CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NC_008261	Clostridium perfringens ATCC 13124, complete sequence	4 crisprs	DEDDh,cas2,csa3,cas3,cas14j,RT,DinG,c2c9_V-U4	0	0	4	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_008261_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_008261_1

306604-306692

Orphan

Consensus_repeat	Method
AGTTTTATATAAATCAATATAAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_008261_1

>merge|NC_008261|1|306604-306692|CRISPRCasFinder
AGTTTTATATAAATCAATATAAATTTAAAATTGCAATTTCAAAAGCTAGATTAGGTACTGATAAAGAGTTTTATATAAATCAATGTAAA

>NC_008261|1|1|306604-306692|CRISPRCasFinder
AGTTTTATATAAATCAATATAAA	TTTAAAATTGCAATTTCAAAAGCTAGATTAGGTACTGATAAAG
AGTTTTATATAAATCAATGTAAA

Protein	Signature genes	Signature genes Name	Protein_function
NC_008261.1\|WP_003476167.1\|324212_325646_+\|glycosyltransferase	unknown	unknown	gnl\|CDD\|340856
NC_008261.1\|WP_003453458.1\|319179_320352_+\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|213187
NC_008261.1\|WP_011590115.1\|302241_303378_+\|mechanosensitive-ion-channel-family-protein	unknown	unknown	gnl\|CDD\|366370
NC_008261.1\|WP_003460432.1\|322916_324098_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213187
NC_008261.1\|WP_003468707.1\|307744_310282_+\|glycoside-hydrolase-family-3-C-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|366376
NC_008261.1\|WP_003464244.1\|306225_306522_-\|hypothetical-protein	unknown	unknown	unknown
NC_008261.1\|WP_003464293.1\|304361_304574_+\|hypothetical-protein	unknown	unknown	unknown
NC_008261.1\|WP_003479536.1\|299316_300459_+\|type-I-restriction-enzyme-HsdR-N-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|227091
NC_008261.1\|WP_003464290.1\|301551_302058_+\|CarD-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224248
NC_008261.1\|WP_003458352.1\|297585_297834_+\|spore-coat-protein	unknown	unknown	gnl\|CDD\|377935
NC_008261.1\|WP_004458058.1\|304694_306005_-\|DUF1576-domain-containing-protein	unknown	unknown	gnl\|CDD\|377881
NC_008261.1\|WP_003453460.1\|318349_319162_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224596
NC_008261.1\|WP_003470229.1\|316025_316493_-\|peroxiredoxin	unknown	unknown	gnl\|CDD\|224146
NC_008261.1\|WP_003453475.1\|317139_317886_+\|peptidylprolyl-isomerase	unknown	unknown	gnl\|CDD\|234605
NC_008261.1\|WP_003453477.1\|321667_322903_+\|glycosyltransferase	unknown	unknown	gnl\|CDD\|340856
NC_008261.1\|WP_004458079.1\|306729_307407_-\|uracil-DNA-glycosylase	unknown	unknown	gnl\|CDD\|235376
NC_008261.1\|WP_011590113.1\|300717_301332_+\|sugar-O-acetyltransferase	unknown	unknown	gnl\|CDD\|100047
NC_008261.1\|WP_003472385.1\|298369_299101_-\|NAD-dependent-protein-deacylase	unknown	unknown	gnl\|CDD\|234777
NC_008261.1\|WP_003453483.1\|320365_321649_+\|glycosyltransferase	unknown	unknown	gnl\|CDD\|340856
NC_008261.1\|WP_011590116.1\|303374_303998_+\|copper-homeostasis-protein-CutC	unknown	unknown	gnl\|CDD\|225684

Protein	Function_ID	Function_description	E-value
NC_008261.1\|WP_003476167.1\|324212_325646_+\|glycosyltransferase	gnl\|CDD\|340856	cd04950, GT4_TuaH-like, teichuronic acid biosynthesis glycosyltransferase TuaH and similar proteins. Members of this family may function in teichuronic acid biosynthesis/cell wall biogenesis. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.	4.11279e-56
NC_008261.1\|WP_003453458.1\|319179_320352_+\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|213187	cd03220, ABC_KpsT_Wzt, ATP-binding cassette component of polysaccharide transport system. The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export. Among the variety of membrane-linked or extracellular polysaccharides excreted by bacteria, only capsular polysaccharides, lipopolysaccharides, and teichoic acids have been shown to be exported by ABC transporters. A typical system is made of a conserved integral membrane and an ABC. In addition to these proteins, capsular polysaccharide exporter systems require two 'accessory' proteins to perform their function: a periplasmic (E.coli) or a lipid-anchored outer membrane protein called OMA (Neisseria meningitidis and Haemophilus influenza) and a cytoplasmic membrane protein MPA2.	7.45112e-115
NC_008261.1\|WP_003460432.1\|322916_324098_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|213187	cd03220, ABC_KpsT_Wzt, ATP-binding cassette component of polysaccharide transport system. The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export. Among the variety of membrane-linked or extracellular polysaccharides excreted by bacteria, only capsular polysaccharides, lipopolysaccharides, and teichoic acids have been shown to be exported by ABC transporters. A typical system is made of a conserved integral membrane and an ABC. In addition to these proteins, capsular polysaccharide exporter systems require two 'accessory' proteins to perform their function: a periplasmic (E.coli) or a lipid-anchored outer membrane protein called OMA (Neisseria meningitidis and Haemophilus influenza) and a cytoplasmic membrane protein MPA2.	2.43573e-120
NC_008261.1\|WP_003453477.1\|321667_322903_+\|glycosyltransferase	gnl\|CDD\|340856	cd04950, GT4_TuaH-like, teichuronic acid biosynthesis glycosyltransferase TuaH and similar proteins. Members of this family may function in teichuronic acid biosynthesis/cell wall biogenesis. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.	1.34702e-58
NC_008261.1\|WP_011590113.1\|300717_301332_+\|sugar-O-acetyltransferase	gnl\|CDD\|100047	cd03357, LbH_MAT_GAT, Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates. MAT acetylates maltose and glucose exclusively at the C6 position of the nonreducing end glucosyl moiety. GAT specifically acetylates galactopyranosides. Furthermore, MAT shows higher affinity toward artificial substrates containing an alkyl or hydrophobic chain as well as a glucosyl unit. Active MAT and GAT are homotrimers, with each subunit consisting of an N-terminal alpha-helical region and a C-terminal left-handed parallel alpha-helix (LbH) subdomain with 6 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X).	9.98698e-97
NC_008261.1\|WP_003468707.1\|307744_310282_+\|glycoside-hydrolase-family-3-C-terminal-domain-containing-protein	gnl\|CDD\|366376	pfam00933, Glyco_hydro_3, Glycosyl hydrolase family 3 N terminal domain.	5.22634e-110
NC_008261.1\|WP_003479536.1\|299316_300459_+\|type-I-restriction-enzyme-HsdR-N-terminal-domain-containing-protein	gnl\|CDD\|227091	COG4748, COG4748, Uncharacterized conserved protein [Function unknown].	5.3452e-80
NC_008261.1\|WP_003464290.1\|301551_302058_+\|CarD-family-transcriptional-regulator	gnl\|CDD\|224248	COG1329, COG1329, Transcriptional regulators, similar to M. xanthus CarD [Transcription].	2.01008e-14
NC_008261.1\|WP_003458352.1\|297585_297834_+\|spore-coat-protein	gnl\|CDD\|377935	pfam07875, Coat_F, Coat F domain. The Coat F proteins, which contribute to the Bacillales spore coat. It occurs multiple times in the genomes it is found in.	2.38946e-13
NC_008261.1\|WP_004458058.1\|304694_306005_-\|DUF1576-domain-containing-protein	gnl\|CDD\|377881	pfam07613, DUF1576, Protein of unknown function (DUF1576). This small family is found in several undescribed proteins. The alignment is distinguished by the frequent occurrence of conserved glycine and aromatic residues.	2.98799e-64
NC_008261.1\|WP_003453460.1\|318349_319162_+\|ABC-transporter-permease	gnl\|CDD\|224596	COG1682, TagG, ABC-type polysaccharide/polyol phosphate export systems, permease component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane].	2.59948e-37
NC_008261.1\|WP_003470229.1\|316025_316493_-\|peroxiredoxin	gnl\|CDD\|224146	COG1225, Bcp, Peroxiredoxin [Posttranslational modification, protein turnover, chaperones].	9.8243e-79
NC_008261.1\|WP_003453475.1\|317139_317886_+\|peptidylprolyl-isomerase	gnl\|CDD\|234605	PRK00059, prsA, peptidylprolyl isomerase; Provisional.	1.6338e-32
NC_008261.1\|WP_004458079.1\|306729_307407_-\|uracil-DNA-glycosylase	gnl\|CDD\|235376	PRK05254, PRK05254, uracil-DNA glycosylase; Provisional.	1.66958e-148
NC_008261.1\|WP_011590115.1\|302241_303378_+\|mechanosensitive-ion-channel-family-protein	gnl\|CDD\|366370	pfam00924, MS_channel, Mechanosensitive ion channel. Two members of this protein family of M. jannaschii have been functionally characterized. Both proteins form mechanosensitive (MS) ion channels upon reconstitution into liposomes and functional examination by the patch-clamp technique. Therefore this family are likely to also be MS channel proteins.	1.46529e-42
NC_008261.1\|WP_003472385.1\|298369_299101_-\|NAD-dependent-protein-deacylase	gnl\|CDD\|234777	PRK00481, PRK00481, NAD-dependent deacetylase; Provisional.	3.29219e-134
NC_008261.1\|WP_003453483.1\|320365_321649_+\|glycosyltransferase	gnl\|CDD\|340856	cd04950, GT4_TuaH-like, teichuronic acid biosynthesis glycosyltransferase TuaH and similar proteins. Members of this family may function in teichuronic acid biosynthesis/cell wall biogenesis. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.	5.35525e-51
NC_008261.1\|WP_011590116.1\|303374_303998_+\|copper-homeostasis-protein-CutC	gnl\|CDD\|225684	COG3142, CutC, Uncharacterized protein involved in copper resistance [Inorganic ion transport and metabolism].	7.93704e-89

>NC_008261.1|WP_003464244.1|306225_306522_-|hypothetical-protein
MKNYKDNDENFKLVPMNMKCNQEYSFMPMNKFNSNSMNLNPMINKNSNHSCCCMHNYVMKPSPYNNNYYENQMFPQNHTDNMMVKTLITVKKKSDLFD
>NC_008261.1|WP_004458058.1|304694_306005_-|DUF1576-domain-containing-protein
MKRLPQEYLIHSILYISFIIFAFFLESPKEILNGLYNIISNSDILITDYISIGGFGATLINSALLGLIFIFLFYITDTKSTGKSIMSLWFLTGFGMFGKNIINIWPIVLGTFIYSKVKKKPFKDYLVIASLGTALAPTVSQFSFFPEVHPISGAIMGALVGIIVGFILPPIAKNASKIHSGFSLYNVGFAGGIIAIAVMSLMRAVGHDFETNSIWHKGNNILYMLFLFTISAYFIICSLILDKSKKSVLKDQIGINKEHGIFPSDFFSIYGSSCYFNMGVLCIFSTLFVLLINGDLNGPTIGAIFSMAGFGCYGKNLANSVPLIIGASLASLISISDINSPVTVVCILFSTGLAPISGYYGWPYGIIAGFLHIFMVFNIGELHGGLNLYNNGLASGFVAAIIVPVIESLQVTNTKNNLKDSSKRHPISLGIKKEAD
>NC_008261.1|WP_003464293.1|304361_304574_+|hypothetical-protein
MLEKMILSDKECEYLAKSIAGGVLIGLALGAIFNNPQFGFALGGVTGIVASLIYTLVKRAKIKSDKKLIN
>NC_008261.1|WP_011590116.1|303374_303998_+|copper-homeostasis-protein-CutC
MTIKLEACVGNYKEGKRAEELGANRIELCDNLAQGGTTPSYGTILQCKKDINIDINVIIRPRGGNFVYSKEELNIMKNDIKLCKDIGVTGVVFGFLKEDNTLDYETTKEFVELAKPLSITFHMAFDEIENKVDALGKLIDLGVDRVLTKGGLDNAFKNKDTLKELVEHAKDKIIILPGGGVTKDNFLELKDYTNARELHGTKIVGNL
>NC_008261.1|WP_011590115.1|302241_303378_+|mechanosensitive-ion-channel-family-protein
MKELERLLGRLTIINIKEIIIILVIMIIVLIINKILINNLFKLLMRGARRTKNYLDNNIVRALENPLKLIVSFVGIYSIFKVINLDSLGIDFLSTYKILRVGIIVSFIYFAYNLTLENSLLYSKLHKNDGGNTIVFPFISIIIRLIILLVGIIIIANEFGLTGFIAGLGVSGVAFALAAQDTCSNLFGGMVIVLDRPFSIGDWIQAGDVEGVVEEITFRSTRIRTFSMAIATVPNSKLANSNIINWTQRKLRRIHFKFTMDCKTPIESIKNSVNKIENMLKKHDKIDKNLIIVSFNELSTYGFGVFIYFYTDEFEYLKYEKLKEEINIKILEILREENVSLMFLNFDFKGFERRSGNCNLENTELESIKNITEEERGV
>NC_008261.1|WP_003464290.1|301551_302058_+|CarD-family-transcriptional-regulator
MFKINDYIMYGTVGVCQVIDITKETLMNNIEKEYYVLSPVYSKYPKKTVIKIPVDNKKISMRTLLSKEDVNSIINSIPETETLWIDNDRQRNDEFKTMLRSGNCDDLIVLIRSIYLDKKKRKLDGKKACKGDDEIMQTAEKLINEEFAVILDIRPEEVKSYIKSHIPQ
>NC_008261.1|WP_011590113.1|300717_301332_+|sugar-O-acetyltransferase
MDLKEIRERMYGQKLYYCNDEDLMREQMKALELLYDFNKTRPSEQDKREKILKKMFAEIGDDCYIEPPFHANWGGKNVHFGNGVYANFNLTMVDDCDIFVGNNVMFGPNVTVSAGTHPIHPELRSKQAQYNIPIHIGNNVWIGANSVILPGVNIGDNSVIGAGSIVTKDIPSNVVAVGNPCRVLREINENDMKYYYRDMKIDIE
>NC_008261.1|WP_003479536.1|299316_300459_+|type-I-restriction-enzyme-HsdR-N-terminal-domain-containing-protein
MAFKDDIQKLSVQVKERKEYITNEEMTKQALIIPFIQILGFDVFNPIEIRPEYSADFGIKKGEKVDYALFKENEPIIFIEAKSVNENLNNHDAQLARYFNSTKEVKLAILTNGIEYKFFTDLNANNVMDDTPFLNINLLEIKESDIESLNKLRKENFDKDSLITYAEELVYTSTLNESLRRLFSNPSDDFVRFIVKDFSEMRITSNVIERFRPLVKKAISNAVLDIVSKGLYQQETLTIKKEENINNDSVNREDLSEIEIGNKVQKGIITTENELKGFNIVKDILEKNNRDISEINYKDTTNYFSVYLRNTTRWIIRFNLDASKKNVMTKLPVEYAKNICPNKEIEQAPKGIGESRVYINSIDELYDLEKYLVDAYDNVN
>NC_008261.1|WP_003472385.1|298369_299101_-|NAD-dependent-protein-deacylase
MDDKINKLKEIIKNSNNIVFFGGAGVSTESGIPDFRSANGLFNEKLNITFTPEQLVSHSFFERYPEEFFNFYKAKLIYPNAKPNDAHIALAKLEEMGKLKAIVTQNIDGLHQMAGSKNVFELHGSVLRNYCVDCHTFYDEKFILESKGVPKCTKCGGIVKPDVVLYEEPLDDNVIRGAIDAISKADTLIIGGTSLVVYPAAGLINYFRGKNLVLINKSSTQADSKADLVINDSIGKVLGKVID
>NC_008261.1|WP_003458352.1|297585_297834_+|spore-coat-protein
MQEKEMISDYLAGINASLAGYGGIISQCENQELRETIQNMRNQDEVRQYALFKIAKEKGYYIPAQQATPEEVATVKQQVSQG
>NC_008261.1|WP_004458079.1|306729_307407_-|uracil-DNA-glycosylase
MAAEFNNDWDDLLKDEFEKEYYLNLRKFLINEYKTQKIHPSMYDIFNALKFTPYKDVKVVILGQDPYHGPNQAHGFSFSVKPGVQTPPSLRNMFKELNSDLGCYIPNNGFLESWAKQGILLLNTVLTVREGQANSHKGKGWEIFTDRVIELLNKREEPIVFILWGRNAISKEALITNSIHKIIKSVHPSPLSATRGFFGSKPFSKTNDFLVSINKEPIDWQIPNI
>NC_008261.1|WP_003468707.1|307744_310282_+|glycoside-hydrolase-family-3-C-terminal-domain-containing-protein
MLLKKLAAILTVASIGATIFTSNKEVMATDSYSKAKEIVSNMTLEEKLGQMIMPDFRMWQEEGAKEPSDLTEINSEVAEVIDKYDLGGVILFAENVKEISQTTTLIHDLQEVAINDEDGNLPLLITLDQEGGIVTRLGEGTNLPGNMALGATRSEKSSYDAGYVIGKELNALGVNVDFAPVLDTNNNPENPVIGVRSISSNPELVGKLGKNIAKGIQDQGVAATAKHFPGHGDTATDSHYGLPMVDKSIEELRETELKPFKIAIENGIDMIMTAHIQFPQIEKDTFISKKDGSQISIPATLSDDIIKGILREEMEYDGVVITDAMNMKAISDHFGELESTKMAINAGIDIILMPTILRNNEDVKKLDYIVNGILDSIKSGEIKEEEITDSAERIVKLKIDRGIIDLKNNNASLEEKIKKAKKTVGSVENRNIERRISEEAITITKNEENILPLNPKEGEKVLLIAPNESQIHSMKFGINRLIHENSLNNIKLDTYEYNNIGIIDDVLKEKIESSDYIIVASLSSNANHLKPGAWNRDLPRSVIDYGNKLNKDTVLISLRNPYDLAAYDNAKAQVVAYGFKGMDPTEGDTLFPTKSSGPNIPASMGVVFGAVEPKGKLPVDIPSLNNDGTMNTEVNYYDYGHGITNINSLGNVNISMNKKINLGDNFQVKFNLSDFNEIVAGKYRAKIKFQGEKLEFINGKVEFSGDLQTNIIDNNTLEVLINLEEGSLKANEVNFILEFKAIDKAELTSIEITSSELIDEKGRCFKQKYVISEFSIEDNKEDKPLSPDEDKEDEENNEDLGNSDDNNKDELPQTGSGVGKEFIFGLGSLSLLAGIGLKSKRFKRK
>NC_008261.1|WP_003470229.1|316025_316493_-|peroxiredoxin
MSIEINKLAPDFKLMGSDGKEHSLSDYKGKNIVLYFYPKDNTAGCTTEACDFRDNIQNFHDLNAIILGVSRDSLASHDKFITKLSLPFVLLSDPDETVCKLYDVIKEKNMYGKKYMGVERSTFLINKEGILIEEFRKVRVKGHIEKVLDKLKEIN
>NC_008261.1|WP_003453475.1|317139_317886_+|peptidylprolyl-isomerase
MEKKVLATVGNTEITSDYIDEIIARYPAQQQAMLASDEGKRQVLEQAIAFELMSEFAKETGLDKTEEFKDQLNKFAKELLAQMVMKKTLSSVTVTDDEAKAFYEEHKENFVELETVTAKHILVASEEEAKKVEEEIASGSITFEDAANKYSSCPSKEQGGNLGSFSKGMMVPEFEEAAFNLELGVVSAPVKTQFGYHLIKVEDKTEAKTKAFEDVKEQVVNMLIQERQQKKYLELIKELREKYGVKLA
>NC_008261.1|WP_003453460.1|318349_319162_+|ABC-transporter-permease
MKDWLEIEKSIFSHWRMIFSISKKEFKKEFAGSKLGMAWAIIRPLAMITVFWMIFSTGMRTTSSNVQVNYLVWLVSAYIPWIFISDVIMSGAGSIRVNSFLVKKVKFPVEILPTIRIVISFYTFLILLVISFIIFAVNGNLNLINIPKLIYAIIITIIFLAALSRLLSTWVVMSIDILHGISVFMQFLFWMCPVMWQAGELPVGSSMPWIEKILKLNPLYYLAVLFRDAYLGTHTVSLAYGVYFWVVTIILFIFGSKVFKKFRPEFDDVL
>NC_008261.1|WP_003453458.1|319179_320352_+|ATP-binding-cassette-domain-containing-protein
MSVAIRVKDLTKKYKLYQKRSERLANAFGKEKNIKEFYALKGVSFEISKGECVGIIGHNGAGKSTLLKLLTGVAFPTSGEIEINGRLASMLELGSGFNPELTGMENIYFNGSLNGLTKEEIDGKLKDILEFADIGNFIEQPVKNYSSGMFARLAFAVAINVDPDILIVDEILSVGDVGFQVKCMEKFNEFKKKGKTILYVSHGLGTVKKFCDRAIWLQKGEVVDDGNSVIVVERYYNLNFNPANIEQLKDHKSDIINSIAVKSNTKNVEYLEKLDLEVEYDLISNDLKDPNIVLEFRKTDYEPGTTRGNDQFVCGINSKDNIKNIPFNLGVNKLKVSLNKVNLVAGVYYIDFVLRDGEEEVYRKINGYSFTLNDKYRGEGFLILGHSWGN
>NC_008261.1|WP_003453483.1|320365_321649_+|glycosyltransferase
MSVGRIARRTTEVLKEDGLIEVIKRVLRYIKRRIKDKLDNNALTYRKNYEEANAIFHKILKKEKFKAVVVFDSRVGWNIPLFQRSQHMANELTDDGYLYFYRTSEQFDPHVKTVEKLKDRLYLVNMANFALQNAMFDLLKEYKGHKFLSLYSTDVYLDEQYIKEKYIDNGFKIIYEYIDELSDEISGHLPDFVYDRHKNIIEDKSNIAVGSADKLIEEIEEIRGKENVAMITNGVQYDHWQYRSDEVPEKLKDIVSKGNPIIGYFGALAKWFDYELLKKVAKERPNYEIVLIGFLYDNSFKDSKIDELENVHYLGIVDYKELNQYSQYFTISTIPFLLNDITESTSPVKLFEYMAMGHPIVTTDMRECRKYKSVLIGKSHEDFIEKLDFALTLDKKDEYYNYLKEEALANTWREKAAILDRLIEKNI
>NC_008261.1|WP_003453477.1|321667_322903_+|glycosyltransferase
MSLKRSLKNLLRPILKPMLLKYREKGHEDQKQVFFDEITGAIKNGNYDAIVIFDVYFGFEVKMFQRPQHIALNLAKENVLYFYKASPYVDKDIKTYKKMEENLYLVNTDLYWLQECLIDIVSQSGVPAFGQIYSTSFVEYDSWLKKFTDRNFKIIYEYVDDLSDDIAGFKISDEIKASHKRMLEDTEKVYVVTTADKLYQEAKELRGENKLALVTNGVQYEHFANIDCKKIPDKMKNIVNSKKKIIGYFGALASWFDYDLIKELAEEFKDDYEIVLIGIDYDQSLGKSGILKLDNVHYLGTVNYNELPTYSKFFNVSIIPFVVNEITEATSPVKLFEYMALGKPIVTTALPECRKYESPLVSDSHEDFINNIKKAAELENSKEYIELLRKEGNQNTWRQKAKDIKELILNS
>NC_008261.1|WP_003460432.1|322916_324098_+|ABC-transporter-ATP-binding-protein
MEKAIEVKNLCKNYRVYDSKSSRIRNIINPFAKKEVKEFKALTDVSFHVNKGEIVGIIGNNGAGKSTLLKILTGVSFPSSGEVNVNGRVSSLLELGTGFNPELTGEENIYFNGSLMGLTQDEIDKVKDNIIEFADIGEFINQPVKSYSSGMYARLAFAVAININPDILIVDEILSVGDVGFQKKCMDKFNEFKEAGKTVLYVSHGLETVQTFCERAIWLEKGRVVDIGPSFDIVEKYYDKLMKSDDKEELETGKFVELINVEILDDKKVYKKGESIEFLVEYEVFNPSVKNAGITIEMRKAYREPCEYRNADQFIFSVNSNVDEFTIPWKKGRNKITFKIDSLDVKEGIYYLDAIFSESQNLVALETQEDVVSFEVKNEGESEGFVFLDSTWT
>NC_008261.1|WP_003476167.1|324212_325646_+|glycosyltransferase
MSNIFEVMLKKNIGDFTYEEKRELNNWLIENLKLKELIYSGLELTKVINEDGEETAYYENKITEEDILSGNFNELCSKTSKYIDDAISSILFEGQFNCFYEKIKSILELEDFDEIIVFHASFGWNIEMKQRPQHLAEALSKKKVLYIYRSDVKNDNIYSIKKIKDNLYVLNLDMYSLNVAFFEAIKSINKPKFVHVYATCLNSVDYEKIKTYMDKGFKVIYDFVDELSSEISGYNITSKMIEDHEKLLRDKENVLVVSTAKKLKDIANKFRGENENNILAPNAVNLEDFKNHGNEIGEKIQPIVNKRKPIIGYYGALAKWFDYKLIEQLAKEREDYEIVLIGMDYDGSYDQSNLKDYSNISYLGMIDYKDLINYSRYFDVCIVPFIKNDITDSTSPLKIFEYMALEKPIVTTDINECKNYESCLISKDYDEFIRNIDKALKLEVDNKEYFNILRREAEENTWDNRAELIKEAIKNLE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_008261_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_008261_2

1068681-1068882

Orphan

Consensus_repeat	Method
TTTTAAACAATATTTGCTTTTAGGT	CRISPRCasFinder

3 spacers

The CRISPR arrays of NC_008261_2

>merge|NC_008261|2|1068681-1068882|CRISPRCasFinder
TTTTAAACAAGCTTTATTTTTTAGGTGTACAAAACATCTTTTCTTTTGGCATTACAATAGATGATTTTAAACAATATTTGCTTTTAGGTCTATTCCGAGTAAATATTAAATAAAATCTAAACTAGATACTTTTAAACAATATTTGTTTTTAGGTGCTAACAGCTTTTTAGTAGTTACTATTAATAGAATATTGATTTTAGGT

>NC_008261|2|2|1068681-1068882|CRISPRCasFinder
TTTTAAACAAGCTTTATTTTTTAGG	TGTACAAAACATCTTTTCTTTTGGCATTACAATAGATGA
TTTTAAACAATATTTGCTTTTAGGT	CTATTCCGAGTAAATATTAAATAAAATCTAAACTAGATAC
TTTTAAACAATATTTGTTTTTAGGT	GCTAACAGCTTTTTAGTAGTTAC
TATTAATAGAATATTGATTTTAGGT

Protein	Signature genes	Signature genes Name	Protein_function
NC_008261.1\|WP_011590433.1\|1076294_1076897_+\|sugar-transferase	unknown	unknown	gnl\|CDD\|376775
NC_008261.1\|WP_011590435.1\|1077931_1079059_+\|glycosyltransferase	unknown	unknown	gnl\|CDD\|340840
NC_008261.1\|WP_011590428.1\|1065632_1066187_+\|BMC-domain-containing-protein	unknown	unknown	gnl\|CDD\|131578
NC_008261.1\|WP_011590431.1\|1073138_1074983_+\|polysaccharide-biosynthesis-protein	unknown	unknown	gnl\|CDD\|224011
NC_008261.1\|WP_158301051.1\|1079182_1080139_+\|EpsG-family-protein	unknown	unknown	gnl\|CDD\|379716
NC_008261.1\|WP_003455851.1\|1064453_1065212_+\|TIGR02536-family-ethanolamine-utilization-protein	unknown	unknown	gnl\|CDD\|274184
NC_008261.1\|WP_003454016.1\|1066237_1067335_+\|ethanolamine-utilization-protein-EutH	unknown	unknown	gnl\|CDD\|237906
NC_008261.1\|WP_011590426.1\|1060623_1062102_+\|acetaldehyde-dehydrogenase-(acetylating)	unknown	unknown	gnl\|CDD\|131570
NC_008261.1\|WP_003459816.1\|1069924_1070236_+\|hypothetical-protein	unknown	unknown	unknown
NC_008261.1\|WP_011590432.1\|1075095_1076289_+\|DegT/DnrJ/EryC1/StrS-family-aminotransferase	unknown	unknown	gnl\|CDD\|99740
NC_008261.1\|WP_011590434.1\|1076919_1077945_+\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|133016
NC_008261.1\|WP_003453956.1\|1065358_1065631_+\|EutN/CcmL-family-microcompartment-protein	unknown	unknown	gnl\|CDD\|377017
NC_008261.1\|WP_003480649.1\|1072271_1072892_+\|flavodoxin-family-protein	unknown	unknown	gnl\|CDD\|223728
NC_008261.1\|WP_003453912.1\|1067337_1067811_+\|DUF861-domain-containing-protein	unknown	unknown	gnl\|CDD\|114941
NC_008261.1\|WP_003474278.1\|1069087_1069633_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NC_008261.1\|WP_003455694.1\|1063610_1064246_+\|phosphate-propanoyltransferase	unknown	unknown	gnl\|CDD\|237899
NC_008261.1\|WP_003453976.1\|1062456_1062747_+\|ethanolamine-utilization-microcompartment-protein-EutM	unknown	unknown	gnl\|CDD\|132899
NC_008261.1\|WP_011590429.1\|1068179_1068656_+\|glutathione-peroxidase	unknown	unknown	gnl\|CDD\|238207
NC_008261.1\|WP_011590430.1\|1070549_1072190_+\|EAL-domain-containing-protein	unknown	unknown	gnl\|CDD\|238923
NC_008261.1\|WP_011590427.1\|1062824_1063601_+\|ethanolamine-utilization-cobalamin-adenosyltransferase	unknown	unknown	gnl\|CDD\|227149

Protein	Function_ID	Function_description	E-value
NC_008261.1\|WP_011590433.1\|1076294_1076897_+\|sugar-transferase	gnl\|CDD\|376775	pfam02397, Bac_transf, Bacterial sugar transferase. This Pfam family represents a conserved region from a number of different bacterial sugar transferases, involved in diverse biosynthesis pathways.	6.54886e-79
NC_008261.1\|WP_011590428.1\|1065632_1066187_+\|BMC-domain-containing-protein	gnl\|CDD\|131578	TIGR02526, putative_ethanolamine_utilization_protein, PduT-like ethanolamine utilization protein. This gene shows up in ethanolamine utilization operons in which a proteinaceous coat organelle is also encoded. It is closely related to the PduT protein in propane-diol operons with the same structure.	3.66334e-91
NC_008261.1\|WP_011590431.1\|1073138_1074983_+\|polysaccharide-biosynthesis-protein	gnl\|CDD\|224011	COG1086, COG1086, Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism].	0
NC_008261.1\|WP_158301051.1\|1079182_1080139_+\|EpsG-family-protein	gnl\|CDD\|379716	pfam14897, EpsG, EpsG family. This family of proteins are related to the EpsG protein from B. subtilis. These proteins are likely glycosyl transferases belonging to the membrane protein GT-C clan.	3.7288e-21
NC_008261.1\|WP_003455851.1\|1064453_1065212_+\|TIGR02536-family-ethanolamine-utilization-protein	gnl\|CDD\|274184	TIGR02536, putative_ethanolamine_utilization_protein, ethanolamine utilization protein. This family of proteins is found in operons for the polyhedral organelle-based degradation of ethanolamine. This family is not found in proteobacterial species which otherwise have the same suite of genes in the eut operon. Proteobacteria have two genes that are not found in non-proteobacteria which may complement this genes function, a phosphotransacetylase (pfam01515) and the EutJ protein (TIGR02529) of unknown function.	2.7194e-73
NC_008261.1\|WP_003454016.1\|1066237_1067335_+\|ethanolamine-utilization-protein-EutH	gnl\|CDD\|237906	PRK15086, PRK15086, ethanolamine utilization protein EutH; Provisional.	5.41583e-166
NC_008261.1\|WP_011590426.1\|1060623_1062102_+\|acetaldehyde-dehydrogenase-(acetylating)	gnl\|CDD\|131570	TIGR02518, Acetaldehyde_dehydrogenase_acetylating, acetaldehyde dehydrogenase (acetylating).	0
NC_008261.1\|WP_011590435.1\|1077931_1079059_+\|glycosyltransferase	gnl\|CDD\|340840	cd03812, GT4_CapH-like, capsular polysaccharide biosynthesis glycosyltransferase CapH and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. capH in Staphylococcus aureus has been shown to be required for the biosynthesis of the type 1 capsular polysaccharide (CP1).	8.04348e-95
NC_008261.1\|WP_011590432.1\|1075095_1076289_+\|DegT/DnrJ/EryC1/StrS-family-aminotransferase	gnl\|CDD\|99740	cd00616, AHBA_syn, 3-amino-5-hydroxybenzoic acid synthase family (AHBA_syn). AHBA_syn family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The members of this CD are involved in various biosynthetic pathways for secondary metabolites. Some well studied proteins in this CD are AHBA_synthase, protein product of pleiotropic regulatory gene degT, Arnb aminotransferase and pilin glycosylation protein. The prototype of this family, the AHBA_synthase, is a dimeric PLP dependent enzyme. AHBA_syn is the terminal enzyme of 3-amino-5-hydroxybenzoic acid (AHBA) formation which is involved in the biosynthesis of ansamycin antibiotics, including rifamycin B. Some members of this CD are involved in 4-amino-6-deoxy-monosaccharide D-perosamine synthesis. Perosamine is an important element in the glycosylation of several cell products, such as antibiotics and lipopolysaccharides of gram-positive and gram-negative bacteria. The pilin glycosylation protein encoded by gene pglA, is a galactosyltransferase involved in pilin glycosylation. Additionally, this CD consists of ArnB (PmrH) aminotransferase, a 4-amino-4-deoxy-L-arabinose lipopolysaccharide-modifying enzyme. This CD also consists of several predicted pyridoxal phosphate-dependent enzymes apparently involved in regulation of cell wall biogenesis. The catalytic lysine which is present in all characterized PLP dependent enzymes is replaced by histidine in some members of this CD.	1.36381e-139
NC_008261.1\|WP_011590434.1\|1076919_1077945_+\|glycosyltransferase-family-2-protein	gnl\|CDD\|133016	cd02525, Succinoglycan_BP_ExoA, ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.	3.92127e-102
NC_008261.1\|WP_003453956.1\|1065358_1065631_+\|EutN/CcmL-family-microcompartment-protein	gnl\|CDD\|377017	pfam03319, EutN_CcmL, Ethanolamine utilisation protein EutN/carboxysome. The crystal structure of EutN contains a central five-stranded beta-barrel, with an alpha-helix at the open end of this barrel (Structure 2HD3). The structure also contains three additional beta-strands, which help the formation of a tight hexamer, with a hole in the center. this suggests that EutN forms a pore, with an opening of 26 Angstrom in diameter on one face and 14 Angstrom on the other face. EutN is involved in the cobalamin-dependent degradation of ethanolamine.	5.50579e-37
NC_008261.1\|WP_003480649.1\|1072271_1072892_+\|flavodoxin-family-protein	gnl\|CDD\|223728	COG0655, WrbA, Multimeric flavodoxin WrbA [General function prediction only].	1.81972e-50
NC_008261.1\|WP_003453912.1\|1067337_1067811_+\|DUF861-domain-containing-protein	gnl\|CDD\|114941	pfam06249, EutQ, Ethanolamine utilisation protein EutQ. The eut operon of Salmonella typhimurium encodes proteins involved in the cobalamin-dependent degradation of ethanolamine. The role of EutQ in this process is unclear.	1.30397e-93
NC_008261.1\|WP_003474278.1\|1069087_1069633_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	1.37214e-09
NC_008261.1\|WP_003455694.1\|1063610_1064246_+\|phosphate-propanoyltransferase	gnl\|CDD\|237899	PRK15070, PRK15070, phosphate propanoyltransferase.	4.63671e-116
NC_008261.1\|WP_003453976.1\|1062456_1062747_+\|ethanolamine-utilization-microcompartment-protein-EutM	gnl\|CDD\|132899	cd07059, BMC_PduA, 1,2-propanediol utilization protein A (PduA), Bacterial Micro-Compartment (BMC) domain. PduA is encoded within the 1,2-propanediol utilization (pdu) operon along with other homologous carboxysome shell proteins PduB, B', J, K, T, and U. PduA is thought to be required for the formation of the outer shell of bacterial pdu polyhedral organelles which are involved in coenzyme B12-dependent degradation of 1,2-propanediol. Although it has been suggested that PduA might form hexamers and further assemble into the flat facets of the polyhedral outer shell of pdu organelles, like PduU does, at present no experimental evidence directly supports this view.	4.19683e-40
NC_008261.1\|WP_011590429.1\|1068179_1068656_+\|glutathione-peroxidase	gnl\|CDD\|238207	cd00340, GSH_Peroxidase, Glutathione (GSH) peroxidase family; tetrameric selenoenzymes that catalyze the reduction of a variety of hydroperoxides including lipid peroxidases, using GSH as a specific electron donor substrate. GSH peroxidase contains one selenocysteine residue per subunit, which is involved in catalysis. Different isoenzymes are known in mammals,which are involved in protection against reactive oxygen species, redox regulation of many metabolic processes, peroxinitrite scavenging, and modulation of inflammatory processes.	1.08469e-98
NC_008261.1\|WP_011590430.1\|1070549_1072190_+\|EAL-domain-containing-protein	gnl\|CDD\|238923	cd01948, EAL, EAL domain. This domain is found in diverse bacterial signaling proteins. It is called EAL after its conserved residues and is also known as domain of unknown function 2 (DUF2). The EAL domain has been shown to stimulate degradation of a second messenger, cyclic di-GMP, and is a good candidate for a diguanylate phosphodiesterase function. Together with the GGDEF domain, EAL might be involved in regulating cell surface adhesiveness in bacteria.	5.75674e-56
NC_008261.1\|WP_011590427.1\|1062824_1063601_+\|ethanolamine-utilization-cobalamin-adenosyltransferase	gnl\|CDD\|227149	COG4812, EutT, Ethanolamine utilization cobalamin adenosyltransferase [Amino acid transport and metabolism].	2.47323e-69

>NC_008261.1|WP_011590429.1|1068179_1068656_+|glutathione-peroxidase
MEIYDISVKDINGENVSLERYRGKVLLIVNTASKCGFTKQFDGLEELYEKYKDEGFEVLGFPCNQFKEQDPGSNSEIMNFCKLNFGVTFPMFEKIDVNGENESLLYSYLKEQKSGMFGSKIKWNFTKFLVDREGNVIKRFSPQTTPKSIEKDIEELLD
>NC_008261.1|WP_003453912.1|1067337_1067811_+|DUF861-domain-containing-protein
MENISKELLEKLVRQIIEEKLAGAGNNDSVDFIRNKDKSGIMSIKLPTVKVDESNRLDTGNPRDVVYTKDLFTLEESPRLGAGIMEMKETTFDWTLNYDEIDYVIEGHLDIIIDGRKISADAGEIILIPKGSKIQFSVPDYARFIYVTYPADWASQA
>NC_008261.1|WP_003454016.1|1066237_1067335_+|ethanolamine-utilization-protein-EutH
MSINEIIVYIMVACMALGAIDKCLGNKFGIGEQFEEGIMAMGSLALAMVGVICLAPVLASVLGPIVTPVFNALGADPAMFAGSILANDMGGAPLAASLAQDPQAGMFSGLIIGAMMGATIVFTIPVSLGIIEKKDHKFLATGILAGIITIPVGAFVGGLVAGFPAMMVLKNLVPIIIFAILIAIGLAFAEEAMIKGFNIFGKIVVIIITLALAAAIIEALTGFVIIPGMAPITDGIEIVGSIAIVLAGAFPLVYIITKVFKKPLMGLGKILGMNEIAAAGMIASLANNIPMFGMLKDMDDRGKIINVAFAVSASFVLGDHLGFTAGFNPEMIFPMIVAKLVGGITAVILAMFIAKKTLGKIEEAK
>NC_008261.1|WP_011590428.1|1065632_1066187_+|BMC-domain-containing-protein
MKKSIGALEFRSISKGIEVSNEVVKKAFVEVSYLKSICPGKFFLIVNGDAGEVKEAIEFGEKLGEKYLVGSFIINSIHHDIINALKGKYSQKNIEDKAIGIMETGKVSSGILALDKTLKSSEVNLVKLQLAFGIGGKLVYIVSGDLSNVENGMREGQAILQEKDIINVSIIPFVHSEIAKNLIK
>NC_008261.1|WP_003453956.1|1065358_1065631_+|EutN/CcmL-family-microcompartment-protein
MEIGRVVGNVWATRKDEKLNGQKFLIVKLLVSKDKEKEGLFVAADNAGAGIGDIVLITKGGAARQSIGNREVPIDAAIVGIVDSIDIEED
>NC_008261.1|WP_003455851.1|1064453_1065212_+|TIGR02536-family-ethanolamine-utilization-protein
MKGGKDNMDYEKLVEFLVDEIYKRIQEENSKSNSLEKRKSIVVIGESNVSFYREALKGFDINPLTSECKDCDILLISKLCIKGLSNIAQGTCTTKAENFALEMLLKGKKVYILEDGIEYRKYKNTAPKVLYNKYIKFEEELLAYGIEVIDDLNRISIESKDEKVSFSGIKEEISKNLCLCSENKVEGKKDLDTTAIADEFTINLSNKKLVSESDLRKPHINGVRTLIVDKKAIITPLAKDYIRINNLNVVLS
>NC_008261.1|WP_003455694.1|1063610_1064246_+|phosphate-propanoyltransferase
MDNLLQDIIEEVVRRVKDEAFIEVEASGRHVHLTREHIEILFGEGHELTRIKDLSQPGQYACKERVTISGPRGKIDNVVVLGPPRNETQVEVSFTDALVLGSIPPVKLSGDLENTPEITISTERASIALNRGLMVAKRHIHMTPEDAIKFGVSNNESVKVKVLGKRPLIFDDVIVRVSKDYRTFMHIDYDEANACGFSKGTFALIVGKDEK
>NC_008261.1|WP_011590427.1|1062824_1063601_+|ethanolamine-utilization-cobalamin-adenosyltransferase
MAVLTEGEVRKRLSREDLKALKEFKVVKGEIITPSAKSYLAEHNINLVYVNSEEEKLNKETEPKEIIREVVREKEYKYETVFGAKLDEKPEHMTHLTGNLLVFKDHKRIIFRGKIDSLEARIVETQVLCHKQGMNKLVEDLQEILNLIGRILRCEVLSEPLEDFSLQGMTEKDLREKSHNPKKYFGIGHEMPTYEMGEIVAALNILRTLTRETELSAYEAFKGEYGQVEREDLIRALNRLSSVFWIMIFKVRTGKYEK
>NC_008261.1|WP_003453976.1|1062456_1062747_+|ethanolamine-utilization-microcompartment-protein-EutM
MANANALGMIETRGLVGAIEAADAMVKAANVQLVGKEQVGGGLVTVMVRGDVGAVKAATDAGAAAAERVGDLISVHVIPRPHFEVDAILPKAPKAE
>NC_008261.1|WP_011590426.1|1060623_1062102_+|acetaldehyde-dehydrogenase-(acetylating)
MEFLDKDLVSIQETRGLIRKAKEAQSKLARMSQQDIDRIVKAISDAAYENSEKLAKMANEETGFGKWEDKVLKNVFAARTVYESIKDTKTVGIVEENVEKRAFKIMVPVGVVAGLIPSTNPTSTAIYKAMISIKARNAIVLSPHPSAKKCIIETAKIIAKAAERAGCPEGAIGCITVPSIEGTNELMKNKDTSLILATGGEAMVRAAYSSGTPAIGVGPGNGPAFIDKSADVKLAVKRILDSKTFDNGTICASEQSIVVEKAMEDEVVRELKEQGAYFLTEEQANQLSKFVMRANGTMNPQIVGKTPQDIAKLAGLEGIPSWARVLIPRECHVGHKYPFSREKLTTILTFFVEENVDAVLNRCREILLNEGAGHTFCMHANNEELVKRFALEMPVSRMVVNSPGALGGIGATINLVPALTLGCGAVGGSSTSHNIGPLDLMNTRNVAYGVRELEDIRELAVGATKEVAASLDLGDKEELINLLVKKIIEELK
>NC_008261.1|WP_003474278.1|1069087_1069633_+|GNAT-family-N-acetyltransferase
MNLKRINSNDNCFNKAMEIYNGSFPIFERRTMDDQIKALDDTNYHFEVIYDKEEIVGILLYWDMGRYKYIEHFAIDSKLRGKNYGSRVLKEFCDHNKNVILEIDPPIDEISIKRLNFYLKLGFKLQDFDYTHPSYRKGCKRHSLKIMTFNHNMPKEDYDTFNILLKRDVMKYSEFKDRLNN
>NC_008261.1|WP_003459816.1|1069924_1070236_+|hypothetical-protein
MKKVLIGVLVFLICIISVFLFFDREEESIVTDVVEKSQYGLLVNYEDGLIAVDTEDAEIIDRDGKENTLDCINEGDRIEIIYDGKIEETYPAQINNVYKIIIF
>NC_008261.1|WP_011590430.1|1070549_1072190_+|EAL-domain-containing-protein
MKKRVFWVSIVFLIIITVLGITIKFDGKKVNCNRKTVKVGFYEYYPYYYLNKNSMPDGYYNEILELICNKLDLNYKYVDCNVTDALEKLKSGQIDLVFGISKTPDREKEYEFTDHYLNNDNFAIYTNKNIKNGDLKALNGLKMGFLKGEENNEWILRLLKDKGINVKPIDVSNYPEDEEYLYNNKVDFVVENTRSNINYENKNIKKIFEFSSGPVYIVSRKGNEKLIEGIDSVLGELEEDEEQKDINLYSKYFDEHLDKLKNEKLLVVIFLIIISLFIYKKRKNKIFAIRTKRKIRDYIKNDKYILYYQPIVDPKKNRVKGFESLLRLNKDGKILTPYSFIKEIEDNNMSLEVSLWLLKKVILDYRIIKDYDMVKGRDFYISLNVSFKEIENPKFLRSLMKIAKDYKIDDCNICLEIVEKFGMEDIGRIQSAIRIIKEYGFLIAIDDFGVEYSNLDLLNKIDSDIVKLDKYFADNLDKSIINEKTVEFISEICIIANRTIVFEGIEEQYQVDIVKAFPYEKIYIQGYFYSKPVDIENLKDFKFKDS
>NC_008261.1|WP_003480649.1|1072271_1072892_+|flavodoxin-family-protein
MKVLLVNGSPNKEGCTYTALKEVSKTLEENGIDTEIFQVGNKPIGGCIGCGSCKKTGECFMKDGVNEFVEKAKDVDGFVFGSPVYYAAASGSITSFLDRAFYSGGKHMAFKPGAVICSARRAGTTSTLDQLSKYLTICNMPVVSSQYWNMVHGNTPEEVKKDLEGMQTMRVLGRNMAWLIKCIELGKNNNILKPELEERERTNFIR
>NC_008261.1|WP_011590431.1|1073138_1074983_+|polysaccharide-biosynthesis-protein
MNSVRKIKCLFLIFLDILFINLGYFISLCFEYGKEMKIEYFFNIRNLIILAIFTNILIFCFFNLYKNIWHMAGISECIRCLIASSISSILLILYKFIFNMDVTIVFLINSSILICMFSLLTRMSIRIFRKIYFPYKLESNLRKNVLIVGAGHCGRIVIDEMNKNNKFNPIGIVDDDLNKKGTFLNGVKVLGNRDDIEKICKRIKVDIILIAISNLSSNDKDEIIKRCENTKIKVKIIPSIYDLIDGNVKLTNIRDIDLRDLLGRDETRLDKEEVNNYIKEKIVIVTGGGGSIGSELCRQIAVFNPKKLIILDIYENYAYELENELKRNFKNLDLEVIIASIRDKSRLKKIFDKYKPDLIFHAAAHKHVPLMENNPEEAIKNNVLGTLNVAECADEFNLEKFVFISTDKAVNPTNIMGATKRIGEMIIQAMNEVSKTDFVAVRFGNVLGSNGSVIPLFIEQIKNGGPVTLTHKDITRYFMLIPEAAQLVLQAGAYAKGGEIFVLDMGKPVKIYDLTEKLIRLSGFEPNKDIQIKIVGLRPGEKLYEELILSEEELKKTKNEKIFILSPFKFDIKEIKKKIVELLNVALNEDKKAIKEKLKEIVKNYRDLEQIDFI
>NC_008261.1|WP_011590432.1|1075095_1076289_+|DegT/DnrJ/EryC1/StrS-family-aminotransferase
MNIPFSPPDIREKEINNVIEVLKSGWITTGNKTKEFERKIAKYCETKKAICLNSATAGLELILRVLDIGEDDEVITTAYTYTASASVINHVGAKIVLADTSKDTYEIDYERLEKLINERTKAIILVDLAGIPCDYDKVFEIVNYKKKNFKAKGIIQEFLGRIAIISDAAHSFGAIYKGKISGSIADFTSFSFHAVKNLTTAEGGAVTWNIKDNELNDILYKKFSLFSLHGQTKDALSKTQVGNWEYDIVSLGYKFNMTDIMAAIGLAQFERYDEILKYRRKNIELYDKLLNVENIKVLDHFNNTLKSSGHLYFININGKDENFRNNIIKKLAERGISTNVHYKPLPMFTAYKKLGFKIEDYKNAYNLYKNEITLPLNTILTESQIEYICNELKGALI
>NC_008261.1|WP_011590433.1|1076294_1076897_+|sugar-transferase
MLNIAKRTFDLFFSLIGIIITIPIFILVSIMIKLTSKGPIIFKQERVGKNKKIFYIYKLRTMTDCDVKASDRQVTVINDQRITRIGRILRKYKIDELPQLYNVLKGDMSFVGPRPEVKKYVKFYEEEYDEILKIKPGITDLASIEYIDENTIISKYSDPEKVYIEEVLPKKLMLNKRYIEEMSIKNDILLILKTIKKIIN
>NC_008261.1|WP_011590434.1|1076919_1077945_+|glycosyltransferase-family-2-protein
MLVSFIIIAHNEEKNLKNLLEDLNGQTYPKKLIEVILIDSISSDNTKNVMNEFRNSNKEFNKIIIKSNVKKILPCGWNIAISESKGDILLRVDAHSRIPKNFIEENVNCIKSGEKICGGYRENIILNKNNWKETLLLAEKSIFGSSIAPYRRNIGKRYVSSIFHGAYSREVFENTGLFNENLARTEDNEMNYRIRKNGYKICFNPNIKSYQYTRNNLLKMLEQKFLNGYWIGLTLGVCPKCISIYHLIPFLFVLALAFTTINIFLNSYGLFIILGMLYSFLIIINTLFIIKNNEFNIFYIFLPIIFLLLHLSYGIGTFIGIIKLPFFKIKVYKGRKINEQN
>NC_008261.1|WP_011590435.1|1077931_1079059_+|glycosyltransferase
MNKIRVLHMVSTLSNGSGVMGFIMNAYRNIDRNKIQFDFIYFDNEERSITYIDEILKLGGKVNYITKPNNLRNINEFKNELSEILKKENYKIIHLHEVYLNKFVNDEAKKVVGAKVIAHSHATKYSDNKIKAIRNKILCFNLKKNVDIFFACSKAAGKFLYGKKAFYDNRVFVINNAIEIDKFKYNENIRNKVRKELNLEEKFVIGNIGRFAKQKNHKFLIDIFYEVKKKKENAFLLLIGEGDLRESIERKLEKLNLRNSVLFLSSRKDVNEILQGMDVFVLPSLYEGLPVSVIEAQTSGLPCIISNKVTDEVNIIDCKFLSITNAKVWCKYILKSEDHLRVDTNESITKAGYDIKYEALRIQNIYEKLYAGRDI
>NC_008261.1|WP_158301051.1|1079182_1080139_+|EpsG-family-protein
MFIFISAFRGRNIGNDTCKYLDLFNKVRFKSITELKDRYEIGYLYLNKMLSLISDNQQIILIVTSCIILICYAYFIKKYSANVWLSVFLFFILGYFTSSMNTIRHQIALGLVLISYKYIKENKIFKFLILILVASTFHSTSIIFLISYPISKLKINFRNIMMFFWFAILGYALFDKIFRFILLGTKYEYYLKTDYLNGDVRLATVVNILIISTVLLFGIISSNNIKKSRDYNIMCLFLFTSLSISIISLKFNLLDRVADYFQVFIIVYLPNVISKISNQKKRIIAIYLVIVMFFLYGISIQYLKPEWNKVFPYSFFWN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_008261_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_008261_3

1140440-1140660

TypeV

Consensus_repeat	Method
GTTAAAAAGATATTATGATAAATTT	CRISPRCasFinder

3 spacers

The CRISPR arrays of NC_008261_3

>merge|NC_008261|3|1140440-1140660|CRISPRCasFinder
TCTAATGAGCTTTTGTGATAAATCTTTCCTTAAATTTTCTTATTAAAGAAACTTACATAGCAAGGGTTAAAAAGATATTATGATAAATTTACTTGTGAGAATCAAGCTTATACCTAATCAATTTAGTAATGTTAAGAAGATATTATGATAAATTTTCTTTTAAATGATGCTAATATATTAAGTGTAGGAAAATAAGTTTAATAAGTTCTTATAATAAATAC

>NC_008261|3|3|1140440-1140660|CRISPRCasFinder
TCTAATGAGCTTTTGTGATAAATCT	TTCCTTAAATTTTCTTATTAAAGAAACTTACATAGCAAGG
GTTAAAAAGATATTATGATAAATTT	ACTTGTGAGAATCAAGCTTATACCTAATCAATTTAGTAAT
GTTAAGAAGATATTATGATAAATTT	TCTTTTAAATGATGCTAATATATTAAGTGTAGGAAAATAAG
TTTAATAAGTTCTTATAATAAATAC

Protein	Signature genes	Signature genes Name	Protein_function
NC_008261.1\|WP_004457245.1\|1131741_1132584_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|293837
NC_008261.1\|WP_011590500.1\|1145647_1146961_+\|McrC-family-protein	unknown	unknown	gnl\|CDD\|370821
NC_008261.1\|WP_011590491.1\|1132600_1132915_+\|DUF3784-domain-containing-protein	unknown	unknown	gnl\|CDD\|378903
NC_008261.1\|WP_041702641.1\|1143401_1143713_+\|hypothetical-protein	unknown	unknown	unknown
NC_008261.1\|WP_011590503.1\|1148754_1149531_+\|DUF1311-domain-containing-protein	unknown	unknown	gnl\|CDD\|226278
NC_008261.1\|WP_011590494.1\|1138907_1139201_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|183800
NC_008261.1\|WP_011590504.1\|1149912_1150716_-\|CPBP-family-intramembrane-metalloprotease	unknown	unknown	gnl\|CDD\|376806
NC_008261.1\|WP_011590497.1\|1142099_1143245_+\|hypothetical-protein	unknown	unknown	unknown
NC_008261.1\|WP_011590493.1\|1137104_1138484_+\|flagellin-lysine-N-methylase	unknown	unknown	unknown
NC_008261.1\|WP_011590489.1\|1129892_1130990_+\|hypothetical-protein	unknown	unknown	unknown
NC_008261.1\|WP_003462042.1\|1146986_1147370_+\|SdpI-family-protein	unknown	unknown	gnl\|CDD\|379303
NC_008261.1\|WP_011590496.1\|1141377_1141770_+\|DUF4440-domain-containing-protein	unknown	unknown	gnl\|CDD\|227327
NC_008261.1\|WP_011590492.1\|1135174_1136323_-\|exo-alpha-sialidase	unknown	unknown	gnl\|CDD\|271234
NC_008261.1\|WP_011590501.1\|1147460_1148018_-\|flavin-reductase-family-protein	unknown	unknown	gnl\|CDD\|224766
NC_008261.1\|WP_004457310.1\|1134210_1134957_+\|hypothetical-protein	unknown	unknown	unknown
NC_008261.1\|WP_011590499.1\|1143880_1145644_+\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|183088
NC_008261.1\|WP_004457215.1\|1133106_1133844_-\|sugar-phosphate-isomerase/epimerase	unknown	unknown	gnl\|CDD\|224007
NC_008261.1\|WP_011590502.1\|1148062_1148452_-\|hypothetical-protein	unknown	unknown	unknown
NC_008261.1\|WP_041702640.1\|1139591_1140212_-\|CPBP-family-intramembrane-metalloprotease	unknown	unknown	gnl\|CDD\|376806
NC_008261.1\|WP_011590490.1\|1131186_1131705_+\|ClbS/DfsB-family-four-helix-bundle-protein	unknown	unknown	gnl\|CDD\|226733

Protein	Function_ID	Function_description	E-value
NC_008261.1\|WP_004457245.1\|1131741_1132584_+\|hypothetical-protein	gnl\|CDD\|293837	cd16279, metallo-hydrolase-like_MBL-fold, uncharacterized subgroup of the MBL-fold_metallo-hydrolase superfamily; MBL-fold metallo. Members of the MBL-fold metallohydrolase superfamily are mainly hydrolytic enzymes which carry out a variety of biological functions. The class B metal beta-lactamases (MBLs) for which this fold was named perform only a small fraction of the activities included in this superfamily.Activities carried out by superfamily members include class B beta-lactamases, hydroxyacylglutathione hydrolases, AHL (acyl homoserine lactone) lactonases, persulfide dioxygenases, flavodiiron proteins, cleavage and polyadenylation specificity factors such as the Int9 and Int11 subunits of Integrator, Sdsa1-like and AtsA-like arylsulfatases, 5'-exonucleases human SNM1A and yeast Pso2p, ribonuclease J and ribonuclease Z, cyclic nucleotide phosphodiesterases, insecticide hydrolases, and proteins required for natural transformation competence. Classical members of the superfamily are di-, or less commonly mono-, zinc-ion-dependent hydrolases, however the diversity of biological roles is reflected in variations in the active site metallo-chemistry. Some members of this subgroup are named as octanoyltransferase (also known as lipoate-protein ligase B).	1.70784e-16
NC_008261.1\|WP_011590500.1\|1145647_1146961_+\|McrC-family-protein	gnl\|CDD\|370821	pfam10117, McrBC, McrBC 5-methylcytosine restriction system component. Members of this family of bacterial proteins modify the specificity of mcrB restriction by expanding the range of modified sequences restricted.	1.53384e-95
NC_008261.1\|WP_011590491.1\|1132600_1132915_+\|DUF3784-domain-containing-protein	gnl\|CDD\|378903	pfam12650, DUF3784, Domain of unknown function (DUF3784). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria and archaea. Proteins in this family are typically between 96 and 110 amino acids in length.	4.3773e-14
NC_008261.1\|WP_011590494.1\|1138907_1139201_-\|hypothetical-protein	gnl\|CDD\|183800	PRK12863, PRK12863, YciI-like protein; Reviewed.	0.000563911
NC_008261.1\|WP_011590503.1\|1148754_1149531_+\|DUF1311-domain-containing-protein	gnl\|CDD\|226278	COG3755, COG3755, Uncharacterized protein conserved in bacteria [Function unknown].	7.52816e-09
NC_008261.1\|WP_011590504.1\|1149912_1150716_-\|CPBP-family-intramembrane-metalloprotease	gnl\|CDD\|376806	pfam02517, Abi, CAAX protease self-immunity. Members of this family are probably proteases (after a isoprenyl group is attached to the Cys residue in the C-terminal CAAX motif of a protein to attach it to the membrane, the AAX tripeptide being removed by one of the CAAX prenyl proteases). The family contains the CAAX prenyl protease. The proteins contain a highly conserved Glu-Glu motif at the amino end of the alignment. The alignment also contains two histidine residues that may be involved in zinc binding. While they are involved in membrane anchoring of proteins in eukaryotes, little is known about their function in prokaryotes. In some known bacteriocin loci, Abi genes have been found downstream of bacteriocin structural genes where they are probably involved in self-immunity. Investigation of the bacteriocin-like loci in the Gram positive bacteria locus from Lactobacillus sakei 23K confirmed that the bacteriocin-like genes (sak23Kalphabeta) exhibited antimicrobial activity when expressed in a heterologous host and that the associated Abi gene (sak23Ki) conferred immunity against the cognate bacteriocin. Interestingly, the immunity genes from three similar systems conferred a high degree of cross-immunity against each other's bacteriocins, suggesting the recognition of a common receptor. Site-directed mutagenesis demonstrated that the conserved motifs constituting the putative proteolytic active site of the Abi proteins are essential for the immunity function of Sak23Ki - thus a new concept in self-immunity.	5.95249e-18
NC_008261.1\|WP_003462042.1\|1146986_1147370_+\|SdpI-family-protein	gnl\|CDD\|379303	pfam13630, SdpI, SdpI/YfhL protein family. This family of proteins includes the SdpI and YfhL proteins from B. subtilis. The SdpI protein is a multipass integral membrane protein that protects toxin-producing cells from being killed. Killing is mediated by the exported toxic protein SdpC an extracellular protein that induces the synthesis of an immunity protein.	3.57032e-17
NC_008261.1\|WP_011590496.1\|1141377_1141770_+\|DUF4440-domain-containing-protein	gnl\|CDD\|227327	COG4994, COG4994, Uncharacterized protein conserved in bacteria [Function unknown].	2.32951e-29
NC_008261.1\|WP_011590492.1\|1135174_1136323_-\|exo-alpha-sialidase	gnl\|CDD\|271234	cd15482, Sialidase_non-viral, Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.	1.99817e-67
NC_008261.1\|WP_011590501.1\|1147460_1148018_-\|flavin-reductase-family-protein	gnl\|CDD\|224766	COG1853, COG1853, Conserved protein/domain typically associated with flavoprotein oxygenases, DIM6/NTAB family [General function prediction only].	8.12118e-38
NC_008261.1\|WP_011590499.1\|1143880_1145644_+\|AAA-family-ATPase	gnl\|CDD\|183088	PRK11331, PRK11331, 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional.	2.42554e-41
NC_008261.1\|WP_004457215.1\|1133106_1133844_-\|sugar-phosphate-isomerase/epimerase	gnl\|CDD\|224007	COG1082, IolE, Sugar phosphate isomerases/epimerases [Carbohydrate transport and metabolism].	2.70164e-10
NC_008261.1\|WP_041702640.1\|1139591_1140212_-\|CPBP-family-intramembrane-metalloprotease	gnl\|CDD\|376806	pfam02517, Abi, CAAX protease self-immunity. Members of this family are probably proteases (after a isoprenyl group is attached to the Cys residue in the C-terminal CAAX motif of a protein to attach it to the membrane, the AAX tripeptide being removed by one of the CAAX prenyl proteases). The family contains the CAAX prenyl protease. The proteins contain a highly conserved Glu-Glu motif at the amino end of the alignment. The alignment also contains two histidine residues that may be involved in zinc binding. While they are involved in membrane anchoring of proteins in eukaryotes, little is known about their function in prokaryotes. In some known bacteriocin loci, Abi genes have been found downstream of bacteriocin structural genes where they are probably involved in self-immunity. Investigation of the bacteriocin-like loci in the Gram positive bacteria locus from Lactobacillus sakei 23K confirmed that the bacteriocin-like genes (sak23Kalphabeta) exhibited antimicrobial activity when expressed in a heterologous host and that the associated Abi gene (sak23Ki) conferred immunity against the cognate bacteriocin. Interestingly, the immunity genes from three similar systems conferred a high degree of cross-immunity against each other's bacteriocins, suggesting the recognition of a common receptor. Site-directed mutagenesis demonstrated that the conserved motifs constituting the putative proteolytic active site of the Abi proteins are essential for the immunity function of Sak23Ki - thus a new concept in self-immunity.	7.04878e-19
NC_008261.1\|WP_011590490.1\|1131186_1131705_+\|ClbS/DfsB-family-four-helix-bundle-protein	gnl\|CDD\|226733	COG4283, COG4283, Uncharacterized conserved protein [Function unknown].	6.54088e-73

>NC_008261.1|WP_041702640.1|1139591_1140212_-|CPBP-family-intramembrane-metalloprotease
MLVYLLIYKCKKYNKNKIINKLPRKDIPKYALISMGMGGLSALWLIFADTILSSITLVKNSLQNFSQISESLNNEAYIFIFLSVILFGPIVEELLFRGLIFNEIDKIKGGAAPIILSGLLFGLFHREPVQVVYASILGIILGFVYSKTRSLPLVIFMHMLNNLVATLPPPLAKHEILQFVNGFQIISIVPMAYLLSKLYKKGSLTN
>NC_008261.1|WP_011590494.1|1138907_1139201_-|hypothetical-protein
MKYFIVEGILKDSDKINEDIMKKHMAYTQKAMDEGMILVSGLKSDMSGGIFVIKSESVEKLESYLSKEPFKLYGIQDYKFVEFNAHYFNPSPSEWFK
>NC_008261.1|WP_011590493.1|1137104_1138484_+|flagellin-lysine-N-methylase
MKVRVPNYFNEFKCIASECEDTCCAGWEIVIDDETHKRYENVDGEFGEILRSKIVKSDGENIFLLNNGNCSFLNEKKMCEIYINLGEDHLCYTCQQFPRYTEEFLDLKEVGLSLSCPEAARIILRKAENTTFNLSEEVNCENEMQEELEDDLSLSCENINPSNCTLGKCSNSKDNENRKSSNLSESENRECFDLKNSEDSECNNSEVESFTDDEDCFDEGIDAEVLSEFLECRNIVFNIIERNDLDLGTKAALALEFVKEVQNKIDLGDMDEIPELMEEYRDENFINTLLKELECFKGKESIKHKNLCEYLNVYKSIKHINSNDPLGLEKALKYFEGNEEFYLRKHKEFNEYYKENLYKFKNILVYFIFRYFMKAIFDYDVSAKIKLAIISTLMIKELAVVRFIENNNEFTEEDMVEVSRIYSKDIEHSDENIENLQEIFETEEIFEVDEILPMLMNDF
>NC_008261.1|WP_011590492.1|1135174_1136323_-|exo-alpha-sialidase
MYNKNNTFEKNLDISHKPEPLILFNKDNNIWNSKYFRIPNIQLLNDGTILTFSDIRYNGPDDHAYIDIASARSTDFGKTWSYDIAMKNNRIDSTYSRVMDSTTVITNTGRIILIAGSWNTNGNWAMTTSTRRSDWSVQMIYSDDNGLTWSNKIDLTKDSSKVKNQPSNTIGWLGGVGSGIVMDDGTIVMPAQISLRENNENNYYSLIIYSKDNGETWTMGNKVPNSNTSENMVIELDGALIMSTRYDYSGYRAAYISHDLGTTWEIYEPLNGKVLTGKGSGCQGSFIKATTSNGHRIGLISAPKNTKGEYIRDNIAVYMIDFDDLSKGVQEICIPYPEDGNKLGGGYSCLSFKNGHLGIVYEANGNIEYQDLTPYYSLINKQ
>NC_008261.1|WP_004457310.1|1134210_1134957_+|hypothetical-protein
MRRYKMVIISIIILLLINNIMHSKVSYALDIANSKNQVLLSEIPNEEIYLYALDSDEGKSVYEDILLNVKGKKKRFNWIVDSGLSFRPELILTDINNDGKKELVIIITTGHGTGINTQEVHIFKEETLEEIKVQNPFDIISKNVKTKVYKDENSVKVYININGKESVISSKKLNELYNDQNNKKNFGDTLFFRDFLIYEVYNEKLKAIVGGDIFFWNYLVNIKIEYKFESNMLVVDKIYFDVTEYFKD
>NC_008261.1|WP_004457215.1|1133106_1133844_-|sugar-phosphate-isomerase/epimerase
MPQLGCLARFFNRYKDEFKFAKENNFDFMQLWYDNRGLCLHEDDKDFINTINKYNFPTIIHAVLNINEFEEHIPKLLDILNKLNHKELIIHPICENEDIDEETLNKLNLNIKYALNILKPHGINLFLENNSKLDPIFTTTDEIQKIFSQNADLEFLLDIAHIDNINHLQDLINIKYPKILHIADRHFDVIHEHLPIGHGEIDFQHIFSKLLPQYNGKIILEIVNKDSDIINSKNLIQNFLNTPNK
>NC_008261.1|WP_011590491.1|1132600_1132915_+|DUF3784-domain-containing-protein
MSMKILMIALFILLGIMFSLGKWSFLIAGFNTMTKEKKAKYDVMSLCKFMGKLMFIIAFCITLFTLSDIFMMKILFNIGTVILIVSIIFTIIYANTGNHFERKN
>NC_008261.1|WP_004457245.1|1131741_1132584_+|hypothetical-protein
MKFRIVGSGGCVSLPKPLCNCEVCKEARSKGRSYSRCGCSLFLDDINLLVDTPEDITYGINYCDIKEIDRVLFSHVDPDHTLGMRVFEHLRLNWLELSCGKNCENPIEVFALEDVMKDINSIGFKFGSYLDYYENVRNLIKRKSVEDYIFIKNIKVSFIKVNHATVFVFEKEGKKLIYAPCDVKPFPESKLFLNADCLIIGNTIVGEVLKDGFILKEDNPLRDELFTIGDIEELKNKYNIKRVIITHLEEDWGKSYDDYVELEKGLDGIEFAYDGMKIEI
>NC_008261.1|WP_011590490.1|1131186_1131705_+|ClbS/DfsB-family-four-helix-bundle-protein
MRTYESKEELKKEIDKYYKKYIAEFDNIPNDLKDSRCEEVDRTPAENLAYQIGWTTLILNWEKDEKAGLKVKTPSDKFKWNQLGDLYNWFNEEYAFLSLSQLKLLLAENIENIYKMIDSMSNDELFKPHQRIWADEATKTAVWEVYKFIHVNTVAPFGTFRTKIRKWKKLML
>NC_008261.1|WP_011590489.1|1129892_1130990_+|hypothetical-protein
MNRCELLLIVDGDTIEVEAKVTLEKEMKLSFALKDSFNMLYSSAEYDTELMEPNFIGKCNKYILKEETDNFTLRYRGKPYGFCTECSDEKVLLSFYCAWYPILDDFLFDDIKVIIKGLENFIVLDAVKEKDFWIFNNKIPFDCNIRAFNKDKVFSSECDFIKIYSGKESELGYINKIVGELHKINEYYSRILGEKENNKLQLISTGIENSGGYFREGFIVLPCLEDNDKFIYSFLGHELAHAWHMGYSVTTYDDWLNETGAEWSSLSYILSIGKNDLYNKQIQYAIKAFEEYPIMKPEDGSRPRTAHFGGVLLFDKIYKRYGLDTINKLLRLAYETTPKNTDEFLKRVKGDFDTEIYNILSEPFR
>NC_008261.1|WP_011590496.1|1141377_1141770_+|DUF4440-domain-containing-protein
MDSIKEQIFQLENDLIKSEVRKSAKKINEILSNDFVEFSSSGSEYHYKCGDVFQDEEDERTLDWEILNFKVKKVAENCILATYRVIKHDELDERKRYSLRSSLWTEENGKWKMSFHQGTLLAGKEGRSIF
>NC_008261.1|WP_011590497.1|1142099_1143245_+|hypothetical-protein
MKHKKEVFIAALIIVFLIAIGPSIKKQVGIYTKGKNIEKSYFKDSLYDIYITNGEGLGLIQISNIQKGNINYSKIDNINVKYDSANFLFIEKDLGGEIYVPYSSDIENPKNANRLLIFNEGKLEDEIEFDDIRNPQTVISDRENNRILLEQNITVQPEDSQGLKLKVIDTTSKEVIKELYLKGYIRDYYVGEKEIVLSLEGAKKLCFLDAQDRSLYAINRETLEGREISKEPICNVVNALCGDSKGNNVIFTNITLKESGDLNKNEIIVMDSHGEIKERKEVPYDMNGSFYGNEKYEYVLNGKIHNKNNGFLIFNKETLEFEKLVDDVKDISYIESLDGYLFILTRDSKLFIYDENTLEQIGSIELEGEVSHRMKVIKKKG
>NC_008261.1|WP_041702641.1|1143401_1143713_+|hypothetical-protein
MGKGSVEINIDRVIFIGLIIEFICTAFIFFNFTTLYENLNLIIDCLMILNVIIFILSIIYFKYNKKLALRYTIISLIFFSFSDKSMYSLILVIILIMQGKGMY
>NC_008261.1|WP_011590499.1|1143880_1145644_+|AAA-family-ATPase
MDKIKNEVTKEVKDLTKEDYLSILEFLKNHAGEEYSNPENEENIEEKNKYIALREEAQETLSKFRAIGDLFKEEGLVYEKKGASKWLVAARVTRVRNYLWIELKEPEKMGFSTSISIFADKIEEGNKLRFRVVLETKDLKSDEGDYVRHFRFLEELDPEEDKFEYWDNYSDYSYLERGKTSDIRALIQDVKERKELKLQIGRTLYYEDVKRISKEEIREFFEDAVKELKPYYDLAVEGEYSLLGEEELGISEEGEEYLEEPKILKVKNQILYGPPGTGKTYNAINRALEIIDFKKYKELIGNEGEREKVIKVFNELLEEGQIAFCTFHQSYGYEDFVEGLRSNESGAGFVPKDGIFKKLCRKASKSPKNYVLIIDEINRGNISKIFGELITLIEDDKRLGEKNELKVTLPYSNERFGVPKNLYILGTMNTADRSIALLDTALRRRFEFFEYMPKEELLPEDACGINLREFLRVINERIEYLFDREHTIGHSYFLKEDLTFEELVSIMKNKVIPLVQEYFYGDWEKVELVLGGSCKKGKSNRFIEKSRIDTRKLFKGMMVDSYGEEYKYSIVENPEKEAFLNIYEDEE
>NC_008261.1|WP_011590500.1|1145647_1146961_+|McrC-family-protein
MRHIIIKESYESLRIVDDFYDYEGEYFYGNYSCEKIISRREAHELYNYAMSKKLDMDNILWERDTLRFINYVGYIRLSTVSIEILPKISLNDSAELERKALLNMLSKCGILKVNYSEISSLKLYKQSLNEILAYLFSKKLQKELRKGVYGEYVYIEENINSLKGSLRVQEQIKNMSSHSSKAFCRFEEFSRDNKLNKILSFFVKEVMKNIKNRETLKLLRISEMILGDVDERSITLNEVNNFSFNRLNKPFEDAFTLGKMIVLGESAIGNLGGNKAYSILFKMNEIFEIYIGKLLKQLLYKETVHMQHSKYKLLIKEESNRGVFKLIPDIVIEKNGIERIIIDTKWKSVESKFNRHGVKREDLYQMYAYLTRYKNVSTVILLYPYNERIEGEEGEYLESWYLDEEEHKRVRVYEVNLENEKETLKSLDKIVRKYLEE
>NC_008261.1|WP_003462042.1|1146986_1147370_+|SdpI-family-protein
MGFWIFMMVMELLIPLIMIILGKQFSKKAPKEINYFYGYRTSMSMKNKDTWEFAHKYCGRLWLKIGYIMFAISFIIMLFVLGKGEQAIGTLGGALCMIQCVVLVASIFPTERALRKNFDKYGNRKNV
>NC_008261.1|WP_011590501.1|1147460_1148018_-|flavin-reductase-family-protein
MSKVKFNKLPLVYPIPSVLIGTVINDKPNFATIGNCGIISLNPAVIYISMEKNHYTNKGIRENQVFSINIPSADLVEKVDYCGLVSGNNIDKSQIFKCFYESNNKIPLIKECPINMECKVTKIIEIYDMEVFIGEIIETYVNQDLLTNGFPDTKKINPLIYSMDNNYWEIGNFIGNAFNIGKNIK
>NC_008261.1|WP_011590502.1|1148062_1148452_-|hypothetical-protein
MDDLILKRCKYCDKTYEGTNESCCCSEPCNIKYQKYMKQREKTETPVKIFSIILLLIFFINIMFLPNNPISKYLFIAISLIAPALHVIFPFGEDKGLQKRGVKKTKILFRTIGIAILIYILTYYFLEQL
>NC_008261.1|WP_011590503.1|1148754_1149531_+|DUF1311-domain-containing-protein
MKKRNYLISLLAVVLSLGVLVGCGDKTNTSNEGASVNSSENSDAASSKDSADVVKDKGESDKAQAKDADSKDKEATNKDESEKKEEDIKNDSSTKETAKVDNSNKNESKGASNSSKKEESKSASKKENSKDESSLAKSKSEYLQKMKNIDSESEKLDKEYETEEGSTQMGMNIISGKQAKLYDAELNQIYDYLKQNLSKEKSKELEKSEMAWIKEKESNIAEIKKQYEGGSVTPLMVNSEVAKESKERCYYLIDNYMK
>NC_008261.1|WP_011590504.1|1149912_1150716_-|CPBP-family-intramembrane-metalloprotease
MTLSENKTLELTKSIFSLIFIYIGIEFLAAIILIPFAIVLDLIFKVNLLGNQYDSILNLILNCTDQVLGIYFFTKIYRKKEFYVPKINNHMSLKTLGKYALISLGVSGISNLWIFLMQFLATYSPTIKSSLESFIEHDEIFNANPILAFISVAILAPIVEEIIFRGIIFNEAAKYKGGAFPIIISALLFGLAHMQPIQIVYAFIVGLIFGFVYSKTHSLPIVMFLHMLNNLLTLFPEPFSTFISIIQILCIIPMIYLLKKLYKESTV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_008261_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_008261_4

2323528-2323640

Orphan

Consensus_repeat	Method
TTCTATTTAAATCTATTACTTTACATAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_008261_4

>merge|NC_008261|4|2323528-2323640|CRISPRCasFinder
TTCTATTTAAATCTATTACTTTACATAAGAAATTATTCTAATTATTTTTAAAATAATAAATCTTTTTTGGAGACCTCTTCTTCTCTTCTATTTAAATTTATTACTTTACATAA

>NC_008261|4|4|2323528-2323640|CRISPRCasFinder
TTCTATTTAAATCTATTACTTTACATAA	GAAATTATTCTAATTATTTTTAAAATAATAAATCTTTTTTGGAGACCTCTTCTTCTC
TTCTATTTAAATTTATTACTTTACATAA

Protein	Signature genes	Signature genes Name	Protein_function
NC_008261.1\|WP_003458656.1\|2327071_2327584_-\|type-II-secretion-system-protein	unknown	unknown	gnl\|CDD\|225076
NC_008261.1\|WP_003451649.1\|2324185_2324743_-\|elongation-factor-P	unknown	unknown	gnl\|CDD\|234788
NC_008261.1\|WP_003458726.1\|2325657_2326269_-\|hypothetical-protein	unknown	unknown	unknown
NC_008261.1\|WP_003458684.1\|2320035_2321208_-\|stage-III-sporulation-protein-AE	unknown	unknown	gnl\|CDD\|213743
NC_008261.1\|WP_003451410.1\|2317853_2318243_-\|Asp23/Gls24-family-envelope-stress-response-protein	unknown	unknown	gnl\|CDD\|377129
NC_008261.1\|WP_011590962.1\|2324913_2325261_-\|hypothetical-protein	unknown	unknown	unknown
NC_008261.1\|WP_003458702.1\|2327603_2328032_-\|prepilin-type-N-terminal-cleavage/methylation-domain-containing-protein	unknown	unknown	gnl\|CDD\|236714
NC_008261.1\|WP_003451516.1\|2322627_2323512_-\|stage-III-sporulation-protein-AA	unknown	unknown	gnl\|CDD\|274324
NC_008261.1\|WP_003458668.1\|2326640_2326937_-\|hypothetical-protein	unknown	unknown	unknown
NC_008261.1\|WP_003458718.1\|2323709_2324072_-\|hypothetical-protein	unknown	unknown	unknown
NC_008261.1\|WP_003458670.1\|2321965_2322481_-\|stage-III-sporulation-protein-SpoAB	unknown	unknown	gnl\|CDD\|131880
NC_008261.1\|WP_003481876.1\|2325257_2325698_-\|hypothetical-protein	unknown	unknown	unknown
NC_008261.1\|WP_003451671.1\|2321692_2321890_-\|stage-III-sporulation-protein-AC	unknown	unknown	gnl\|CDD\|131895
NC_008261.1\|WP_011590964.1\|2326243_2326654_-\|hypothetical-protein	unknown	unknown	unknown
NC_008261.1\|WP_003451336.1\|2318850_2319456_-\|stage-III-sporulation-protein-AG	unknown	unknown	gnl\|CDD\|274319
NC_008261.1\|WP_003468981.1\|2319470_2320028_-\|stage-III-sporulation-protein-AF	unknown	unknown	gnl\|CDD\|131942
NC_008261.1\|WP_003451406.1\|2321218_2321605_-\|stage-III-sporulation-protein-AD	unknown	unknown	gnl\|CDD\|131896
NC_008261.1\|WP_011590966.1\|2328024_2329044_-\|type-II-secretion-system-F-family-protein	unknown	unknown	gnl\|CDD\|224376
NC_008261.1\|WP_003451536.1\|2318327_2318825_-\|SpoIIIAH-like-family-protein	unknown	unknown	gnl\|CDD\|378918
NC_008261.1\|WP_003451187.1\|2317327_2317735_-\|transcription-antitermination-factor-NusB	unknown	unknown	gnl\|CDD\|234686

Protein	Function_ID	Function_description	E-value
NC_008261.1\|WP_003451649.1\|2324185_2324743_-\|elongation-factor-P	gnl\|CDD\|234788	PRK00529, PRK00529, elongation factor P; Validated.	2.22205e-107
NC_008261.1\|WP_011590966.1\|2328024_2329044_-\|type-II-secretion-system-F-family-protein	gnl\|CDD\|224376	COG1459, PulF, Type II secretory pathway, component PulF [Cell motility and secretion / Intracellular trafficking and secretion].	1.10653e-52
NC_008261.1\|WP_003458684.1\|2320035_2321208_-\|stage-III-sporulation-protein-AE	gnl\|CDD\|213743	TIGR02829, Stage_III_sporulation_protein_AE, stage III sporulation protein AE. A comparative genome analysis of all sequenced genomes of shows a number of proteins conserved strictly among the endospore-forming subset of the Firmicutes. This protein, a member of this panel, is found in a spore formation operon and is designated stage III sporulation protein AE. [Cellular processes, Sporulation and germination].	3.04994e-149
NC_008261.1\|WP_003451410.1\|2317853_2318243_-\|Asp23/Gls24-family-envelope-stress-response-protein	gnl\|CDD\|377129	pfam03780, Asp23, Asp23 family, cell envelope-related function. The alkaline shock protein Asp23 was identified as an alkaline shock protein that was expressed in a sigmaB-dependent manner in Staphylococcus aureus. Following an alkaline shock Asp23 accumulates in the soluble protein fraction of the S. aureus cell. Asp23 is one of the most abundant proteins in the cytosolic protein fraction of stationary S. aureus cells, with a copy-number of >25000 per cell. A second Asp23-family protein, AmaP, which is encoded within the asp23-operon, is required to localize Asp23 to the cell membrane. The overall function for the family is thus a cell envelope-related one in Gram-positive bacteria.	5.69298e-30
NC_008261.1\|WP_003458702.1\|2327603_2328032_-\|prepilin-type-N-terminal-cleavage/methylation-domain-containing-protein	gnl\|CDD\|236714	PRK10557, PRK10557, prepilin peptidase-dependent protein.	0.00245866
NC_008261.1\|WP_003451516.1\|2322627_2323512_-\|stage-III-sporulation-protein-AA	gnl\|CDD\|274324	TIGR02858, Stage_III_sporulation_protein_AA, stage III sporulation protein AA. Members of this protein are the stage III sporulation protein AA, encoded by one of several genes in the spoIIIA locus. It seems that this protein is found in a species if and only if that species is capable of endospore formation. [Cellular processes, Sporulation and germination].	1.56037e-161
NC_008261.1\|WP_003458656.1\|2327071_2327584_-\|type-II-secretion-system-protein	gnl\|CDD\|225076	COG2165, PulG, Type II secretory pathway, pseudopilin PulG [Cell motility and secretion / Intracellular trafficking and secretion].	0.000623571
NC_008261.1\|WP_003458670.1\|2321965_2322481_-\|stage-III-sporulation-protein-SpoAB	gnl\|CDD\|131880	TIGR02833, Stage_III_sporulation_protein_AB, stage III sporulation protein AB. A comparative genome analysis of all sequenced genomes of shows a number of proteins conserved strictly among the endospore-forming subset of the Firmicutes. This protein, a member of this panel, is designated stage III sporulation protein AB. [Cellular processes, Sporulation and germination].	1.85407e-76
NC_008261.1\|WP_003451671.1\|2321692_2321890_-\|stage-III-sporulation-protein-AC	gnl\|CDD\|131895	TIGR02848, Stage_III_sporulation_protein_AC, stage III sporulation protein AC. Members of this protein family are designated SpoIIIAC, part of the spoIIIA operon of sporulation genes whose mutant phenotype is linked to sporulation stage III. Members of this family are encoded by the genome of a species if and only if that species is capable of endospore formation, as in Bacillus subtilis. The molecular function of this small, probable integral membrane protein is unknown. [Cellular processes, Sporulation and germination].	1.97477e-14
NC_008261.1\|WP_003451336.1\|2318850_2319456_-\|stage-III-sporulation-protein-AG	gnl\|CDD\|274319	TIGR02830, Stage_III_sporulation_protein_AG, stage III sporulation protein AG. CC A comparative genome analysis of all sequenced genomes of shows a number of proteins conserved strictly among the endospore-forming subset of the Firmicutes. This protein, a member of this panel, is found in a spore formation operon and is designated stage III sporulation protein AG. [Cellular processes, Sporulation and germination].	2.26928e-69
NC_008261.1\|WP_003468981.1\|2319470_2320028_-\|stage-III-sporulation-protein-AF	gnl\|CDD\|131942	TIGR02896, Stage_III_sporulation_protein_AF, stage III sporulation protein AF. This family represents the stage III sporulation protein AF of the bacterial endospore formation program, which exists in some but not all members of the Firmicutes (formerly called low-GC Gram-positives). The C-terminal region of this protein is poorly conserved, so only the N-terminal region, which includes two predicted transmembrane domains, is included in the seed alignment. [Cellular processes, Sporulation and germination].	1.64506e-24
NC_008261.1\|WP_003451406.1\|2321218_2321605_-\|stage-III-sporulation-protein-AD	gnl\|CDD\|131896	TIGR02849, Stage_III_sporulation_protein_AD, stage III sporulation protein AD. Members of this family are the uncharacterized protein SpoIIIAD, part of the spoIIIA operon that acts at sporulation stage III as part of a cascade of events leading to endospore formation. Note that the start sites of members of this family as annotated tend to be variable; quite a few members have apparent homologous protein-coding regions continuing upstream of the first available start codon. The length of the alignment and the scoring cutoff thresholds for the model have been set to try to detect all valid members of the family, even if annotation of the start site begins too far downstream. [Cellular processes, Sporulation and germination].	5.58273e-33
NC_008261.1\|WP_003451536.1\|2318327_2318825_-\|SpoIIIAH-like-family-protein	gnl\|CDD\|378918	pfam12685, SpoIIIAH, SpoIIIAH-like protein. Stage III sporulation protein AH (SpoIIIAH) is a protein that is involved in forespore engulfment. It forms a channel with SpoIIIAH that is open on the forespore end and closed (or gated) on the mother cell end. This allows sigma-E-directed gene expression in the mother-cell compartment of the sporangium to trigger the activation of sigma-G forespore-specific gene expression by a pathway of intercellular signaling. This family of proteins is found in bacteria, archaea and eukaryotes and so must have a wider function that in sporulation. Proteins in this family are typically between 174 and 223 amino acids in length.	3.45938e-23
NC_008261.1\|WP_003451187.1\|2317327_2317735_-\|transcription-antitermination-factor-NusB	gnl\|CDD\|234686	PRK00202, nusB, transcription antitermination factor NusB.	2.5545e-50

>NC_008261.1|WP_003451516.1|2322627_2323512_-|stage-III-sporulation-protein-AA
MKEIFDVLPDKINSCLKDKSNLNKLQEIRVKVGKPLNIVLDNTETIFNYVIRREDVKAIIQKISNYSLYAFEEDIRQGYITIQGGHRVGLAGQCVIEDNSIKTIRNITSLNIRVCREIVGCSNSLMNSLVENNRVNNTLIISPPKCGKTTLLRDITRNISNGISQIGFKGKRTVVIDERSEIAACYNGIPQMNVGMRTDVYDNCIKSEGMMMAVRGLSPEVIICDEIGTYKDMEGLMMAYNSGVSIIATLHGRNVEELYRRPVFREIVENNIINKVVVLSGKKGIGTIEGIYNV
>NC_008261.1|WP_003458670.1|2321965_2322481_-|stage-III-sporulation-protein-SpoAB
MKVFFLLIIVLLSSLIGYLYGEGFRNRLSQLRELKRALIDFENDIVYTYTPLPESIESIALKAKSPIKELFNEISFKLKNNEVENVYMAFKESINEHKKEMNLRNKDFEILLDLSKSLGETNVEGQIKIFNLAKEKLDIELEIAEDECNKNTKVYRYLGVAVGAMIAIFLV
>NC_008261.1|WP_003451671.1|2321692_2321890_-|stage-III-sporulation-protein-AC
MSDLSLIFQIAGVGIVLVILDKVLDQSGKKEYATLANIVGVVIILTMMIQLISRLFSSVKSMFLF
>NC_008261.1|WP_003451406.1|2321218_2321605_-|stage-III-sporulation-protein-AD
MDVVIQVISFVLISLFLYLVLKDNKSTFAVFLLLGAGIVIFLFVMPYVNEIIAFMQDIARESGMDSSYIAIVMKIIAIAYLSTFCSYICNDAGVTVLGKKVEFTGKIMILLLAIPIMANILNSILSIM
>NC_008261.1|WP_003458684.1|2320035_2321208_-|stage-III-sporulation-protein-AE
MKKLINIILLSLIFVFCFNLKVLANDNLESSKEKIDNDSRIERFYDYINNLETEEDILGNMSAKEYIMNYLESGEDPITLKKIGASILSYIFRELNIVLKFIASILVIALLSALLKNLQDAFNIEEGVTQIAFFACYALLIMLLTKSFFISLNLGKEVLTSIIDFMNVIVPVIVMLIATSGGVTSAVTIDPIVLGAVSITPRIYTYFLFPLILAYFTLQFVNNLSSEFKIDRMCKFIKQVVMISQGFILTIFVGILTLRGMTADTLDAVAVKTVKFAVDNFVPIVGKAFSDAITTVAGYSLAMKSVITSLGVIVIVVIVIYPIIKIGLMAICFKLTSAVIEPVVDSKISSSVETVGEALFMIMSCIISVSIMFFIMASMMATAGNFIVGG
>NC_008261.1|WP_003468981.1|2319470_2320028_-|stage-III-sporulation-protein-AF
MELLKNWISTLCVVIVIISIAHIILPNSSIKKHVKFAFSLIILSVMLSPIIGLLTMNKDIDETVFQEKISDVTRSDEEKKSLYDEEAILKSVEKNLEKSLKDEFYENEFEVNLIGKIDFDEVKFNIEKAEITVLDEKKVKKVDKVVVGKEKVNKEEKKDSFLEKIEKFVEKELEISHENIIVSYA
>NC_008261.1|WP_003451336.1|2318850_2319456_-|stage-III-sporulation-protein-AG
MHELKEKIANLFKQKNITNLIILLLLVIMFYLVVSYFTGVNNITKSEKTNLEKVSKEDMNSNSQKDSEVLSYQEKQEKDLERILGKINGVGSVDVVINFQSSEVKVPAVDNSSQKSTTEETDSEGGTRVNSQETDGDKIVMSNSSNGSEPVILKTEKPEVLGVMVVAEGAEDSKIKYEITKAISSLYNISVDKVNVLAMKK
>NC_008261.1|WP_003451536.1|2318327_2318825_-|SpoIIIAH-like-family-protein
MNRKQAGIILTLLALIVCTGVLATRVNNQIKESMGEVPTAFGENDDNATETSSNYFYESRNLREQKDSKTIDNLKAIVEDKNTSAEQKEEAEKELTEKTMARDYETRIELSIKSKGYEDVICFIDGDNAKVVVKTNEELTQEKMVEIQDIVMNVSKVYDVDIEKK
>NC_008261.1|WP_003451410.1|2317853_2318243_-|Asp23/Gls24-family-envelope-stress-response-protein
MNEMNRDEANLGIVNISDEVIGVVAGIAASEIDGILEINHNNSTGIGHKFSKKSLGKGIKVNVENGEAVIEIGVTVQYGIKIPDVVSQVQENVRRTVEAITGLKVALVNIYVQNIIILKEEDKNEILKK
>NC_008261.1|WP_003451187.1|2317327_2317735_-|transcription-antitermination-factor-NusB
MNRVKSREYLLQLAYQMEITSETALETFNSFMENEDISKDDLDLAYIKSGLLGIEENKEKLDSLIESQLVKWKLNRISKVNLSILRISTYEILFAEDVPGKVSINEAIELCKKYSDNKSVSFINGVLDKVYKNMQ
>NC_008261.1|WP_003458718.1|2323709_2324072_-|hypothetical-protein
MKDIKNNISNLLKAMDKNTELDKEFKDSLLNVISSLVDKIEELQVNVETLDENVNLLNDDLSGVQDELFEELTLEELEEYDDEYCEVVCDKCHKPIYIEKDILNRSESIPCPYCGNEFEV
>NC_008261.1|WP_003451649.1|2324185_2324743_-|elongation-factor-P
MISGSDLRKGTTFELDGQVYTVIDFLHVKPGKGAAFVRTKLRNVIMGGVTDRTFNPTDKLQEAIIERKEMQYLYSDGELYYFMDQETFEQIPLNHEKVEDAIKFLKENMNAVIKFYKGEAFSVEAPNFVELLITECEPSVKGNTATTAMKTAVVETGATVMVPMFVEEGNTIRIDTRTGEYMERV
>NC_008261.1|WP_011590962.1|2324913_2325261_-|hypothetical-protein
MKKLKLDVTLATIFIVILLVQGIELFQLRNYEIPVLTNSIGEMDLNTVLKNIENKDCTVLQLEYKEGWIGKVLFTGSLEDLSNYVNLLKNNNINIKNYKIEKSEELRCFLDLKVV
>NC_008261.1|WP_003481876.1|2325257_2325698_-|hypothetical-protein
MRLEVRRIYIKKYKNFLPIEYVEEYNRKIKKKLNIYILLLLLFNLFFYGKIKTENNKIKNYLSEIKGVNRERSLDKEFLEDINKLKEIIKDEKILNLSLERKSFEVEVNSIYKNSLINYINKINGRVYDISLNESNNTYRLKGELR
>NC_008261.1|WP_003458726.1|2325657_2326269_-|hypothetical-protein
MLIKTLVINDTNDISKLKELKDKRVKIILLNEKIFIETLRVDKKCNIEEKIEQLIRDRFFNYTPLVHYEVLKYKKSLFLIVYFIGCDERFKSLLYERKDFALTFPELKNKNILSFKKATFELKNLKISIYIKGKLVLLKSVKDSNIIEVIEESLKGLEKDFGVSLKDFTFKIQKEYLKEEIKEWFKGLKLNEIRGEENLYQKI
>NC_008261.1|WP_011590964.1|2326243_2326654_-|hypothetical-protein
MKRRKGFVSIEVMLVSLICSMIVTILMDNSFQRRKELDRSFKIISSNIDKNNSEEQFLKYMLKEKILNIDNINKLDFTLNNMNATYIEDKKAIHIKSKDKISGVFKDTYYGIDFRNDDIILSKRGNYEFVNKDLSN
>NC_008261.1|WP_003458668.1|2326640_2326937_-|hypothetical-protein
MYLNHRFWDNMVENIKINKDKNYILVKFWRDGIVAEDKIEKIKNKLYVYYNYTGYGRNYSPALIEDVEKFDLMEKGNLFYIKLKVKNQEERIYCYEKA
>NC_008261.1|WP_003458656.1|2327071_2327584_-|type-II-secretion-system-protein
MEDKINKKKGYLLVDMVLALALISILFLGIGKSYSTYIKNNYYIKEKIKVAEIINSLAMELKHNISFEDLRSINSGTYKISSLKINDLINSDIKEFLRKNLILHNKNHNDLGWTINISHFDQYESIINIIYKNEKPYISENKEVKIYKFLEKSFQNLENPPQKEEEKHIY
>NC_008261.1|WP_003458702.1|2327603_2328032_-|prepilin-type-N-terminal-cleavage/methylation-domain-containing-protein
MYRKRKGFTLSEVIIYLAITSLILAIPTSFMIIKDRGYELKVEGEISKIHDFLMEAKQLSKKDNLYGEIIFDILDNKLIYENALRTTSLKLNEVKVSFNRDNLITINETGMISISGTITIIDKNNKRREITIVPGIWKINVK
>NC_008261.1|WP_011590966.1|2328024_2329044_-|type-II-secretion-system-F-family-protein
MFGFKDEASYICLNLSTYVKSGMPIGRSLDLIKNTVKDKKYKESLKRIEKKVLNGEALSKAFKEEGNLYPDLMKDMMKIGEESGNLEEVLEKCARNILAEKEIKNKIIKSLRYPISLLIGLIIMIFGYVTYILPQFVDMYELRGIEGSKIMTLLNNYINFVEENPNVEVIVFCYFSCVLISLYLFFKVIPSEKILEKIEVYRMYYEIRILFLISMILNSGISLNNSLSVFGESLSDVKLRKYIKSINEELIKGTTLSSSIWKINVISHVSKGFLITGEESGLFSKNIEELLKIREKDFDRALNKTVGKIEPAMFIILGFVISAMMLLVLVPTFEGMKYV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

796479 : 809069

Synechococcus_phage(25.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003457021.1\|796479_797130_+	aminotransferase	A0A1B1P8C0	Bacillus_phage	2.9e-14	31.1
WP_003456962.1\|797634_798945_+	phosphomethylpyrimidine synthase ThiC	NA	NA	NA	NA
WP_011590300.1\|799182_802983_+	phosphoribosylformylglycinamidine synthase	A6N228	Microbacterium_phage	3.3e-33	25.0
WP_003453078.1\|803293_803773_+	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	2.6e-28	47.4
WP_003456948.1\|803772_804480_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	M4SM18	Cyanophage	2.8e-47	43.8
WP_011009969.1\|804501_805947_+	amidophosphoribosyltransferase	A0A1B1ISH6	uncultured_Mediterranean_phage	1.4e-56	33.0
WP_003468449.1\|805947_806949_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3FGG1	Synechococcus_phage	6.7e-71	49.0
WP_003468450.1\|806936_807551_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	2.2e-24	38.3
WP_011590302.1\|807563_809069_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	1.2e-66	47.2

DBSCAN-SWA_2

1085225 : 1150716

Clostridium_phage(82.5%)

integrase,holin,capsid,protease,terminase

attL 1082439:1082455|attR 1097346:1097362

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1082439:1082455	attL	NA	NA	NA	NA
WP_011590443.1\|1085225_1087037_+	ribonucleoside triphosphate reductase	D9ZNH0	Clostridium_phage	5.4e-220	62.6
WP_011590444.1\|1087033_1087492_+	4Fe-4S cluster-binding domain-containing protein	D9ZNH1	Clostridium_phage	1.3e-29	48.6
WP_011590445.1\|1087686_1088409_+	hypothetical protein	NA	NA	NA	NA
WP_003477284.1\|1089076_1090141_-\|integrase	site-specific integrase	B3GVW7	Streptococcus_phage	1.6e-33	33.1
WP_011590446.1\|1090233_1090698_-	ImmA/IrrE family metallo-endopeptidase	A0A0A7RVV2	Clostridium_phage	7.0e-39	51.3
WP_110003070.1\|1090713_1091190_-	helix-turn-helix transcriptional regulator	A0A0A7RTR3	Clostridium_phage	3.3e-28	53.2
WP_011590448.1\|1091368_1091605_+	helix-turn-helix domain-containing protein	B6SBW9	Clostridium_virus	5.7e-13	57.9
WP_011590449.1\|1091616_1092348_+	ORF6C domain-containing protein	A0A288WG93	Bacillus_phage	3.9e-20	33.2
WP_011590450.1\|1092373_1092628_+	hypothetical protein	NA	NA	NA	NA
WP_110003034.1\|1092596_1093268_-	hypothetical protein	NA	NA	NA	NA
WP_011590452.1\|1093444_1093747_+	histidine kinase	NA	NA	NA	NA
WP_011590453.1\|1093748_1093928_+	hypothetical protein	M9Q2G4	Clostridium_phage	9.3e-08	50.0
WP_003477299.1\|1093938_1094121_+	hypothetical protein	I2E8Z1	Clostridium_phage	2.7e-07	48.3
WP_162467388.1\|1094215_1094374_+	hypothetical protein	NA	NA	NA	NA
WP_011590455.1\|1094417_1094603_+	hypothetical protein	NA	NA	NA	NA
WP_011590456.1\|1094602_1095514_+	YqaJ viral recombinase family protein	A0A0A7RWR9	Clostridium_phage	4.5e-106	64.9
WP_011590457.1\|1095515_1096385_+	recombinase RecT	A0A0A7RW37	Clostridium_phage	5.4e-101	68.3
WP_011590458.1\|1096402_1097116_+	GntR family transcriptional regulator	A0A0A7RTY6	Clostridium_phage	2.0e-32	60.0
WP_011590459.1\|1097116_1097290_+	hypothetical protein	NA	NA	NA	NA
WP_011590460.1\|1097283_1097670_+	RusA family crossover junction endodeoxyribonuclease	A0A2K9V3I2	Faecalibacterium_phage	5.1e-19	44.3
1097346:1097362	attR	NA	NA	NA	NA
WP_011590461.1\|1097819_1098467_+	hypothetical protein	NA	NA	NA	NA
WP_011590462.1\|1099025_1099499_+	hypothetical protein	A0A0A8WFM4	Clostridium_phage	3.3e-12	34.4
WP_011590463.1\|1099981_1101157_+	DUF4935 domain-containing protein	NA	NA	NA	NA
WP_011590464.1\|1101225_1101693_+\|terminase	terminase small subunit	A7J290	Streptococcus_phage	4.7e-35	60.1
WP_011590465.1\|1101685_1103050_+\|terminase	terminase	M9Q2I1	Clostridium_phage	4.7e-261	96.2
WP_041702636.1\|1103105_1103873_+	hypothetical protein	NA	NA	NA	NA
WP_041702637.1\|1103918_1105439_+\|capsid	phage capsid protein	M9Q246	Clostridium_phage	1.3e-283	97.2
WP_080503691.1\|1106562_1107060_+	hypothetical protein	A0A0A8WIE7	Clostridium_phage	4.8e-30	59.8
WP_041702747.1\|1107105_1107297_+	hypothetical protein	A0A0A8WJ56	Clostridium_phage	1.8e-09	64.7
WP_011590470.1\|1107324_1107942_+	hypothetical protein	NA	NA	NA	NA
WP_011590471.1\|1108035_1108641_+	hypothetical protein	M9Q248	Clostridium_phage	4.5e-78	90.0
WP_011590472.1\|1108665_1109571_+	hypothetical protein	M9Q2F4	Clostridium_phage	6.5e-150	84.4
WP_003460293.1\|1109585_1109855_+	hypothetical protein	M9Q1H8	Clostridium_phage	3.4e-22	100.0
WP_011590473.1\|1109890_1110253_+	hypothetical protein	M9Q2K9	Clostridium_phage	3.9e-61	98.3
WP_011590474.1\|1110256_1110583_+	hypothetical protein	M9Q2I3	Clostridium_phage	5.2e-57	99.1
WP_011590475.1\|1110582_1110966_+	hypothetical protein	M9Q249	Clostridium_phage	8.0e-65	96.9
WP_011590476.1\|1110965_1111352_+	hypothetical protein	M9Q2F6	Clostridium_phage	5.0e-67	96.9
WP_003460307.1\|1111361_1111820_+	hypothetical protein	M9Q1I1	Clostridium_phage	7.8e-83	96.7
WP_003460275.1\|1111832_1112201_+	hypothetical protein	M9Q2L0	Clostridium_phage	1.1e-52	99.2
WP_041702638.1\|1112160_1112523_+	bacteriophage Gp15 protein	M9Q2I4	Clostridium_phage	7.3e-60	97.5
WP_011590478.1\|1112563_1115776_+	membrane protein	M9Q251	Clostridium_phage	0.0e+00	90.1
WP_003460303.1\|1115779_1116133_+	hypothetical protein	M9Q2F8	Clostridium_phage	4.3e-57	96.4
WP_003460286.1\|1116155_1116422_+	hypothetical protein	M9Q1I4	Clostridium_phage	1.0e-39	97.7
WP_011590479.1\|1116488_1116869_+	DUF1617 family protein	M9Q2L1	Clostridium_phage	1.4e-58	92.9
WP_011590480.1\|1116904_1122013_+	KID repeat-containing protein	M9Q2I5	Clostridium_phage	6.7e-268	87.7
WP_011590481.1\|1122031_1122280_+	hypothetical protein	Q0SPG3	Clostridium_phage	5.4e-38	95.1
WP_011590482.1\|1122293_1122710_+\|holin	phage holin family protein	M9Q253	Clostridium_phage	1.2e-69	97.8
WP_011590483.1\|1122750_1123167_+	hypothetical protein	M9Q2G0	Clostridium_phage	2.8e-55	86.2
WP_011590484.1\|1123252_1124281_+	SH3 domain-containing protein	Q0SPG7	Clostridium_phage	2.0e-187	93.3
WP_011590485.1\|1124698_1125361_+	hypothetical protein	NA	NA	NA	NA
WP_011590486.1\|1125584_1126673_+	hypothetical protein	NA	NA	NA	NA
WP_148194390.1\|1126608_1126959_+	hypothetical protein	NA	NA	NA	NA
WP_011590488.1\|1126965_1127691_+	restriction endonuclease	NA	NA	NA	NA
WP_003477359.1\|1128750_1129536_-	phosphorylase	NA	NA	NA	NA
WP_011590489.1\|1129892_1130990_+	hypothetical protein	NA	NA	NA	NA
WP_011590490.1\|1131186_1131705_+	ClbS/DfsB family four-helix bundle protein	NA	NA	NA	NA
WP_004457245.1\|1131741_1132584_+	hypothetical protein	NA	NA	NA	NA
WP_011590491.1\|1132600_1132915_+	DUF3784 domain-containing protein	NA	NA	NA	NA
WP_004457215.1\|1133106_1133844_-	sugar phosphate isomerase/epimerase	NA	NA	NA	NA
WP_004457310.1\|1134210_1134957_+	hypothetical protein	NA	NA	NA	NA
WP_011590492.1\|1135174_1136323_-	exo-alpha-sialidase	Q9III6	Frog_adenovirus	4.0e-19	28.9
WP_011590493.1\|1137104_1138484_+	flagellin lysine-N-methylase	NA	NA	NA	NA
WP_011590494.1\|1138907_1139201_-	hypothetical protein	NA	NA	NA	NA
WP_041702640.1\|1139591_1140212_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_011590496.1\|1141377_1141770_+	DUF4440 domain-containing protein	NA	NA	NA	NA
WP_011590497.1\|1142099_1143245_+	hypothetical protein	NA	NA	NA	NA
WP_041702641.1\|1143401_1143713_+	hypothetical protein	NA	NA	NA	NA
WP_011590499.1\|1143880_1145644_+	AAA family ATPase	K4I1H4	Acidithiobacillus_phage	3.5e-46	37.8
WP_011590500.1\|1145647_1146961_+	McrC family protein	NA	NA	NA	NA
WP_003462042.1\|1146986_1147370_+	SdpI family protein	NA	NA	NA	NA
WP_011590501.1\|1147460_1148018_-	flavin reductase family protein	NA	NA	NA	NA
WP_011590502.1\|1148062_1148452_-	hypothetical protein	NA	NA	NA	NA
WP_011590503.1\|1148754_1149531_+	DUF1311 domain-containing protein	NA	NA	NA	NA
WP_011590504.1\|1149912_1150716_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA

DBSCAN-SWA_3

1744791 : 1862464

112

Clostridium_phage(71.11%)

integrase,tail,portal,plate,tRNA,head,capsid,protease,terminase,transposase

attL 1761946:1761966|attR 1861401:1861421

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011010387.1\|1744791_1745784_-\|tRNA	tRNA epoxyqueuosine(34) reductase QueG	NA	NA	NA	NA
WP_003450775.1\|1745928_1746438_-	serine O-acetyltransferase	NA	NA	NA	NA
WP_011010388.1\|1746456_1747359_-	cysteine synthase A	A0A1X9I5K7	Streptococcus_phage	3.8e-89	56.4
WP_003477931.1\|1747697_1748969_-	CBS domain-containing protein	NA	NA	NA	NA
WP_011590753.1\|1749308_1750097_+	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003481390.1\|1750110_1750752_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_011590754.1\|1750763_1751456_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.0e-26	35.7
WP_011590755.1\|1751624_1752305_-	hypothetical protein	NA	NA	NA	NA
WP_003460604.1\|1752377_1753259_-	YegS/Rv2252/BmrU family lipid kinase	NA	NA	NA	NA
WP_003453570.1\|1753573_1754095_+	CDP-diacylglycerol--serine O-phosphatidyltransferase	NA	NA	NA	NA
WP_003453576.1\|1754141_1754492_-	hypothetical protein	NA	NA	NA	NA
WP_003460610.1\|1754513_1755050_-	rubrerythrin family protein	NA	NA	NA	NA
WP_003460596.1\|1755101_1756451_-	SpoVR family protein	NA	NA	NA	NA
WP_003460597.1\|1756477_1757656_-	sporulation protein YhbH	NA	NA	NA	NA
WP_003460607.1\|1757659_1759582_-	PrkA family serine protein kinase	A0MN77	Thermus_phage	2.0e-84	32.8
WP_011590757.1\|1759671_1761450_-	DNA helicase RecQ	A0A2P1EM61	Moumouvirus	2.2e-77	36.7
WP_003460600.1\|1761680_1762304_-	thiamine phosphate synthase	NA	NA	NA	NA
1761946:1761966	attL	NA	NA	NA	NA
WP_003460606.1\|1762296_1763094_-	hydroxyethylthiazole kinase	NA	NA	NA	NA
WP_011590758.1\|1763105_1763900_-	bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase	NA	NA	NA	NA
WP_003460605.1\|1764206_1765046_+	patatin family protein	NA	NA	NA	NA
WP_003470312.1\|1765163_1766177_-	substrate-binding domain-containing protein	NA	NA	NA	NA
WP_003477945.1\|1766394_1767459_+	galactose/glucose ABC transporter substrate-binding protein MglB	NA	NA	NA	NA
WP_003449162.1\|1767533_1769081_+	galactose/methyl galactoside ABC transporter ATP-binding protein MglA	F2Y2R6	Organic_Lake_phycodnavirus	3.7e-12	33.3
WP_003449090.1\|1769052_1770081_+	galactose/methyl galactoside ABC transporter permease MglC	NA	NA	NA	NA
WP_011590759.1\|1770120_1771143_-	galactose mutarotase	NA	NA	NA	NA
WP_003465923.1\|1771368_1772532_+	galactokinase	NA	NA	NA	NA
WP_011590760.1\|1772654_1774151_+	UDP-glucose--hexose-1-phosphate uridylyltransferase	NA	NA	NA	NA
WP_003460743.1\|1774341_1775997_-	nucleoside kinase	NA	NA	NA	NA
WP_003472738.1\|1776127_1776826_+	DUF421 domain-containing protein	NA	NA	NA	NA
WP_011590761.1\|1776822_1777257_+	DUF4363 family protein	NA	NA	NA	NA
WP_003449129.1\|1777353_1778220_+	class II fructose-1,6-bisphosphate aldolase	NA	NA	NA	NA
WP_011590762.1\|1778266_1779310_-	nucleoid-associated protein	J9QE81	Clostridium_phage	5.4e-39	29.5
WP_011590763.1\|1779449_1780013_+	CYTH domain-containing protein	NA	NA	NA	NA
WP_041702689.1\|1780262_1780865_-	hypothetical protein	NA	NA	NA	NA
WP_011590766.1\|1781005_1782667_-	C40 family peptidase	A0A1J0GW44	Streptomyces_phage	3.5e-16	37.2
WP_003449139.1\|1782832_1783201_-	DUF2164 family protein	NA	NA	NA	NA
WP_011590767.1\|1783388_1783775_+	hypothetical protein	NA	NA	NA	NA
WP_011590768.1\|1784094_1784580_-\|tRNA	Cys-tRNA(Pro) deacylase	NA	NA	NA	NA
WP_003460283.1\|1784746_1785049_-	hypothetical protein	I2E8X0	Clostridium_phage	1.2e-20	73.5
WP_011590769.1\|1785240_1786269_-	SH3 domain-containing protein	Q0SPG7	Clostridium_phage	5.4e-193	95.9
WP_011590770.1\|1786322_1786805_-	cobalt ABC transporter permease	I2E8W8	Clostridium_phage	4.4e-52	68.1
WP_011590771.1\|1786825_1787059_-	hemolysin XhlA family protein	Q0SPG4	Clostridium_phage	5.8e-34	100.0
WP_011590772.1\|1787140_1787326_-	hypothetical protein	I2E8W6	Clostridium_phage	1.1e-19	76.9
WP_011590773.1\|1787344_1789843_-\|plate	BppU family phage baseplate upper protein	I2E8W5	Clostridium_phage	1.1e-151	52.9
WP_011590774.1\|1789858_1791739_-	MBL fold metallo-hydrolase	I2E8W4	Clostridium_phage	6.0e-307	91.7
WP_011590775.1\|1791789_1794849_-	peptidoglycan DD-metalloendopeptidase family protein	I2E8W3	Clostridium_phage	0.0e+00	97.1
WP_041702692.1\|1794853_1795615_-\|tail	phage tail family protein	I2E8W2	Clostridium_phage	7.0e-145	97.6
WP_011590777.1\|1795556_1798811_-\|tail	phage tail tape measure protein	I2E8W1	Clostridium_phage	0.0e+00	97.0
WP_158301053.1\|1798846_1799176_-	hypothetical protein	NA	NA	NA	NA
WP_011590779.1\|1799361_1799679_-	hypothetical protein	I2E8W0	Clostridium_phage	7.1e-51	100.0
WP_011590780.1\|1799681_1800284_-\|tail	tail protein	I2E8V9	Clostridium_phage	2.0e-110	100.0
WP_011590781.1\|1800300_1800648_-	hypothetical protein	I2E8V8	Clostridium_phage	9.1e-60	100.0
WP_041702697.1\|1800656_1801094_-	HK97 gp10 family phage protein	I2E8V7	Clostridium_phage	8.5e-79	98.6
WP_011590783.1\|1801093_1801423_-\|head	phage head closure protein	I2E8V6	Clostridium_phage	4.4e-48	87.2
WP_011590784.1\|1801415_1801694_-\|head,tail	phage gp6-like head-tail connector protein	Q8SBP7	Clostridium_phage	6.2e-27	61.5
WP_011590785.1\|1801705_1802890_-\|capsid	phage major capsid protein	Q8SBP8	Clostridium_phage	5.7e-146	79.3
WP_011590786.1\|1802930_1803536_-\|head,protease	HK97 family phage prohead protease	Q8SBP9	Clostridium_phage	3.0e-98	88.1
WP_011590787.1\|1803525_1804773_-\|portal	phage portal protein	Q8SBQ1	Clostridium_phage	2.3e-201	81.5
WP_011590788.1\|1804773_1806513_-\|terminase	terminase large subunit	Q8SBQ2	Clostridium_phage	1.5e-307	85.9
WP_041702751.1\|1806505_1807009_-\|terminase	phage terminase small subunit P27 family	Q8SBQ3	Clostridium_phage	2.7e-76	88.6
WP_041702752.1\|1807108_1807525_-	HNH endonuclease	Q8SBK4	Clostridium_phage	1.3e-57	79.7
WP_011590790.1\|1807520_1808342_-	hypothetical protein	NA	NA	NA	NA
WP_011590791.1\|1808516_1809065_-\|integrase	site-specific integrase	Q8SBK8	Clostridium_phage	1.2e-74	74.6
WP_011590792.1\|1809159_1809513_-	hypothetical protein	NA	NA	NA	NA
WP_041702754.1\|1809571_1809757_-	hypothetical protein	NA	NA	NA	NA
WP_011590794.1\|1809919_1810381_-	sigma-70 family RNA polymerase sigma factor	A0A0A8WFM4	Clostridium_phage	5.3e-15	39.0
WP_011590796.1\|1810916_1811306_-	single-stranded DNA-binding protein	Q8SBL5	Clostridium_phage	6.2e-41	60.9
WP_011590797.1\|1811320_1811467_-	hypothetical protein	NA	NA	NA	NA
WP_011590798.1\|1811478_1812762_-	DNA helicase	Q8SBL9	Clostridium_phage	2.3e-196	81.7
WP_193332938.1\|1812772_1813420_-	phage protein	Q8SBM0	Clostridium_phage	2.0e-52	53.6
WP_158301054.1\|1813540_1813699_-	hypothetical protein	NA	NA	NA	NA
WP_011590801.1\|1813701_1813881_-	hypothetical protein	I2E8Z1	Clostridium_phage	2.2e-09	60.4
WP_011590802.1\|1813906_1814137_-	hypothetical protein	NA	NA	NA	NA
WP_011590803.1\|1814142_1814640_-	hypothetical protein	A0A2K9V3J3	Faecalibacterium_phage	3.4e-23	41.5
WP_011590804.1\|1814689_1814878_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_011590805.1\|1815027_1815372_+	helix-turn-helix transcriptional regulator	A0A1L2BY72	Clostridium_phage	5.7e-22	52.7
WP_011590806.1\|1815422_1817012_+	hypothetical protein	Q7Y4B3	Escherichia_virus	6.4e-07	28.8
WP_011590807.1\|1817079_1817934_+	DNA adenine methylase	NA	NA	NA	NA
WP_011590808.1\|1818045_1818543_+	ImmA/IrrE family metallo-endopeptidase	A0A1L2BY64	Clostridium_phage	1.5e-34	44.8
WP_011590809.1\|1818555_1820064_+	recombinase family protein	M9Q2G2	Clostridium_phage	3.6e-60	35.6
WP_011590811.1\|1820819_1821197_-	hypothetical protein	NA	NA	NA	NA
WP_011590813.1\|1821672_1822233_-	AAA family ATPase	NA	NA	NA	NA
WP_011590814.1\|1822316_1823267_-	ribonuclease Z	NA	NA	NA	NA
WP_041702699.1\|1823379_1827816_-	discoidin domain-containing protein	NA	NA	NA	NA
WP_003449118.1\|1828028_1828655_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_011590816.1\|1828706_1829459_-	hypothetical protein	NA	NA	NA	NA
WP_011590817.1\|1829550_1830699_-	YibE/F family protein	NA	NA	NA	NA
WP_011590818.1\|1830779_1835912_-	CehA/McbA family metallohydrolase	NA	NA	NA	NA
WP_003449110.1\|1836148_1836652_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_011590819.1\|1836960_1837740_+	histidinol-phosphatase	NA	NA	NA	NA
WP_003460070.1\|1838090_1839404_+	sodium-dependent transporter	NA	NA	NA	NA
WP_003449164.1\|1839694_1840390_+	energy-coupled thiamine transporter ThiT	NA	NA	NA	NA
WP_003460055.1\|1840498_1841575_+	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_003470420.1\|1841710_1842757_-	calcium/proton exchanger	NA	NA	NA	NA
WP_041702701.1\|1843197_1844481_-	alkaline phosphatase family protein	O90761	Fowlpox_virus	7.6e-11	24.8
WP_003460059.1\|1844549_1844885_-	hypothetical protein	NA	NA	NA	NA
WP_003460053.1\|1845024_1845438_-	hypothetical protein	NA	NA	NA	NA
WP_003460063.1\|1845637_1846549_-	DUF368 domain-containing protein	NA	NA	NA	NA
WP_078209945.1\|1846708_1847881_-\|transposase	transposase	Q331V1	Clostridium_botulinum_C_phage	4.0e-168	76.5
WP_011590822.1\|1848574_1849366_-	M15 family metallopeptidase	NA	NA	NA	NA
WP_003470421.1\|1849635_1849962_-	hypothetical protein	NA	NA	NA	NA
WP_003472741.1\|1850447_1851389_+	hypothetical protein	NA	NA	NA	NA
WP_003466212.1\|1851426_1852296_-	methionyl aminopeptidase	NA	NA	NA	NA
WP_003460916.1\|1852643_1853240_-	zinc dependent phospholipase C family protein	NA	NA	NA	NA
WP_011590823.1\|1853341_1854265_+	hypothetical protein	NA	NA	NA	NA
WP_011010422.1\|1854404_1854974_-	hypothetical protein	NA	NA	NA	NA
WP_003460758.1\|1855338_1855554_-	hypothetical protein	NA	NA	NA	NA
WP_011590826.1\|1855589_1856072_-	hypothetical protein	NA	NA	NA	NA
WP_003448636.1\|1856288_1856882_-	YihA family ribosome biogenesis GTP-binding protein	NA	NA	NA	NA
WP_003460768.1\|1856881_1859212_-	endopeptidase La	A0A0R6PGP8	Moraxella_phage	2.8e-176	45.3
WP_003460767.1\|1859333_1861046_-\|protease	ATP-dependent protease LonB	A0A0R6PGP8	Moraxella_phage	3.1e-23	27.4
WP_003448621.1\|1861156_1862464_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	4.0e-140	58.4
1861401:1861421	attR	NA	NA	NA	NA

DBSCAN-SWA_4

1964698 : 1977955

Clostridium_phage(22.22%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003457168.1\|1964698_1965736_-\|tRNA	tRNA 2-thiocytidine(32) synthetase TtcA	A0A0U2S5Z2	Escherichia_phage	5.4e-31	36.0
WP_003454568.1\|1965936_1966206_+	ACT domain-containing protein	NA	NA	NA	NA
WP_003474040.1\|1966222_1967575_+	PFL family protein	NA	NA	NA	NA
WP_003457240.1\|1967786_1968290_-	QueT transporter family protein	E7DN70	Pneumococcus_phage	1.1e-13	37.2
WP_003457231.1\|1968614_1969490_-	MBL fold metallo-hydrolase	Q332C0	Clostridium_botulinum_C_phage	1.1e-64	50.2
WP_011590863.1\|1969660_1970983_-	sensor histidine kinase	X5JAC0	Clostridium_phage	3.6e-72	37.8
WP_003449818.1\|1970976_1971687_-	response regulator transcription factor	A0A2R2ZGH8	Clostridioides_phage	3.3e-32	31.8
WP_003456038.1\|1971825_1972839_-	N-acetylmuramoyl-L-alanine amidase	Q8SBN4	Clostridium_phage	2.5e-121	64.0
WP_003455890.1\|1972935_1973223_-	thiamine-binding protein	NA	NA	NA	NA
WP_003456055.1\|1973446_1974460_-	DUF348 domain-containing protein	A0A143FMI2	Bacillus_phage	3.5e-19	52.0
WP_003455941.1\|1974885_1976184_-	uracil permease	Q9KX94	Enterobacteria_phage	3.6e-69	39.3
WP_003456099.1\|1976371_1977955_+	ATP-binding cassette domain-containing protein	A0A1V0SGN0	Hokovirus	8.5e-44	25.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_008261

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection