CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NC_008528	Oenococcus oeni PSU-1, complete sequence	2 crisprs	cas3,csa3,DEDDh	0	0	4	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_008528_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_008528_1

50007-50100

Orphan

Consensus_repeat	Method
TTTATCTCCGATATAAATACAAAAAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_008528_1

>merge|NC_008528|1|50007-50100|CRISPRCasFinder
TTTATCTCCGATATAAATACAAAAAAGCACAAAATCGTACAAGAACCCCAGGGTTTAGCATTTCTATTTTATCTCCCGATATAAATACAAAAAA

>NC_008528|1|1|50007-50100|CRISPRCasFinder
TTTATCTCCGATATAAATACAAAAAA	GCACAAAATCGTACAAGAACCCCAGGGTTTAGCATTTCTATT
TTATCTCCCGATATAAATACAAAAAA

Protein	Signature genes	Signature genes Name	Protein_function
NC_008528.1\|WP_002821448.1\|48402_49512_+\|P1-family-peptidase	unknown	unknown	gnl\|CDD\|239071
NC_008528.1\|WP_002821227.1\|56801_57041_+\|hypothetical-protein	unknown	unknown	unknown
NC_008528.1\|WP_002817977.1\|43915_44512_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
NC_008528.1\|WP_002817972.1\|41995_42328_-\|hypothetical-protein	unknown	unknown	unknown
NC_008528.1\|WP_002824628.1\|50341_50761_+\|hypothetical-protein	unknown	unknown	unknown
NC_008528.1\|WP_002821224.1\|53546_54074_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|366166
NC_008528.1\|WP_002817975.1\|43231_43777_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NC_008528.1\|WP_002821222.1\|52449_52623_-\|DUF2273-domain-containing-protein	unknown	unknown	gnl\|CDD\|227834
NC_008528.1\|WP_002821223.1\|52633_53194_-\|alkaline-shock-response-membrane-anchor-protein-AmaP	unknown	unknown	gnl\|CDD\|380217
NC_008528.1\|WP_011677337.1\|45913_47101_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|225371
NC_008528.1\|WP_002821221.1\|51839_52409_-\|Asp23/Gls24-family-envelope-stress-response-protein	unknown	unknown	gnl\|CDD\|377129
NC_008528.1\|WP_002817974.1\|42337_43129_-\|SDR-family-NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|187628
NC_008528.1\|WP_002817971.1\|40763_41750_+\|LacI-family-DNA-binding-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224525
NC_008528.1\|WP_002817528.1\|51500_51758_-\|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein	unknown	unknown	gnl\|CDD\|225170
NC_008528.1\|WP_002821447.1\|47288_48311_+\|Gfo/Idh/MocA-family-oxidoreductase	unknown	unknown	gnl\|CDD\|182305
NC_008528.1\|WP_002821226.1\|55122_56484_-\|putative-DNA-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|225420
NC_008528.1\|WP_002817527.1\|50820_51126_-\|YtxH-domain-containing-protein	unknown	unknown	gnl\|CDD\|369204
NC_008528.1\|WP_002821507.1\|39159_40575_-\|SLC45-family-MFS-transporter	unknown	unknown	gnl\|CDD\|340871
NC_008528.1\|WP_002821509.1\|44696_45656_-\|Gfo/Idh/MocA-family-oxidoreductase	unknown	unknown	gnl\|CDD\|223745
NC_008528.1\|WP_002821220.1\|51155_51395_-\|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein	unknown	unknown	gnl\|CDD\|225170

Protein	Function_ID	Function_description	E-value
NC_008528.1\|WP_002821448.1\|48402_49512_+\|P1-family-peptidase	gnl\|CDD\|239071	cd02253, DmpA, L-Aminopeptidase D-amidase/D-esterase (DmpA) family; DmpA catalyzes the release of N-terminal D and L amino acids from peptide susbtrates. DmpA is synthesized as a single polypeptide precursor, which is autocatalytically cleaved to the active heterodimeric form. The cleavage results in two polypeptide chains, with one chain containing an N-terminal nucleophile. This group represents one of the rare aminopeptidases that are not metalloenzymes. DmpA shows similarity in catalytic mechanism to N-terminal nucleophile (Ntn) hydrolases, which are enzymes that catalyze the cleavage of amide bonds through the nucleophilic attack of the side chain of an N-terminal serine, threonine, or cysteine.	1.16724e-154
NC_008528.1\|WP_002817977.1\|43915_44512_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	6.84399e-14
NC_008528.1\|WP_002821223.1\|52633_53194_-\|alkaline-shock-response-membrane-anchor-protein-AmaP	gnl\|CDD\|380217	NF033218, anchor_AmaP, alkaline shock response membrane anchor protein AmaP. The founding member of this family, AmaP (Asp23 membrane anchoring protein), is related to Asp23 through part of its length, but includes a highly hydrophobic N-terminal region that should make it an integral membrane protein. Asp23 (alkaline shock protein of 23 kDa), described in PMID:7864904, is a cytosolic protein in Staphylococcus aureus, strongly induced by a pH shift from 7 to 10, and also recruited to the membrane. AmaP appears to be the partner protein with an integral membrane segment and the ability to anchor Asp23 to the membrane. This model was built to identify full-length homologs of AmaP, while excluding Asp23. Some but not all members of this family score above the cutoffs of Pfam model version PF03780.11, but full-length homologs of Asp23 score considerably higher. Asp23 family members previously were known as DUF322.	2.66478e-36
NC_008528.1\|WP_002821224.1\|53546_54074_+\|alpha/beta-hydrolase	gnl\|CDD\|366166	pfam00561, Abhydrolase_1, alpha/beta hydrolase fold. This catalytic domain is found in a very wide range of enzymes.	0.00184643
NC_008528.1\|WP_002817975.1\|43231_43777_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	1.49308e-12
NC_008528.1\|WP_002821222.1\|52449_52623_-\|DUF2273-domain-containing-protein	gnl\|CDD\|227834	COG5547, COG5547, Small integral membrane protein [Function unknown].	4.46342e-05
NC_008528.1\|WP_002821226.1\|55122_56484_-\|putative-DNA-binding-domain-containing-protein	gnl\|CDD\|225420	COG2865, COG2865, Predicted transcriptional regulator containing an HTH domain and an uncharacterized domain shared with the mammalian protein Schlafen [Transcription].	1.59903e-50
NC_008528.1\|WP_011677337.1\|45913_47101_-\|MFS-transporter	gnl\|CDD\|225371	COG2814, AraJ, Arabinose efflux permease [Carbohydrate transport and metabolism].	1.35807e-67
NC_008528.1\|WP_002821221.1\|51839_52409_-\|Asp23/Gls24-family-envelope-stress-response-protein	gnl\|CDD\|377129	pfam03780, Asp23, Asp23 family, cell envelope-related function. The alkaline shock protein Asp23 was identified as an alkaline shock protein that was expressed in a sigmaB-dependent manner in Staphylococcus aureus. Following an alkaline shock Asp23 accumulates in the soluble protein fraction of the S. aureus cell. Asp23 is one of the most abundant proteins in the cytosolic protein fraction of stationary S. aureus cells, with a copy-number of >25000 per cell. A second Asp23-family protein, AmaP, which is encoded within the asp23-operon, is required to localize Asp23 to the cell membrane. The overall function for the family is thus a cell envelope-related one in Gram-positive bacteria.	8.72724e-31
NC_008528.1\|WP_002817974.1\|42337_43129_-\|SDR-family-NAD(P)-dependent-oxidoreductase	gnl\|CDD\|187628	cd05370, SDR_c2, classical (c) SDR, subgroup 2. Short-chain dehydrogenases/reductases (SDRs, aka Tyrosine-dependent oxidoreductases) are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	2.73398e-106
NC_008528.1\|WP_002817971.1\|40763_41750_+\|LacI-family-DNA-binding-transcriptional-regulator	gnl\|CDD\|224525	COG1609, PurR, Transcriptional regulators [Transcription].	2.81512e-90
NC_008528.1\|WP_002817528.1\|51500_51758_-\|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein	gnl\|CDD\|225170	COG2261, COG2261, Predicted membrane protein [Function unknown].	1.32525e-11
NC_008528.1\|WP_002821447.1\|47288_48311_+\|Gfo/Idh/MocA-family-oxidoreductase	gnl\|CDD\|182305	PRK10206, PRK10206, putative oxidoreductase; Provisional.	3.74974e-104
NC_008528.1\|WP_002817527.1\|50820_51126_-\|YtxH-domain-containing-protein	gnl\|CDD\|369204	pfam07093, SGT1, SGT1 protein. This family consists of several eukaryotic SGT1 proteins. Human SGT1 or hSGT1 is known to suppress GCR2 and is highly expressed in the muscle and heart. The function of this family is unknown although it has been speculated that SGT1 may be functionally analogous to the Gcr2p protein of Saccharomyces cerevisiae which is known to be a regulatory factor of glycolytic gene expression.	0.00651028
NC_008528.1\|WP_002821507.1\|39159_40575_-\|SLC45-family-MFS-transporter	gnl\|CDD\|340871	cd17313, MFS_SLC45_SUC, Solute carrier family 45 and similar sugar transporters of the Major Facilitator Superfamily of transporters. This group includes the solute carrier 45 (SLC45) family as well as plant sucrose transporters (SUCs or SUTs) and similar proteins such as Schizosaccharomyces pombe general alpha-glucoside permease. the SLC45 family is composed of four (A1-A4) vertebrate proteins as well as related insect proteins such as Drosophila sucrose transporter SCRT or Slc45-1. Members of this group transport sucrose and other sugars like maltose into the cell, with the concomitant uptake of protons (symport system). Plant sucrose transporters are crucial to carbon partitioning, playing a key role in phloem loading/unloading. They play a key role in loading and unloading of sucrose into the phloem and as a result, they control sucrose distribution throughout the whole plant and drive the osmotic flow system in the phloem. They also play a role in the exchange of sucrose between beneficial symbionts (mycorrhiza and Rhizobium) as well as pathogens such as nematodes and parasitic fungi. There are nine sucrose transporter genes in Arabidopsis and five in rice. Vertebrate SLC45 family proteins have been implicated in the regulation of glucose homoeostasis in the brain (SLC45A1), with skin and hair pigmentation (SLC45A2), and with prostate cancer and myelination (SLC45A3). Mutations in SLC45A2, also called MATP (membrane-associated transporter protein) or melanoma antigen AIM1, cause oculocutaneous albinism type 4 (OCA4), an autosomal recessive disorder of melanin biosynthesis that results in congenital hypopigmentation of ocular and cutaneous tissues. The SLC45 family and related sugar transporters belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.06257e-123
NC_008528.1\|WP_002821509.1\|44696_45656_-\|Gfo/Idh/MocA-family-oxidoreductase	gnl\|CDD\|223745	COG0673, MviM, Predicted dehydrogenases and related proteins [General function prediction only].	1.00898e-53
NC_008528.1\|WP_002821220.1\|51155_51395_-\|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein	gnl\|CDD\|225170	COG2261, COG2261, Predicted membrane protein [Function unknown].	5.60317e-08

>NC_008528.1|WP_002821448.1|48402_49512_+|P1-family-peptidase
MGLSVDLIDDISEGIKGPKNLITDVDGVEVGQITIDQDDFHSGVTAILPHPGNVFKRKVPAASYVINGFGKSVGLIQIDELGTIETPIVLTNTFGVGTAINALTKYMLKQNPEIGDTTSTVNPIVAECNDGNISNIRAMKITESDVSSALNAAKDTLEEGAVGGGRGMVCYGLKGGIGSSSRIVKVDDDHTYTLGALVMTNYGFLDNFIVNGIPIGKSLAEMLVSDKQKEEKGSIITVLATDAPLNSRQLKRLAKRATVGINRTGGYIGNGSGEIVFAFSTSNLVSHFTEQNFDTVSRFNDNHIDLFFRAVAASIDEAILSSMVHAKTVIDRKGQLRYGLVDAAKQLVQQQPRYTAMIAQLFQQLGVKL
>NC_008528.1|WP_002821447.1|47288_48311_+|Gfo/Idh/MocA-family-oxidoreductase
MLTIAYIGNGKSTNRYHLPFSLKLKDKIKVKTIFSRRPDSSWSKIEGIHYTNDINDIYSDPEIQLVVVSTPGNTHYKLAKDTLLHNKNVLVEKPFTETSAEAKELFSLAKEKSLFVQCYQNRRYDSDFLTTQKVINSGVLGDLLEVEMHFDYYRPQIPESSREFSVGSSYLYGHACHTLDQVISFFGKPENTHYEVRQLLGKGHMNDYFDLDLFYDGPLKVSIKSSYFRLKARPSFVVYGKKGVFIKQEKDRQETDLKHFYMPDHADFGLDRPEDYGTLTYLDDKGQYHEEKVVSEIGDYSRMYAGIYDAIVNHKEKPVKDEETILQLEMLETAIKQIKE
>NC_008528.1|WP_011677337.1|45913_47101_-|MFS-transporter
MKLFKLQSMVLIAIAFVLGCSEYIIVGILDNLAKQFQIGISQVGYLVTGFALVYAISTPLITLAIGKKSLYKALLILLSIFIVGNLLTAVANSYIILAVSRLITATSSGACIAVALAFANFIAPIKKRGWLVSWVFSGFSIASVFGVPFGTWISKNYGWRYSFYAIILVSIIILFFSILLLPKNIHQQASKNFKEQLRIFGDRRIQIGMFLPMFNLAGIYVFYTYLQPILSHILLVKENFLTLTLFLYGLMALISNQLSGKISSSSGLKKMPEIYIGQFLLLVLFPFLAVVPFIGMIVVMLLGVSMYLLNSPIQIFFLTVAEADYPQSLILASSLNSIFANFGIALGSATGGIVTEYFSLNKIAPIGSLYVLIALVLTLILERIGKLSTHKFNMI
>NC_008528.1|WP_002821509.1|44696_45656_-|Gfo/Idh/MocA-family-oxidoreductase
MINFGIIGAGNIANRFADSLSHFKDANLYAVACRGIEKAAAFQRKHPCQLIYDDYDELLSNKDIDIVYIAVPHGFHYLWISKALKKGKAVLCEKPATLNAEQMKSVQKLAEAKNIFFMEAMKSRFTPAYQEIKTIINNGEIGKIISIDSSFCREISKKTATYHFQPIQGGCLLDIGIYNVALTEDFAKTLPKVEVLENKMDISGVESYTKAKLLFPNLSATIECAFDRNKQTEATIKGEKGQIEIKNFHRAESFIVKTSSGTKNYHIAYEQDDFHGEIAHVIQCYGKNKTESNNMPISDSVNCALIIEKIKNQIPELAV
>NC_008528.1|WP_002817977.1|43915_44512_-|helix-turn-helix-transcriptional-regulator
MLKEGFMVFSEIISSKRRELGMTQDQVAELLYVSRQALSNWEKGKNYPDLDTLVELSKIYDLSLDVLIKGDKKVMKKVQEDSQDLRKQKKLRVLDISLAAVIVILILVPVLLNFFGDRNILNGHLMSGLMSILIMYIMIASLWHYHLAYPGPISKQAPILIPKSFGIGLTINPQSPIGLAIWIILLVIIVIAFMPMIF
>NC_008528.1|WP_002817975.1|43231_43777_+|TetR/AcrR-family-transcriptional-regulator
MNKLSKKNILDEATQLIKQKGIDSVSLTDIARVLGTSHAALYKYFPNKNALLSALAQEWLDALLIKLFPFNKSPYNTKADIVHDWLWTLFTQKILAYQKDPEMFKLYTEYIDSNPKLLQEHMNALINSLLAATGWENRDKALAVIEAFILFSAPKLAFLWNEQSEQQFENIWALVAESLND
>NC_008528.1|WP_002817974.1|42337_43129_-|SDR-family-NAD(P)-dependent-oxidoreductase
MELKNKKIVVTGGTSGIGLAFAKKLAAIDNQIIIGSRSKEKITEVVKDNKNISGYQVDVSDQESVERFYKQTISEFKNIDIVINSAGIMRHYNLLDEKTTSQKLQAEIQTNLIGTINIDKIFLPILRKQAESMIVNISSGLANLSSAAHPIYSATKAGVHMFTDALREQLHFAGEDHIHIVELVPPLVAETNLEKDVNSQNTPLNIKLSDLINEAIQGIEENSIRINAGMAKEMRKMGQTDPDKNEREMATMMIPMYFPDGLK
>NC_008528.1|WP_002817972.1|41995_42328_-|hypothetical-protein
MNNTDLPQVINQFVEYTNSENSKDFINLFAEEAILNDWGRIFKGRDSISEWNKNENIGKKSRFQILDSHETAVNNWMVQIKVNGNGFNGTGPMEFKISDNHILSIRILPN
>NC_008528.1|WP_002817971.1|40763_41750_+|LacI-family-DNA-binding-transcriptional-regulator
MSVTIKDVAKAAGVSTATVSRVLSGKDFFYSEKTEKKVKKAIRDLGYRKNTAAVELVTMKSKVIAVILPDTKTTFSNSIIEGIQNEAFKIDLSVIILYIGNNDREKQKRALTTVIERSVNGILLLSSQLEKENQELLNSSNIPYVYVSIAVQSENIRFIASDDFQIGYQAANFLINKGHKKIGLAALEPNTFIGRQRINGYLRALNEHSLPSNENWIFSGNYSYDDGVQAMKYYGSDTELTAIIGASDLVAIGIINQAKKIGFKVPQQLSVMSIDGTDAVNIVDPNLTSVTQSFYTMGVESMKMLLNPELKSKYTETKIEERQSTGNI
>NC_008528.1|WP_002821507.1|39159_40575_-|SLC45-family-MFS-transporter
MNLSHASDSKISADIPLVNKKEKPLIKNTDKEEKHHLPKLRLSTIFAMTFGFFGINMAFSLQSSQLGRIFQTIGANPNNLGFFFILPPLAGMVIQPLIGKYSDRTWNRFGRRMPYLLIGAPAAAIVLILLPNAGSFGFGYASVAALCFGAVATLFMDLTSNICMQPFKMIIGDMVNEDQKDLAWSWQQSFSNLGGVLAAVIPFVLTLVGISNTAPKGEVPLTVKIAFYSAAIILLVTSLLTIIKVHEYDPKTYAQYHEIDLQAQKKSPSLVKLLKDAPRAFWETSVVEFFSWFAILYLWTYATGAISLNVWHTSNASSAGYQAAGNWYGVLTCIMSIAAVIWGIVVQARTKPTSRKFWYSFGLLAGAVGYFMIYFIHNKWLMIIPFCLIGISYLVINTQPFSLLTEALNGQHEGSYLGLFNCSICLPQICASVASFWLFPLMGQSMPAMFLVGGTSLVLGAISVRFVHSRF
>NC_008528.1|WP_002824628.1|50341_50761_+|hypothetical-protein
MDKAEYEKELCAEFEDLVQRIKHRKQSDEKNLLRQIRTLMISFSKLEKFDSSVTYIAGLAYDIRDILGIDLQTYAKDTARALYQNRPQETVEDFYYAAAAYPYFLSKCQDNEKDDDKKISRLNNLFLNYLLSQSESSKS
>NC_008528.1|WP_002817527.1|50820_51126_-|YtxH-domain-containing-protein
MENTLKNILKMTVACTLITGGLIVAGTVFAAKKIDESGDDLEDKIPENIKAYINKMNKETMQKNKGKLQESFGTAKEVAQNTKDKISDKVDDIKKNFNKND
>NC_008528.1|WP_002821220.1|51155_51395_-|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein
MYWLLVLIIGFLIGTIAGTTINKKEAMGWIGDIAAGLVGSWIGQVFFGSWGPQFYDVAIFPSIIGALILVLMISFFLRK
>NC_008528.1|WP_002817528.1|51500_51758_-|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein
MHLIWALIVGAIIGAIAGALTSKGKSMGWIANIVAGLIGSWLGESLLGDWGPKLAGMALIPSIIGAVIIVLIASWFVTRSNRTAK
>NC_008528.1|WP_002821221.1|51839_52409_-|Asp23/Gls24-family-envelope-stress-response-protein
MENSNRKEQNSKSETEIKNDNNNIRGALTYEDKVIQKIVGLSIGSIDGLLTVDGGFFSNIAEKIVNTNDETAGVGVEVGRKQVAVDLSIVAEYGKNIAEIYEEIKKIVAKQVSQMTELEVVEVNVDVTDIKTREQYEKDAVSLEDRATSAAGTANKTISEQSNKLSGKMKNTAEKVKKNAENNSEPRVE
>NC_008528.1|WP_002821222.1|52449_52623_-|DUF2273-domain-containing-protein
MENIFNQYKWPILIGTAGFILAILFLTVGFLQTMLILILTIAGSVLGFYLQAHGILK
>NC_008528.1|WP_002821223.1|52633_53194_-|alkaline-shock-response-membrane-anchor-protein-AmaP
MSKITKLLYIVIAIAFLLPLTDLLLRFQSTVSFPFKLTQLEHYPMIGKYMPEILFWLSAVLGVLTILFIITIILWSSIKHELIFKKSKGKLQIQKKAIESFVNENAKEDSFIKDPKSKIKITRHRLKIYLNGSFDPNVVLPSENQKFQEDLTHKLTKLLNAPREKIKITLKLNNLYKEEINHHRVE
>NC_008528.1|WP_002821224.1|53546_54074_+|alpha/beta-hydrolase
MNAIIFHGSAPHATANKFWYQNIANSLIEQGVKTIIADLPKLDQESLTDTLSKIKKMNLVIDKNTILIGHSAGTNIIFALLEKLTMPVKAVYLVAGYSQLNGMKHTTLKSSYDWDAIKKNAKEFYIFNSFNDPFNCNEKQGKILFDHLGGTLILRNDGHFTKQQQPLLLALLKQY
>NC_008528.1|WP_002821226.1|55122_56484_-|putative-DNA-binding-domain-containing-protein
MLLNSKDQPFPAENQVIEYKEDFTDRIKREIAGFLNGKDRAFIYIGVSDKKREIVREFSIDEKHSFEERISNWASTSYYPSAVNLVKVHTNNDPFCIEVIPGNLTPYQLKVKSNLYTYVRNNSLTEPASAESIKKLINRSKLDSFDEQASEIQKLSFDYLKKEFANIDEPFTNRKLQGFISKENKYSNTALLLSEENPYISTIAIFESDKTLDSLVDSRRFKGSIFEQIDNILEFINLNNHAYSKITGNPQRMDRRDFPPIAIREGLINAFAHRSYLDKGRVQIKIYSDRLEILSPGSLPGGLTVQDVLAGRNYPRNHNVVYVLRYFKYVEDLGTGIDRIEDSYELDKLKRRPKLESGENFVKLTLPNQNFHFDINKTKTQQMNASSTAISETDATEKIIAFLKKNQSIRRKDVEDILSIKDTQANQYLKELVDRGIINKIATGPKTRYQLNK
>NC_008528.1|WP_002821227.1|56801_57041_+|hypothetical-protein
MAVTSKSAKQVAKVTTTQRITFATKEKIKLLAYFIDGTNDKQKLAFNDTVELLADLYVKNNLNDRQRELFKDMLEEKRI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_008528_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_008528_2

1707619-1707680

Orphan

Consensus_repeat	Method
TCGTCATCATCATCGCTATCGTC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_008528_2

>merge|NC_008528|2|1707619-1707680|CRISPRCasFinder
TCGGTATCGTCTTCGTCATCATCATCGCTATCGTCAGAGTCTTCGTCATCATCAGTATCGAT

>NC_008528|2|2|1707619-1707680|CRISPRCasFinder
TCGGTATCGTCTTCGTCATCATC	ATCGCTATCGTCAGAG
TCTTCGTCATCATCAGTATCGAT

Protein	Signature genes	Signature genes Name	Protein_function
NC_008528.1\|WP_011677838.1\|1697867_1698881_-\|zinc-dependent-alcohol-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|176196
NC_008528.1\|WP_002819664.1\|1715271_1715973_-\|NAD-dependent-protein-deacylase	unknown	unknown	gnl\|CDD\|238702
NC_008528.1\|WP_011677839.1\|1699169_1701359_-\|alpha-galactosidase	unknown	unknown	gnl\|CDD\|307952
NC_008528.1\|WP_002818299.1\|1711255_1711936_-\|VIT-family-protein	unknown	unknown	gnl\|CDD\|153123
NC_008528.1\|WP_002819663.1\|1714371_1715262_-\|cation-transporter	unknown	unknown	gnl\|CDD\|224151
NC_008528.1\|WP_002819653.1\|1702492_1703923_-\|C69-family-dipeptidase	unknown	unknown	gnl\|CDD\|335383
NC_008528.1\|WP_002816850.1\|1695837_1696257_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|273772
NC_008528.1\|WP_011677478.1\|1710575_1711259_-\|VIT-family-protein	unknown	unknown	gnl\|CDD\|153123
NC_008528.1\|WP_002819655.1\|1703985_1704228_-\|type-B-50S-ribosomal-protein-L31	unknown	unknown	gnl\|CDD\|234969
NC_008528.1\|WP_002821425.1\|1705648_1707283_-\|CTP-synthase	unknown	unknown	gnl\|CDD\|235437
NC_008528.1\|WP_011677837.1\|1696316_1697786_-\|sucrose-phosphorylase	unknown	unknown	gnl\|CDD\|163564
NC_008528.1\|WP_002819651.1\|1701447_1702410_-\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381318
NC_008528.1\|WP_002820331.1\|1712008_1712455_-\|universal-stress-protein	unknown	unknown	gnl\|CDD\|238182
NC_008528.1\|WP_002819661.1\|1709882_1710389_-\|universal-stress-protein	unknown	unknown	gnl\|CDD\|366180
NC_008528.1\|WP_002826425.1\|1715972_1717496_-\|phosphoenolpyruvate-carboxylase	unknown	unknown	gnl\|CDD\|237459
NC_008528.1\|WP_002819659.1\|1708573_1709866_+\|HD-domain-containing-protein	unknown	unknown	gnl\|CDD\|224004
NC_008528.1\|WP_011677840.1\|1704328_1705615_-\|UDP-N-acetylglucosamine-1-carboxyvinyltransferase	unknown	unknown	gnl\|CDD\|183779
NC_008528.1\|WP_011677842.1\|1712553_1714152_-\|Nramp-family-divalent-metal-transporter	unknown	unknown	gnl\|CDD\|234815
NC_008528.1\|WP_002819658.1\|1708090_1708531_-\|DUF1934-domain-containing-protein	unknown	unknown	gnl\|CDD\|378129
NC_008528.1\|WP_002816852.1\|1695345_1695813_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045

Protein	Function_ID	Function_description	E-value
NC_008528.1\|WP_011677838.1\|1697867_1698881_-\|zinc-dependent-alcohol-dehydrogenase-family-protein	gnl\|CDD\|176196	cd08234, threonine_DH_like, L-threonine dehydrogenase. L-threonine dehydrogenase (TDH) catalyzes the zinc-dependent formation of 2-amino-3-ketobutyrate from L-threonine, via NAD(H)-dependent oxidation. THD is a member of the zinc-requiring, medium chain NAD(H)-dependent alcohol dehydrogenase family (MDR). MDRs have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Sorbitol and aldose reductase are NAD(+) binding proteins of the polyol pathway, which interconverts glucose and fructose.	2.92861e-161
NC_008528.1\|WP_002819664.1\|1715271_1715973_-\|NAD-dependent-protein-deacylase	gnl\|CDD\|238702	cd01411, SIR2H, SIR2H: Uncharacterized prokaryotic Sir2 homologs from several gram positive bacterial species and Fusobacteria; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span.	4.0602e-132
NC_008528.1\|WP_011677839.1\|1699169_1701359_-\|alpha-galactosidase	gnl\|CDD\|307952	pfam02065, Melibiase, Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.	0
NC_008528.1\|WP_002818299.1\|1711255_1711936_-\|VIT-family-protein	gnl\|CDD\|153123	cd02432, Nodulin-21_like_1, Nodulin-21 and CCC1-related protein family. Nodulin-21_like_1: This is a family of proteins closely related to nodulin-21, a plant nodule-specific protein that may be involved in symbiotic nitrogen fixation. This family is also related to CCC1, a yeast vacuole transmembrane protein that functions as an iron and manganese transporter. .	7.62229e-102
NC_008528.1\|WP_002819663.1\|1714371_1715262_-\|cation-transporter	gnl\|CDD\|224151	COG1230, CzcD, Co/Zn/Cd efflux system component [Inorganic ion transport and metabolism].	9.44781e-73
NC_008528.1\|WP_002819653.1\|1702492_1703923_-\|C69-family-dipeptidase	gnl\|CDD\|335383	pfam03577, Peptidase_C69, Peptidase family C69.	0
NC_008528.1\|WP_002816850.1\|1695837_1696257_+\|hypothetical-protein	gnl\|CDD\|273772	TIGR01716, HTH-type_transcriptional_regulator_rgg, transcriptional activator, Rgg/GadR/MutR family, C-terminal domain. This model describes the whole, except for a 60 residue N-terminal helix-turn-helix DNA-binding domain (pfam01381) of the family of proteins related to the transcriptional regulator Rgg, also called RopB. Rgg is required for secretion of several proteins, including a cysteine proteinase associated with virulence. GadR is a positive regulator of a glutamate-dependent acid resistance mechanism. MutR is a transcriptional activator for mutacin biosynthesis genes in Streptococcus mutans. This family appears restricted to the low-GC Gram-positive bacteria, including at least eight members in Lactococcus lactis. [Regulatory functions, DNA interactions].	6.04088e-08
NC_008528.1\|WP_011677478.1\|1710575_1711259_-\|VIT-family-protein	gnl\|CDD\|153123	cd02432, Nodulin-21_like_1, Nodulin-21 and CCC1-related protein family. Nodulin-21_like_1: This is a family of proteins closely related to nodulin-21, a plant nodule-specific protein that may be involved in symbiotic nitrogen fixation. This family is also related to CCC1, a yeast vacuole transmembrane protein that functions as an iron and manganese transporter. .	1.83051e-99
NC_008528.1\|WP_002819655.1\|1703985_1704228_-\|type-B-50S-ribosomal-protein-L31	gnl\|CDD\|234969	PRK01678, rpmE2, type B 50S ribosomal protein L31.	2.00556e-42
NC_008528.1\|WP_002821425.1\|1705648_1707283_-\|CTP-synthase	gnl\|CDD\|235437	PRK05380, pyrG, CTP synthetase; Validated.	0
NC_008528.1\|WP_011677837.1\|1696316_1697786_-\|sucrose-phosphorylase	gnl\|CDD\|163564	TIGR03852, sucrose_gtfA, sucrose phosphorylase. In the forward direction, this enzyme uses phosphate to cleave sucrose into D-fructose + alpha-D-glucose 1-phosphate. Characterized representatives from Streptococcus mutans and Bifidobacterium adolescentis represent well-separated branches of a molecular phylogenetic tree. In S. mutans, the region including this gene has been associated with neighboring transporter genes and multiple sugar metabolism.	0
NC_008528.1\|WP_002819651.1\|1701447_1702410_-\|aldo/keto-reductase	gnl\|CDD\|381318	cd19092, AKR_BsYcsN_EcYdhF-like, Bacillus subtilis YcsN, Escherichia coli YdhF and similar proteins. Bacillus subtilis YcsN and Escherichia coli YdhF are prototypes of this family. They are uncharacterized aldo/keto reductase family oxidoreductases.	6.72527e-124
NC_008528.1\|WP_002820331.1\|1712008_1712455_-\|universal-stress-protein	gnl\|CDD\|238182	cd00293, USP_Like, Usp: Universal stress protein family. The universal stress protein Usp is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. Usp enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae Usp reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, athough Usp lacks ATP-binding activity.	2.09749e-20
NC_008528.1\|WP_002819661.1\|1709882_1710389_-\|universal-stress-protein	gnl\|CDD\|366180	pfam00582, Usp, Universal stress protein family. The universal stress protein UspA is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. UspA enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae UspA reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, though UspA lacks ATP-binding activity.	9.29187e-21
NC_008528.1\|WP_002826425.1\|1715972_1717496_-\|phosphoenolpyruvate-carboxylase	gnl\|CDD\|237459	PRK13655, PRK13655, phosphoenolpyruvate carboxylase; Provisional.	0
NC_008528.1\|WP_002819659.1\|1708573_1709866_+\|HD-domain-containing-protein	gnl\|CDD\|224004	COG1078, COG1078, HD superfamily phosphohydrolases [General function prediction only].	9.42003e-120
NC_008528.1\|WP_011677840.1\|1704328_1705615_-\|UDP-N-acetylglucosamine-1-carboxyvinyltransferase	gnl\|CDD\|183779	PRK12830, PRK12830, UDP-N-acetylglucosamine 1-carboxyvinyltransferase; Reviewed.	0
NC_008528.1\|WP_011677842.1\|1712553_1714152_-\|Nramp-family-divalent-metal-transporter	gnl\|CDD\|234815	PRK00701, PRK00701, divalent metal cation transporter MntH.	3.59294e-172
NC_008528.1\|WP_002819658.1\|1708090_1708531_-\|DUF1934-domain-containing-protein	gnl\|CDD\|378129	pfam09148, DUF1934, Domain of unknown function (DUF1934). Members of this family are found in a set of hypothetical bacterial proteins. Their precise function has not, as yet, been defined.	1.53976e-10
NC_008528.1\|WP_002816852.1\|1695345_1695813_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	8.38883e-07

>NC_008528.1|WP_002821425.1|1705648_1707283_-|CTP-synthase
MTDKKQTKYIFVTGGVVSSLGKGIVAASLGRLLKSRGLAVTVQKFDPYLNPDPGTMSPYQHGETFVTQDGVETDLDLGHYERFMDINTNKYSNVTSGKIYQEVIDRERTGDYMGRTVQVIPHVTDAIKDKIFRGAKESEADVIITEIGGTIGDIESMAFIEAIRQMKKEVGSDNTFYIHVSLVPFLRAAGELKTKPTQHSVHELRGMGIQPDMIVVRSEKAITDSMKEKLSEFTDVPTEAIIQSIDSDVLYSVPLNLAAQNMDQVVLEKLGLGSQPKANLSQWGALVDRIRHLSKEIKIALVGKYTDLPDAYISVHEALKHAGYAVDSKITLKSINSEMLTDNNVAEKLAGIDGVIVPGGFGPRGIEGMISAIKYARENNIPFFGVCLGMQMASVEFARDAVGMSNANSTEMNPDTPYPVVGLMDSQKKITKIGGTMRLGSYPAILKAGTKTAEAYNNVSEISERHRHRYEFNNDYREQFEKAGMVFAGTSPDNSLVEIIEYPQNDFFIAVQYHPEFLSRPDRPEGLYAAFIQAALAYEEKLKD
>NC_008528.1|WP_011677840.1|1704328_1705615_-|UDP-N-acetylglucosamine-1-carboxyvinyltransferase
MTKILINGGKHLHGEVTIGGAKNSTVALIPASILAETPVRFDTVPAILDVKNLQLILRSMNVSSNFENGFLEIDPTHIVDAPLPKDAIKSLRASYYFMGALLGKFGKATVTFPGGDNIGPRPIDQHIKGFKALGAMVREENDTIYITTGPEGLHGAEIFFDKVSVGATMNLIMASVRAKGLTILENVAREPEIIDLATFLNNMGANIRGAGTDTIRITGVPVLRSSAVHAIIPDRIEAGTYITAAAAIGDGVTVKNVIPEHLESFTSKLIEMGVHLRISEDEIYVPATSHLKPVTITTAPFPGFATDLQQPISPLLMKADGVSTIVDTIYPQRIRHIVELRRMGGHISSLEGGVIQVNESPRLVGTDVQAAEIRAGAALVIAGLMADGQTIIDHAEHILRGYEQIQQKLTGLGASVSVLGVDIPSLMP
>NC_008528.1|WP_002819655.1|1703985_1704228_-|type-B-50S-ribosomal-protein-L31
MKADIHPDYRQVVFVDSTTGAKFLSGSTAKAQGEVEYEGQTYPMVRVEVTSDSHPFYTGKQKINQADGAVDKFNKKYGLN
>NC_008528.1|WP_002819653.1|1702492_1703923_-|C69-family-dipeptidase
MKNQFSKTSCTTILVGKKASYDGSTIVARTEDSGDGTFEAKKFIVVSPKEQPKHYVSKISKVEIDLPDNPLRYTSVPNADLTEGIWGEAGINSENAAMSATETITTNERVLAADPMVTDGIGEEDFLTIVLPYIHSAKEGVKRLGSLLEQFGTYEQNGVAFSDADEIWFLETIGGHHWVAQRVPDDSYVTVPNQLGIQEINFDDSDNFVYSADLKDFIRDNHLNLSFDGKVNSRLTFGSHADIDHHYNTPRAWFMQKFLTPSVEQDPMSDTIPFSQKPFRKVTIEDIKYVLSGHYQDTVYDPYGTSGTEAEKHMFRPIGINRTSELSVLQIRPNKPKGNQAVQWIAFGSMPFNTLVPFYTNVEDTPSYLRDTTNRVSSENYYWINRIIAALADPHYRDVVAYFERYQQKTIALGHKNLLSADKLAAGKSGQELTATLEAANKKITDQIKKETEDLLDQVLFTVSNLMNNKFARSDN
>NC_008528.1|WP_002819651.1|1701447_1702410_-|aldo/keto-reductase
MKQIELGQSGLNASQIALGVMRIDRKNAQEAAKTVSTAFDAGINYYDTADIYGAGKSSTIFGQALKDAGIDRNKIYIQTKIGIILKNGQINGDGLTGLRYDFSREHLLSAVDIELQRLQTDHIDFLLLHRPDTLMEPEEIADAFSQLEASGKVLHFGVSNFTPYDIELVQQAVSQRLEVNQLQFALTHANMISENIQMNIDGSPDSDTHVRTFDILTYMRLHKMTIQAWSPFQYGMFAGVFIDNPKFKELNDQLQTLADKYHSNKSAVAVAWILKHPANIQTILGSTSPEHIKQMTEVDDVHLSNQEWYDLYQAAGYKIP
>NC_008528.1|WP_011677839.1|1699169_1701359_-|alpha-galactosidase
MITFDENTKVFHLSNNQISYLMSVEEGNLLAHLYFGKRVGHYSGERLNPRFDRSFSGNLPGSLDRTYSKDTLLQEWSGNNTGDYRAPAVIIRDENGARQTDFRFQSYKIIDGKPELKNLPHAYVKDDSEAQTLIVNLLNENLACEVELSYSIYNDRPIIARSAKLINKGRHILHIEKIASMQIDFPKSDFQVISLPGAHARERQIERQTLHHGLTQFESRRGTSSHHMNPFIALIHPSTTEFNDEAIGIQLVYSGNHQETLERDYIDQTRVLAGINQYDFDWKLRAGDSFQTPEALIVYSSSGLNGMSQTYHRLLRERVARGKYQFAQRPIVINNWEATFFDFDTEKIQKILDNAAPLGIEMFVLDDGWFGHRDDDNSSLGDWFEHATKLRGGLKALSQQVHDRKMKFGLWFEPEMISEDSELYKKHPDYALQVPGRGMTPSRGQYVLDFSRKEVVDNIFNQMTKILDNVDIDYVKWDMNRHLTEVYSTELPADRQGEVSHRYVLGVYDLAQRITSRYPDILFEGCSGGGGRFDAGMLYYFPQSWTSDNTDAVARLKIQYGSSLSYPVSSMTAHVSVSPNQQTGRQTSFEMRGDVAMAAVFGYELNLADLSDKEKEIVKSQIKFYKKHRQLIQYGDFIRLKSPFDGNQTAWEFVSPDKKELLLYRYKLISQAQPEFTLTKLAALDPDKIYLADDKKRYAGDELMNIGLYDTPIQLADWTSRVDYFQAEN
>NC_008528.1|WP_011677838.1|1697867_1698881_-|zinc-dependent-alcohol-dehydrogenase-family-protein
MNALVLDKMNHLELENLEKPTPKNNEVLIKVAYVGVCGTDKALYQGLPGSADAVPPIVLGHEDSGTVVEIGESVTNFEVGDRVAIDPNIYCHKCDFCRTNRPELCTNLSAVGVTRNGGLEEYVAVPEEVAYKLPDNVSFKQAALTEPLSCVVHGVDLLAIKPFQEAIVLGDGFTGQLFVKTLKAYGVSKVTISTRHLDDEKHVDFLKKVVGADEVVDARSNDFDKDYDVVVEAVGSADVQEQAVKAAAHGGQVLMFGVGKPEQKFSVSSYEIFQKQLTVQGSFINPYTFKAAIAMIAAGKIDPSELVSMELKAAKMNDYLSGKIRTNKAVLNIEAAF
>NC_008528.1|WP_011677837.1|1696316_1697786_-|sucrose-phosphorylase
MPVKNKAMLITYSDSMGKNIKELQYILDKYIGDAIGGVHLLPFFPSTGDRGFAPSDYTRVNPDFGDWEDVEELGKKYYLMFDFMINHISRESIMYQDFKEKKDASSYKDFFIRWEKFWPKGRPTKADIDLIYKRKDKAPIQGITFADGSQEHLWNTFGDEQIDINVKSKVAQEFFKDTLQSMVKHGADLIRLDAFAYAIKKIDTNDFFIEPEIWDLLESVRKILDPLHAEILPEIYEHYTIPAKINEYGYFTYDFVLPLVILYTLYSGNPKQLAKWLKMSPKKQFTTLDTHDGIGVVDARDILTDEEIDYTSSELYKVGANVKRTYSSAAYNNLDIYQINSTYYSALGNDDKAYLLARAIQIFAPGIPQIYYAGLLAGENDLDLLEKTKEGRNINRHYYSEEEVANEVQRPIVACLLKLLAWRNRSAAFDLQGDIQVSATDKNEIKIIRTSTNGQDTAELTANVALKTFTIKENDKIILIEDQTDTKDI
>NC_008528.1|WP_002816850.1|1695837_1696257_+|hypothetical-protein
MSIINLFSPMQSFYLTQQMLKNGSETIDVNWNHQADFLYIILSTALIMAFQGKIPELAQLIKQAGNSIHNEQYLYEKTELHFIKGLLDYLKGDRIVAKQSIKESIDVFQVLNSPKLVDLYNRRWQEFLNRQKIDNKKFR
>NC_008528.1|WP_002816852.1|1695345_1695813_+|helix-turn-helix-transcriptional-regulator
MHIVRRRDHDRYGQTFKELRIAKGVSLSNAAKNVVSKSFLSRFERDQSNIVFDKLYRLLLNINFSVEEFVYINNQRNNRYQPFHYEDTKDYVDQQIIENSNKLGKYYYQRWINNQIEYDYVNFLKEKSIMEKHHIAKVSQKEKQFLYNYLFAKET
>NC_008528.1|WP_002819658.1|1708090_1708531_-|DUF1934-domain-containing-protein
MMRDSFKSAINIKIASKIDQAGEQQTVNQAVQGDLLLNEDHSYTILYKMENHLIRLEVAPEKTRVVYFGHGGRTVLVYDEKIDLAESKYASDQGIIDMLVKTENVDFDQVDATGSLHIEYELFQDKDSLGKFDLTLQFSPTVSKID
>NC_008528.1|WP_002819659.1|1708573_1709866_+|HD-domain-containing-protein
MTTLNSEKVFRDPILGFIHVDDSIILDLINSHEMQRLRRIKHLGVANSVFHGGEQSRFQHSLGVYEISRRMIQALDDNEKFANERHWDHENDLLVQAAALLHDVGHGAYSHTFEHLFDTVHEQFTQKIIVDPSTEVNAILKTVSNDFPERVAAVIGKSYPDKRVVQLISSQLDADRMDYLLRDAYYTGAEYGRYDIERILRLMRPIKDGFAFDIAGVHSIEDYVISRYQMYLQVYFHPVSRGMEVVLENLLIRAQDIFDKDPDNPIFFPIIRPIFALKNKIDIQDYISLDDSVFNTAFNIWQKVDDKILADLSKRFLDRKPLKSIVLNEKTKDLIPSLRKKIKDRGFDPKYYTGENDATDLPYESYSPKTGEEGIKFVYPDGQQVELSKLSPLVEAINGKESIDRRFFFPREMLSNPEINQLYLKYKKTY
>NC_008528.1|WP_002819661.1|1709882_1710389_-|universal-stress-protein
MVSKFKPKQFKHVLAAVDDSPQGQSALSFAIHQAKEDHAKLTILSVLEEDELPVTTRLDANEMSLLQDRIDKALMDYQQIAKNFGLKNDRVEKMFAQGDNAGETVVKDVLPHTDIDLVVVGAHSRTGWSSHLGSQASYIAKTAPVSVTIIRDKKISEDEEKIGFLNRQ
>NC_008528.1|WP_011677478.1|1710575_1711259_-|VIT-family-protein
MKNSKNKQTLEQRLNKIRAGVLGSNDGILTVVGVLFSTAAATSNNFLILVAGFSDLLSCAFSMAAGEYASVSAQREIERAVIQIEEKQIGQDKDYARKTIAKSYISRGVNQQTAYSIADELIQKHEIESLVSAKYTLKIGEYVNPWGAAFSSLISAALGGLFPLLAMLLLPGHLKFAGTIVATTFAVALTGSLAAKLGEFHLRPAIIRNIVIGLITVAIHYYIGKLF
>NC_008528.1|WP_002818299.1|1711255_1711936_-|VIT-family-protein
MNLAEKINVVRASVMGANDGIISVAGIVLGVFAATQGRTNDNWVIFVAGFSGTIAGMISMAAGEYVSVHGQRDAENAAIEKEEIANQESFNQQISLVKDFLIKDDISKELAQRAASEMMKTKPIETAVRVKHGFNISDKINPYHAALASFISFPIGATLPMLAILMVNRSYKVASTYFGVLLALIITGYLAARIGNNDRKKGITRNVLSGLFTMTATYLIGRLLHK
>NC_008528.1|WP_002820331.1|1712008_1712455_-|universal-stress-protein
MSEKPIDKVFNRILVGVDDSADAQLAFRYAVRRAVKDNATLIITSILENDEMNVYQALTKDYVHGERYELVEHLKKYRDIAAKAGVKDIKEIVDEGNAGETIVKNVIPAVKADLLIIGSLSKKGISKYFGSQAAYMAKYAPISVLIIR
>NC_008528.1|WP_011677842.1|1712553_1714152_-|Nramp-family-divalent-metal-transporter
MSENAEGKTRRNHGLIHYANGPSLEEINGTVKVPKGRGFGETLFAYSGPGALVAVGYMDPGNWSTSITGGQNFQYLLMSTILISSLIAMLLQYMAAKLGIVSQMDLAQAIRARTSKSLGIVLWIMTELAIMATDIAEVIGAAIALYLLFHIPLVIAVFITVFDVLLLLLLTKIGFRKIEAIVVALILVILFVFVYQVALSDPNWSGVIAGLVPSAKAFATSPHIGGQTPLTGSLGIIGATVMPHNLYLHSAISQTRKIDHNDEEDVARTVRFSSWDSNIQLTAAFFVNALLLIMGVAVFKSGAVKDPSFFGLFEALSDTSTLSNGILISVAKTGILSTLFAVALLASGQNSTITGTLTGQVIMEGFVHMKMPLWLRRLVTRLISVIPVLICVSMTSGQSAINEHEALNTLMNNSQVFLAFALPFSMLPLLMFTDSDIEMGRRFKNTMWVKVLGWISVLSLTLLNLINLPGANGQIAAFFGDNATKSQLFLANIIAYALIVAIIALLVWTIVEILKGNKRYQLENHSVVGVED
>NC_008528.1|WP_002819663.1|1714371_1715262_-|cation-transporter
MDQESFFQRGKSNNKYWFGISINLLFIVFEVICGVFAGSLALVTDAIHNLGDVLGLVIAFVAVILIKRKPTKHHTYGFYNTTILAAFTNSLILVASLAIVIWEAFLRLMNPEDHVDGWIVVIVALTGVAINGLTAYIFHRGSKRDLNEKANYWHFFADALISLCVVFAGFIINFTNWVILDPLVSIFAAVFILFESWRVLCHAFSLVTNGVPDNISENEVEKYLLSFPEIEKINDVHIWALSTTEVAISAHLQCNRPADYMKILDDATDGLRKKFDIDHVTLQLETSDKKHKESKI
>NC_008528.1|WP_002819664.1|1715271_1715973_-|NAD-dependent-protein-deacylase
MLTDEIQNLFNNAKRIVFMTGAGVSTASGIPDYRSKGGLYTTSALDRPEYLLSHTCFQKDPERQYKFMKENMYFPDAKPNAIHRKMAEFVKAGKARVITQNVDGLHTKLDPSTIEFHGSLYRIYAPVDQKSANVDDYLKSMYRASDHAVLRPDITFYEEMPQHVQEAVETVSKADLLVIVGTSFQVYPFAGLIDYAPADADKIAINMERINTTAPIRQIIGDATKFFSELISH
>NC_008528.1|WP_002826425.1|1715972_1717496_-|phosphoenolpyruvate-carboxylase
MHKIDRKIPNIMGTQHPDNAGVPFFKGDQSKNPFITAYKEVDEAFNNFAVLDTDEYMWDWEGKHADAAVIDRLYSEHYEYFKGHQLGRDKFLTFRLPNIWEEKGYSLMQAMTTMLSAEDFARDLSFEQRPLFEAILPMAQTSEQLIEIEDKFSKLAHFKSDEFTSGSNNTDHIEMIPLFEGFKTQLHSPEILKEYLQLYEQRTGQSLPYLRVFLAGSDSALSNGFMNSIIGNKLALTRLHEFSDQKDLPIFPIAGTGSTIFRGGLSPKWIKRYLQEFPGLKTATVQSAFRYDYPLKQVQSAIKELRSGLQNNQAVSMTDREQNVLINVAKKSADCYHETLDQLINDLQKIFDAFPKRRDRRQHVGILGYSRQVDGYKMPRAITFTGSLYSVGVPPEFIGFGRALMSLNAEELAIFTRHYPNLRNDFTFLAHYISVDALESLIAKNPAWLEAKKDIQDLQSILQFEIGPSNEKEEEHSRLASDLVKISDPTTRTLLIQKQAVLRNFLG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

543072 : 550539

Streptococcus_phage(33.33%)

protease

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002818421.1\|543072_543948_+	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	2.6e-71	48.6
WP_002818422.1\|544056_544998_+	thioredoxin-disulfide reductase	G3MA85	Bacillus_virus	2.5e-80	48.2
WP_002817243.1\|545014_545446_+	hypothetical protein	NA	NA	NA	NA
WP_002817244.1\|545442_546426_+	uridine diphosphate-N-acetylglucosamine-binding protein YvcK	A1IMD5	Streptococcus_phage	5.4e-73	44.3
WP_002817245.1\|546422_547370_+	DNA-binding protein WhiA	Q7AWZ3	Streptococcus_phage	3.2e-30	32.7
WP_002818424.1\|547423_548020_+\|protease	ATP-dependent Clp protease proteolytic subunit	A0A223W000	Agrobacterium_phage	2.1e-48	53.0
WP_002817248.1\|548136_548361_+	hypothetical protein	NA	NA	NA	NA
WP_002818426.1\|548376_550539_+\|protease	ATP-dependent Clp protease ATP-binding subunit	H6X3M6	Enterobacteria_phage	1.6e-117	36.9

DBSCAN-SWA_2

1055204 : 1064203

Hokovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002818955.1\|1055204_1056758_-	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	1.7e-17	31.1
WP_002817151.1\|1056759_1057323_-	hypoxanthine phosphoribosyltransferase	A0A1V0SEQ1	Hokovirus	3.3e-11	28.3
WP_002821338.1\|1057319_1058621_-	adenylosuccinate lyase	A0A1B3B081	Gordonia_phage	9.1e-20	31.1
WP_011677623.1\|1058617_1059928_-	adenylosuccinate synthase	G5CQQ4	Megavirus	1.7e-69	37.9
WP_011677624.1\|1060015_1061164_-	IMP dehydrogenase	A0A0N9Q9A5	Chrysochromulina_ericina_virus	3.7e-41	36.2
WP_002821345.1\|1062673_1064203_-	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	1.5e-69	46.9

DBSCAN-SWA_3

1310131 : 1318700

uncultured_virus(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002821742.1\|1310131_1310902_-	nicotinamide mononucleotide transporter	A0A1B1SDZ0	Weissella_phage	5.0e-82	63.9
WP_011677696.1\|1311052_1312678_-	chaperonin GroEL	A0A240F779	uncultured_virus	1.5e-157	54.8
WP_002820779.1\|1312681_1312957_-	co-chaperone GroES	A0A221S452	uncultured_virus	2.6e-09	35.5
WP_002821741.1\|1313069_1313735_-	redox-sensing transcriptional repressor Rex	NA	NA	NA	NA
WP_011677697.1\|1313818_1314844_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	1.2e-46	35.5
WP_002820782.1\|1314840_1315356_-	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_011677698.1\|1315339_1316065_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
WP_002820784.1\|1316061_1317060_-	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	3.7e-53	40.0
WP_011677699.1\|1317094_1317844_-	acyl-ACP thioesterase	NA	NA	NA	NA
WP_011677700.1\|1317836_1318700_-	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	5.6e-74	53.2

DBSCAN-SWA_4

1343450 : 1351274

Lactobacillus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011677710.1\|1343450_1344644_-	LysM peptidoglycan-binding domain-containing protein	K4ID66	Lactobacillus_phage	5.3e-06	48.5
WP_002820821.1\|1344948_1345854_-	trypsin-like peptidase domain-containing protein	A0A1B1IRH0	uncultured_Mediterranean_phage	4.6e-10	28.3
WP_002817319.1\|1345942_1346527_-	50S ribosome-binding GTPase	A0A218KC48	Bacillus_phage	4.0e-07	28.7
WP_002821730.1\|1346600_1348172_-	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L0W2	Tupanvirus	2.7e-50	28.0
WP_002820824.1\|1348222_1348543_+	hypothetical protein	NA	NA	NA	NA
WP_011677712.1\|1348539_1349529_-	phosphate acetyltransferase	NA	NA	NA	NA
WP_011677713.1\|1349574_1350255_-	uracil-DNA glycosylase	Q53CZ3	Macaca_fuscata_rhadinovirus	6.2e-36	41.4
WP_002820827.1\|1350288_1350813_+	hypothetical protein	NA	NA	NA	NA
WP_002817314.1\|1350806_1351274_-	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	1.0e-34	49.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_008528

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection