPLHPGVAPDPILKPFNELSPPALTFEQLGDDSQAGKLLRQAGLL
>NC_007510.1|WP_011351133.1|872773_874084_-|deferrochelatase/peroxidase-EfeB
MADDSNQPPRPTRRGFLKAGGAAVAAGLAAASIPAAKAADAPAAAPAPAPASAHDGVEPFYGKHQSGIATPQQRHAYFAALDLTTAQRADVIALLKTWTDAAARMARGDTALPLATTGNDEVAPADGGDALGLGPARLTITFGFGPGMFALAGKDRFGLAKHRPAALVDLPRFNGDQLLPEKTGGDLFIQACADDAQVAFHAVRQLVRLGAKATQMRWGQAGFTSGKPGETPRNLMGFKDGTMNPPMSDPAAMDEFVWAGSEGPAWMNGGTYTVVRRIRITLEHWDNTELGFQEQVVGRHKYSGAPLGQKHEFEALDLDAADKDGNPVIPDNAHARLASPQLNNGAQILRRAYSYNDSTSFYIERWPPWRQQTEYDAGLMFVAHQRDPRKGFIPINEKLAKMDIMNQFTTHVGSAIFACPPGAQPGSYIGAALFEA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_007510_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_007510_2

3000899-3000971

Orphan

Consensus_repeat	Method
GGCATGGGACCTCCCTAAGCGCT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_007510_2

>merge|NC_007510|2|3000899-3000971|CRISPRCasFinder
GGCATGGGACCTCCCTAAGCGCTAAAGCGCCAAGGGCGGTCGACCGCCTTGGCATGGGACCGCCCTAAGCGCT

>NC_007510|2|1|3000899-3000971|CRISPRCasFinder
GGCATGGGACCTCCCTAAGCGCT	AAAGCGCCAAGGGCGGTCGACCGCCTT
GGCATGGGACCGCCCTAAGCGCT

Protein	Signature genes	Signature genes Name	Protein_function
NC_007510.1\|WP_011352984.1\|2992935_2993643_+\|Crp/Fnr-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223736
NC_007510.1\|WP_011352992.1\|3001827_3002670_-\|SirB1-family-protein	unknown	unknown	gnl\|CDD\|225464
NC_007510.1\|WP_011352988.1\|2997688_2998717_+\|tetraacyldisaccharide-4'-kinase	unknown	unknown	gnl\|CDD\|179349
NC_007510.1\|WP_011352998.1\|3007900_3008386_+\|YajQ-family-cyclic-di-GMP-binding-protein	unknown	unknown	gnl\|CDD\|180061
NC_007510.1\|WP_011352985.1\|2993729_2994941_+\|chromate-efflux-transporter	unknown	unknown	gnl\|CDD\|273350
NC_007510.1\|WP_011352994.1\|3004533_3004806_+\|30S-ribosomal-protein-S20	unknown	unknown	gnl\|CDD\|178943
NC_007510.1\|WP_011352991.1\|3001005_3001764_+\|SDR-family-NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|187629
NC_007510.1\|WP_011352982.1\|2991290_2992337_-\|2-dehydropantoate-2-reductase	unknown	unknown	gnl\|CDD\|236193
NC_007510.1\|WP_011352990.1\|2999997_3000660_+\|adenylate-kinase	unknown	unknown	gnl\|CDD\|234711
NC_007510.1\|WP_011352993.1\|3002678_3004229_-\|murein-biosynthesis-integral-membrane-protein-MurJ	unknown	unknown	gnl\|CDD\|223800
NC_007510.1\|WP_011352987.1\|2995855_2997238_-\|exodeoxyribonuclease-VII-large-subunit	unknown	unknown	gnl\|CDD\|234714
NC_007510.1\|WP_011352986.1\|2995049_2995628_-\|superoxide-dismutase	unknown	unknown	gnl\|CDD\|182534
NC_007510.1\|WP_011352999.1\|3008466_3009105_-\|glycerol-3-phosphate-1-O-acyltransferase-PlsY	unknown	unknown	gnl\|CDD\|234691
NC_007510.1\|WP_011353000.1\|3009213_3009705_-\|Cys-tRNA(Pro)-deacylase	unknown	unknown	gnl\|CDD\|237976
NC_007510.1\|WP_011352995.1\|3004959_3005280_-\|DUF3579-domain-containing-protein	unknown	unknown	gnl\|CDD\|371904
NC_007510.1\|WP_010090898.1\|2998697_2998892_+\|Trm112-family-protein	unknown	unknown	gnl\|CDD\|225391
NC_007510.1\|WP_011352997.1\|3006713_3007763_-\|UDP-N-acetylmuramate-dehydrogenase	unknown	unknown	gnl\|CDD\|234593
NC_007510.1\|WP_011352989.1\|2999003_2999789_+\|3-deoxy-manno-octulosonate-cytidylyltransferase	unknown	unknown	gnl\|CDD\|235473
NC_007510.1\|WP_011352983.1\|2992329_2992854_-\|DUF962-domain-containing-protein	unknown	unknown	gnl\|CDD\|226914
NC_007510.1\|WP_011352996.1\|3005693_3006623_+\|ornithine-carbamoyltransferase	unknown	unknown	gnl\|CDD\|234835

Protein	Function_ID	Function_description	E-value
NC_007510.1\|WP_011352984.1\|2992935_2993643_+\|Crp/Fnr-family-transcriptional-regulator	gnl\|CDD\|223736	COG0664, Crp, cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms].	8.07804e-42
NC_007510.1\|WP_011352992.1\|3001827_3002670_-\|SirB1-family-protein	gnl\|CDD\|225464	COG2912, COG2912, Uncharacterized conserved protein [Function unknown].	3.3143e-72
NC_007510.1\|WP_011352988.1\|2997688_2998717_+\|tetraacyldisaccharide-4'-kinase	gnl\|CDD\|179349	PRK01906, PRK01906, tetraacyldisaccharide 4'-kinase; Provisional.	0
NC_007510.1\|WP_011352998.1\|3007900_3008386_+\|YajQ-family-cyclic-di-GMP-binding-protein	gnl\|CDD\|180061	PRK05412, PRK05412, putative nucleotide-binding protein; Reviewed.	6.59201e-87
NC_007510.1\|WP_011352985.1\|2993729_2994941_+\|chromate-efflux-transporter	gnl\|CDD\|273350	TIGR00937, Chromate_transport_protein, chromate transporter, chromate ion transporter (CHR) family. Members of this family probably act as chromate transporters, and are found in Pseudomonas aeruginosa, Alcaligenes eutrophus, Vibrio cholerae, Bacillus subtilis, Ochrobactrum tritici, cyanobacteria and archaea. The protein reduces chromate accumulation and is essential for chromate resistance. [Transport and binding proteins, Anions].	3.4642e-81
NC_007510.1\|WP_011352994.1\|3004533_3004806_+\|30S-ribosomal-protein-S20	gnl\|CDD\|178943	PRK00239, rpsT, 30S ribosomal protein S20; Reviewed.	1.33252e-18
NC_007510.1\|WP_011352991.1\|3001005_3001764_+\|SDR-family-NAD(P)-dependent-oxidoreductase	gnl\|CDD\|187629	cd05371, HSD10-like_SDR_c, 17hydroxysteroid dehydrogenase type 10 (HSD10)-like, classical (c) SDRs. HSD10, also known as amyloid-peptide-binding alcohol dehydrogenase (ABAD), was previously identified as a L-3-hydroxyacyl-CoA dehydrogenase, HADH2. In fatty acid metabolism, HADH2 catalyzes the third step of beta-oxidation, the conversion of a hydroxyl to a keto group in the NAD-dependent oxidation of L-3-hydroxyacyl CoA. In addition to alcohol dehydrogenase and HADH2 activites, HSD10 has steroid dehydrogenase activity. Although the mechanism is unclear, HSD10 is implicated in the formation of amyloid beta-petide in the brain (which is linked to the development of Alzheimer's disease). Although HSD10 is normally concentrated in the mitochondria, in the presence of amyloid beta-peptide it translocates into the plasma membrane, where it's action may generate cytotoxic aldehydes and may lower estrogen levels through its use of 17-beta-estradiol as a substrate. HSD10 is a member of the SRD family, but differs from other SDRs by the presence of two insertions of unknown function. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	4.29056e-126
NC_007510.1\|WP_011352982.1\|2991290_2992337_-\|2-dehydropantoate-2-reductase	gnl\|CDD\|236193	PRK08229, PRK08229, 2-dehydropantoate 2-reductase; Provisional.	0
NC_007510.1\|WP_011352990.1\|2999997_3000660_+\|adenylate-kinase	gnl\|CDD\|234711	PRK00279, adk, adenylate kinase; Reviewed.	1.51631e-138
NC_007510.1\|WP_011352993.1\|3002678_3004229_-\|murein-biosynthesis-integral-membrane-protein-MurJ	gnl\|CDD\|223800	COG0728, MviN, Uncharacterized membrane protein, putative virulence factor [General function prediction only].	1.50778e-148
NC_007510.1\|WP_011352987.1\|2995855_2997238_-\|exodeoxyribonuclease-VII-large-subunit	gnl\|CDD\|234714	PRK00286, xseA, exodeoxyribonuclease VII large subunit; Reviewed.	0
NC_007510.1\|WP_011352986.1\|2995049_2995628_-\|superoxide-dismutase	gnl\|CDD\|182534	PRK10543, PRK10543, superoxide dismutase [Fe].	7.07483e-106
NC_007510.1\|WP_011352999.1\|3008466_3009105_-\|glycerol-3-phosphate-1-O-acyltransferase-PlsY	gnl\|CDD\|234691	PRK00220, PRK00220, glycerol-3-phosphate 1-O-acyltransferase PlsY.	7.40778e-92
NC_007510.1\|WP_011353000.1\|3009213_3009705_-\|Cys-tRNA(Pro)-deacylase	gnl\|CDD\|237976	cd00002, YbaK_deacylase, This CD includes cysteinyl-tRNA(Pro) deacylases from Haemophilus influenzae and Escherichia coli and other related bacterial proteins. These trans-acting, single-domain proteins are homologs of ProX and also the cis-acting prolyl-tRNA synthetase (ProRS) inserted (INS) editing domain. The bacterial amino acid trans-editing enzyme YbaK is a deacylase that hydrolyzes cysteinyl-tRNA(Pro)'s mischarged by prolyl-tRNA synthetase. YbaK also hydrolyzes glycyl-tRNA's, alanyl-tRNA's, seryl-tRNA's, and prolyl-tRNA's. YbaK is homologous to the INS domain of prolyl-tRNA synthetase (ProRS) as well as the trans-editing enzyme ProX of Aeropyrum pernix which hydrolyzes alanyl-tRNA's and glycyl-tRNA's.	4.39049e-62
NC_007510.1\|WP_011352995.1\|3004959_3005280_-\|DUF3579-domain-containing-protein	gnl\|CDD\|371904	pfam12112, DUF3579, Protein of unknown function (DUF3579). This family of proteins is functionally uncharacterized. This protein is found in bacteria. Proteins in this family are typically between 98 to 126 amino acids in length. This protein has a conserved FRP sequence motif.	1.74433e-54
NC_007510.1\|WP_010090898.1\|2998697_2998892_+\|Trm112-family-protein	gnl\|CDD\|225391	COG2835, COG2835, Uncharacterized conserved protein [Function unknown].	1.8632e-25
NC_007510.1\|WP_011352997.1\|3006713_3007763_-\|UDP-N-acetylmuramate-dehydrogenase	gnl\|CDD\|234593	PRK00046, murB, UDP-N-acetylmuramate dehydrogenase.	0
NC_007510.1\|WP_011352989.1\|2999003_2999789_+\|3-deoxy-manno-octulosonate-cytidylyltransferase	gnl\|CDD\|235473	PRK05450, PRK05450, 3-deoxy-manno-octulosonate cytidylyltransferase; Provisional.	1.55463e-141
NC_007510.1\|WP_011352983.1\|2992329_2992854_-\|DUF962-domain-containing-protein	gnl\|CDD\|226914	COG4539, COG4539, Predicted membrane protein [Function unknown].	2.25624e-60
NC_007510.1\|WP_011352996.1\|3005693_3006623_+\|ornithine-carbamoyltransferase	gnl\|CDD\|234835	PRK00779, PRK00779, ornithine carbamoyltransferase; Provisional.	0

>NC_007510.1|WP_011352990.1|2999997_3000660_+|adenylate-kinase
MRLILLGAPGAGKGTQANFIKEKFGIPQISTGDMLRAAVKAGTPLGVEAKGYMDAGKLVPDALIIGLVKERLKESDCANGYLFDGFPRTIAQADAMKEAGVAIDYVLEIDVPFSEIIERMSGRRTHPASGRTYHVKFNPPKVEGHDDVTGEPLIQRDDDKEETVKKRLEVYEAQTKPLITYYGDWAQRGEENGLKAPQYRKISGLGSVEEIRERAFGALK
>NC_007510.1|WP_011352989.1|2999003_2999789_+|3-deoxy-manno-octulosonate-cytidylyltransferase
MTQPFIAVIPARLASTRLPNKPLADLGGKPMVVRVAERAREAGAQQVLVASDAQSVLDAARDHGFEAVLTRADHPSGTDRLAEVAATLGWSDDTVVVNVQGDEPLIDPVLVRDVASHLAAHPACAIATAAHPIHDAADVFNPNVVKVALDAQSVALYFSRAPIPWSRDAYQPHWPDVAAMPAPAFPVYRHIGLYAYRARFLRTYPTLAQAPIEQAEQLEQLRALWHGERIAVLITESAPEAGIDTPADLARVQALFQPSSK
>NC_007510.1|WP_010090898.1|2998697_2998892_+|Trm112-family-protein
MDARLLEILVCPICKGPLHYDRAAQELICNADKLAYPIRDGIPVMLVDEARQTVEGTPVDPAGR
>NC_007510.1|WP_011352988.1|2997688_2998717_+|tetraacyldisaccharide-4'-kinase
MSAPDGPLARLEARLTREWQRRGALAWALTPFACVFGLCAALRRTAYAQGWKKPVDVGVPVVVVGNVTVGGTGKTPTVIALVDALRAAGFTPGIVSRGYGANVKAPTAVTTASRASAGGDEPLLIARRTGAPVWVCPDRVAAAQALRAAHPDVDVIVSDDGLQHYRLARTVELVVFDHRLGGNGFLLPAGPLREPLSRHRDATLVNDPYSGALPPWPDTYSLALTPGAAWHLDQPALRRPLSQFANERVLAAAGIGAPERFFATLRSAGLAPATRALPDHYAFADNPFVDDAVDAILITEKDAVKLGASWRDARLWVVPVEAALDPRLIALVVEKLRGRSPA
>NC_007510.1|WP_011352987.1|2995855_2997238_-|exodeoxyribonuclease-VII-large-subunit
MPSDSPFAAPGATRGGDEVIPVSALNRAISTMLERSFPLLWISGEVSNFTRAASGHWYFSIKDQQAQMRCVMFRGRAQYAEFTPREGDRIEVRAVVTMYEPRGEVQLNVEAVRRTGQGRLYEAFLRLKAQLESEGLFAPERKRPLPAHPRAIGIVTSLQAAALRDVLTTLARRAPHIPVIVYPAPVQGAGSADKLVTAVETANARREVDVLLVCRGGGSIEDLWSFNDEALARAIAASELPVVSGVGHETDFTIADFAADLRAPTPTGAAELASPQRALLLREVGERQRALARGMERRLEQRAQQLDWLARRLVSPAERLQRQRTHVEQLAVRLASAASRPVRDARARFALAQLRWQRARPDPSQARQALAGLSQRLALALQRRHERDTARVSACAARLEVLSPQRTLERGYAALIDAQTGRAVRTPNALKPQRRLTVHLAEGSADVSLADVQPRLSDTI
>NC_007510.1|WP_011352986.1|2995049_2995628_-|superoxide-dismutase
MAHTLPPLPYAEDALAPTISLETIQYHYGKHHQAYVTNLNNLIPGTEFENLSLEEIVKKSSGGIFNNAAQIWNHTFFWNSLSPNGGGAPTGALGDAINAKWGSYDAFKEAFTKAAVGTFGSGWAWLVKKADGSLDIVSTSNAATPLTTADKALLTIDVWEHAYYIDYRNARPKFVEAFWNIVNWDFAAKNFA
>NC_007510.1|WP_011352985.1|2993729_2994941_+|chromate-efflux-transporter
MSTSTASAPSRHPWPVFVAFLRLGLTSFGGPVAHLGYFRTEFVTRRGWLTERAYADLVGLCQFLPGPASSQVGMAIGLARAGYAGMFAAWLGFTLPSALLMMLFALGVHATGAPIEAGALHGLRIVSVAVIAQAVWGMARTLCPDARRATLMAAAACVALLAPAAWTQVAVIVAAGLAGLVLLPQPARGAHDPLPLHVSPRAGMLWLALFAALLVVLPFAARALRSDTLAVVDAFFRTGALVFGGGHVVLPLLQAAVVAPGWVGDAAFLAGYGVTQAVPGPLFTFSAFLGASLRNAPNGWLGGTIALVSIFAPSFLLVAGTAPFWERLRRSTRMQAALAGVNAAVVGLLVAALYHPVWTDTIVAPRDLAAALVAFVALVFWRVPPWAVVIASAALGWGLGVAA
>NC_007510.1|WP_011352984.1|2992935_2993643_+|Crp/Fnr-family-transcriptional-regulator
MPSSLAPYLPQIEANPWFAALPPALRADLLARAALRRLPAGHALFRRGDPPCGLYAVLAGSLTIGAVDPQGKEALLTVAEPVTWFGEIALFDGQPRTHDAIALDDALLLHVPQAALLAILDATPQYWRQFALLMAQKLRLSFLTVESMSVMPAAQRLAARLLMIADGYGGISAGRTHIRLSQEKLAAMLSLTRQTTNQLLKALQADGVVRLHVGEIELVDVDALRRASGLPDSLR
>NC_007510.1|WP_011352983.1|2992329_2992854_-|DUF962-domain-containing-protein
MKTLEDHLAQYAAYHRDARNIATHLVGIPMIVFAVEVLLSRPALGMTAGVALSPALLLAVVFALFYLRLDLRFGIVMTVLFALSLWAAQALALLPTAQWLAIGIGAFVVGWIVQFVGHWFEGRKPAFVDDLVGLMVGPLFVVAEVAFFAGLRADVRREVERRAGPVHGGAHSHV
>NC_007510.1|WP_011352982.1|2991290_2992337_-|2-dehydropantoate-2-reductase
MSDAPVCVFGAGAVGCYLGGRLAAAGANVTLVGRARIGDAIHRHGLTLTDQRGYRATLAPADVVFETDPAAAAAARLVLVAVKSAATREAAAQLAGVLRPGTVVISFQNGLHNADVLREVLPQATVLAGMVPFNVIEREPGAFHQGSAGALAAEASPTLQPFAGAFARAGLPLALHRDMPAVQWAKLLLNLNNAVNALANLPLRDELAQRAYRRCVALAQREALHWLARAAIRPARLTPLPAGWIPAVLDLPDPAFRVLGGRMLAIDPLARSSMSDDLAAGRATEVEWINGEVVRLAARFGGQAPVNARLCALVHDAERAAARPAWRGEALWAELTAQVPRAGDVRAA
>NC_007510.1|WP_011352991.1|3001005_3001764_+|SDR-family-NAD(P)-dependent-oxidoreductase
MEIRGNVFLITGGASGLGAGTARMLAQAGGTVVLADLNDAAGTALAAELGGIFVHCDVSSEADAQAAVNAATRAGTLRGLVNCAGIAPAAKTVGKDGAHPLDVFAKTINVNLVGTFNMIRLAAAAMAATAPTADGERGVIVSTASVAAFDGQIGQAAYAASKAGVAGMTLPIARDLSRSGIRVMTIAPGLFETPMLLGMPQDVQDALGAMVPFPPRLGKPAEYALLVRQIVENPMLNGEVIRLDGAIRMQPK
>NC_007510.1|WP_011352992.1|3001827_3002670_-|SirB1-family-protein
MTRVLDYFSTLVADDDSLPVTEAALSLAQDAYPDLDLQGTLAELDMLAARLRRRFTDDADLKGRVAALNDFFFRELGFACNHNDYYDPDNSHLNAVLKRRRGIPISLSVLYLELAEQIGVPARGVSFPGHFLLRVTLPDGDLIIDPANGHSLSEAEMVEMLEPYVARAAGAVDSALRALLQPATSREIIARMLRNLKTIYLQTERWQRLLAVQQRLVILLPEHLDEVRDRGFAYARLDYLRPALEDLEQYLGERPEADDATVVESQVIELRQRMQRDGED
>NC_007510.1|WP_011352993.1|3002678_3004229_-|murein-biosynthesis-integral-membrane-protein-MurJ
MNLFRALLTVSGFTLLSRVTGLARETLIARAFGASQYTDAFYVAFRIPNLLRRLSAEGAFSQAFVPILAEFKNQQGHDATKALVDAMSTVLAWALAVLSVFGIVGASWVVFAVASGLHTDGQAFPLAVTMTRIMFPYIVFISLTTLASGVLNTYKSFSLPAFAPVLLNVAFIAAAVFVAPHLKVPVFALAWAVIVGGVLQFLVQLPGLKKIDMVPLIGLNPLRALRHPGVKRVLAKMVPATFAVSVAQLSLIINTNIASRLGQGAVSWINYADRLMEFPTALLGVALGTILLPSLSKAHVDADSHEYSALLDWGLRVTFLLAAPSALALFFFATPLTATLFNYGKFDAHTVTMVARALATYGIGLVGIILIKILAPGFYAKQDIKTPVKIAIGVLIVTQISNYVFVPLIGHAGLTLSIGVGACLNSLLLFIGLRKRGIYQPSPGWLRFFVQLIGAALVLAGLMHWLSISFDWTGMRAQPLDRIALMAACLVVFAALYFGMLWVMGFKYAYFRRRAK
>NC_007510.1|WP_011352994.1|3004533_3004806_+|30S-ribosomal-protein-S20
MANSAQARKRARQAAKANSHNSALRSKFRTAIKAVRKAVDAGDQAKAADLFKAAVKTIDTIADKKIVHKNKAARSKSRLAAAVKGLQAAA
>NC_007510.1|WP_011352995.1|3004959_3005280_-|DUF3579-domain-containing-protein
MAETPPTEFFIQGITKDGKKFRPSDWSERLAGVMACFGPGASGRNARLQYSLYVRPTMLGDLKCVILDSRLRDVEPMAFDFVLNFAKDNNLVVTEACELPDYGEKK
>NC_007510.1|WP_011352996.1|3005693_3006623_+|ornithine-carbamoyltransferase
MTAKTIRHYLQFTDFSLEDYEYVLERTGILKRKFKNYETYHPLHDRTLAMIFEKSSTRTRLSFEAGIFQLGGHAVFMSTRDTQLGRGEPVEDSAQVISRMVDIIMIRTFEQEVIKRFADNSRVPVINGLTNEYHPCQVLADIFTYYEHRGPIAGKTVAWVGDANNMLYTWIEAAQILGFKLRLSTPPGYALDMKLVSPDSAPFYEVFEDPNEACKGADLVTTDVWTSMGFEAENEARMQAFADWCVDEEMMGHANPDALFMHCLPAHRGEEVTAGVIDGPQSVVWDEAENRLHVQKALMEFLLLGRLKH
>NC_007510.1|WP_011352997.1|3006713_3007763_-|UDP-N-acetylmuramate-dehydrogenase
MPMPLDDSTLSLLPDHPLAAHNTFGIAATARFAARITHASQFEALHRDPRVAHLPQLVLGGGSNVVFTRDFDGVVLLDEIAGRRVVREDDDAWYVEAGGGENWHAFVAWTLEHGMAGLENLALIPGTVGAAPIQNIGAYGLEMKAYFDSLVAVELATGCSERFDAARCAFGYRDSFFKREGRGRFAIVSVTFRLPKQWVPRLGYADVTRELDARGIAPDAATARDVFDAVVAIRRAKLPDPLVLGNAGSFFKNPVIDAAQFDALRARAPEVVSYPQPDGQVKLAAGWLIDRCGWKGRALGAAAVHDRQALVLVNRGGATGADVLALARAIQADVQTQFGVELEAEPVCL
>NC_007510.1|WP_011352998.1|3007900_3008386_+|YajQ-family-cyclic-di-GMP-binding-protein
MPSFDVVSEANMIEVKNAIEQSNKEISTRFDFKGSDARVEQKERELTLFADDDFKLGQVKDVLIGKLAKRNVDVRFLDYGKVEKIGGDKLKQIVTVKKGVTGDLAKKIVRLVKDSKIKVQASIQGDAVRVNGTKRDDLQSVIAMLRKDVTDTPLDFNNFRD
>NC_007510.1|WP_011352999.1|3008466_3009105_-|glycerol-3-phosphate-1-O-acyltransferase-PlsY
MQILLAALVAYLIGSVSFAVVVSGAMGLADPRSYGSKNPGATNVLRSGNKKAAILTLVGDAFKGWIAVWLARHLGLPDVAVAWVAIAVFLGHLYPVFFRFQGGKGVATAAGVLLAVHPVLGLATALTWLIVAFFFRYSSLAALVAAVFAPVFDVFLFGTGHNPVAWAVLAMSVLLVWRHRGNISKLLAGQESRIGDKKKAAADGGAQDGGKA
>NC_007510.1|WP_011353000.1|3009213_3009705_-|Cys-tRNA(Pro)-deacylase
MSKSRHVSETPATQLLRRHGVAFGEHPYDYVEHGGTGESARQLGVDEHSVVKTLVMEDEHAKPLIVLMHGDRTVSTKNLARQIGAKRVEPCKPEVANRHSGYLVGGTSPFGTRKAMPVYVEATILELPTIYLNGGRRGYLVSLAPAVLTSLLGAQPVQCASVD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NC_007510_1	1.1\|864066\|49\|NC_007510\|CRT	864066-864114	49	NC_007510.1	863934-863982	0	1.0

1. spacer 1.1|864066|49|NC_007510|CRT matches to position: 863934-863982, mismatch: 0, identity: 1.0

ttcgaacccgctggcgccggtccaaggcgtcgtgaaccaagtgacgggc	CRISPR spacer
ttcgaacccgctggcgccggtccaaggcgtcgtgaaccaagtgacgggc	Protospacer
*************************************************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_007510_2	2.1\|3000922\|27\|NC_007510\|CRISPRCasFinder	3000922-3000948	27	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	993183-993209	5	0.815

1. spacer 2.1|3000922|27|NC_007510|CRISPRCasFinder matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 5, identity: 0.815

aaagcgccaagggcggtcgaccgcctt	CRISPR spacer
ggagcgccatgggcggtcgatcgccat	Protospacer
..******* **********.**** *

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

744669 : 753761

Hokovirus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011351024.1\|744669_746622_+	molecular chaperone DnaK	A0A1V0SH73	Hokovirus	2.0e-148	49.6
WP_011351025.1\|746890_748027_+	molecular chaperone DnaJ	E3T4P7	Cafeteria_roenbergensis_virus	1.6e-23	39.1
WP_011351026.1\|748040_749975_+	aminodeoxychorismate synthase component I	S4VNU7	Pandoravirus	8.4e-54	36.1
WP_011351027.1\|750100_750916_-	3-methyl-2-oxobutanoate hydroxymethyltransferase	A0A0N7HVJ8	Ostreococcus_lucimarinus_virus	2.6e-36	32.5
WP_011351028.1\|750961_751648_-	deoxynucleoside kinase	A0A0M3UL55	Enterococcus_phage	3.6e-07	25.9
WP_011351029.1\|751644_752187_-	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
WP_011351030.1\|752222_753761_-	polynucleotide adenylyltransferase PcnB	H7BUW3	unidentified_phage	8.0e-23	31.0

DBSCAN-SWA_2

1099634 : 1107922

Bacillus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011351338.1\|1099634_1101035_+	UDP-glucose/GDP-mannose dehydrogenase family protein	A0A127AXI2	Bacillus_phage	3.0e-77	38.1
WP_011351339.1\|1101042_1101993_+	D-glycero-beta-D-manno-heptose-7-phosphate kinase	A0A2H4N7X4	Lake_Baikal_phage	3.4e-16	27.4
WP_011351340.1\|1102056_1103049_+	ADP-glyceromanno-heptose 6-epimerase	R9S880	Prochlorococcus_phage	4.1e-28	31.2
WP_011351341.1\|1103122_1103464_+	helix-hairpin-helix domain-containing protein	NA	NA	NA	NA
WP_011351342.1\|1103676_1104579_+	cysteine synthase CysM	A0A1X9I5F1	Streptococcus_phage	1.5e-53	40.5
WP_081436585.1\|1104658_1106002_-	lytic murein transglycosylase B	NA	NA	NA	NA
WP_011351344.1\|1106045_1106969_+	histone deacetylase family protein	A0A2K9KZC4	Tupanvirus	5.1e-41	34.9
WP_011351345.1\|1107001_1107922_-	alpha/beta hydrolase	Q6TUZ7	Yaba_monkey_tumor_virus	3.0e-17	27.6

DBSCAN-SWA_3

2004235 : 2059218

Stx2-converting_phage(20.0%)

transposase,integrase,protease

attL 2014914:2014931|attR 2021543:2021560

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011352128.1\|2004235_2005831_+\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	1.5e-136	58.7
WP_011352129.1\|2006122_2006644_-	SRPBCC domain-containing protein	NA	NA	NA	NA
WP_011352130.1\|2006636_2007050_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_011352131.1\|2007334_2007655_+	hypothetical protein	NA	NA	NA	NA
WP_041492845.1\|2007937_2008183_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_011352134.1\|2008842_2009361_+	3'-5' exoribonuclease	NA	NA	NA	NA
WP_011352135.1\|2009442_2011209_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_011352136.1\|2011584_2012091_-	hypothetical protein	NA	NA	NA	NA
WP_011352137.1\|2012083_2014408_-	hypothetical protein	NA	NA	NA	NA
WP_167316025.1\|2014404_2015919_-\|integrase	site-specific integrase	NA	NA	NA	NA
2014914:2014931	attL	NA	NA	NA	NA
WP_041492846.1\|2015944_2017168_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_011352140.1\|2017386_2018034_-	glutathione S-transferase	NA	NA	NA	NA
WP_011352141.1\|2018154_2019183_-	MFS transporter	NA	NA	NA	NA
WP_011352142.1\|2019400_2020789_-	hypothetical protein	NA	NA	NA	NA
WP_011352143.1\|2020815_2021805_-	3-oxoacyl-ACP synthase	NA	NA	NA	NA
2021543:2021560	attR	NA	NA	NA	NA
WP_011352144.1\|2021801_2023166_-	hypothetical protein	NA	NA	NA	NA
WP_011352145.1\|2023162_2024386_-	pyridoxal phosphate-dependent aminotransferase family protein	V5LQ39	Emiliania_huxleyi_virus	9.4e-43	28.9
WP_041492849.1\|2024382_2024643_-	acyl carrier protein	NA	NA	NA	NA
WP_157687183.1\|2024644_2025571_-	hypothetical protein	NA	NA	NA	NA
WP_011352147.1\|2025974_2029136_-	multidrug efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	2.7e-49	21.9
WP_011352148.1\|2029157_2030519_-\|protease	Zn-dependent protease	NA	NA	NA	NA
WP_011352149.1\|2030518_2031970_-	TldD/PmbA family protein	NA	NA	NA	NA
WP_011352150.1\|2031962_2033606_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	7.7e-16	31.4
WP_011352151.1\|2033605_2034718_-	ABC transporter permease	NA	NA	NA	NA
WP_011352152.1\|2034671_2035724_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_041493083.1\|2035737_2037597_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_011352154.1\|2037899_2040707_-	TonB-dependent receptor	NA	NA	NA	NA
WP_011352155.1\|2041043_2041619_-	cupin domain-containing protein	NA	NA	NA	NA
WP_011352156.1\|2041921_2043112_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_011352157.1\|2043128_2043560_-	biopolymer transporter ExbD	NA	NA	NA	NA
WP_011352158.1\|2043687_2044110_-	biopolymer transporter ExbD	NA	NA	NA	NA
WP_011352159.1\|2044130_2045045_-	MotA/TolQ/ExbB proton channel family protein	NA	NA	NA	NA
WP_011352160.1\|2045131_2045830_-	energy transducer TonB	NA	NA	NA	NA
WP_011352161.1\|2046655_2047141_-	YbaK/EbsC family protein	NA	NA	NA	NA
WP_011352162.1\|2047265_2048243_-	cysteine synthase A	A0A1X9I5F1	Streptococcus_phage	1.0e-47	37.2
WP_041493084.1\|2048390_2048876_+	adenosine-specific kinase	NA	NA	NA	NA
WP_011352164.1\|2049100_2049394_+	YciI family protein	NA	NA	NA	NA
WP_011352165.1\|2049401_2050379_-	magnesium/cobalt transporter CorA	NA	NA	NA	NA
WP_011352166.1\|2050558_2050705_+	cytochrome bd-I oxidase subunit CydX	NA	NA	NA	NA
WP_041492851.1\|2050701_2051319_+	ATP-binding protein	NA	NA	NA	NA
WP_011352168.1\|2051415_2052516_-	saccharopine dehydrogenase NADP-binding domain-containing protein	NA	NA	NA	NA
WP_011352169.1\|2052764_2053547_+	membrane protein	NA	NA	NA	NA
WP_011352170.1\|2053594_2054035_+	hypothetical protein	NA	NA	NA	NA
WP_011352171.1\|2054116_2054782_+	response regulator transcription factor	NA	NA	NA	NA
WP_011352172.1\|2054757_2056182_+	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_006481526.1\|2056185_2056650_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_011352173.1\|2056905_2057451_+	Spy/CpxP family protein refolding chaperone	NA	NA	NA	NA
WP_011352174.1\|2057588_2058020_+	PGDYG domain-containing protein	NA	NA	NA	NA
WP_011352175.1\|2058053_2058416_-	DUF3022 domain-containing protein	NA	NA	NA	NA
WP_011352176.1\|2058429_2059218_-\|protease	YhfC family intramembrane metalloprotease	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_007511

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NC_007510

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection