CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NC_008499	Lactobacillus brevis ATCC 367 plasmid 2, complete sequence	0 crisprs	csa3	0	0	0	0
NC_008498	Lactobacillus brevis ATCC 367 plasmid 1, complete sequence	1 crisprs	NA	0	1	0	0
NC_008497	Lactobacillus brevis ATCC 367, complete sequence	2 crisprs	cas3,csa3,DEDDh,DinG	2	9	2	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_008498_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_008498_1

8726-8827

Orphan

Consensus_repeat	Method
GTCCGATTTTCGGATTTTCGCTTGTAGCAAGGGTTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_008498_1

>merge|NC_008498|1|8726-8827|CRISPRCasFinder
GTCCGATTTTCGGATTTTCGCTTGTAGCAAGGGTTTGTGGGGTGTCGTCAACGAACTTTCGCGAACGTCCGATTTTCGGATTTTCGCTTGTAGCAAGGGTTT

>NC_008498|1|1|8726-8827|CRISPRCasFinder
GTCCGATTTTCGGATTTTCGCTTGTAGCAAGGGTTT	GTGGGGTGTCGTCAACGAACTTTCGCGAAC
GTCCGATTTTCGGATTTTCGCTTGTAGCAAGGGTTT

Protein	Signature genes	Signature genes Name	Protein_function
NC_008498.1\|WP_011668983.1\|3439_5071_+\|type-IV-secretory-system-conjugative-DNA-transfer-family-protein	unknown	unknown	gnl\|CDD\|226036
NC_008498.1\|WP_011668981.1\|1612_2449_-\|hypothetical-protein	unknown	unknown	unknown
NC_008498.1\|WP_007127120.1\|12845_13160_-\|Txe/YoeB-family-addiction-module-toxin	unknown	unknown	gnl\|CDD\|226600
NC_008498.1\|WP_010579598.1\|13152_13413_-\|type-II-toxin-antitoxin-system-Phd/YefM-family-antitoxin	unknown	unknown	gnl\|CDD\|376852
NC_008498.1\|WP_011668988.1\|9976_10564_+\|DUF536-domain-containing-protein	unknown	unknown	gnl\|CDD\|224486
NC_008498.1\|WP_080504823.1\|2836_3022_-\|hypothetical-protein	unknown	unknown	unknown
NC_008498.1\|WP_011668984.1\|5143_5467_+\|plasmid-maintenance-system-killer-protein	unknown	unknown	gnl\|CDD\|282822
NC_008498.1\|WP_011668982.1\|3022_3307_-\|type-II-toxin-antitoxin-system-RelB/DinJ-family-antitoxin	unknown	unknown	gnl\|CDD\|225619
NC_008498.1\|WP_011668989.1\|11197_11962_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
NC_008498.1\|WP_187146779.1\|6198_6672_+\|plasmid-mobilization-relaxosome-protein-MobC	unknown	unknown	gnl\|CDD\|368576
NC_008498.1\|WP_011668986.1\|6653_7823_+\|relaxase/mobilization-nuclease-domain-containing-protein	unknown	unknown	gnl\|CDD\|367497
NC_008498.1\|WP_011668990.1\|12100_12706_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
NC_008498.1\|WP_011668985.1\|5480_5816_+\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|274228
NC_008498.1\|WP_011668980.1\|351_1281_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NC_008498.1\|WP_011668983.1\|3439_5071_+\|type-IV-secretory-system-conjugative-DNA-transfer-family-protein	gnl\|CDD\|226036	COG3505, VirD4, Type IV secretory pathway, VirD4 components [Intracellular trafficking and secretion].	5.2424e-48
NC_008498.1\|WP_187146779.1\|6198_6672_+\|plasmid-mobilization-relaxosome-protein-MobC	gnl\|CDD\|368576	pfam05713, MobC, Bacterial mobilisation protein (MobC). This family consists of several bacterial MobC-like, mobilisation proteins. MobC proteins belong to the group of relaxases. Together with MobA and MobB they bind to a single cis-active site of a mobilising plasmid, the origin of transfer (oriT) region. The absence of MobC has several different effects on oriT DNA. Site- and strand-specific nicking by MobA protein is severely reduced, accounting for the lower frequency of mobilisation. The localized DNA strand separation required for this nicking is less affected, but becomes more sensitive to the level of active DNA gyrase in the cell. In addition, strand separation is not efficiently extended through the region containing the nick site. These effects suggest a model in which MobC acts as a molecular wedge for the relaxosome-induced melting of oriT DNA. The effect of MobC on strand separation may be partially complemented by the helical distortion induced by supercoiling. However, MobC extends the melted region through the nick site, thus providing the single-stranded substrate required for cleavage by MobA.	5.48261e-07
NC_008498.1\|WP_011668990.1\|12100_12706_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	1.09809e-12
NC_008498.1\|WP_007127120.1\|12845_13160_-\|Txe/YoeB-family-addiction-module-toxin	gnl\|CDD\|226600	COG4115, COG4115, Uncharacterized protein conserved in bacteria [Function unknown].	4.77631e-18
NC_008498.1\|WP_010579598.1\|13152_13413_-\|type-II-toxin-antitoxin-system-Phd/YefM-family-antitoxin	gnl\|CDD\|376852	pfam02604, PhdYeFM_antitox, Antitoxin Phd_YefM, type II toxin-antitoxin system. Members of this family act as antitoxins in type II toxin-antitoxin systems. When bound to their toxin partners, they can bind DNA via the N-terminus and repress the expression of operons containing genes encoding the toxin and the antitoxin. This domain complexes with Txe toxins containing pfam06769, Fic/DOC toxins containing pfam02661 and YafO toxins containing pfam13957.	1.98493e-07
NC_008498.1\|WP_011668988.1\|9976_10564_+\|DUF536-domain-containing-protein	gnl\|CDD\|224486	COG1570, XseA, Exonuclease VII, large subunit [DNA replication, recombination, and repair].	0.008278
NC_008498.1\|WP_011668986.1\|6653_7823_+\|relaxase/mobilization-nuclease-domain-containing-protein	gnl\|CDD\|367497	pfam03432, Relaxase, Relaxase/Mobilisation nuclease domain. Relaxases/mobilisation proteins are required for the horizontal transfer of genetic information contained on plasmids that occurs during bacterial conjugation. The relaxase, in conjunction with several auxiliary proteins, forms the relaxation complex or relaxosome. Relaxases nick duplex DNA in a specific manner by catalyzing trans-esterification.	1.50059e-54
NC_008498.1\|WP_011668984.1\|5143_5467_+\|plasmid-maintenance-system-killer-protein	gnl\|CDD\|282822	pfam05015, HigB-like_toxin, RelE-like toxin of type II toxin-antitoxin system HigB. This family carries several different examples of type II bacterial toxins of toxin-antitoxin systems including many HigB-like ones. The fold is referred to as the RelE/YoeB/Txe/Yeeu fold suggesting all examples of these are present in this family. Several plasmids with proteic killer gene-systems have been reported. All of them encode a stable toxin and an unstable antidote. Upon loss of the plasmid, the less stable inhibitor is inactivated more rapidly than the toxin, allowing the toxin to be activated. The activation of these systems results in cell filamentation and cessation of viable cell production. It has been verified that both the stable killer and the unstable inhibitor of the systems are short polypeptides. This family corresponds to the toxin.	0.00588913
NC_008498.1\|WP_011668985.1\|5480_5816_+\|transcriptional-regulator	gnl\|CDD\|274228	TIGR02607, Virulence-associated_protein_I, addiction module antidote protein, HigA family. Members of this family form a distinct clade within the larger family HTH_3 of helix-turn-helix proteins, described by pfam01381. Members of this clade are strictly bacterial and nearly always shorter than 110 amino acids. This family includes the characterized member HigA, without which the killer protein HigB cannot be cloned. The hig (host inhibition of growth) system is noted to be unusual in that killer protein is uncoded by the upstream member of the gene pair. [Regulatory functions, DNA interactions, Regulatory functions, Protein interactions, Mobile and extrachromosomal element functions, Other].	1.4617e-09
NC_008498.1\|WP_011668982.1\|3022_3307_-\|type-II-toxin-antitoxin-system-RelB/DinJ-family-antitoxin	gnl\|CDD\|225619	COG3077, RelB, DNA-damage-inducible protein J [DNA replication, recombination, and repair].	3.88209e-09
NC_008498.1\|WP_011668989.1\|11197_11962_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	1.33159e-15

>NC_008498.1|WP_011668986.1|6653_7823_+|relaxase/mobilization-nuclease-domain-containing-protein
MATTHIKRSTSASRLVNYAEKRAVKKDGLNLDIQYAKSELKQVRDVYGNPGKTQAYASRIAFSPLEFNPKDPHDQATVLAVAKEIYAQAYPNQQVALYEHADTDSLHVHAVIGAINLETGQKLHGNWHQYRDHLVHITDQVCWEHGLMVTKPDPNRHEKRTMAEIKLRAKQQPTWKDQIRQAVDHTMQNPLIRDFQAFQSDLKQQAVKVWQRGKNLTYQLLGTNYKSRGTKLGLDYEKETIFNELARRQFQSKNNQQPQRAVNATNEPAQSNPDRTPQLPGHPDSTASHGQNVVGSTTPADRTDCSTGQSPVSDDLKQLRRQQQQLTGPIKTDLTKRLRSLSKADQPNQSAKSDRTQTDPNRARPKQSAPQPTRRPSEPDHSRNDGPSR
>NC_008498.1|WP_187146779.1|6198_6672_+|plasmid-mobilization-relaxosome-protein-MobC
MRVACQTFVIRLSLGGIQPTAEPTFDISNNFARRATEVGFVNEPQKKASTKSTTNVHRRASKQINFRVSEPDYLKLAQSAKTLNMSVPAFVKKKAQGARLVSPKIAAQDAQNITHQLAKIGSNLNQLAHHANQGGQVDPQALRNLQNEVQHLWQQLT
>NC_008498.1|WP_011668985.1|5480_5816_+|transcriptional-regulator
MLHRENSIRQYHTSSAADLIKETMDFYQITQTDLAARLGVSQKNISDILKRKRFINELLALRIETVMGISSQLLLNLDANFKLHQAKENAKNSEPDHQSDKFLKRYDWVSA
>NC_008498.1|WP_011668984.1|5143_5467_+|plasmid-maintenance-system-killer-protein
MEYVAENRKLAKILNDPRLLVKNFGRDRAKRIQSRLDEFDAADTLQQIPSDPPPRCHRLHNNLEGKFAVDVSKNFRIVFEGYDKSDQLSVEKSAIVTVQILKIEDYH
>NC_008498.1|WP_011668983.1|3439_5071_+|type-IV-secretory-system-conjugative-DNA-transfer-family-protein
MIDLIVLVLLILLAIYAHKKHAAGEKLITKPLRFFIFPVHWWLRNAIFKFTGSNFITGIIWFFAGIFIFLLFIPVYVINKTAGFIFAYYLAFGYFFCLFPQNTALAGDSDLGRAKYLSYSELKHGGLITNTGLVLGKKQHRLVAKPSDFEGNVAVFGGAGTGKTAGNLIPTLLTFQGNALVVDIKPELLKRTGHLHPNKEVLNFINPKQSYDPLATLQTYTDVTDLAKTLIPISSDIKEPYFRESAQNILASACWEFKGQKSFSEIAEFLTATPADAIIKQLSASSKSETRILINAVAGIKTEQLASVMNELRNTLVIFATDPVLKQLAGHSANSIQPQDIETNWIYLVLPESKLKVYQPYLALIVAQFTRYLTQRPEKSQPNLLLALDEFPRLGYLPAFADAISTLRSRNVSVMILLQSLAQLDQLYQETGRKIIMDNMHYVVVHNALDHTSQQYFSDRAGTKTAVAKSHSYGTGGSGGTIDALFGSSSTSYNQQSAPLIRPEEFATLKQPILYAYQLGITPVDKAYWFEDNHMKSMVELND
>NC_008498.1|WP_011668982.1|3022_3307_-|type-II-toxin-antitoxin-system-RelB/DinJ-family-antitoxin
MARIEARIDGTIKSKAKDVLAEHGLTISDFMRMTLTTVANEGLPKYYSIPNRQLKDSIQEVIDDLSGKEKLPEAHSLKELDQLLSSDDALESSK
>NC_008498.1|WP_080504823.1|2836_3022_-|hypothetical-protein
MTKAIKYTKTFKKQFKKQFKKRYQDPKWRSVFKSPLPQELDEQERSPWKFIIITVFSQLKI
>NC_008498.1|WP_011668981.1|1612_2449_-|hypothetical-protein
MSKYKRNFQEVNEQWNDQINFIQESIRAFDNGNEKEARRLATAIRVMFHDSRESLSIYNQLIKWSGKDMIFKSITDIYSPANLISSWLQLALQQSKNGLRYIPNLDESVNRRIFFMNFDDWWNQIIFDDKKNCFTRRDVVLFVANKDGGAHLDSEIKESYANIVKYNSIGWTDSDGKSPSNNPLYTSIRVISQEILDSIKLNLYSPHRVTYINKGHEMEMRFVKQGEKKRYPWSSTEVQKSPETQSIVDKHQKKSRTLYIREYQGENEGKIRVEYIGK
>NC_008498.1|WP_011668980.1|351_1281_-|hypothetical-protein
MKEKNSNYNRFMAETQVTWEHYERVRKCFGNVGSFAYWPERDSSSTQIPGKGKRAIKYKALPIIAHNESEYIAKKLNKHLHNGVVLLGLNFGVPKDCLGFTEFEKIEALRSMNDMSNQYGGKYGRKSLNVYLNEDYYSNVENVVGDPIGYDEVVCRYTEGAYMTDFFKYSIETKLDNKKSACSKPTGMPSTDGEKLLKQYRKEEFEHLIEVNAKGLKKELDALGTPDNVIIAPMSARLRDKDVEDAICKCLERNVKFINCLEHYQSRSGNKPEKDKCIKHPLQARFARNLIKANEGIEKIVQERLSEQN
>NC_008498.1|WP_011668988.1|9976_10564_+|DUF536-domain-containing-protein
MGKTIRQLSEELQLSKQAINQRISSIKDFRSKHTHKVKNHLEIDEQGVKMLANFDKQKRQDQQVNRQERQAENDKQDKKQTNINDVLLKQLDVKDQQISKLQKSLDQQQQLQLATLAENRQLKGHIQKLNGLLESSNSTQKRQATKKNDNLPNSVKPHNIKDKNDKQDRNSVVGAGKMQRKIHKNKTNKSWWHFW
>NC_008498.1|WP_011668989.1|11197_11962_+|helix-turn-helix-transcriptional-regulator
MSFKEDIKTLRRQSNLTQEALAQQLHVTRQTVSTWETGKNMPNLETLHALSQLFNISLEKLLFNEEITMKKDKDPSLATQIDHDVKLKSRYRRWTFGLGGLIALALVSIGILCLGYYKGIGTIDRFDPFLSYKVGYTKLPSEKEISPNNKATNGYWTAWFTDNTMGNEWTKLTLTTGLNPGVKNPYVMAYHKGSYVKVARIVPRTYINQTYVSNLAALDALLNHKGNTATNNHDLKKYKTQIHISDTVQQLVTE
>NC_008498.1|WP_011668990.1|12100_12706_+|helix-turn-helix-transcriptional-regulator
MKFGDRLKKGRTELNLTQEQVARDFFITRQTISSWENEKTYPDIISLIKLSDYYHVSLDTLLKEDTGMREFLEKKDVTRKIKPIYRNLIVIDLLVCSLLLGDFFNLIHLGVFILPIFLLLLCSVSALNKLNAFNNSSSLGLKYTWQKYLSGEKGLKYSLVMPTLFIISGVAFLLLKELYIGGIIIIAGALLIFFIFTQKKD
>NC_008498.1|WP_007127120.1|12845_13160_-|Txe/YoeB-family-addiction-module-toxin
MSNRWKVKIKSSAKGDLKKVLRSPLRQSFEEIKNVLESDPYKPIQSFEKLTPPAAGYYSRRINGQHRVVYTIDKVTKIVEIYSCWAHYESGNLEMSGKSNSRKN
>NC_008498.1|WP_010579598.1|13152_13413_-|type-II-toxin-antitoxin-system-Phd/YefM-family-antitoxin
MEKIINPTTARTNLFSLIKNANRDSQPVIIAGSNDSRSAVLIGKKDYDALQETMNLMMNGQIQATLSRKDDESVDLDEMIKEIDHE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_008498_1	1.1\|8762\|30\|NC_008498\|CRISPRCasFinder	8762-8791	30	NC_008498	Lactobacillus brevis ATCC 367 plasmid 1, complete sequence	8762-8791	0	1.0
NC_008498_1	1.1\|8762\|30\|NC_008498\|CRISPRCasFinder	8762-8791	30	NC_017017	Pediococcus claussenii ATCC BAA-344 plasmid pPECL-6, complete sequence	5387-5416	1	0.967
NC_008498_1	1.1\|8762\|30\|NC_008498\|CRISPRCasFinder	8762-8791	30	NZ_CP014928	Lactobacillus paracollinoides strain TMW 1.1995 plasmid pL11995-4, complete sequence	6824-6853	1	0.967
NC_008498_1	1.1\|8762\|30\|NC_008498\|CRISPRCasFinder	8762-8791	30	NZ_CP047125	Lactobacillus hilgardii strain FLUB plasmid unnamed4	5237-5266	1	0.967
NC_008498_1	1.1\|8762\|30\|NC_008498\|CRISPRCasFinder	8762-8791	30	NZ_CP014920	Lactobacillus paracollinoides strain TMW 1.1994 plasmid pL11994-5, complete sequence	12632-12661	2	0.933
NC_008498_1	1.1\|8762\|30\|NC_008498\|CRISPRCasFinder	8762-8791	30	NC_017468	Lactobacillus helveticus H10 plasmid pH10, complete sequence	15844-15873	2	0.933
NC_008498_1	1.1\|8762\|30\|NC_008498\|CRISPRCasFinder	8762-8791	30	NZ_CP033891	Lactobacillus plantarum strain LMT1-48 plasmid p_3, complete sequence	3330-3359	2	0.933
NC_008498_1	1.1\|8762\|30\|NC_008498\|CRISPRCasFinder	8762-8791	30	NZ_CP031200	Lactobacillus brevis strain UCCLBBS449 plasmid pUCCLBBS449_B, complete sequence	39624-39653	2	0.933
NC_008498_1	1.1\|8762\|30\|NC_008498\|CRISPRCasFinder	8762-8791	30	NZ_CP014874	Lactobacillus backii strain TMW 1.1989 plasmid pL11989-1, complete sequence	6854-6883	3	0.9
NC_008498_1	1.1\|8762\|30\|NC_008498\|CRISPRCasFinder	8762-8791	30	NZ_CP027191	Lactobacillus sp. CBA3605 plasmid pCBA3605-1, complete sequence	29359-29388	3	0.9
NC_008498_1	1.1\|8762\|30\|NC_008498\|CRISPRCasFinder	8762-8791	30	NZ_CP027195	Lactobacillus sp. CBA3606 plasmid pCBA3606-1, complete sequence	30409-30438	3	0.9
NC_008498_1	1.1\|8762\|30\|NC_008498\|CRISPRCasFinder	8762-8791	30	NC_006529	Lactobacillus salivarius UCC118 plasmid pSF118-20, complete sequence	4742-4771	3	0.9
NC_008498_1	1.1\|8762\|30\|NC_008498\|CRISPRCasFinder	8762-8791	30	NC_015421	Lactobacillus buchneri NRRL B-30929 plasmid pLBUC03, complete sequence	1005-1034	3	0.9
NC_008498_1	1.1\|8762\|30\|NC_008498\|CRISPRCasFinder	8762-8791	30	NZ_CP014900	Lactobacillus backii strain TMW 1.2002 plasmid pL12002-1, complete sequence	28835-28864	3	0.9
NC_008498_1	1.1\|8762\|30\|NC_008498\|CRISPRCasFinder	8762-8791	30	NZ_CP014913	Lactobacillus paracollinoides strain TMW 1.1979 plasmid pL11979-1, complete sequence	22508-22537	4	0.867
NC_008498_1	1.1\|8762\|30\|NC_008498\|CRISPRCasFinder	8762-8791	30	NZ_CP019033	Lactobacillus fermentum strain SNUV175 plasmid pSNU175-4, complete sequence	21083-21112	4	0.867
NC_008498_1	1.1\|8762\|30\|NC_008498\|CRISPRCasFinder	8762-8791	30	NZ_CP017358	Lactobacillus plantarum strain TMW 1.25 plasmid pL125-4, complete sequence	4830-4859	4	0.867
NC_008498_1	1.1\|8762\|30\|NC_008498\|CRISPRCasFinder	8762-8791	30	NZ_CP017368	Lactobacillus plantarum strain TMW 1.277 plasmid pL1277-5, complete sequence	5770-5799	4	0.867
NC_008498_1	1.1\|8762\|30\|NC_008498\|CRISPRCasFinder	8762-8791	30	NZ_CP017265	Lactobacillus paracasei strain FAM18149 plasmid pFAM18149.24, complete sequence	26504-26533	4	0.867
NC_008498_1	1.1\|8762\|30\|NC_008498\|CRISPRCasFinder	8762-8791	30	NZ_CP019982	Pediococcus inopinatus strain DSM 20285 plasmid pLDW-12, complete sequence	10405-10434	4	0.867
NC_008498_1	1.1\|8762\|30\|NC_008498\|CRISPRCasFinder	8762-8791	30	NZ_CP019982	Pediococcus inopinatus strain DSM 20285 plasmid pLDW-12, complete sequence	86924-86953	4	0.867
NC_008498_1	1.1\|8762\|30\|NC_008498\|CRISPRCasFinder	8762-8791	30	NZ_CP017960	Lactobacillus plantarum strain C410L1 plasmid unnamed6, complete sequence	6891-6920	4	0.867
NC_008498_1	1.1\|8762\|30\|NC_008498\|CRISPRCasFinder	8762-8791	30	NZ_CP017960	Lactobacillus plantarum strain C410L1 plasmid unnamed6, complete sequence	20910-20939	4	0.867
NC_008498_1	1.1\|8762\|30\|NC_008498\|CRISPRCasFinder	8762-8791	30	NZ_CP014934	Pediococcus claussenii strain TMW 2.53 plasmid pL253-1, complete sequence	5933-5962	4	0.867
NC_008498_1	1.1\|8762\|30\|NC_008498\|CRISPRCasFinder	8762-8791	30	NZ_CP014937	Pediococcus claussenii strain TMW 2.54 plasmid pL254-1, complete sequence	5934-5963	4	0.867
NC_008498_1	1.1\|8762\|30\|NC_008498\|CRISPRCasFinder	8762-8791	30	MK994179	Lactobacillus plantarum strain PC518 plasmid plp75TA, complete sequence	4885-4914	4	0.867
NC_008498_1	1.1\|8762\|30\|NC_008498\|CRISPRCasFinder	8762-8791	30	NZ_CP011537	Lactobacillus fermentum 3872 plasmid pLF3872, complete sequence	7181-7210	4	0.867
NC_008498_1	1.1\|8762\|30\|NC_008498\|CRISPRCasFinder	8762-8791	30	NZ_AP014682	Lactobacillus hokkaidonensis JCM 18461 strain LOOC260 plasmid pLOOC260-2, complete sequence	515-544	5	0.833
NC_008498_1	1.1\|8762\|30\|NC_008498\|CRISPRCasFinder	8762-8791	30	MN034684	Leviviridae sp. isolate H1_Rhizo_27_scaffold_801 RNA-dependent RNA polymerase (H1Rhizo27801_000001), hypothetical protein (H1Rhizo27801_000002), and hypothetical protein (H1Rhizo27801_000003) genes, complete cds	2054-2083	8	0.733

1. spacer 1.1|8762|30|NC_008498|CRISPRCasFinder matches to NC_008498 (Lactobacillus brevis ATCC 367 plasmid 1, complete sequence) position: , mismatch: 0, identity: 1.0

gtggggtgtcgtcaacgaactttcgcgaac	CRISPR spacer
gtggggtgtcgtcaacgaactttcgcgaac	Protospacer
******************************

2. spacer 1.1|8762|30|NC_008498|CRISPRCasFinder matches to NC_017017 (Pediococcus claussenii ATCC BAA-344 plasmid pPECL-6, complete sequence) position: , mismatch: 1, identity: 0.967

gtggggtgtcgtcaacgaactttcgcgaac	CRISPR spacer
gcggggtgtcgtcaacgaactttcgcgaac	Protospacer
*.****************************

3. spacer 1.1|8762|30|NC_008498|CRISPRCasFinder matches to NZ_CP014928 (Lactobacillus paracollinoides strain TMW 1.1995 plasmid pL11995-4, complete sequence) position: , mismatch: 1, identity: 0.967

gtggggtgtcgtcaacgaactttcgcgaac	CRISPR spacer
gcggggtgtcgtcaacgaactttcgcgaac	Protospacer
*.****************************

4. spacer 1.1|8762|30|NC_008498|CRISPRCasFinder matches to NZ_CP047125 (Lactobacillus hilgardii strain FLUB plasmid unnamed4) position: , mismatch: 1, identity: 0.967

gtggggtgtcgtcaacgaactttcgcgaac	CRISPR spacer
gcggggtgtcgtcaacgaactttcgcgaac	Protospacer
*.****************************

5. spacer 1.1|8762|30|NC_008498|CRISPRCasFinder matches to NZ_CP014920 (Lactobacillus paracollinoides strain TMW 1.1994 plasmid pL11994-5, complete sequence) position: , mismatch: 2, identity: 0.933

gtggggtgtcgtcaacgaactttcgcgaac	CRISPR spacer
gcggggtgtcgtcaacgaactttcgcgaat	Protospacer
*.***************************.

6. spacer 1.1|8762|30|NC_008498|CRISPRCasFinder matches to NC_017468 (Lactobacillus helveticus H10 plasmid pH10, complete sequence) position: , mismatch: 2, identity: 0.933

gtggggtgtcgtcaacgaactttcgcgaac	CRISPR spacer
gcggggtgtcgtcaacgaactttcgcgaag	Protospacer
*.***************************

7. spacer 1.1|8762|30|NC_008498|CRISPRCasFinder matches to NZ_CP033891 (Lactobacillus plantarum strain LMT1-48 plasmid p_3, complete sequence) position: , mismatch: 2, identity: 0.933

gtggggtgtcgtcaacgaactttcgcgaac	CRISPR spacer
gcggggtgtcgtcaacgaactttcgcgaag	Protospacer
*.***************************

8. spacer 1.1|8762|30|NC_008498|CRISPRCasFinder matches to NZ_CP031200 (Lactobacillus brevis strain UCCLBBS449 plasmid pUCCLBBS449_B, complete sequence) position: , mismatch: 2, identity: 0.933

gtggggtgtcgtcaacgaactttcgcgaac	CRISPR spacer
gcggggtgtcgtcaacgaactttcgcgaat	Protospacer
*.***************************.

9. spacer 1.1|8762|30|NC_008498|CRISPRCasFinder matches to NZ_CP014874 (Lactobacillus backii strain TMW 1.1989 plasmid pL11989-1, complete sequence) position: , mismatch: 3, identity: 0.9

gtggggtgtcgtcaacgaactttcgcgaac	CRISPR spacer
gcggggtgttgtcaacgaactttcgcgaat	Protospacer
*.*******.*******************.

10. spacer 1.1|8762|30|NC_008498|CRISPRCasFinder matches to NZ_CP027191 (Lactobacillus sp. CBA3605 plasmid pCBA3605-1, complete sequence) position: , mismatch: 3, identity: 0.9

gtggggtgtcgtcaacgaactttcgcgaac	CRISPR spacer
gcggggtgttgtcaacgaactttcgcgaat	Protospacer
*.*******.*******************.

11. spacer 1.1|8762|30|NC_008498|CRISPRCasFinder matches to NZ_CP027195 (Lactobacillus sp. CBA3606 plasmid pCBA3606-1, complete sequence) position: , mismatch: 3, identity: 0.9

gtggggtgtcgtcaacgaactttcgcgaac	CRISPR spacer
gcggggtgttgtcaacgaactttcgcgaat	Protospacer
*.*******.*******************.

12. spacer 1.1|8762|30|NC_008498|CRISPRCasFinder matches to NC_006529 (Lactobacillus salivarius UCC118 plasmid pSF118-20, complete sequence) position: , mismatch: 3, identity: 0.9

gtggggtgtcgtcaacgaactttcgcgaac	CRISPR spacer
gcggggtgtcgtcaacggactttcgcgaag	Protospacer
*.***************.***********

13. spacer 1.1|8762|30|NC_008498|CRISPRCasFinder matches to NC_015421 (Lactobacillus buchneri NRRL B-30929 plasmid pLBUC03, complete sequence) position: , mismatch: 3, identity: 0.9

gtggggtgtcgtcaacgaactttcgcgaac	CRISPR spacer
gcgggttgtcgtcaacgaactttcgcgaat	Protospacer
*.*** ***********************.

14. spacer 1.1|8762|30|NC_008498|CRISPRCasFinder matches to NZ_CP014900 (Lactobacillus backii strain TMW 1.2002 plasmid pL12002-1, complete sequence) position: , mismatch: 3, identity: 0.9

gtggggtgtcgtcaacgaactttcgcgaac	CRISPR spacer
gcggggtgttgtcaacgaactttcgcgaat	Protospacer
*.*******.*******************.

15. spacer 1.1|8762|30|NC_008498|CRISPRCasFinder matches to NZ_CP014913 (Lactobacillus paracollinoides strain TMW 1.1979 plasmid pL11979-1, complete sequence) position: , mismatch: 4, identity: 0.867

gtggggtgtcgtcaacgaactttcgcgaac	CRISPR spacer
gcggggtgtcatcaacggactttcgcgaag	Protospacer
*.********.******.***********

16. spacer 1.1|8762|30|NC_008498|CRISPRCasFinder matches to NZ_CP019033 (Lactobacillus fermentum strain SNUV175 plasmid pSNU175-4, complete sequence) position: , mismatch: 4, identity: 0.867

gtggggtgtcgtcaacgaactttcgcgaac	CRISPR spacer
gcggagtgtcgtcaacggactttcgcgaag	Protospacer
*.**.************.***********

17. spacer 1.1|8762|30|NC_008498|CRISPRCasFinder matches to NZ_CP017358 (Lactobacillus plantarum strain TMW 1.25 plasmid pL125-4, complete sequence) position: , mismatch: 4, identity: 0.867

gtggggtgtcgtcaacgaactttcgcgaac	CRISPR spacer
gcggggtgtcatcaacggactttcgcgaag	Protospacer
*.********.******.***********

18. spacer 1.1|8762|30|NC_008498|CRISPRCasFinder matches to NZ_CP017368 (Lactobacillus plantarum strain TMW 1.277 plasmid pL1277-5, complete sequence) position: , mismatch: 4, identity: 0.867

gtggggtgtcgtcaacgaactttcgcgaac	CRISPR spacer
gcggggtgtcatcaacggactttcgcgaag	Protospacer
*.********.******.***********

19. spacer 1.1|8762|30|NC_008498|CRISPRCasFinder matches to NZ_CP017265 (Lactobacillus paracasei strain FAM18149 plasmid pFAM18149.24, complete sequence) position: , mismatch: 4, identity: 0.867

gtggggtgtcgtcaacgaactttcgcgaac	CRISPR spacer
gcggggtgtcatcaacggactttcgcgaag	Protospacer
*.********.******.***********

20. spacer 1.1|8762|30|NC_008498|CRISPRCasFinder matches to NZ_CP019982 (Pediococcus inopinatus strain DSM 20285 plasmid pLDW-12, complete sequence) position: , mismatch: 4, identity: 0.867

gtggggtgtcgtcaacgaactttcgcgaac	CRISPR spacer
gcggagtgttgtcaacgaactttcgcgaat	Protospacer
*.**.****.*******************.

21. spacer 1.1|8762|30|NC_008498|CRISPRCasFinder matches to NZ_CP019982 (Pediococcus inopinatus strain DSM 20285 plasmid pLDW-12, complete sequence) position: , mismatch: 4, identity: 0.867

gtggggtgtcgtcaacgaactttcgcgaac	CRISPR spacer
gcggagtgttgtcaacgaactttcgcgaat	Protospacer
*.**.****.*******************.

22. spacer 1.1|8762|30|NC_008498|CRISPRCasFinder matches to NZ_CP017960 (Lactobacillus plantarum strain C410L1 plasmid unnamed6, complete sequence) position: , mismatch: 4, identity: 0.867

gtggggtgtcgtcaacgaactttcgcgaac	CRISPR spacer
gcggggtgtcatcaacggactttcgcgaag	Protospacer
*.********.******.***********

23. spacer 1.1|8762|30|NC_008498|CRISPRCasFinder matches to NZ_CP017960 (Lactobacillus plantarum strain C410L1 plasmid unnamed6, complete sequence) position: , mismatch: 4, identity: 0.867

gtggggtgtcgtcaacgaactttcgcgaac	CRISPR spacer
gcggggtgtcatcaacggactttcgcgaag	Protospacer
*.********.******.***********

24. spacer 1.1|8762|30|NC_008498|CRISPRCasFinder matches to NZ_CP014934 (Pediococcus claussenii strain TMW 2.53 plasmid pL253-1, complete sequence) position: , mismatch: 4, identity: 0.867

gtggggtgtcgtcaacgaactttcgcgaac	CRISPR spacer
gcggggtgtcatcaacggactttcgcgaag	Protospacer
*.********.******.***********

25. spacer 1.1|8762|30|NC_008498|CRISPRCasFinder matches to NZ_CP014937 (Pediococcus claussenii strain TMW 2.54 plasmid pL254-1, complete sequence) position: , mismatch: 4, identity: 0.867

gtggggtgtcgtcaacgaactttcgcgaac	CRISPR spacer
gcggggtgtcatcaacggactttcgcgaag	Protospacer
*.********.******.***********

26. spacer 1.1|8762|30|NC_008498|CRISPRCasFinder matches to MK994179 (Lactobacillus plantarum strain PC518 plasmid plp75TA, complete sequence) position: , mismatch: 4, identity: 0.867

gtggggtgtcgtcaacgaactttcgcgaac	CRISPR spacer
gcggggtgtcatcaacggactttcgcgaag	Protospacer
*.********.******.***********

27. spacer 1.1|8762|30|NC_008498|CRISPRCasFinder matches to NZ_CP011537 (Lactobacillus fermentum 3872 plasmid pLF3872, complete sequence) position: , mismatch: 4, identity: 0.867

gtggggtgtcgtcaacgaactttcgcgaac	CRISPR spacer
gcggagtgtcgtcaacggactttcgcgaag	Protospacer
*.**.************.***********

28. spacer 1.1|8762|30|NC_008498|CRISPRCasFinder matches to NZ_AP014682 (Lactobacillus hokkaidonensis JCM 18461 strain LOOC260 plasmid pLOOC260-2, complete sequence) position: , mismatch: 5, identity: 0.833

gtggggtgtcgtcaacgaactttcgcgaac	CRISPR spacer
gaggggtgtcgtcaacgaacttatgcggaa	Protospacer
* ******************** .***.*

29. spacer 1.1|8762|30|NC_008498|CRISPRCasFinder matches to MN034684 (Leviviridae sp. isolate H1_Rhizo_27_scaffold_801 RNA-dependent RNA polymerase (H1Rhizo27801_000001), hypothetical protein (H1Rhizo27801_000002), and hypothetical protein (H1Rhizo27801_000003) genes, complete cds) position: , mismatch: 8, identity: 0.733

gtggggtgtcgtcaacgaactttcgcgaac	CRISPR spacer
cgctggtgtcgtcaacgaacattcgctact	Protospacer
    **************** ***** * .

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NC_008497

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_008497_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_008497_1

944684-945017

Orphan

I-B,III-A,III-B

Consensus_repeat	Method
AGGATCACCCCCACATGTGTGGGGAATAC	CRISPRCasFinder
GGATCACCCCCACANGTGTGGGGAATAC	CRT
AGGATCACCCCCACATGTGTGGGGAATAC	PILER-CR

5 spacers

The CRISPR arrays of NC_008497_1

>merge|NC_008497|1|944684-945017|CRISPRCasFinder,CRT,PILER-CR
GAGACCACCCCTACATATGTGGGGAATACTTGGTTCAAATGCTACAAGCTCGTTTTCAGCCAGGATCACCCCCACACGTGTGGGGAATACCACTAAGGCAGCTAAGCCGAAAAAGGCCATCTAGGATCACCCCCACATGTGTGGGGAATACGAAAAATCTGTTGGGCTATAAGGCTACAGCAGAGGATCACCCCCACATGTGTGGGGAATACACAGTTGTTTGTGGAATATCTTGGTACTGTCCAGGATCACCCCCACATGTGTGGGGAATACTTCATAAAAAAGCCGTCATTCCGCATTCAATGGGGATCACCCCCACACGTGTGGGGAATAC

>NC_008497|1|1|944684-945017|CRISPRCasFinder
GAGACCACCCCTACATATGTGGGGAATAC	TTGGTTCAAATGCTACAAGCTCGTTTTCAGCC
AGGATCACCCCCACACGTGTGGGGAATAC	CACTAAGGCAGCTAAGCCGAAAAAGGCCATCT
AGGATCACCCCCACATGTGTGGGGAATAC	GAAAAATCTGTTGGGCTATAAGGCTACAGCAG
AGGATCACCCCCACATGTGTGGGGAATAC	ACAGTTGTTTGTGGAATATCTTGGTACTGTCC
AGGATCACCCCCACATGTGTGGGGAATAC	TTCATAAAAAAGCCGTCATTCCGCATTCAATG
GGGATCACCCCCACACGTGTGGGGAATAC

>NC_008497|1|1|944685-945017|CRT
AGACCACCCCTACATATGTGGGGAATAC	TTGGTTCAAATGCTACAAGCTCGTTTTCAGCCA
GGATCACCCCCACACGTGTGGGGAATAC	CACTAAGGCAGCTAAGCCGAAAAAGGCCATCTA
GGATCACCCCCACATGTGTGGGGAATAC	GAAAAATCTGTTGGGCTATAAGGCTACAGCAGA
GGATCACCCCCACATGTGTGGGGAATAC	ACAGTTGTTTGTGGAATATCTTGGTACTGTCCA
GGATCACCCCCACATGTGTGGGGAATAC	TTCATAAAAAAGCCGTCATTCCGCATTCAATGG
GGATCACCCCCACACGTGTGGGGAATAC

>NC_008497|1|1|944745-945017|PILER-CR
AGGATCACCCCCACACGTGTGGGGAATAC	CACTAAGGCAGCTAAGCCGAAAAAGGCCATCT
AGGATCACCCCCACATGTGTGGGGAATAC	GAAAAATCTGTTGGGCTATAAGGCTACAGCAG
AGGATCACCCCCACATGTGTGGGGAATAC	ACAGTTGTTTGTGGAATATCTTGGTACTGTCC
AGGATCACCCCCACATGTGTGGGGAATAC	TTCATAAAAAAGCCGTCATTCCGCATTCAATG
GGGATCACCCCCACACGTGTGGGGAATAC

Protein	Signature genes	Signature genes Name	Protein_function
NC_008497.1\|WP_011667639.1\|941318_941549_+\|hypothetical-protein	unknown	unknown	unknown
NC_008497.1\|WP_114639870.1\|941886_942885_+\|CAP-domain-containing-protein	unknown	unknown	gnl\|CDD\|365934
NC_008497.1\|WP_011667632.1\|935053_936118_+\|ribosome-small-subunit-dependent-GTPase-A	unknown	unknown	gnl\|CDD\|234988
NC_008497.1\|WP_011667642.1\|945224_945539_-\|type-II-toxin-antitoxin-system-HicB-family-antitoxin	unknown	unknown	gnl\|CDD\|374224
NC_008497.1\|WP_011667647.1\|947696_948017_-\|MazG-like-family-protein	unknown	unknown	gnl\|CDD\|212133
NC_008497.1\|WP_139588292.1\|942982_944464_-\|VaFE-repeat-containing-surface-anchored-protein	unknown	unknown	gnl\|CDD\|375630
NC_008497.1\|WP_011667648.1\|948261_948783_-\|biotin-transporter-BioY	unknown	unknown	gnl\|CDD\|224187
NC_008497.1\|WP_011667637.1\|940010_940643_-\|DJ-1/PfpI-family-protein	unknown	unknown	gnl\|CDD\|153234
NC_008497.1\|WP_011667649.1\|948793_949585_-\|biotin--[acetyl-CoA-carboxylase]-ligase	unknown	unknown	gnl\|CDD\|223417
NC_008497.1\|WP_011667644.1\|946256_946715_+\|DUF3021-domain-containing-protein	unknown	unknown	gnl\|CDD\|378668
NC_008497.1\|WP_011667643.1\|945819_946260_+\|LytTR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197918
NC_008497.1\|WP_011667636.1\|938794_939883_+\|NAD(P)-dependent-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|176239
NC_008497.1\|WP_011667634.1\|937343_937697_+\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133384
NC_008497.1\|WP_161936528.1\|937780_938584_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223656
NC_008497.1\|WP_011667646.1\|946869_947385_-\|isochorismatase-family-protein	unknown	unknown	gnl\|CDD\|238496
NC_008497.1\|WP_011667650.1\|949597_950356_-\|enoyl-ACP-reductase-FabI	unknown	unknown	gnl\|CDD\|235694
NC_008497.1\|WP_011667633.1\|936224_937232_-\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381305
NC_008497.1\|WP_011667651.1\|950386_951154_-\|acetyl-CoA-carboxylase-carboxyl-transferase-subunit-alpha	unknown	unknown	gnl\|CDD\|235580
NC_008497.1\|WP_011667652.1\|951153_951987_-\|acetyl-CoA-carboxylase-carboxyltransferase-subunit-beta	unknown	unknown	gnl\|CDD\|235547
NC_008497.1\|WP_133174544.1\|941135_941210_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|237756

Protein	Function_ID	Function_description	E-value
NC_008497.1\|WP_011667646.1\|946869_947385_-\|isochorismatase-family-protein	gnl\|CDD\|238496	cd01014, nicotinamidase_related, Nicotinamidase_ related amidohydrolases. Cysteine hydrolases of unknown function that share the catalytic triad with other amidohydrolases, like nicotinamidase, which converts nicotinamide to nicotinic acid and ammonia.	9.48325e-42
NC_008497.1\|WP_114639870.1\|941886_942885_+\|CAP-domain-containing-protein	gnl\|CDD\|365934	pfam00188, CAP, Cysteine-rich secretory protein family. This is a large family of cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 proteins (CAP) that are found in a wide range of organisms, including prokaryotes and non-vertebrate eukaryotes, The nine subfamilies of the mammalian CAP 'super'family include: the human glioma pathogenesis-related 1 (GLIPR1), Golgi associated pathogenesis related-1 (GAPR1) proteins, peptidase inhibitor 15 (PI15), peptidase inhibitor 16 (PI16), cysteine-rich secretory proteins (CRISPs), CRISP LCCL domain containing 1 (CRISPLD1), CRISP LCCL domain containing 2 (CRISPLD2), mannose receptor like and the R3H domain containing like proteins. Members are most often secreted and have an extracellular endocrine or paracrine function and are involved in processes including the regulation of extracellular matrix and branching morphogenesis, potentially as either proteases or protease inhibitors; in ion channel regulation in fertility; as tumor suppressor or pro-oncogenic genes in tissues including the prostate; and in cell-cell adhesion during fertilisation. The overall protein structural conservation within the CAP 'super'family results in fundamentally similar functions for the CAP domain in all members, yet the diversity outside of this core region dramatically alters the target specificity and, thus, the biological consequences. The Ca++-chelating function would fit with the various signalling processes (e.g. the CRISP proteins) that members of this family are involved in, and also the sequence and structural evidence of a conserved pocket containing two histidines and a glutamate. It also may explain how the cysteine-rich venom protein helothermine blocks the Ca++ transporting ryanodine receptors.	7.10226e-15
NC_008497.1\|WP_011667632.1\|935053_936118_+\|ribosome-small-subunit-dependent-GTPase-A	gnl\|CDD\|234988	PRK01889, PRK01889, GTPase RsgA; Reviewed.	7.97028e-136
NC_008497.1\|WP_011667642.1\|945224_945539_-\|type-II-toxin-antitoxin-system-HicB-family-antitoxin	gnl\|CDD\|374224	pfam15919, HicB_lk_antitox, HicB_like antitoxin of bacterial toxin-antitoxin system. This is a family of HicB-like antitoxins.	1.54624e-06
NC_008497.1\|WP_011667647.1\|947696_948017_-\|MazG-like-family-protein	gnl\|CDD\|212133	cd11523, NTP-PPase, Nucleoside Triphosphate Pyrophosphohydrolase (EC 3.6.1.8) MazG-like domain superfamily. This superfamily contains enzymes that hydrolyze the alpha-beta phosphodiester bond of all canonical NTPs into monophosphate derivatives and pyrophosphate (PPi). Divalent ions, such as Mg2+ ion(s), are essential to activate a proposed water nucleophile and stabilize the charged intermediates to facilitate catalysis. These enzymes share a conserved divalent ion-binding motif EXX[E/D] in their active sites. They also share a highly conserved four-helix bundle, where one face forms the active site, while the other participates in oligomer assembly. The four-helix bundle consists of two central antiparallel alpha-helices that can be contained within a single protomer or form upon dimerization. The superfamily members include dimeric dUTP pyrophosphatases (dUTPases; EC 3.6.1.23), the nonspecific NTP-PPase MazG proteins, HisE-encoded phosphoribosyl ATP pyrophosphohydolase (PRA-PH), fungal histidine biosynthesis trifunctional proteins, and several uncharacterized protein families.	3.85638e-12
NC_008497.1\|WP_139588292.1\|942982_944464_-\|VaFE-repeat-containing-surface-anchored-protein	gnl\|CDD\|375630	pfam18202, TQ, T-Q ester bond containing domain. This domain is found in gram positive bacterial surface proteins. It contains a very unusual isopeptide bond between a conserved N-terminal threonine residue on the first beta strand of the Ig-like fold and and a glutamine residue in the final strand of the domain.	0.000484474
NC_008497.1\|WP_011667648.1\|948261_948783_-\|biotin-transporter-BioY	gnl\|CDD\|224187	COG1268, BioY, Uncharacterized conserved protein [General function prediction only].	1.07517e-24
NC_008497.1\|WP_011667637.1\|940010_940643_-\|DJ-1/PfpI-family-protein	gnl\|CDD\|153234	cd03140, GATase1_PfpI_3, Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus. Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus. PfpI is an ATP-independent intracellular proteases which may hydrolyze small peptides to provide a nutritional source. Only Cys of the catalytic triad typical of GATase1 domains is conserved in this group. This Cys residue is found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow.	1.21631e-61
NC_008497.1\|WP_011667649.1\|948793_949585_-\|biotin--[acetyl-CoA-carboxylase]-ligase	gnl\|CDD\|223417	COG0340, BirA, Biotin-(acetyl-CoA carboxylase) ligase [Coenzyme metabolism].	1.3895e-46
NC_008497.1\|WP_011667644.1\|946256_946715_+\|DUF3021-domain-containing-protein	gnl\|CDD\|378668	pfam11457, DUF3021, Protein of unknown function (DUF3021). This is a bacterial family of uncharacterized proteins.	2.29851e-27
NC_008497.1\|WP_011667643.1\|945819_946260_+\|LytTR-family-transcriptional-regulator	gnl\|CDD\|197918	smart00850, LytTR, LytTr DNA-binding domain. This domain is found in a variety of bacterial transcriptional regulators. The domain binds to a specific DNA sequence pattern.	1.70891e-16
NC_008497.1\|WP_011667636.1\|938794_939883_+\|NAD(P)-dependent-alcohol-dehydrogenase	gnl\|CDD\|176239	cd08278, benzyl_alcohol_DH, Benzyl alcohol dehydrogenase. Benzyl alcohol dehydrogenase is similar to liver alcohol dehydrogenase, but has some amino acid substitutions near the active site, which may determine the enzyme's specificity of oxidizing aromatic substrates. Also known as aryl-alcohol dehydrogenases, they catalyze the conversion of an aromatic alcohol + NAD+ to an aromatic aldehyde + NADH + H+. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction.	0
NC_008497.1\|WP_011667634.1\|937343_937697_+\|MerR-family-transcriptional-regulator	gnl\|CDD\|133384	cd01109, HTH_YyaN, Helix-Turn-Helix DNA binding domain of the MerR-like transcription regulators YyaN and YraB. Putative helix-turn-helix (HTH) MerR-like transcription regulators of Bacillus subtilis, YyaN and YraB, and related proteins; N-terminal domain. Based on sequence similarity, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.	5.54847e-40
NC_008497.1\|WP_161936528.1\|937780_938584_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|223656	COG0583, LysR, Transcriptional regulator [Transcription].	6.29434e-15
NC_008497.1\|WP_011667650.1\|949597_950356_-\|enoyl-ACP-reductase-FabI	gnl\|CDD\|235694	PRK06079, PRK06079, enoyl-[acyl-carrier-protein] reductase FabI.	2.99038e-168
NC_008497.1\|WP_011667633.1\|936224_937232_-\|aldo/keto-reductase	gnl\|CDD\|381305	cd19079, AKR_EcYajO-like, Escherichia coli YajO and similar proteins. Escherichia coli YajO is the prototype of this family. It is an uncharacterized aldo/keto reductase family oxidoreductase.	2.00788e-158
NC_008497.1\|WP_011667651.1\|950386_951154_-\|acetyl-CoA-carboxylase-carboxyl-transferase-subunit-alpha	gnl\|CDD\|235580	PRK05724, PRK05724, acetyl-CoA carboxylase carboxyltransferase subunit alpha; Validated.	2.56053e-113
NC_008497.1\|WP_011667652.1\|951153_951987_-\|acetyl-CoA-carboxylase-carboxyltransferase-subunit-beta	gnl\|CDD\|235547	PRK05654, PRK05654, acetyl-CoA carboxylase carboxyltransferase subunit beta.	4.8975e-131
NC_008497.1\|WP_133174544.1\|941135_941210_+\|hypothetical-protein	gnl\|CDD\|237756	PRK14559, PRK14559, serine/threonine phosphatase.	0.00158602

>NC_008497.1|WP_139588292.1|942982_944464_-|VaFE-repeat-containing-surface-anchored-protein
MSATDKTEIVAAFSNVVSKIKDIQNSDQNTVDQNTGDNASNPNHANTGYTTNLSETAAANKRLSENKLVPVKPDYDTTPINPHDKKYLIDTTALRGQKMVMIEDMSTGQGTKEDQITSEVDVNNTKQTVRVTNPAIHTMQTVNNKKNFVLKGDGSNVQEPIVDKVSFTDFAPGEKMVLTAVEMDAGTQQPVILDNQYLIGRKTLTPTTSDGVATVQFNEFDGAPNARYMTPVLNSAGLVTNNAVNDGISSAQDSDNNADAVNRDETNDAQADGTTTGAYQGVAGLGLGTDDTDAETDTTAYNINLQSLNSLAALSDGDQAKWVAYETAQSADGSIVAEHKDASDTGQTISITHNAGTTDNNAQSGLTVNNQNGQKQGNDGSLDSHNNNNPSNGSNPSNGGGSLSNGSNPTTGSSTTPGSQYTTTQPGQNGMTPTTQVPSQLPSQARSVFSQGQPLQGTTYVRPSVTRPTFGQTGGTDKLSNNWFYNFIYRFMK
>NC_008497.1|WP_114639870.1|941886_942885_+|CAP-domain-containing-protein
MYKTIRKGEFKLSNKAQKLLCIAFSALVGLSITAAIPTTSQAAKRKPGKVVRTMKYKTMKVKAKKGYVYTSTKLTKRGVHLTKYKNKVMTTKKAYLIKVPGKPAVWYDRVSSKNKKLNGYVYNNYLKVIKKSSTNGKTSTKTTNKVPVDPDANVPLKDLYSYGTNSKTNPGQKTGHDGDQSYFDSDLFSKYPANLEDYKTIFVELLNQERQMRGISPVSADSALMQIADKRAEDTKAINYLEHRDGNGNLIAGNYLKEAGINVSNYAECLCFETEAPARMAVRDSLRGYIYQDADHNWGHRDSLLNPAFAHIGVGAVKSSDGNFIDNAVVLY
>NC_008497.1|WP_011667639.1|941318_941549_+|hypothetical-protein
MSIETAHDSIVLWENKAVELQDHIDDLCIILESHDDPEIEKMIHRAMQEKARYNKKIQRAQNELDSAIGSILSGIN
>NC_008497.1|WP_133174544.1|941135_941210_+|hypothetical-protein
MECPYCGQPVSVSDTQCPYCHRDL
>NC_008497.1|WP_011667637.1|940010_940643_-|DJ-1/PfpI-family-protein
MKQAIFVMMDQYADWEGAHLSSQLNQMTDWTVKTASNQPEVTSIGGWTTRVDYQISELNPEMTLLVLIGGNAWQHDDPRLTALIQQCLQRKVIVGAICGAVDYLARNGLLTGYRHTGNAQFSWQSFPKYQNPTDFELQQVVVDRQLVTANGTAALSFTSAVLKASGQLTIAAKQALDLQQLGYYDNTETHLNCRGDRSWIRLVLKKVTDC
>NC_008497.1|WP_011667636.1|938794_939883_+|NAD(P)-dependent-alcohol-dehydrogenase
MQIKTAFSDGTSEQLKIIDATLDEPKANEVLIKMVATGVCHTDTAGRDGLTTPLPVSLGHEGAGIVEQVGSSVMDLQPGDHVVLSFAYCGRCQHCLTGHPGMCEHFNELNFAGHNFDGSHRIHTLDGQPISTFFGQSSFSTHTVVDQHNVIKVDPTVDLRLLGPLGCGIQTGAGTILNYLQPKFGESLVIFGTGAVGLSAIMAAKITGANHIIAIDIFDNRLALAKELGATEVINSHQADVEATLKEILPTGADYAIDTTGVSPVVMNALHALKPGGECAVVGMGRGLTFNLMDDLMAEGKKISGVIEGDAIPQLFIPKLVDYYKQGRFPFDKLIKFYDFDQINDGFAASKDGSVLKPVITF
>NC_008497.1|WP_161936528.1|937780_938584_-|LysR-family-transcriptional-regulator
MSKRISALEAEIGATLFDRQKNKINLTAAGKHFLTRATELLNTMRMTTYEVQQFTQQAKEQFSVGYFSPFEGALLRMALLDLPTTTNFLIEEAGIEHLISDVLLKKIDCAVIIDNPLFNAKIDQTNLDSVTLVTDHMTLGLSPDLISDQTDSPADYLAKFPVIYYSSEESTYLEEVFKSSIGQLADTFNARRVNSYEQMQLLVGMGKAISFYPTELIKYMATPYDHIAYLSLDGVTTAHSEFKLIYHHDNHQPLIKQIQRYFDTHQF
>NC_008497.1|WP_011667634.1|937343_937697_+|MerR-family-transcriptional-regulator
MKIETVAQRYHISTSAIRYYEQQGLIGPINRINGIRDFNTTDLERMDFILCVKQCGMTIKQMKQFIATYEQGDSTLRERLTILQTQLSASEEQLTTLTQSISHLKQKIGDIHIRLAE
>NC_008497.1|WP_011667633.1|936224_937232_-|aldo/keto-reductase
MQYTKLGHTEIMASKICVGAMSFGQPGTMHDWTLDYPASERVISHALSLGINFFDTAKGYSAGTSETYLGRALKAQRVARDQVVLASKVYFNPGRLSAKAIHHEIDGTLKRLETDYLDLYIIHRFDYDTPIEETMAALNELVTAGKVRAIGASAMYGYQFNNMQQVAKDRGWAQFQTMGNRYNLLYREDERELIPICQQQGVSLTPYSPLAAGHLSHSAWQVDTLRSQTDRVAMGKYDRTETEDQRIVARVAELAHKYQVSMTQIALAWQWAKGVAAPIVGSTKTSHLDEAVAALSVKLTTADIDYLEDLYRPHPIVGALDHTPAAGTILIDQKK
>NC_008497.1|WP_011667632.1|935053_936118_+|ribosome-small-subunit-dependent-GTPase-A
MSNSNLLSYGVTSTLIHQFADISDRQVGHIVRQERQQYQVITAVGVVSAQTSGRFNHHVLDTSDFPVIGDFVGIQLTPTKDAAIIHQELPRNSLFVRQAAGTTHQVQSVAANVDVALICMSLNHDFNPHRLERYLTVCWDSGATPVVVLTKSDLCSDTEAKLAVIAPMTLGVTVLTTTTTTANGLAPLQTFLQAGQTFALLGSSDVGKSILINRLLGKTIITTDGLRNDDKGHHTTTSRELYQLSSGALMIDTPGMRALGLWGADTGLAQNFSDVADLIRHCRFRNCHHQTEPGCAVKAALATGQLTTERGQSYQKLQAENAYSHDTQAYLAQKQRTEVANAKQIRQIYHPKHY
>NC_008497.1|WP_011667642.1|945224_945539_-|type-II-toxin-antitoxin-system-HicB-family-antitoxin
MTKSNIVTYPAVFHDNEVGGYTVTFPDIEDATTSGQTLGESLVNAAIVLGQTLHDQPTVLPSATTITELMHQYPMAFIQFVAVDLNQVIARAVPTDQVDLQLIQ
>NC_008497.1|WP_011667643.1|945819_946260_+|LytTR-family-transcriptional-regulator
MHVTFNLKASFIPPFITINAPAETPELQHLATNISQLTNSQLIAGISPRGTRELVPVNQIIRIHTDAKHVVMETKATSYTLTQRIYQLKQLLPSDLFLQLSSGELVNRQHIRHFSLTPSGQVLLSTGATTFVSRRCMQQIRKEFLK
>NC_008497.1|WP_011667644.1|946256_946715_+|DUF3021-domain-containing-protein
MKRLGILTSGAFLGLSIGFICALFFSLTNHATTFMPSSPDFVAHLSSNTMATLAAAGLWAAIGLLFSLTSLIFFNEHWSIARQTIWHLGLSYLGFTPLAILAGWFPLNVTWLLLYTLIFVGIYLVIWTYSMLRARKTVQHLNDVLLPHKYTN
>NC_008497.1|WP_011667646.1|946869_947385_-|isochorismatase-family-protein
MAQALIVIDMQQALAKIDHRNQMVATINQRIDRYREAQRPIIFIQHTEPGMEVASAGWQLFPDLHAAGSDVYYNKTRPDSFYQTGLEAFLKMNQLRTIEICGAQVEYCVDTTIRVAYHLGFQIELLMAGISTLDSDLLTATQIKQHHAHIWEHRFAEFVTANTELDGQYQK
>NC_008497.1|WP_011667647.1|947696_948017_-|MazG-like-family-protein
MSISDHQQWLVDFYRQRNWYQYSPFVHLNFLTEEVGEVSRAIRAEEIGRDHPGERPATTAEKRANLKEELADALDQVLVISSLYDIDAADLLTASEQKLTQRFKQK
>NC_008497.1|WP_011667648.1|948261_948783_-|biotin-transporter-BioY
MQERQSIPLVGLFIAIIVIFGFFPAIPLAISPVPLVLQNMGVMVVTLLLPTRQSLAAIGLFLLLVLVGLPVLASRQAGPAVFLGPNGGYLVGWLIMPLMLQGLTYGRVPRLVAILLSAMGVDILGAVWLSTVTTMSLPQALVATLAFIPGDSLKAVGAWWLAQRLRKWAPKMI
>NC_008497.1|WP_011667649.1|948793_949585_-|biotin--[acetyl-CoA-carboxylase]-ligase
MQPKGNQLAVDRIRELRQTTCPIAIQLRSTVDSTNAWAKRVPAASDSPMQAFLAEQQTAGYGKRQRAFFSPAFQGVYLTVRTAVTAPVNPGRLTTAVGVMVVRCLAATYPKQTFQLKWVNDILLHQRKCGGILIENLLDRQEVLIGIGLNVTTRFSTELANKATSIVGGNWVDRNGLVAGLLDELVMGLPHYQDAQFLADYQQLCTTLGQAVRVQVGPDWVQGVAVTLTDQGALVIQLASGERRIVASSEAIKVMTPVGDYRG
>NC_008497.1|WP_011667650.1|949597_950356_-|enoyl-ACP-reductase-FabI
MNGILTDKVIVVMGVANQRSIAWGCVQAILAQGGTPVLTYQNERLKKSIQRFVPEDIQLVACDVAEDAAIQQAFQQIGERYGNIDGVIHAIAYADPETLKQGLVETRRTGYNLAQEISAYSFIAVARYARPWLTKPASLITLTYFGATRAIPNYNMMGVAKAALESSVRYLATDLGTEQIRVNAISAGAVKTLAVTGIKGHGDLLKMSTSLTVYQQSVTTSEIGNVAAFLLSDLSTGMTGDILYVDKGVHLM
>NC_008497.1|WP_011667651.1|950386_951154_-|acetyl-CoA-carboxylase-carboxyl-transferase-subunit-alpha
MVKSAYQTVQAARSQDKITTEALIDGLVTDFFECHGDRVDGDDPTIIGGIGRLNGQPITVIGTRKGRNLTENVARHFGSPMPQGYRKVQRLLQQAEKFGRPVLTLINTPGAYPDVASEFHGQGEAIAQCLYQGMQLKVPYISLIFGEGGSGGALALACGDRVYMTVDSIYSVLSPEGYASIMWKDASRVREAAAALALTPQDLKREKVIDDILPEVHTATELSQLTDFLHEQFKILGKLPISTLIDQRQTRFDQY
>NC_008497.1|WP_011667652.1|951153_951987_-|acetyl-CoA-carboxylase-carboxyltransferase-subunit-beta
MLPAKFKTPSQKSLNRRMASIPDGLVRRCPVCHTTFLTDHWEPTRLCPACGYGFRLTAMQRIKLTMDTFQETNAQLTVPDRYTDAAYQAKVARGRQLTGLNESVLTGFGTIDHQSTAIGVMDAFFVMGSLGTATGEKITRLFDEATAKRLPVILFTASGGARMQEGIHSLMQMAKVSAAVARHSQAGLLYIVVLCDPTTGGVTASFAMQGDLILAEPHALVGFAGRRVIEQTIHQTPPADFQRAETVLQHGFIDAIVARPQLKQRLADLLRLHKGES

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_008497_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_008497_2

2249734-2250005

Orphan

I-E,II-B

Consensus_repeat	Method
GGATCACCCCCACACCTGTGGGGAATAC	CRISPRCasFinder
GGATCACCCCCACACCTGTGGGGAATAC	CRT
GGATCACCCCCACACCTGTGGGGAATAC	PILER-CR

4 spacers

The CRISPR arrays of NC_008497_2

>merge|NC_008497|2|2249734-2250005|CRISPRCasFinder,CRT,PILER-CR
GAAATGCCCCCACACCTGTGGGGTATACGCTTAAAATCAAGCAGTCGTTGGGCTACGTCAAGGATCACCCCCACACCTGTGGGGAATACTGACAACCAAAAAATATACGACTTTAACTTCTGGGATCACCCCCACACCTGTGGGGAATACCTTTCTGGTATTTCTTCTCTATGTCATGATTAAGGATCACCCCCACACCTGTGGGGAATACGATGAATAAGAAAAGAAAACAAAATAATACGCAGGATCACCCCCACACCTGTGGGGAATAC

>NC_008497|2|2|2249734-2250005|CRISPRCasFinder
GAAATGCCCCCACACCTGTGGGGTATAC	GCTTAAAATCAAGCAGTCGTTGGGCTACGTCAA
GGATCACCCCCACACCTGTGGGGAATAC	TGACAACCAAAAAATATACGACTTTAACTTCTG
GGATCACCCCCACACCTGTGGGGAATAC	CTTTCTGGTATTTCTTCTCTATGTCATGATTAA
GGATCACCCCCACACCTGTGGGGAATAC	GATGAATAAGAAAAGAAAACAAAATAATACGCA
GGATCACCCCCACACCTGTGGGGAATAC

>NC_008497|2|2|2249734-2250005|CRT
GAAATGCCCCCACACCTGTGGGGTATAC	GCTTAAAATCAAGCAGTCGTTGGGCTACGTCAA
GGATCACCCCCACACCTGTGGGGAATAC	TGACAACCAAAAAATATACGACTTTAACTTCTG
GGATCACCCCCACACCTGTGGGGAATAC	CTTTCTGGTATTTCTTCTCTATGTCATGATTAA
GGATCACCCCCACACCTGTGGGGAATAC	GATGAATAAGAAAAGAAAACAAAATAATACGCA
GGATCACCCCCACACCTGTGGGGAATAC

>NC_008497|2|2|2249795-2250005|PILER-CR
GGATCACCCCCACACCTGTGGGGAATAC	TGACAACCAAAAAATATACGACTTTAACTTCTG
GGATCACCCCCACACCTGTGGGGAATAC	CTTTCTGGTATTTCTTCTCTATGTCATGATTAA
GGATCACCCCCACACCTGTGGGGAATAC	GATGAATAAGAAAAGAAAACAAAATAATACGCA
GGATCACCCCCACACCTGTGGGGAATAC

Protein	Signature genes	Signature genes Name	Protein_function
NC_008497.1\|WP_011668937.1\|2246256_2246856_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|379199
NC_008497.1\|WP_011668945.1\|2257097_2257619_+\|QueT-transporter-family-protein	unknown	unknown	gnl\|CDD\|377623
NC_008497.1\|WP_011668934.1\|2243424_2244567_+\|ArgE/DapE-family-deacylase	unknown	unknown	gnl\|CDD\|181490
NC_008497.1\|WP_011668951.1\|2263543_2265019_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|225121
NC_008497.1\|WP_011668938.1\|2246998_2247982_+\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381309
NC_008497.1\|WP_011668933.1\|2239524_2243130_-\|ATP-dependent-helicase/deoxyribonuclease-subunit-B	unknown	unknown	gnl\|CDD\|213736
NC_008497.1\|WP_011668950.1\|2261901_2263524_-\|glycoside-hydrolase-family-43-protein	unknown	unknown	gnl\|CDD\|226038
NC_008497.1\|WP_011668935.1\|2244669_2245683_-\|polysaccharide-deacetylase-family-protein	unknown	unknown	gnl\|CDD\|200578
NC_008497.1\|WP_011668943.1\|2252704_2253619_-\|prenyltransferase	unknown	unknown	gnl\|CDD\|260125
NC_008497.1\|WP_011668942.1\|2251770_2252547_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|272861
NC_008497.1\|WP_011668940.1\|2250144_2250675_-\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197670
NC_008497.1\|WP_011668944.1\|2253720_2256837_-\|YfhO-family-protein	unknown	unknown	gnl\|CDD\|370572
NC_008497.1\|WP_011668941.1\|2250820_2251756_+\|daunorubicin-resistance-protein-DrrA-family-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|130256
NC_008497.1\|WP_011668939.1\|2248262_2249573_+\|NCS2-family-permease	unknown	unknown	gnl\|CDD\|225161
NC_008497.1\|WP_011668835.1\|2235752_2239541_-\|helicase-exonuclease-AddAB-subunit-AddA	unknown	unknown	gnl\|CDD\|274299
NC_008497.1\|WP_011668949.1\|2259341_2261162_-\|DUF2207-domain-containing-protein	unknown	unknown	gnl\|CDD\|378333
NC_008497.1\|WP_011668833.1\|2233579_2234341_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197666
NC_008497.1\|WP_011668936.1\|2245814_2246180_-\|hypothetical-protein	unknown	unknown	unknown
NC_008497.1\|WP_011668834.1\|2234755_2235661_+\|hypothetical-protein	unknown	unknown	unknown
NC_008497.1\|WP_107696508.1\|2258320_2259028_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NC_008497.1\|WP_011668937.1\|2246256_2246856_-\|SDR-family-oxidoreductase	gnl\|CDD\|379199	pfam13460, NAD_binding_10, NAD(P)H-binding.	8.82255e-28
NC_008497.1\|WP_011668945.1\|2257097_2257619_+\|QueT-transporter-family-protein	gnl\|CDD\|377623	pfam06177, QueT, QueT transporter. This family includes the queT gene encoding a hypothetical integral membrane protein with 5 predicted transmembrane regions. The queT genes in Firmicutes are often preceded by the PreQ1 (7-aminomethyl-7-deazaguanine) riboswitches of two distinct classes, suggesting involvement of the QueT transporters in uptake of a queuosine biosynthetic intermediate.	2.03886e-36
NC_008497.1\|WP_011668934.1\|2243424_2244567_+\|ArgE/DapE-family-deacylase	gnl\|CDD\|181490	PRK08588, PRK08588, succinyl-diaminopimelate desuccinylase; Reviewed.	0
NC_008497.1\|WP_011668951.1\|2263543_2265019_-\|MFS-transporter	gnl\|CDD\|225121	COG2211, MelB, Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism].	3.02992e-117
NC_008497.1\|WP_011668938.1\|2246998_2247982_+\|aldo/keto-reductase	gnl\|CDD\|381309	cd19083, AKR_AKR11A1_11D1, AKR11A and AKR11D families of aldo-keto reductase (AKR). Bacillus subtilis aldo-keto reductase IolS, also called vegetative protein 147 (VEG147), is a founding member of aldo-keto reductase family 11 member A1 (AKR11A1). It is able to reduce the standard aldo-keto reductase (AKR) substrates DL-glyceraldehyde, D-erythrose, and methylglyoxal in the presence of NADPH, albeit with poor efficiency in vitro. Bacillus aryabhattai aldo keto reductase is a founding member of aldo-keto reductase family 11 member D1 (AKR11D1).	1.4297e-166
NC_008497.1\|WP_011668933.1\|2239524_2243130_-\|ATP-dependent-helicase/deoxyribonuclease-subunit-B	gnl\|CDD\|213736	TIGR02773, ATP-dependent_helicase/deoxyribonuclease_subunit_B, helicase-exonuclease AddAB, AddB subunit. DNA repair is accomplished by several different systems in prokaryotes. Recombinational repair of double-stranded DNA breaks involves the RecBCD pathway in some lineages, and AddAB (also called RexAB) in other. The AddA protein is conserved between the firmicutes and the alphaproteobacteria, while the partner protein is not. Nevertheless, the partner is designated AddB in both systems. This model describes the AddB protein as found Bacillus subtilis and related species. Although the RexB protein of Streptococcus and Lactococcus is considered to be orthologous, functionally equivalent, and merely named differently, all members of this protein family have a P-loop nucleotide binding motif GxxGxGK[ST] at the N-terminus, unlike RexB proteins, and a CxxCxxxxxC motif at the C-terminus, both of which may be relevant to function. [DNA metabolism, DNA replication, recombination, and repair].	0
NC_008497.1\|WP_011668950.1\|2261901_2263524_-\|glycoside-hydrolase-family-43-protein	gnl\|CDD\|226038	COG3507, XynB, Beta-xylosidase [Carbohydrate transport and metabolism].	0
NC_008497.1\|WP_011668935.1\|2244669_2245683_-\|polysaccharide-deacetylase-family-protein	gnl\|CDD\|200578	cd10954, CE4_CtAXE_like, Catalytic NodB homology domain of Clostridium thermocellum acetylxylan esterase and its bacterial homologs. This family is represented by Clostridium thermocellum acetylxylan esterase (CtAXE, EC 3.1.1.72), a member of the carbohydrate esterase 4 (CE4) superfamily. CtAXE deacetylates O-acetylated xylan, a key component of plant cell walls. It shows no detectable activity on generic esterase substrates including para-nitrophenyl acetate. It is specific for sugar-based substrates and will precipitate acetylxylan, as a consequence of deacetylation. CtAXE is a monomeric protein containing a catalytic NodB homology domain with the same overall topology and a deformed (beta/alpha)8 barrel fold as other CE4 esterases. However, due to differences in the topography of the substrate-binding groove, the chemistry of the active center, and metal ion coordination, CtAXE has different metal ion preference and lacks activity on N-acetyl substrates. It is significantly activated by Co2+. Moreover, CtAXE displays distinctly different ligand coordination to the metal ion, utilizing an aspartate, a histidine, and four water molecules, as opposed to the conserved His-His-Asp zinc-binding triad of other CE4 esterases.	1.66375e-79
NC_008497.1\|WP_011668943.1\|2252704_2253619_-\|prenyltransferase	gnl\|CDD\|260125	cd13962, PT_UbiA_UBIAD1, 1,4-Dihydroxy-2-naphthoate octaprenyltransferase. Human UBIAD1 is an enzyme involved in the synthesis of MK-4. Menaquinones (MKs, also called bacterial forms) are one of the two forms of natural vitamin K, the other being the plant form, phylloquinone (PK). All forms of vitamin K have a 2-methyl-1,4-naphthoquinone (menadione; K3) ring structure in common. At the 3-position of the ring, PK has a phytyl side chain while MKs have several repeating prenyl units. Prenyltransferases (PTs) catalyze the regioselective transfer of prenyl moieties onto a wide variety of substrates and play an important role in many biosynthetic pathways.	1.05209e-57
NC_008497.1\|WP_011668942.1\|2251770_2252547_+\|ABC-transporter-permease	gnl\|CDD\|272861	TIGR00025, Mtu_efflux, ABC transporter efflux protein, DrrB family. The seed members for this model are a paralogous family of Mycobacterium tuberculosis. Nearly all proteins scoring above the noise cutoff are from high-GC Gram-positive organisms. The members of this paralogous family of efflux proteins are all found in operons with ATP-binding chain partners. They are related to a putative daunorubicin resistance efflux protein of Streptomyces peucetius. This model represents a branch of a larger superfamily that also includes NodJ, a part of the NodIJ pair of nodulation-triggering signal efflux proteins. The members of this branch may all act in antibiotic resistance.	1.49732e-17
NC_008497.1\|WP_011668940.1\|2250144_2250675_-\|MarR-family-transcriptional-regulator	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	2.64201e-15
NC_008497.1\|WP_011668944.1\|2253720_2256837_-\|YfhO-family-protein	gnl\|CDD\|370572	pfam09586, YfhO, Bacterial membrane protein YfhO. This protein is a conserved membrane protein. The yfhO gene is transcribed in Difco sporulation medium and the transcription is affected by the YvrGHb two-component system. Some members of this family have been annotated as glycosyl transferases of the PMT family.	3.69128e-73
NC_008497.1\|WP_011668939.1\|2248262_2249573_+\|NCS2-family-permease	gnl\|CDD\|225161	COG2252, COG2252, Xanthine/uracil/vitamin C permease [Nucleotide transport and metabolism].	4.97728e-143
NC_008497.1\|WP_011668941.1\|2250820_2251756_+\|daunorubicin-resistance-protein-DrrA-family-ABC-transporter-ATP-binding-protein	gnl\|CDD\|130256	TIGR01188, drrA, daunorubicin resistance ABC transporter ATP-binding subunit. This model describes daunorubicin resistance ABC transporter, ATP binding subunit in bacteria and archaea. This model is restricted in its scope to preferentially recognize the ATP binding subunit associated with effux of the drug, daunorubicin. This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily. The characteristic feature of these transporter is the obligatory coupling of ATP hydrolysis to substrate translocation. The minimal configuration of bacterial ABC transport system: an ATPase or ATP binding subunit; An integral membrane protein; a hydrophilic polypetpide, which likely functions as substrate binding protein. In eukaryotes proteins of similar function include p-gyco proteins, multidrug resistance protein etc. [Transport and binding proteins, Other].	7.68686e-106
NC_008497.1\|WP_011668835.1\|2235752_2239541_-\|helicase-exonuclease-AddAB-subunit-AddA	gnl\|CDD\|274299	TIGR02785, ATP-dependent_helicase/nuclease_subunit_A, helicase-exonuclease AddAB, AddA subunit, Firmicutes type. AddAB, also called RexAB, substitutes for RecBCD in several bacterial lineages. These DNA recombination proteins act before synapse and are particularly important for DNA repair of double-stranded breaks by homologous recombination. The term AddAB is used broadly, with AddA homologous between the Firmicutes (as modeled here) and the alphaproteobacteria, while the partner AddB proteins show no strong homology across the two groups of species. [DNA metabolism, DNA replication, recombination, and repair].	0
NC_008497.1\|WP_011668949.1\|2259341_2261162_-\|DUF2207-domain-containing-protein	gnl\|CDD\|378333	pfam09972, DUF2207, Predicted membrane protein (DUF2207). This domain, found in various hypothetical bacterial proteins, has no known function.	9.83052e-111
NC_008497.1\|WP_011668833.1\|2233579_2234341_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|197666	smart00342, HTH_ARAC, helix_turn_helix, arabinose operon control protein.	6.69297e-20

>NC_008497.1|WP_011668939.1|2248262_2249573_+|NCS2-family-permease
MQRIANFFHFEELGTNYKTEILAGLTTFVSMAYILFVNPQVLGASGISQGAVFTATAFASAFGCMLMGILANYPIAISASLGINAFFAYSVVIGMKVPWQTALAGVFVASILFMILTAFKLREKVVDAIPRDLKMAISAGIGLFIAFIGLSQGGLVAADKSTIVSLGSLQVGSTWLTIFGLLVTVLLMSARVPGAIFIGMVANSILGLVTGLIPMPSHIVAAVPSISSTFMVGLTHVGSINSLQMIVVVLTFLLVTFFDTTGTLVGLAEQAGLVKNNKLPRIGKALMADSSTMVVGSLLGTSPMGAFVESSAGIAVGGRTGFTAIVTGILFIFGAFFSPLLAVVTDQVTAPALIIVGVLMAQSLKNIHWEKFEVAAPAFLIVLGMPLTYSISDGIALGFITYPLTMLAAKRGKEVGAMMYGLAVVFVLFLWILNAA
>NC_008497.1|WP_011668938.1|2246998_2247982_+|aldo/keto-reductase
MTHELVTLGKTDVRTTPLGLGTNAVGGYNLFPNLKDDDGLNLVKAGLNHGIQLLDTAFVYGLGHSEELVGQAMHDFDRHSFTLATKGAQDFSSGEQVINNDPAFLTAQVDASLKRLNTDYLDIYYIHFPDKQTPKAEAVGALQRLREQGKIRAIGLSNFSLVQVKEANADGYVDVVEDEFSLLHRDHETDLMPYLADHQISFVPYFPLASGLLTGKYDQSVQFPADDIRSQISDFQEPRYSQALTAIDQVRPIAQAHQATVAQTILAWYMQNPLVSVVIPGAKRAAQVEANAQALEVTLTAAEYQTIDTAFAGFKATANGKSLADPD
>NC_008497.1|WP_011668937.1|2246256_2246856_-|SDR-family-oxidoreductase
MTTYLIIGANRVGQLVARQLATESATVRLLHDGKETLPSDLATQVTELTGDLTQEATYTAALQDQPIIFSALTGMDVDLAFEALFDAQYHQRLTFQRFVMLSTAGVDQEVTGDLAYPGITDVAEYLKQQRYAAKLVDEAEFPYTILRPVTLADSPRRDPQIIKEGAAVPAGTVSRETVAQVAVSLLQAGGADYQSLAIC
>NC_008497.1|WP_011668936.1|2245814_2246180_-|hypothetical-protein
MALQIDEQQLQAIRERMDEANQRAHFVIFQSVERESGKVLRLITDIDSFRAIQEQHQDDSDMVIIQDIVPITDTLARWAVAENMAAQQGDNAEVLADLERYTNEVLKENHQTVNPPESTDD
>NC_008497.1|WP_011668935.1|2244669_2245683_-|polysaccharide-deacetylase-family-protein
MVKIGKVLGVLVATVALGVGSVPVTGQAKSTNKTVTFGQLTNKNTHRLAAIRQAARQEILTTTKAKSSRVAAVYQVKLPTHMTKTATLTKSGLRMNLLKNSFKVKQITIPYAQLKGKVLNRYLPKANRTSTIKTSKLVALTFDDGPDPTLTSRLLKTLKKYHAHATFFEVGQSVSRYPKISRAVLAGGNEIGNHSWNHPNFNSIGTAQTVSQVTRTNRAIYQATGTLPQYVRPPYGNITAAEGRAIEQPIIRWSVDSRDWAYLNSSKDINEVMHDTHGGDIILMHDIHAQSVAAAPTIIKRLQAKGYKLVTVSQLLNSQALPGLQYFGAHDYRTVGK
>NC_008497.1|WP_011668934.1|2243424_2244567_+|ArgE/DapE-family-deacylase
MEDSEQIQILQHLISINSVNDHEADVAAYIQQLFADHGITSQVIPYADGRANIIAEIGDTTSDQVFALAGHLDTVATGDVADWKFDPFSAHIVDNQLYGRGAADMKSGLAAMVITLINLADQQTPLTGRLRFIGTVGEENGAMGSRMLTEKGVADDLTAMVIGEPTGGNLVYAHNGSLNYHVYSRGVGAHSSMPEKGINAITNLIKYVTAEATAFDDAPVSPELGPLVHSVTVFNGGEQVNSIPAKAELQGNIRPIPEFDNTAVIHRLHETVDRLNQEPGVDLALHVDYSFKPIISAKDSPLVQTTKAIADQEFGHAIDLQVIHGATDASEFTKSSHDFPVIVYGAGKWDAAHALNESVDLDEFRHVQHVYQQLVEKFLS
>NC_008497.1|WP_011668933.1|2239524_2243130_-|ATP-dependent-helicase/deoxyribonuclease-subunit-B
MSLQFILGSAGQDHRTPMVTALAQQVTAHPTDQSYYLVPNHIKFETEVDVLSALKEQIAPEQALFAQTQVQVFSFTRLAWFFMKNEPIYQLPRISPAGLNMLIYQIIQTHADELTIFRGEVDRPGFVSQLATQLAEFKVGQVTAADLMSAIEQLDTTNTDLQAKLHDLMIIYEAFETQMMGKFVENTDLLNQLATYLEQQVDLQHAHFYLEGFSQLSAQERQLVAILIQRSASVTVALNLDHGYPQKLPDKTTLFFQSAKLYQQLYMVAQANRVPVLIDQQAKTARVSADLQALDTYWQASQTLSPQPSAVEKPTHIQIVQAANRYVEVSRVATQIRQLVATGNYRYRDFLVLTRHLDAYQTVIDPIFQAQAVPYFDDADIRMADHPFVELLNALFDVQRRNYRYADVFRVLKSELLLPRDADGELMAVPAYRQALALTENFVLKNGLEGQHWWTQDKDWVYNRFAVGDGGVQTTRDDQISAQINRIRRFVKQTLPPFFARLKVAATYTDAAAVLYQFVANAGVSERLMTWRDQAIAAGDLTKAGQPEQTWAAFCDILDEFHTILGDLPTVLPDFQALLQAGFAGAKFSQIPSTLDQVVISESGIVQANNRKITFIMGATADTMPDNQIPTTLLADNDRQDLSARLQQVDDGTYLRDDAATQLAGEPYLNYLAFMSGSERLIFSYPAMSDDARSGLQLSPYVARIKDYFGLSIDIAAANPVAEDEAILPFVGTRRTTLRHLVQASHDSQLREVPLSRSWLYVLNLLRTDPTYGELTTKLLGSLSYRNVPTQLTPDIVTQLYGTKINTSISKLEEYYANPYAYFLKYGLNLQERDVFALSPASTGEFFHATLDGLMKLVNDQKLNLAALDDQQLREMTDEVMAKLLDTTENPQFAILESSHRMGYIRQQLMKTMRQMAKTLQEQSKRTKLRPKRTEVQFGLGDERGLAALSFDVGKRRQVTVRGRIDRLDAVQVKDKTYLGIVDYKSSEHKFSYQEAYYGRAMQMLTYLDAVKQNLPTLLDAPTAKDAELAGAVYLHLQNPILKAAEVLGEDPLTSLLKAEQYQGLLLDDPDLLTNLDTLFGTPDYSGSSLLFRGLRRTKTGKITSYGKLLVNSNELDLLLTHTERLIKRAATDIFDGRVDLAPFREQNRTALQYSPYKSVMQFDPLLKENNYRDLPSLNKDDVMARIAAEQEQEATDEHEI
>NC_008497.1|WP_011668835.1|2235752_2239541_-|helicase-exonuclease-AddAB-subunit-AddA
MSTKFSFTPSQDQAIHQTGNNLLVSASAGSGKTRVLVQRVIERLKTGVGIDQILIVTFTKAAAAEMRERIQTALRQELAVSQGDSAQQQFYLRQLNQLPVADISTLDAFCLRLLQRYYYVIDLDPVFRLLADETENGLLRDEVWADLREDLYANDDSGLFARLTENFSGDRNDQGLADLVQQTYTFANATPNPTAWLAELPQPYQLDSDQLMTTSFYQQRLRPFFQSQLQQLQADLTSAQALANQAGLDKQAAHVTAVLENVAAVQQLVTGDSWNALRAAIQDFAWGRMPAVRKTNEDYPIYNELKTTYYDPARKQLDSLKKTYLIQDEQQAMTTIRRSGELVGELSRVVTAFRTAYRQEKQRRHVLDFADVEHAALAILTQDSDQSRQVAAQLRHQFAEIMVDEYQDTNGLQEAILTAIAEPAPQGNLFMVGDVKQSIYRFRQADPTLFMTKTDQYAADAAAGELIVLAENFRSMKNVDDFTNLIFKQLMDRELGEIDYTGAAQLKFGASYYPDTVTSTAELLVYLTEDAPESAGDADSEAMDATFQVDNKHQGEVLMVGQKIQQLIADQTPIYDREAKQVRPMTYGDITLLTPTRTNNLIITDELRRLGIPVVVNDARNYFKTTEIQIMMALLQIIDNPYQDIPLAAVLRSPIVGLNENELALLRINQRTGDYYQAVLHFQRSFVPNQASDFQQAVYQKVSHFLEQLQEFRDIAQQDELVTLIWRIYQETGFLDYVGGMPAGEQRQANLHALYERAKSYEQSSFKGLFQFVRFVERLQERDDDLAGAPVQAADDAVSVMTIHGSKGLEFPVVFIMDASRQFNKQDQQGNYVMSGKTGIGIDYLDPDSRVKAPSLQKLVTAQAISRASLAEEMRKLYVALTRAESRVYIVGSHKTQEAAISAWEQAYQSPNLVLNATLREKNTLANYLDWIGMCLVRDPKFAAELRQGTTTFSGLAGDPATFAVHFVTAHDLGPTQGVNETAVDWLQAASETAAKVTTPPVDTEQLHQIMDFRYPHQAATATTAYQSVSEAKRLFEDPDNATIGEYQASATGQVGGHRFVTHDFARPDFLQTVREPLATEIGSATHLVLQQLDVTVTPTLDRVQGVIDQLVADQVLTAEVAQRIQPELILRFFSSSVGQQVLAAPDQLHREVPFSLLMPARSLFQDFQETDSQVLVHGIIDGYLTTPAGVILFDYKTDHVNAQNQAASIEKIVERYGGQVNLYAAALKQMTGQPIVGQYLYLLAIGELVAVPEQQVRRLSE
>NC_008497.1|WP_011668834.1|2234755_2235661_+|hypothetical-protein
MTIITRIIKGCLCLLALGTVTVGSLSGRAQTEKPSALVKVGDYRASTDFLNLSAYYQTIRPVTVKVAYVSTYKTQHTIMQKLTLPAGLTVAGNLTTTKHGSYLVPSLQLYLARLSYPALQNSAKANYTLDPGTSAYSPQATISDTTKLRAFKRVAAPDYMPGYSHGDLYIGGAKAALSPVEPTTKSIRITPDGYVEVLKYDTKANAGLGFYQKPVSLAKIVKTRFHDPNRTLYLNHPLASVKTKAITQNGQTRYRLTLKNLHTPQHIAGDPETGTAGTFDSLYSIGGTTYYTFIGYDGVSN
>NC_008497.1|WP_011668833.1|2233579_2234341_-|helix-turn-helix-transcriptional-regulator
MGWDLQFTHYLDDMQTYRSRDQTAKALILLGYVERDFIRFYRAGRIAEGIQFAKENLARSRLLLNELPPQQKRAQLHGLVDILAFEGVQNHAFIYEFIQLRDDYHRQIKTLPVTTARYVPWIIEIVQDFGNLAAKDGLPYDDHLESTLDIIYYVSAHLRDKLTVKQVVDHVNQRCNPVGVQRAFSDEMQMSIRDYINVKKIREAQRALLTTTVSVKQIAQELGFYDTSDFSKRFKREIGQTPLEYRQINSQKD
>NC_008497.1|WP_011668940.1|2250144_2250675_-|MarR-family-transcriptional-regulator
MSDLFKQETTASKLIEFGMLRHVADDIADRDDDHPERQMIFQGQGKILLALMQEDHLAQKELAERLNLTAQSTAEFVRKLEKKGFVTRMKSPTDQRVTVVSITDAGRKETTKNVQQIPPFLTILDDTELDQLAHILDKVNQHMYEEVNAANPTWFNKFHQVIMNRMLSQLHSGEDR
>NC_008497.1|WP_011668941.1|2250820_2251756_+|daunorubicin-resistance-protein-DrrA-family-ABC-transporter-ATP-binding-protein
MQPSTAITVSHLSKTFGVKTVVDDLSFAVKPGEVFGLLGPNGAGKTTTLRMMTTLLKATSGTVTIFGHDVRKESRLARAMFGLTGQYASIDEDISARENLMIFSRLNGLSRTAAKQRTMELLEEFSLTASANKALSDFSGGMRRRLDLAVSLITRPGLIFLDEPTTGLDPRTRSQMWTTIRQLVAHGSTIVLTTQYLDEADALADRIAVIDHGKLIKLGTPTALKQQIGGATLTLSLAKATQGPLAQRLLAQALHAQPTLHGAQLTAHLENPNQITDLLVQLQAADISLANIAVQEPSLDDVFFALTTGKN
>NC_008497.1|WP_011668942.1|2251770_2252547_+|ABC-transporter-permease
MEIQTQHGNLIGNTLTMAYRNLLKTLHNPDRFMDVIIQPVMFMLLFGYLFGGAIAGGVQAYLPTIVPGILIQTLLSAASGSGAQIREDLDSGVFDRFKSLPMAHIAPLAGQLFADILRLLVATVVSLLTGYAMGWRPTVGFGWIIVIAALAIFIGWAISWVFALFGLLAKSSSMVQSVSMMVMMLLSFLSNAFIPLKTLPHFMRVIADANPITYVITAIRQILAQGAWNNNAWIVLIFGIGIVVLFAPLTVWAYNHNN
>NC_008497.1|WP_011668943.1|2252704_2253619_-|prenyltransferase
MPKWLNWSVFYELTEIYTAPLNVMWFILGAAIVQYHVHTVDWINVGLCLAVVFIFDLAVNVADNYYDYLHAHDREDYAQKTNPIGRLHLPAKGVFWLAWVLYAVAAIPGIVLVMRTGWSVAVFGVVGYLIGIFYTAGPHPINATPVSAAVVALAIAFGIQLTCVYVSIYGQQPLSWSIVGTTFLLCMPLTLIFFTVQLANDTSDRDEDIANHRYTLAVYLGKRRSVRLIQLFLVIGTLWTLVNVGLGLAPLVTALAVILLPVMWRGMRPFFAIQDKRKTFMAMVKSASLFFIAYPVLFALGTWL
>NC_008497.1|WP_011668944.1|2253720_2256837_-|YfhO-family-protein
MRIAHHRWPLWVLYTLAFAVIAAISFGIFGVANRTLIWNMDGITQHYPLIREFHQLLMKSGLAGVTGWSWTFGLGADKLTTLAYYVLGDPFAYALALLPTRLLEVGYGWAIVLRLYAAGLAFLVLAKRYAFKPGSQLVGAVTYAFTGYSLMVGVHHPFFLLPMVWLPLLFVGIDRILQGKGWGFLAAVTGITILSNFYFAYILGLGSLIYALIRYFSCRERGQLAVSWLVATARFLAAAVTGLLISGVLLLPSLLMMLKSTRTVSIFANGLWLYPLNYYLTLSNTILTTGNTLNYWAVLGITGFGFLGCVYTLVHWRQHRWLAITLLAVIVGLLFPAVAAFFNVLSTPSNRWILLAAVPFGLALMTLMDHLTALSLPDRWWLLGSSFGLLGVIYLSNGFTFSNPARDLLTYGLLLATTLLVVVALPRRWTFGGIGILIGLNLINNAWGYYDPNLSNQATQQLRVSDATRYIQDYFDGAQSAVQSDHAFSRVSATRNYNLFRTVGNNMTMSHGLHGIMSYFSVQNGYVGQFSRDLGNAEYAMNAPMGQADDRTTLTQLLGVKYLFARTDQVTNHAALPYGYRAAKKIYPEQPVYGLSNGVGTQVLTTNLAFPLVYTQPQVLTTKAWHRLSLVDRERSLTQAAVTSQPVAGVKAAHYQSPKRTLAYTVTPDTIPVIDSTNKVIQYRLKQAAAGQKTGLNDKQLATYGTTIQTPQLTVDKNGLLSKQEVQQYGPMVQLNRDQAALQRVLTHNQQIIQRTTQANQTGLHQLTSDAQGQPIKYTVTLKHPQQAQGTELYLELDGISSQQLTTKDQLQTADNTSVLGNTPRSNLTKLNAWRTAISNPDLGDYWVTAKTRNATKTFSQFGLDNLSDYEPKHQVLLNLGYSQQLRKTIDVTFNATKQLNIKSAKLIAVPFGARYDQQVHAVQRRGLQHAQIRDNAVTGELTTPQASVMTTSIPYSSGWRLTVDGRPTATTVVNEGFVGARLAAGTHRIRLTYRTPGLIGGLILTIVGLVVWLGEMSWWHWRHPQAKTRATKSKSDA
>NC_008497.1|WP_011668945.1|2257097_2257619_+|QueT-transporter-family-protein
MNSKKRVSGVSDTRSMVLAALIAALYVVLTTVLSALSFGPFQIRLSEMFNHLVVFNKRYIAAVTLGVFIANIIASPFGFLDIATGTIQTLLALLVMYWLSKFVHNRIAQMAINTVVAVFFMCMIAWEIAIVSKTAFWPTFWANWLSIGWGELVSMIFGGVVIYLLSLKIDFTK
>NC_008497.1|WP_107696508.1|2258320_2259028_-|hypothetical-protein
MRTKHAMDIGAREKTKSGYKPIYIKKNKLLSISAMNIRGKYPHFKTYVAVTLGDIHYAKINKVVYMKKFIRYTTANFTPVKTLRAPIRTQLLRQGTGFVMSSTHINQPTYSSALFVTLDNYIQTYSQARMTKINDKWMNADVDSDFAKLKPTDSVKVTKLVKTGTAYKIDYARPLKSFSDKKIGPHHYRLTIKQLGRQYQNYTPIDDTYDTAASWTNFTINTKPYFSGFADWGLD
>NC_008497.1|WP_011668949.1|2259341_2261162_-|DUF2207-domain-containing-protein
MRYRQGVWWLLGLILALIGGCQMTTINAAASYTIKPFRMNVDVTRRGDANVTETMTYHFDDDYHGVYNVQDLRGIQGGRLTGVSTRLNDGGMRPARAVDSGDSRYQVSQSNQRLKVKVYRAVSAGDRLQVTYRFHLTGVVTNYADTAELNWKLIGAGWDEPLHNVRLTIQLPTQPVKQLQAWTHGPLTGHTAVQSKTGRVVMTIPENPANTFVESHLLFPTQVTAANPNTCTQKRRAAAQKQEAKLAADANAKRQQQRWLVVGGYAALTVGLVALLAGSYHWMRHHPANRYPHPIPVDHFFDVPGVAPAVAVALLNFRSPDTDALSGELMMAASRHEIKLEPVREKKHDTVRLTKTGTVTNIFLQRAFERLGSLDSFTLRDLKQFAKKDKGSRVSHWFKEWQNQVDEAAEVYQDGDNIAIRQRLLGIAWGLTFVIAAWIGVSALVDPLVFKLSAGLGLVVLFGSWTYISRQRRQVDRNTAEGLVLINEIGGFRRMLKDIGHFNTAKIGDLILWEQILPYAAAFGLAKQVADKLAIDFGKDVVAGALVAYPLYYPGAFNLSLGDMVQTSIAGAIDTSANFSSPSGGSGGFSGGSSGGFGGGSGGGAF
>NC_008497.1|WP_011668950.1|2261901_2263524_-|glycoside-hydrolase-family-43-protein
MKIQNPVLPGFNADPSMIRVGDTYYIANSTFEWFPGVRLHESKDLVHWNLLPSPLSTTTLLDMKGNPASGGIWAPDLSYADGKFWLIYTDVKITEGPFKDMTNYLTTATDIRGPWTDPIAVNGVGFDASLFHDENGRKYLVQQTWDHREYHHPFNGITLTEFDTATMQLKPETARNIYNGTDVKLVEGPHLYQINGYYYLFAAEGGTVFTHQEVVARSKTLDELSFESEPDGPFITNMDTPDFYLQKQGHGALTSTPSGEWYYASLVSRPWNHTNESSHDPRGWSTLGRETSIQKVEWDDAGWPRVVGGHGGQVEVDAPKDAIETTAPKDHSQHDDFDQPTLDLNWNTLRQPFTAQMGSVGNGELKLIGQQTMSSNFDVSLIARRWQAFNFDAETKVKFDPFTYQQMAGLANIYNDKHYSWIFITWDEKKGHVIEVAQNDNNNYTSYLKDDAIKIPDGTDYVWFRTKVRKQSYTYEYSFDGQNWETVPVELDAAILSDDYVLQNYGGFFTGAFVGLMAADYAGYKRVATFDYFDYQELPD
>NC_008497.1|WP_011668951.1|2263543_2265019_-|MFS-transporter
MASNIQATAQPAANDEFAKLSWRERISYGAGDLAQNLIFGTVGSMLLFYLTTVYGISAAVGATIFLVVRWVNVFWDPWVGAFVDKHGFKRGKYRPYLIYGGIPLTIMAALLFLPIDAVRGNVFYAFIAYLATALIYSFVNIPYGALNASLTRDNDEISTLTTVRMTEANIGNLLVYTFLPLFVQLASPNPQSKDIGFFGIHMNLGDYTSPKSGGAYFMVMAIYMIIGFIMLMCTYFGIKERVLPTEKESSAVKYADLWVEFKQNKPLQILGLFFLIGFTFMFFGNTVWPFYMQYNIGHSEWVASINLIGSIPGIFLVFLWPIVRKKIGKRQFFYAFLTLFIIGTLVLWVWSFPAFKNSVALGYIGRFLMQWGITAATGYMWSLVPEVVSYGEYHSKKRVAGIINAIMGLFFKIGLALGGIIPGYINAFFKFDGTKTTQSAGALAGIQWSMIWLPIILAFVAMWVMSRYTLTDSDVNKMNEELTAERKANQV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NC_008497_1	1.1\|944713\|32\|NC_008497\|CRISPRCasFinder	944713-944744	32	NC_008497.1	1129413-1129444	0	1.0
NC_008497_1	1.6\|944713\|33\|NC_008497\|CRT	944713-944745	33	NC_008497.1	1129413-1129445	0	1.0

1. spacer 1.1|944713|32|NC_008497|CRISPRCasFinder matches to position: 1129413-1129444, mismatch: 0, identity: 1.0

ttggttcaaatgctacaagctcgttttcagcc	CRISPR spacer
ttggttcaaatgctacaagctcgttttcagcc	Protospacer
********************************

2. spacer 1.6|944713|33|NC_008497|CRT matches to position: 1129413-1129445, mismatch: 0, identity: 1.0

ttggttcaaatgctacaagctcgttttcagcca	CRISPR spacer
ttggttcaaatgctacaagctcgttttcagcca	Protospacer
*********************************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_008497_1	1.5\|944957\|32\|NC_008497\|CRISPRCasFinder,PILER-CR	944957-944988	32	NZ_CP037431	Lactobacillus plantarum strain EM plasmid pEM2, complete sequence	26272-26303	0	1.0
NC_008497_1	1.5\|944957\|32\|NC_008497\|CRISPRCasFinder,PILER-CR	944957-944988	32	NZ_CP037431	Lactobacillus plantarum strain EM plasmid pEM2, complete sequence	41504-41535	0	1.0
NC_008497_1	1.5\|944957\|32\|NC_008497\|CRISPRCasFinder,PILER-CR	944957-944988	32	NZ_CP018327	Lactobacillus plantarum subsp. plantarum strain TS12 plasmid pLP12-3, complete sequence	14223-14254	0	1.0
NC_008497_1	1.5\|944957\|32\|NC_008497\|CRISPRCasFinder,PILER-CR	944957-944988	32	NZ_CP014624	Lactobacillus backii strain TMW 1.1988 plasmid L11988-1, complete sequence	2807-2838	0	1.0
NC_008497_1	1.5\|944957\|32\|NC_008497\|CRISPRCasFinder,PILER-CR	944957-944988	32	NZ_CP018212	Lactobacillus plantarum strain BLS41 plasmid pLPBLS41_3, complete sequence	3699-3730	0	1.0
NC_008497_1	1.5\|944957\|32\|NC_008497\|CRISPRCasFinder,PILER-CR	944957-944988	32	NZ_CP035157	Lactobacillus plantarum strain SRCM103362 plasmid unnamed1	14176-14207	0	1.0
NC_008497_1	1.5\|944957\|32\|NC_008497\|CRISPRCasFinder,PILER-CR	944957-944988	32	NC_021904	Lactobacillus plantarum ZJ316 plasmid pLP-ZJ102, complete sequence	18656-18687	0	1.0
NC_008497_1	1.5\|944957\|32\|NC_008497\|CRISPRCasFinder,PILER-CR	944957-944988	32	NC_005952	Lactobacillus brevis plasmid pRH45II, complete sequence	20354-20385	0	1.0
NC_008497_1	1.5\|944957\|32\|NC_008497\|CRISPRCasFinder,PILER-CR	944957-944988	32	NZ_CP035145	Lactobacillus plantarum strain SRCM103357 plasmid unnamed2	42351-42382	0	1.0
NC_008497_1	1.5\|944957\|32\|NC_008497\|CRISPRCasFinder,PILER-CR	944957-944988	32	NZ_CP028277	Lactobacillus plantarum strain SRCM100995 plasmid unnamed2, complete sequence	36436-36467	0	1.0
NC_008497_1	1.5\|944957\|32\|NC_008497\|CRISPRCasFinder,PILER-CR	944957-944988	32	NZ_CP014893	Lactobacillus backii strain TMW 1.1992 plasmid pL11992-3, complete sequence	18266-18297	0	1.0
NC_008497_1	1.10\|944957\|33\|NC_008497\|CRT	944957-944989	33	NZ_CP037431	Lactobacillus plantarum strain EM plasmid pEM2, complete sequence	26271-26303	0	1.0
NC_008497_1	1.10\|944957\|33\|NC_008497\|CRT	944957-944989	33	NZ_CP037431	Lactobacillus plantarum strain EM plasmid pEM2, complete sequence	41503-41535	0	1.0
NC_008497_1	1.10\|944957\|33\|NC_008497\|CRT	944957-944989	33	NZ_CP018327	Lactobacillus plantarum subsp. plantarum strain TS12 plasmid pLP12-3, complete sequence	14222-14254	0	1.0
NC_008497_1	1.10\|944957\|33\|NC_008497\|CRT	944957-944989	33	NZ_CP018212	Lactobacillus plantarum strain BLS41 plasmid pLPBLS41_3, complete sequence	3698-3730	0	1.0
NC_008497_1	1.10\|944957\|33\|NC_008497\|CRT	944957-944989	33	NZ_CP035157	Lactobacillus plantarum strain SRCM103362 plasmid unnamed1	14175-14207	0	1.0
NC_008497_1	1.10\|944957\|33\|NC_008497\|CRT	944957-944989	33	NC_021904	Lactobacillus plantarum ZJ316 plasmid pLP-ZJ102, complete sequence	18655-18687	0	1.0
NC_008497_1	1.10\|944957\|33\|NC_008497\|CRT	944957-944989	33	NZ_CP035145	Lactobacillus plantarum strain SRCM103357 plasmid unnamed2	42350-42382	0	1.0
NC_008497_1	1.10\|944957\|33\|NC_008497\|CRT	944957-944989	33	NZ_CP028277	Lactobacillus plantarum strain SRCM100995 plasmid unnamed2, complete sequence	36435-36467	0	1.0
NC_008497_1	1.10\|944957\|33\|NC_008497\|CRT	944957-944989	33	NZ_CP014893	Lactobacillus backii strain TMW 1.1992 plasmid pL11992-3, complete sequence	18265-18297	0	1.0
NC_008497_1	1.10\|944957\|33\|NC_008497\|CRT	944957-944989	33	NZ_CP014624	Lactobacillus backii strain TMW 1.1988 plasmid L11988-1, complete sequence	2807-2839	0	1.0
NC_008497_1	1.10\|944957\|33\|NC_008497\|CRT	944957-944989	33	NC_005952	Lactobacillus brevis plasmid pRH45II, complete sequence	20354-20386	0	1.0
NC_008497_1	1.5\|944957\|32\|NC_008497\|CRISPRCasFinder,PILER-CR	944957-944988	32	NZ_CP032754	Lactobacillus plantarum subsp. argentoratensis strain DSM 16365 plasmid unnamed3, complete sequence	198-229	1	0.969
NC_008497_1	1.5\|944957\|32\|NC_008497\|CRISPRCasFinder,PILER-CR	944957-944988	32	NZ_CP028228	Lactobacillus plantarum strain SRCM101187 plasmid unnamed2, complete sequence	12578-12609	1	0.969
NC_008497_1	1.5\|944957\|32\|NC_008497\|CRISPRCasFinder,PILER-CR	944957-944988	32	NZ_CP012296	Pediococcus damnosus strain TMW 2.1536 plasmid pL21536-2, complete sequence	32889-32920	1	0.969
NC_008497_1	1.5\|944957\|32\|NC_008497\|CRISPRCasFinder,PILER-CR	944957-944988	32	NZ_CP053341	Lactobacillus paraplantarum strain CK401 plasmid pCK401D, complete sequence	33191-33222	1	0.969
NC_008497_1	1.5\|944957\|32\|NC_008497\|CRISPRCasFinder,PILER-CR	944957-944988	32	NZ_CP035559	Lactobacillus plantarum strain SRCM103297 plasmid unnamed3	30140-30171	1	0.969
NC_008497_1	1.5\|944957\|32\|NC_008497\|CRISPRCasFinder,PILER-CR	944957-944988	32	NZ_CP035572	Lactobacillus plantarum strain SRCM103303 plasmid unnamed1	27890-27921	1	0.969
NC_008497_1	1.5\|944957\|32\|NC_008497\|CRISPRCasFinder,PILER-CR	944957-944988	32	NZ_CP035175	Lactobacillus plantarum strain SRCM103426 plasmid unnamed1	96451-96482	1	0.969
NC_008497_1	1.5\|944957\|32\|NC_008497\|CRISPRCasFinder,PILER-CR	944957-944988	32	NZ_CP032758	Lactobacillus pentosus strain DSM 20314 plasmid unnamed1, complete sequence	41923-41954	1	0.969
NC_008497_1	1.5\|944957\|32\|NC_008497\|CRISPRCasFinder,PILER-CR	944957-944988	32	NZ_CP012280	Pediococcus damnosus strain TMW 2.1533 plasmid pL21533-5, complete sequence	9955-9986	1	0.969
NC_008497_1	1.5\|944957\|32\|NC_008497\|CRISPRCasFinder,PILER-CR	944957-944988	32	NZ_CP014887	Lactobacillus backii strain TMW 1.1991 plasmid pL11991-6, complete sequence	1562-1593	1	0.969
NC_008497_1	1.5\|944957\|32\|NC_008497\|CRISPRCasFinder,PILER-CR	944957-944988	32	NZ_CP014878	Lactobacillus backii strain TMW 1.1989 plasmid pL11989-5, complete sequence	9725-9756	1	0.969
NC_008497_1	1.5\|944957\|32\|NC_008497\|CRISPRCasFinder,PILER-CR	944957-944988	32	NZ_CP035116	Lactobacillus plantarum strain SRCM103295 plasmid unnamed3	103057-103088	1	0.969
NC_008497_1	1.5\|944957\|32\|NC_008497\|CRISPRCasFinder,PILER-CR	944957-944988	32	NZ_CP023773	Lactobacillus plantarum strain PC520 plasmid p1, complete sequence	53323-53354	1	0.969
NC_008497_1	1.5\|944957\|32\|NC_008497\|CRISPRCasFinder,PILER-CR	944957-944988	32	NZ_CP023302	Lactobacillus plantarum strain pc-26 plasmid p.pc-2601, complete sequence	16481-16512	1	0.969
NC_008497_1	1.5\|944957\|32\|NC_008497\|CRISPRCasFinder,PILER-CR	944957-944988	32	NZ_CP032461	Lactobacillus plantarum strain ATG-K2 plasmid pK2-1, complete sequence	8945-8976	1	0.969
NC_008497_1	1.5\|944957\|32\|NC_008497\|CRISPRCasFinder,PILER-CR	944957-944988	32	NZ_CP032461	Lactobacillus plantarum strain ATG-K2 plasmid pK2-1, complete sequence	50559-50590	1	0.969
NC_008497_1	1.5\|944957\|32\|NC_008497\|CRISPRCasFinder,PILER-CR	944957-944988	32	NZ_CP017958	Lactobacillus plantarum strain C410L1 plasmid unnamed4, complete sequence	33330-33361	1	0.969
NC_008497_1	1.5\|944957\|32\|NC_008497\|CRISPRCasFinder,PILER-CR	944957-944988	32	NZ_CP032660	Lactobacillus pentosus strain ZFM94 plasmid unnamed1, complete sequence	51969-52000	1	0.969
NC_008497_1	1.5\|944957\|32\|NC_008497\|CRISPRCasFinder,PILER-CR	944957-944988	32	NZ_CP025415	Lactobacillus plantarum strain X7021 plasmid unnamed3, complete sequence	18630-18661	1	0.969
NC_008497_1	1.5\|944957\|32\|NC_008497\|CRISPRCasFinder,PILER-CR	944957-944988	32	NZ_CP028237	Lactobacillus plantarum strain SRCM101511 plasmid unnamed2, complete sequence	26410-26441	1	0.969
NC_008497_1	1.5\|944957\|32\|NC_008497\|CRISPRCasFinder,PILER-CR	944957-944988	32	NZ_CP028263	Lactobacillus plantarum strain SRCM102737 plasmid unnamed2, complete sequence	9562-9593	1	0.969
NC_008497_1	1.5\|944957\|32\|NC_008497\|CRISPRCasFinder,PILER-CR	944957-944988	32	NZ_CP014904	Lactobacillus backii strain TMW 1.2002 plasmid pL12002-5, complete sequence	26558-26589	1	0.969
NC_008497_1	1.5\|944957\|32\|NC_008497\|CRISPRCasFinder,PILER-CR	944957-944988	32	NC_020823	Lactobacillus brevis KB290 plasmid pKB290-5, complete sequence	901-932	1	0.969
NC_008497_1	1.5\|944957\|32\|NC_008497\|CRISPRCasFinder,PILER-CR	944957-944988	32	NZ_CP032655	Lactobacillus pentosus strain ZFM222 plasmid unnamed1, complete sequence	59779-59810	1	0.969
NC_008497_1	1.5\|944957\|32\|NC_008497\|CRISPRCasFinder,PILER-CR	944957-944988	32	NZ_CP013152	Lactobacillus plantarum strain MF1298 plasmid pMF1298-4, complete sequence	28178-28209	1	0.969
NC_008497_1	1.10\|944957\|33\|NC_008497\|CRT	944957-944989	33	NZ_CP053341	Lactobacillus paraplantarum strain CK401 plasmid pCK401D, complete sequence	33190-33222	1	0.97
NC_008497_1	1.10\|944957\|33\|NC_008497\|CRT	944957-944989	33	NZ_CP035559	Lactobacillus plantarum strain SRCM103297 plasmid unnamed3	30139-30171	1	0.97
NC_008497_1	1.10\|944957\|33\|NC_008497\|CRT	944957-944989	33	NZ_CP035572	Lactobacillus plantarum strain SRCM103303 plasmid unnamed1	27889-27921	1	0.97
NC_008497_1	1.10\|944957\|33\|NC_008497\|CRT	944957-944989	33	NZ_CP035175	Lactobacillus plantarum strain SRCM103426 plasmid unnamed1	96450-96482	1	0.97
NC_008497_1	1.10\|944957\|33\|NC_008497\|CRT	944957-944989	33	NZ_CP032758	Lactobacillus pentosus strain DSM 20314 plasmid unnamed1, complete sequence	41922-41954	1	0.97
NC_008497_1	1.10\|944957\|33\|NC_008497\|CRT	944957-944989	33	NZ_CP014878	Lactobacillus backii strain TMW 1.1989 plasmid pL11989-5, complete sequence	9724-9756	1	0.97
NC_008497_1	1.10\|944957\|33\|NC_008497\|CRT	944957-944989	33	NZ_CP035116	Lactobacillus plantarum strain SRCM103295 plasmid unnamed3	103056-103088	1	0.97
NC_008497_1	1.10\|944957\|33\|NC_008497\|CRT	944957-944989	33	NZ_CP032461	Lactobacillus plantarum strain ATG-K2 plasmid pK2-1, complete sequence	8944-8976	1	0.97
NC_008497_1	1.10\|944957\|33\|NC_008497\|CRT	944957-944989	33	NZ_CP032461	Lactobacillus plantarum strain ATG-K2 plasmid pK2-1, complete sequence	50558-50590	1	0.97
NC_008497_1	1.10\|944957\|33\|NC_008497\|CRT	944957-944989	33	NZ_CP017958	Lactobacillus plantarum strain C410L1 plasmid unnamed4, complete sequence	33329-33361	1	0.97
NC_008497_1	1.10\|944957\|33\|NC_008497\|CRT	944957-944989	33	NZ_CP032660	Lactobacillus pentosus strain ZFM94 plasmid unnamed1, complete sequence	51968-52000	1	0.97
NC_008497_1	1.10\|944957\|33\|NC_008497\|CRT	944957-944989	33	NZ_CP025415	Lactobacillus plantarum strain X7021 plasmid unnamed3, complete sequence	18629-18661	1	0.97
NC_008497_1	1.10\|944957\|33\|NC_008497\|CRT	944957-944989	33	NZ_CP028263	Lactobacillus plantarum strain SRCM102737 plasmid unnamed2, complete sequence	9561-9593	1	0.97
NC_008497_1	1.10\|944957\|33\|NC_008497\|CRT	944957-944989	33	NC_020823	Lactobacillus brevis KB290 plasmid pKB290-5, complete sequence	900-932	1	0.97
NC_008497_1	1.10\|944957\|33\|NC_008497\|CRT	944957-944989	33	NZ_CP013152	Lactobacillus plantarum strain MF1298 plasmid pMF1298-4, complete sequence	28177-28209	1	0.97
NC_008497_1	1.10\|944957\|33\|NC_008497\|CRT	944957-944989	33	NZ_CP032754	Lactobacillus plantarum subsp. argentoratensis strain DSM 16365 plasmid unnamed3, complete sequence	198-230	1	0.97
NC_008497_1	1.10\|944957\|33\|NC_008497\|CRT	944957-944989	33	NZ_CP028228	Lactobacillus plantarum strain SRCM101187 plasmid unnamed2, complete sequence	12578-12610	1	0.97
NC_008497_1	1.10\|944957\|33\|NC_008497\|CRT	944957-944989	33	NZ_CP012296	Pediococcus damnosus strain TMW 2.1536 plasmid pL21536-2, complete sequence	32889-32921	1	0.97
NC_008497_1	1.10\|944957\|33\|NC_008497\|CRT	944957-944989	33	NZ_CP012280	Pediococcus damnosus strain TMW 2.1533 plasmid pL21533-5, complete sequence	9955-9987	1	0.97
NC_008497_1	1.10\|944957\|33\|NC_008497\|CRT	944957-944989	33	NZ_CP014887	Lactobacillus backii strain TMW 1.1991 plasmid pL11991-6, complete sequence	1562-1594	1	0.97
NC_008497_1	1.10\|944957\|33\|NC_008497\|CRT	944957-944989	33	NZ_CP023773	Lactobacillus plantarum strain PC520 plasmid p1, complete sequence	53323-53355	1	0.97
NC_008497_1	1.10\|944957\|33\|NC_008497\|CRT	944957-944989	33	NZ_CP023302	Lactobacillus plantarum strain pc-26 plasmid p.pc-2601, complete sequence	16481-16513	1	0.97
NC_008497_1	1.10\|944957\|33\|NC_008497\|CRT	944957-944989	33	NZ_CP028237	Lactobacillus plantarum strain SRCM101511 plasmid unnamed2, complete sequence	26410-26442	1	0.97
NC_008497_1	1.10\|944957\|33\|NC_008497\|CRT	944957-944989	33	NZ_CP014904	Lactobacillus backii strain TMW 1.2002 plasmid pL12002-5, complete sequence	26558-26590	1	0.97
NC_008497_1	1.10\|944957\|33\|NC_008497\|CRT	944957-944989	33	NZ_CP032655	Lactobacillus pentosus strain ZFM222 plasmid unnamed1, complete sequence	59779-59811	1	0.97
NC_008497_2	2.2\|2249823\|33\|NC_008497\|CRISPRCasFinder,CRT,PILER-CR	2249823-2249855	33	MN830254	Lactobacillus phage JNU_P2, complete genome	17234-17266	1	0.97
NC_008497_2	2.2\|2249823\|33\|NC_008497\|CRISPRCasFinder,CRT,PILER-CR	2249823-2249855	33	MN830255	Lactobacillus phage JNU_P4, complete genome	3757-3789	1	0.97
NC_008497_2	2.4\|2249945\|33\|NC_008497\|CRISPRCasFinder,CRT,PILER-CR	2249945-2249977	33	NZ_CP014920	Lactobacillus paracollinoides strain TMW 1.1994 plasmid pL11994-5, complete sequence	5729-5761	1	0.97
NC_008497_1	1.5\|944957\|32\|NC_008497\|CRISPRCasFinder,PILER-CR	944957-944988	32	NZ_CP025588	Lactobacillus plantarum strain KC3 plasmid unnamed2, complete sequence	4082-4113	2	0.938
NC_008497_1	1.5\|944957\|32\|NC_008497\|CRISPRCasFinder,PILER-CR	944957-944988	32	NZ_CP035568	Lactobacillus plantarum strain SRCM103300 plasmid unnamed2	23742-23773	2	0.938
NC_008497_1	1.5\|944957\|32\|NC_008497\|CRISPRCasFinder,PILER-CR	944957-944988	32	NZ_CP012285	Pediococcus damnosus strain TMW 2.1534 plasmid pL21534-2, complete sequence	7341-7372	2	0.938
NC_008497_1	1.5\|944957\|32\|NC_008497\|CRISPRCasFinder,PILER-CR	944957-944988	32	NZ_CP012272	Pediococcus damnosus strain TMW 2.1532 plasmid pL21532-3, complete sequence	22047-22078	2	0.938
NC_008497_1	1.10\|944957\|33\|NC_008497\|CRT	944957-944989	33	NZ_CP035568	Lactobacillus plantarum strain SRCM103300 plasmid unnamed2	23741-23773	2	0.939
NC_008497_1	1.10\|944957\|33\|NC_008497\|CRT	944957-944989	33	NZ_CP025588	Lactobacillus plantarum strain KC3 plasmid unnamed2, complete sequence	4082-4114	2	0.939
NC_008497_1	1.10\|944957\|33\|NC_008497\|CRT	944957-944989	33	NZ_CP012272	Pediococcus damnosus strain TMW 2.1532 plasmid pL21532-3, complete sequence	22046-22078	2	0.939
NC_008497_1	1.10\|944957\|33\|NC_008497\|CRT	944957-944989	33	NZ_CP012285	Pediococcus damnosus strain TMW 2.1534 plasmid pL21534-2, complete sequence	7341-7373	2	0.939
NC_008497_1	1.1\|944713\|32\|NC_008497\|CRISPRCasFinder	944713-944744	32	MN657132	Psychrobacter sp. strain ANT_H9 plasmid pA9H1, complete sequence	4497-4528	7	0.781
NC_008497_2	2.4\|2249945\|33\|NC_008497\|CRISPRCasFinder,CRT,PILER-CR	2249945-2249977	33	MK496698	Capybara microvirus Cap1_SP_87, complete genome	2934-2966	7	0.788
NC_008497_2	2.4\|2249945\|33\|NC_008497\|CRISPRCasFinder,CRT,PILER-CR	2249945-2249977	33	NC_017296	Clostridium acetobutylicum EA 2018 plasmid pEA2018, complete sequence	62340-62372	7	0.788
NC_008497_2	2.4\|2249945\|33\|NC_008497\|CRISPRCasFinder,CRT,PILER-CR	2249945-2249977	33	NC_015686	Clostridium acetobutylicum DSM 1731 plasmid pSMBa, complete sequence	62340-62372	7	0.788
NC_008497_2	2.4\|2249945\|33\|NC_008497\|CRISPRCasFinder,CRT,PILER-CR	2249945-2249977	33	NC_001988	Clostridium acetobutylicum ATCC 824 plasmid pSOL1, complete sequence	62340-62372	7	0.788
NC_008497_1	1.4\|944896\|32\|NC_008497\|CRISPRCasFinder,PILER-CR	944896-944927	32	NZ_CP020932	Marinobacter salarius strain SMR5 plasmid pSMR5, complete sequence	219578-219609	8	0.75
NC_008497_1	1.6\|944713\|33\|NC_008497\|CRT	944713-944745	33	MN657132	Psychrobacter sp. strain ANT_H9 plasmid pA9H1, complete sequence	4496-4528	8	0.758
NC_008497_2	2.1\|2249762\|33\|NC_008497\|CRISPRCasFinder,CRT	2249762-2249794	33	KY979109	Salmonella phage SHP1, complete genome	32802-32834	8	0.758
NC_008497_2	2.1\|2249762\|33\|NC_008497\|CRISPRCasFinder,CRT	2249762-2249794	33	NC_019500	Enterobacteria phage Bp7, complete genome	22258-22290	8	0.758
NC_008497_1	1.2\|944774\|32\|NC_008497\|CRISPRCasFinder,PILER-CR	944774-944805	32	NC_017588	Thermus thermophilus JL-18 plasmid pTTJL1801, complete sequence	127714-127745	9	0.719
NC_008497_2	2.4\|2249945\|33\|NC_008497\|CRISPRCasFinder,CRT,PILER-CR	2249945-2249977	33	NZ_CP047434	Spiroplasma citri strain BLH-13 plasmid pSciBLH13-6	89325-89357	10	0.697
NC_008497_2	2.4\|2249945\|33\|NC_008497\|CRISPRCasFinder,CRT,PILER-CR	2249945-2249977	33	NZ_CP047434	Spiroplasma citri strain BLH-13 plasmid pSciBLH13-6	98643-98675	10	0.697
NC_008497_2	2.4\|2249945\|33\|NC_008497\|CRISPRCasFinder,CRT,PILER-CR	2249945-2249977	33	NZ_LR214978	Mycoplasma cynos strain NCTC10142 plasmid 5	6-38	10	0.697
NC_008497_2	2.4\|2249945\|33\|NC_008497\|CRISPRCasFinder,CRT,PILER-CR	2249945-2249977	33	NZ_LR214986	Mycoplasma cynos strain NCTC10142 plasmid 13	771862-771894	10	0.697

1. spacer 1.5|944957|32|NC_008497|CRISPRCasFinder,PILER-CR matches to NZ_CP037431 (Lactobacillus plantarum strain EM plasmid pEM2, complete sequence) position: , mismatch: 0, identity: 1.0

ttcataaaaaagccgtcattccgcattcaatg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaatg	Protospacer
********************************

2. spacer 1.5|944957|32|NC_008497|CRISPRCasFinder,PILER-CR matches to NZ_CP037431 (Lactobacillus plantarum strain EM plasmid pEM2, complete sequence) position: , mismatch: 0, identity: 1.0

ttcataaaaaagccgtcattccgcattcaatg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaatg	Protospacer
********************************

3. spacer 1.5|944957|32|NC_008497|CRISPRCasFinder,PILER-CR matches to NZ_CP018327 (Lactobacillus plantarum subsp. plantarum strain TS12 plasmid pLP12-3, complete sequence) position: , mismatch: 0, identity: 1.0

ttcataaaaaagccgtcattccgcattcaatg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaatg	Protospacer
********************************

4. spacer 1.5|944957|32|NC_008497|CRISPRCasFinder,PILER-CR matches to NZ_CP014624 (Lactobacillus backii strain TMW 1.1988 plasmid L11988-1, complete sequence) position: , mismatch: 0, identity: 1.0

ttcataaaaaagccgtcattccgcattcaatg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaatg	Protospacer
********************************

5. spacer 1.5|944957|32|NC_008497|CRISPRCasFinder,PILER-CR matches to NZ_CP018212 (Lactobacillus plantarum strain BLS41 plasmid pLPBLS41_3, complete sequence) position: , mismatch: 0, identity: 1.0

ttcataaaaaagccgtcattccgcattcaatg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaatg	Protospacer
********************************

6. spacer 1.5|944957|32|NC_008497|CRISPRCasFinder,PILER-CR matches to NZ_CP035157 (Lactobacillus plantarum strain SRCM103362 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

ttcataaaaaagccgtcattccgcattcaatg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaatg	Protospacer
********************************

7. spacer 1.5|944957|32|NC_008497|CRISPRCasFinder,PILER-CR matches to NC_021904 (Lactobacillus plantarum ZJ316 plasmid pLP-ZJ102, complete sequence) position: , mismatch: 0, identity: 1.0

ttcataaaaaagccgtcattccgcattcaatg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaatg	Protospacer
********************************

8. spacer 1.5|944957|32|NC_008497|CRISPRCasFinder,PILER-CR matches to NC_005952 (Lactobacillus brevis plasmid pRH45II, complete sequence) position: , mismatch: 0, identity: 1.0

ttcataaaaaagccgtcattccgcattcaatg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaatg	Protospacer
********************************

9. spacer 1.5|944957|32|NC_008497|CRISPRCasFinder,PILER-CR matches to NZ_CP035145 (Lactobacillus plantarum strain SRCM103357 plasmid unnamed2) position: , mismatch: 0, identity: 1.0

ttcataaaaaagccgtcattccgcattcaatg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaatg	Protospacer
********************************

10. spacer 1.5|944957|32|NC_008497|CRISPRCasFinder,PILER-CR matches to NZ_CP028277 (Lactobacillus plantarum strain SRCM100995 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

ttcataaaaaagccgtcattccgcattcaatg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaatg	Protospacer
********************************

11. spacer 1.5|944957|32|NC_008497|CRISPRCasFinder,PILER-CR matches to NZ_CP014893 (Lactobacillus backii strain TMW 1.1992 plasmid pL11992-3, complete sequence) position: , mismatch: 0, identity: 1.0

ttcataaaaaagccgtcattccgcattcaatg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaatg	Protospacer
********************************

12. spacer 1.10|944957|33|NC_008497|CRT matches to NZ_CP037431 (Lactobacillus plantarum strain EM plasmid pEM2, complete sequence) position: , mismatch: 0, identity: 1.0

ttcataaaaaagccgtcattccgcattcaatgg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaatgg	Protospacer
*********************************

13. spacer 1.10|944957|33|NC_008497|CRT matches to NZ_CP037431 (Lactobacillus plantarum strain EM plasmid pEM2, complete sequence) position: , mismatch: 0, identity: 1.0

ttcataaaaaagccgtcattccgcattcaatgg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaatgg	Protospacer
*********************************

14. spacer 1.10|944957|33|NC_008497|CRT matches to NZ_CP018327 (Lactobacillus plantarum subsp. plantarum strain TS12 plasmid pLP12-3, complete sequence) position: , mismatch: 0, identity: 1.0

ttcataaaaaagccgtcattccgcattcaatgg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaatgg	Protospacer
*********************************

15. spacer 1.10|944957|33|NC_008497|CRT matches to NZ_CP018212 (Lactobacillus plantarum strain BLS41 plasmid pLPBLS41_3, complete sequence) position: , mismatch: 0, identity: 1.0

ttcataaaaaagccgtcattccgcattcaatgg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaatgg	Protospacer
*********************************

16. spacer 1.10|944957|33|NC_008497|CRT matches to NZ_CP035157 (Lactobacillus plantarum strain SRCM103362 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

ttcataaaaaagccgtcattccgcattcaatgg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaatgg	Protospacer
*********************************

17. spacer 1.10|944957|33|NC_008497|CRT matches to NC_021904 (Lactobacillus plantarum ZJ316 plasmid pLP-ZJ102, complete sequence) position: , mismatch: 0, identity: 1.0

ttcataaaaaagccgtcattccgcattcaatgg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaatgg	Protospacer
*********************************

18. spacer 1.10|944957|33|NC_008497|CRT matches to NZ_CP035145 (Lactobacillus plantarum strain SRCM103357 plasmid unnamed2) position: , mismatch: 0, identity: 1.0

ttcataaaaaagccgtcattccgcattcaatgg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaatgg	Protospacer
*********************************

19. spacer 1.10|944957|33|NC_008497|CRT matches to NZ_CP028277 (Lactobacillus plantarum strain SRCM100995 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

ttcataaaaaagccgtcattccgcattcaatgg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaatgg	Protospacer
*********************************

20. spacer 1.10|944957|33|NC_008497|CRT matches to NZ_CP014893 (Lactobacillus backii strain TMW 1.1992 plasmid pL11992-3, complete sequence) position: , mismatch: 0, identity: 1.0

ttcataaaaaagccgtcattccgcattcaatgg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaatgg	Protospacer
*********************************

21. spacer 1.10|944957|33|NC_008497|CRT matches to NZ_CP014624 (Lactobacillus backii strain TMW 1.1988 plasmid L11988-1, complete sequence) position: , mismatch: 0, identity: 1.0

ttcataaaaaagccgtcattccgcattcaatgg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaatgg	Protospacer
*********************************

22. spacer 1.10|944957|33|NC_008497|CRT matches to NC_005952 (Lactobacillus brevis plasmid pRH45II, complete sequence) position: , mismatch: 0, identity: 1.0

ttcataaaaaagccgtcattccgcattcaatgg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaatgg	Protospacer
*********************************

23. spacer 1.5|944957|32|NC_008497|CRISPRCasFinder,PILER-CR matches to NZ_CP032754 (Lactobacillus plantarum subsp. argentoratensis strain DSM 16365 plasmid unnamed3, complete sequence) position: , mismatch: 1, identity: 0.969

ttcataaaaaagccgtcattccgcattcaatg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaatt	Protospacer
*******************************

24. spacer 1.5|944957|32|NC_008497|CRISPRCasFinder,PILER-CR matches to NZ_CP028228 (Lactobacillus plantarum strain SRCM101187 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.969

ttcataaaaaagccgtcattccgcattcaatg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaatt	Protospacer
*******************************

25. spacer 1.5|944957|32|NC_008497|CRISPRCasFinder,PILER-CR matches to NZ_CP012296 (Pediococcus damnosus strain TMW 2.1536 plasmid pL21536-2, complete sequence) position: , mismatch: 1, identity: 0.969

ttcataaaaaagccgtcattccgcattcaatg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaatt	Protospacer
*******************************

26. spacer 1.5|944957|32|NC_008497|CRISPRCasFinder,PILER-CR matches to NZ_CP053341 (Lactobacillus paraplantarum strain CK401 plasmid pCK401D, complete sequence) position: , mismatch: 1, identity: 0.969

ttcataaaaaagccgtcattccgcattcaatg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaatt	Protospacer
*******************************

27. spacer 1.5|944957|32|NC_008497|CRISPRCasFinder,PILER-CR matches to NZ_CP035559 (Lactobacillus plantarum strain SRCM103297 plasmid unnamed3) position: , mismatch: 1, identity: 0.969

ttcataaaaaagccgtcattccgcattcaatg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaatt	Protospacer
*******************************

28. spacer 1.5|944957|32|NC_008497|CRISPRCasFinder,PILER-CR matches to NZ_CP035572 (Lactobacillus plantarum strain SRCM103303 plasmid unnamed1) position: , mismatch: 1, identity: 0.969

ttcataaaaaagccgtcattccgcattcaatg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaatt	Protospacer
*******************************

29. spacer 1.5|944957|32|NC_008497|CRISPRCasFinder,PILER-CR matches to NZ_CP035175 (Lactobacillus plantarum strain SRCM103426 plasmid unnamed1) position: , mismatch: 1, identity: 0.969

ttcataaaaaagccgtcattccgcattcaatg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaatt	Protospacer
*******************************

30. spacer 1.5|944957|32|NC_008497|CRISPRCasFinder,PILER-CR matches to NZ_CP032758 (Lactobacillus pentosus strain DSM 20314 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.969

ttcataaaaaagccgtcattccgcattcaatg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaatt	Protospacer
*******************************

31. spacer 1.5|944957|32|NC_008497|CRISPRCasFinder,PILER-CR matches to NZ_CP012280 (Pediococcus damnosus strain TMW 2.1533 plasmid pL21533-5, complete sequence) position: , mismatch: 1, identity: 0.969

ttcataaaaaagccgtcattccgcattcaatg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaatt	Protospacer
*******************************

32. spacer 1.5|944957|32|NC_008497|CRISPRCasFinder,PILER-CR matches to NZ_CP014887 (Lactobacillus backii strain TMW 1.1991 plasmid pL11991-6, complete sequence) position: , mismatch: 1, identity: 0.969

ttcataaaaaagccgtcattccgcattcaatg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaatt	Protospacer
*******************************

33. spacer 1.5|944957|32|NC_008497|CRISPRCasFinder,PILER-CR matches to NZ_CP014878 (Lactobacillus backii strain TMW 1.1989 plasmid pL11989-5, complete sequence) position: , mismatch: 1, identity: 0.969

ttcataaaaaagccgtcattccgcattcaatg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaatt	Protospacer
*******************************

34. spacer 1.5|944957|32|NC_008497|CRISPRCasFinder,PILER-CR matches to NZ_CP035116 (Lactobacillus plantarum strain SRCM103295 plasmid unnamed3) position: , mismatch: 1, identity: 0.969

ttcataaaaaagccgtcattccgcattcaatg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaatt	Protospacer
*******************************

35. spacer 1.5|944957|32|NC_008497|CRISPRCasFinder,PILER-CR matches to NZ_CP023773 (Lactobacillus plantarum strain PC520 plasmid p1, complete sequence) position: , mismatch: 1, identity: 0.969

ttcataaaaaagccgtcattccgcattcaatg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaatt	Protospacer
*******************************

36. spacer 1.5|944957|32|NC_008497|CRISPRCasFinder,PILER-CR matches to NZ_CP023302 (Lactobacillus plantarum strain pc-26 plasmid p.pc-2601, complete sequence) position: , mismatch: 1, identity: 0.969

ttcataaaaaagccgtcattccgcattcaatg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaatt	Protospacer
*******************************

37. spacer 1.5|944957|32|NC_008497|CRISPRCasFinder,PILER-CR matches to NZ_CP032461 (Lactobacillus plantarum strain ATG-K2 plasmid pK2-1, complete sequence) position: , mismatch: 1, identity: 0.969

ttcataaaaaagccgtcattccgcattcaatg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaatt	Protospacer
*******************************

38. spacer 1.5|944957|32|NC_008497|CRISPRCasFinder,PILER-CR matches to NZ_CP032461 (Lactobacillus plantarum strain ATG-K2 plasmid pK2-1, complete sequence) position: , mismatch: 1, identity: 0.969

ttcataaaaaagccgtcattccgcattcaatg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaatt	Protospacer
*******************************

39. spacer 1.5|944957|32|NC_008497|CRISPRCasFinder,PILER-CR matches to NZ_CP017958 (Lactobacillus plantarum strain C410L1 plasmid unnamed4, complete sequence) position: , mismatch: 1, identity: 0.969

ttcataaaaaagccgtcattccgcattcaatg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaatt	Protospacer
*******************************

40. spacer 1.5|944957|32|NC_008497|CRISPRCasFinder,PILER-CR matches to NZ_CP032660 (Lactobacillus pentosus strain ZFM94 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.969

ttcataaaaaagccgtcattccgcattcaatg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaatt	Protospacer
*******************************

41. spacer 1.5|944957|32|NC_008497|CRISPRCasFinder,PILER-CR matches to NZ_CP025415 (Lactobacillus plantarum strain X7021 plasmid unnamed3, complete sequence) position: , mismatch: 1, identity: 0.969

ttcataaaaaagccgtcattccgcattcaatg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaatt	Protospacer
*******************************

42. spacer 1.5|944957|32|NC_008497|CRISPRCasFinder,PILER-CR matches to NZ_CP028237 (Lactobacillus plantarum strain SRCM101511 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.969

ttcataaaaaagccgtcattccgcattcaatg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaatt	Protospacer
*******************************

43. spacer 1.5|944957|32|NC_008497|CRISPRCasFinder,PILER-CR matches to NZ_CP028263 (Lactobacillus plantarum strain SRCM102737 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.969

ttcataaaaaagccgtcattccgcattcaatg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaatt	Protospacer
*******************************

44. spacer 1.5|944957|32|NC_008497|CRISPRCasFinder,PILER-CR matches to NZ_CP014904 (Lactobacillus backii strain TMW 1.2002 plasmid pL12002-5, complete sequence) position: , mismatch: 1, identity: 0.969

ttcataaaaaagccgtcattccgcattcaatg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaatt	Protospacer
*******************************

45. spacer 1.5|944957|32|NC_008497|CRISPRCasFinder,PILER-CR matches to NC_020823 (Lactobacillus brevis KB290 plasmid pKB290-5, complete sequence) position: , mismatch: 1, identity: 0.969

ttcataaaaaagccgtcattccgcattcaatg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaatt	Protospacer
*******************************

46. spacer 1.5|944957|32|NC_008497|CRISPRCasFinder,PILER-CR matches to NZ_CP032655 (Lactobacillus pentosus strain ZFM222 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.969

ttcataaaaaagccgtcattccgcattcaatg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaatt	Protospacer
*******************************

47. spacer 1.5|944957|32|NC_008497|CRISPRCasFinder,PILER-CR matches to NZ_CP013152 (Lactobacillus plantarum strain MF1298 plasmid pMF1298-4, complete sequence) position: , mismatch: 1, identity: 0.969

ttcataaaaaagccgtcattccgcattcaatg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaatt	Protospacer
*******************************

48. spacer 1.10|944957|33|NC_008497|CRT matches to NZ_CP053341 (Lactobacillus paraplantarum strain CK401 plasmid pCK401D, complete sequence) position: , mismatch: 1, identity: 0.97

ttcataaaaaagccgtcattccgcattcaatgg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaattg	Protospacer
******************************* *

49. spacer 1.10|944957|33|NC_008497|CRT matches to NZ_CP035559 (Lactobacillus plantarum strain SRCM103297 plasmid unnamed3) position: , mismatch: 1, identity: 0.97

ttcataaaaaagccgtcattccgcattcaatgg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaattg	Protospacer
******************************* *

50. spacer 1.10|944957|33|NC_008497|CRT matches to NZ_CP035572 (Lactobacillus plantarum strain SRCM103303 plasmid unnamed1) position: , mismatch: 1, identity: 0.97

ttcataaaaaagccgtcattccgcattcaatgg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaattg	Protospacer
******************************* *

51. spacer 1.10|944957|33|NC_008497|CRT matches to NZ_CP035175 (Lactobacillus plantarum strain SRCM103426 plasmid unnamed1) position: , mismatch: 1, identity: 0.97

ttcataaaaaagccgtcattccgcattcaatgg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaattg	Protospacer
******************************* *

52. spacer 1.10|944957|33|NC_008497|CRT matches to NZ_CP032758 (Lactobacillus pentosus strain DSM 20314 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.97

ttcataaaaaagccgtcattccgcattcaatgg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaattg	Protospacer
******************************* *

53. spacer 1.10|944957|33|NC_008497|CRT matches to NZ_CP014878 (Lactobacillus backii strain TMW 1.1989 plasmid pL11989-5, complete sequence) position: , mismatch: 1, identity: 0.97

ttcataaaaaagccgtcattccgcattcaatgg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaattg	Protospacer
******************************* *

54. spacer 1.10|944957|33|NC_008497|CRT matches to NZ_CP035116 (Lactobacillus plantarum strain SRCM103295 plasmid unnamed3) position: , mismatch: 1, identity: 0.97

ttcataaaaaagccgtcattccgcattcaatgg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaattg	Protospacer
******************************* *

55. spacer 1.10|944957|33|NC_008497|CRT matches to NZ_CP032461 (Lactobacillus plantarum strain ATG-K2 plasmid pK2-1, complete sequence) position: , mismatch: 1, identity: 0.97

ttcataaaaaagccgtcattccgcattcaatgg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaattg	Protospacer
******************************* *

56. spacer 1.10|944957|33|NC_008497|CRT matches to NZ_CP032461 (Lactobacillus plantarum strain ATG-K2 plasmid pK2-1, complete sequence) position: , mismatch: 1, identity: 0.97

ttcataaaaaagccgtcattccgcattcaatgg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaattg	Protospacer
******************************* *

57. spacer 1.10|944957|33|NC_008497|CRT matches to NZ_CP017958 (Lactobacillus plantarum strain C410L1 plasmid unnamed4, complete sequence) position: , mismatch: 1, identity: 0.97

ttcataaaaaagccgtcattccgcattcaatgg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaattg	Protospacer
******************************* *

58. spacer 1.10|944957|33|NC_008497|CRT matches to NZ_CP032660 (Lactobacillus pentosus strain ZFM94 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.97

ttcataaaaaagccgtcattccgcattcaatgg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaattg	Protospacer
******************************* *

59. spacer 1.10|944957|33|NC_008497|CRT matches to NZ_CP025415 (Lactobacillus plantarum strain X7021 plasmid unnamed3, complete sequence) position: , mismatch: 1, identity: 0.97

ttcataaaaaagccgtcattccgcattcaatgg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaattg	Protospacer
******************************* *

60. spacer 1.10|944957|33|NC_008497|CRT matches to NZ_CP028263 (Lactobacillus plantarum strain SRCM102737 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.97

ttcataaaaaagccgtcattccgcattcaatgg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaattg	Protospacer
******************************* *

61. spacer 1.10|944957|33|NC_008497|CRT matches to NC_020823 (Lactobacillus brevis KB290 plasmid pKB290-5, complete sequence) position: , mismatch: 1, identity: 0.97

ttcataaaaaagccgtcattccgcattcaatgg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaattg	Protospacer
******************************* *

62. spacer 1.10|944957|33|NC_008497|CRT matches to NZ_CP013152 (Lactobacillus plantarum strain MF1298 plasmid pMF1298-4, complete sequence) position: , mismatch: 1, identity: 0.97

ttcataaaaaagccgtcattccgcattcaatgg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaattg	Protospacer
******************************* *

63. spacer 1.10|944957|33|NC_008497|CRT matches to NZ_CP032754 (Lactobacillus plantarum subsp. argentoratensis strain DSM 16365 plasmid unnamed3, complete sequence) position: , mismatch: 1, identity: 0.97

ttcataaaaaagccgtcattccgcattcaatgg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaattg	Protospacer
******************************* *

64. spacer 1.10|944957|33|NC_008497|CRT matches to NZ_CP028228 (Lactobacillus plantarum strain SRCM101187 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.97

ttcataaaaaagccgtcattccgcattcaatgg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaattg	Protospacer
******************************* *

65. spacer 1.10|944957|33|NC_008497|CRT matches to NZ_CP012296 (Pediococcus damnosus strain TMW 2.1536 plasmid pL21536-2, complete sequence) position: , mismatch: 1, identity: 0.97

ttcataaaaaagccgtcattccgcattcaatgg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaattg	Protospacer
******************************* *

66. spacer 1.10|944957|33|NC_008497|CRT matches to NZ_CP012280 (Pediococcus damnosus strain TMW 2.1533 plasmid pL21533-5, complete sequence) position: , mismatch: 1, identity: 0.97

ttcataaaaaagccgtcattccgcattcaatgg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaattg	Protospacer
******************************* *

67. spacer 1.10|944957|33|NC_008497|CRT matches to NZ_CP014887 (Lactobacillus backii strain TMW 1.1991 plasmid pL11991-6, complete sequence) position: , mismatch: 1, identity: 0.97

ttcataaaaaagccgtcattccgcattcaatgg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaattg	Protospacer
******************************* *

68. spacer 1.10|944957|33|NC_008497|CRT matches to NZ_CP023773 (Lactobacillus plantarum strain PC520 plasmid p1, complete sequence) position: , mismatch: 1, identity: 0.97

ttcataaaaaagccgtcattccgcattcaatgg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaattg	Protospacer
******************************* *

69. spacer 1.10|944957|33|NC_008497|CRT matches to NZ_CP023302 (Lactobacillus plantarum strain pc-26 plasmid p.pc-2601, complete sequence) position: , mismatch: 1, identity: 0.97

ttcataaaaaagccgtcattccgcattcaatgg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaattg	Protospacer
******************************* *

70. spacer 1.10|944957|33|NC_008497|CRT matches to NZ_CP028237 (Lactobacillus plantarum strain SRCM101511 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.97

ttcataaaaaagccgtcattccgcattcaatgg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaattg	Protospacer
******************************* *

71. spacer 1.10|944957|33|NC_008497|CRT matches to NZ_CP014904 (Lactobacillus backii strain TMW 1.2002 plasmid pL12002-5, complete sequence) position: , mismatch: 1, identity: 0.97

ttcataaaaaagccgtcattccgcattcaatgg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaattg	Protospacer
******************************* *

72. spacer 1.10|944957|33|NC_008497|CRT matches to NZ_CP032655 (Lactobacillus pentosus strain ZFM222 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.97

ttcataaaaaagccgtcattccgcattcaatgg	CRISPR spacer
ttcataaaaaagccgtcattccgcattcaattg	Protospacer
******************************* *

73. spacer 2.2|2249823|33|NC_008497|CRISPRCasFinder,CRT,PILER-CR matches to MN830254 (Lactobacillus phage JNU_P2, complete genome) position: , mismatch: 1, identity: 0.97

tgacaaccaaaaaatatacgactttaacttctg	CRISPR spacer
tggcaaccaaaaaatatacgactttaacttctg	Protospacer
**.******************************

74. spacer 2.2|2249823|33|NC_008497|CRISPRCasFinder,CRT,PILER-CR matches to MN830255 (Lactobacillus phage JNU_P4, complete genome) position: , mismatch: 1, identity: 0.97

tgacaaccaaaaaatatacgactttaacttctg	CRISPR spacer
tggcaaccaaaaaatatacgactttaacttctg	Protospacer
**.******************************

75. spacer 2.4|2249945|33|NC_008497|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP014920 (Lactobacillus paracollinoides strain TMW 1.1994 plasmid pL11994-5, complete sequence) position: , mismatch: 1, identity: 0.97

gatgaataagaaaagaaaacaaaataatacgca	CRISPR spacer
gatgaataagaaaagaaaacaagataatacgca	Protospacer
**********************.**********

76. spacer 1.5|944957|32|NC_008497|CRISPRCasFinder,PILER-CR matches to NZ_CP025588 (Lactobacillus plantarum strain KC3 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.938

ttcataaaaaagccgtcattccgcattcaatg	CRISPR spacer
ttcattaaaaagccgtcattccgcattcaatt	Protospacer
***** *************************

77. spacer 1.5|944957|32|NC_008497|CRISPRCasFinder,PILER-CR matches to NZ_CP035568 (Lactobacillus plantarum strain SRCM103300 plasmid unnamed2) position: , mismatch: 2, identity: 0.938

ttcataaaaaagccgtcattccgcattcaatg	CRISPR spacer
ttcataaaaaagccgtcattccgcattaaatt	Protospacer
*************************** ***

78. spacer 1.5|944957|32|NC_008497|CRISPRCasFinder,PILER-CR matches to NZ_CP012285 (Pediococcus damnosus strain TMW 2.1534 plasmid pL21534-2, complete sequence) position: , mismatch: 2, identity: 0.938

ttcat-aaaaaagccgtcattccgcattcaatg	CRISPR spacer
-tcataaaaaaagccgtcattccgcattcaatt	Protospacer
 **** **************************

79. spacer 1.5|944957|32|NC_008497|CRISPRCasFinder,PILER-CR matches to NZ_CP012272 (Pediococcus damnosus strain TMW 2.1532 plasmid pL21532-3, complete sequence) position: , mismatch: 2, identity: 0.938

ttcat-aaaaaagccgtcattccgcattcaatg	CRISPR spacer
-tcataaaaaaagccgtcattccgcattcaatt	Protospacer
 **** **************************

80. spacer 1.10|944957|33|NC_008497|CRT matches to NZ_CP035568 (Lactobacillus plantarum strain SRCM103300 plasmid unnamed2) position: , mismatch: 2, identity: 0.939

ttcataaaaaagccgtcattccgcattcaatgg	CRISPR spacer
ttcataaaaaagccgtcattccgcattaaattg	Protospacer
*************************** *** *

81. spacer 1.10|944957|33|NC_008497|CRT matches to NZ_CP025588 (Lactobacillus plantarum strain KC3 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.939

ttcataaaaaagccgtcattccgcattcaatgg	CRISPR spacer
ttcattaaaaagccgtcattccgcattcaattg	Protospacer
***** ************************* *

82. spacer 1.10|944957|33|NC_008497|CRT matches to NZ_CP012272 (Pediococcus damnosus strain TMW 2.1532 plasmid pL21532-3, complete sequence) position: , mismatch: 2, identity: 0.939

ttcat-aaaaaagccgtcattccgcattcaatgg	CRISPR spacer
-tcataaaaaaagccgtcattccgcattcaattg	Protospacer
 **** ************************** *

83. spacer 1.10|944957|33|NC_008497|CRT matches to NZ_CP012285 (Pediococcus damnosus strain TMW 2.1534 plasmid pL21534-2, complete sequence) position: , mismatch: 2, identity: 0.939

ttcat-aaaaaagccgtcattccgcattcaatgg	CRISPR spacer
-tcataaaaaaagccgtcattccgcattcaattg	Protospacer
 **** ************************** *

84. spacer 1.1|944713|32|NC_008497|CRISPRCasFinder matches to MN657132 (Psychrobacter sp. strain ANT_H9 plasmid pA9H1, complete sequence) position: , mismatch: 7, identity: 0.781

ttggttcaaatgctacaagctcgttttcagcc	CRISPR spacer
cttgagctaatgctacaagctcgtttttggcc	Protospacer
.* *  * *******************..***

85. spacer 2.4|2249945|33|NC_008497|CRISPRCasFinder,CRT,PILER-CR matches to MK496698 (Capybara microvirus Cap1_SP_87, complete genome) position: , mismatch: 7, identity: 0.788

gatgaataagaaaagaaaacaaaataatacgca	CRISPR spacer
gatgaataataaaagaaaataaaataaactaaa	Protospacer
********* *********.*******  .. *

86. spacer 2.4|2249945|33|NC_008497|CRISPRCasFinder,CRT,PILER-CR matches to NC_017296 (Clostridium acetobutylicum EA 2018 plasmid pEA2018, complete sequence) position: , mismatch: 7, identity: 0.788

gatgaataagaaaagaaaacaaaataatacgca	CRISPR spacer
gaataataagaaaagaaaaacaaataatataaa	Protospacer
**  ***************  ********.. *

87. spacer 2.4|2249945|33|NC_008497|CRISPRCasFinder,CRT,PILER-CR matches to NC_015686 (Clostridium acetobutylicum DSM 1731 plasmid pSMBa, complete sequence) position: , mismatch: 7, identity: 0.788

gatgaataagaaaagaaaacaaaataatacgca	CRISPR spacer
gaataataagaaaagaaaaacaaataatataaa	Protospacer
**  ***************  ********.. *

88. spacer 2.4|2249945|33|NC_008497|CRISPRCasFinder,CRT,PILER-CR matches to NC_001988 (Clostridium acetobutylicum ATCC 824 plasmid pSOL1, complete sequence) position: , mismatch: 7, identity: 0.788

gatgaataagaaaagaaaacaaaataatacgca	CRISPR spacer
gaataataagaaaagaaaaacaaataatataaa	Protospacer
**  ***************  ********.. *

89. spacer 1.4|944896|32|NC_008497|CRISPRCasFinder,PILER-CR matches to NZ_CP020932 (Marinobacter salarius strain SMR5 plasmid pSMR5, complete sequence) position: , mismatch: 8, identity: 0.75

acagttgtttgtggaatatcttggtactgtcc	CRISPR spacer
ggaattgtttgcggaatatcttgggacgatcg	Protospacer
. *.*******.************ ** .**

90. spacer 1.6|944713|33|NC_008497|CRT matches to MN657132 (Psychrobacter sp. strain ANT_H9 plasmid pA9H1, complete sequence) position: , mismatch: 8, identity: 0.758

ttggttcaaatgctacaagctcgttttcagcca	CRISPR spacer
cttgagctaatgctacaagctcgtttttggccc	Protospacer
.* *  * *******************..***

91. spacer 2.1|2249762|33|NC_008497|CRISPRCasFinder,CRT matches to KY979109 (Salmonella phage SHP1, complete genome) position: , mismatch: 8, identity: 0.758

gcttaaaatcaagcagtcgttgggctacgtcaa	CRISPR spacer
tcttaacatcaagcagtcgtttggcattatcac	Protospacer
 ***** ************** ***  ..***

92. spacer 2.1|2249762|33|NC_008497|CRISPRCasFinder,CRT matches to NC_019500 (Enterobacteria phage Bp7, complete genome) position: , mismatch: 8, identity: 0.758

gcttaaaatcaagcagtcgttgggctacgtcaa	CRISPR spacer
tcttaacatcaagcagtcgtttggcattatcac	Protospacer
 ***** ************** ***  ..***

93. spacer 1.2|944774|32|NC_008497|CRISPRCasFinder,PILER-CR matches to NC_017588 (Thermus thermophilus JL-18 plasmid pTTJL1801, complete sequence) position: , mismatch: 9, identity: 0.719

cactaaggcagctaagccgaaaaaggccatct	CRISPR spacer
tccgtaggcacctaagccaaaaaaggccgcgt	Protospacer
. *  ***** *******.*********.. *

94. spacer 2.4|2249945|33|NC_008497|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP047434 (Spiroplasma citri strain BLH-13 plasmid pSciBLH13-6) position: , mismatch: 10, identity: 0.697

gatgaataagaaaagaaaacaaaataatacgca	CRISPR spacer
gtattataagaaaagaaaaaagaataataaaag	Protospacer
*    ************** *.******* . .

95. spacer 2.4|2249945|33|NC_008497|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP047434 (Spiroplasma citri strain BLH-13 plasmid pSciBLH13-6) position: , mismatch: 10, identity: 0.697

gatgaataagaaaagaaaacaaaataatacgca	CRISPR spacer
gtattataagaaaagaaaaaagaataataaaag	Protospacer
*    ************** *.******* . .

96. spacer 2.4|2249945|33|NC_008497|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LR214978 (Mycoplasma cynos strain NCTC10142 plasmid 5) position: , mismatch: 10, identity: 0.697

gatgaataagaaaagaaaacaaaataatacgca	CRISPR spacer
atagaataagaaaagaaaacaacaaaaacatta	Protospacer
.  ******************* * **    .*

97. spacer 2.4|2249945|33|NC_008497|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LR214986 (Mycoplasma cynos strain NCTC10142 plasmid 13) position: , mismatch: 10, identity: 0.697

gatgaataagaaaagaaaacaaaataatacgca	CRISPR spacer
atagaataagaaaagaaaacaacaaaaacatta	Protospacer
.  ******************* * **    .*

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

808855 : 818111

Staphylococcus_phage(42.86%)

tRNA

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011667553.1\|808855_809131_+	HU family DNA-binding protein	A0A0H3UZA0	Geobacillus_virus	3.1e-26	68.5
WP_011667554.1\|809236_810496_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_042254316.1\|810613_811510_-	YitT family protein	M1Q1P6	Streptococcus_phage	1.6e-52	38.8
WP_011667556.1\|811685_812879_+\|tRNA	CCA tRNA nucleotidyltransferase	G3MAR3	Bacillus_virus	4.1e-35	39.7
WP_011667557.1\|812907_814800_+	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L0W2	Tupanvirus	6.1e-49	29.3
WP_011667558.1\|814811_815762_+	thymidylate synthase	A0A0N9SH48	Staphylococcus_phage	5.9e-117	61.8
WP_011667559.1\|815778_816270_+	dihydrofolate reductase	A0A0N9S8H6	Staphylococcus_phage	5.7e-23	37.2
WP_011667560.1\|816449_817091_-	hemolysin III family protein	NA	NA	NA	NA
WP_011667561.1\|817259_818111_+	DegV family protein	A0A0N9SI50	Staphylococcus_phage	5.8e-15	33.6

DBSCAN-SWA_2

1065562 : 1132477

Lactobacillus_phage(57.14%)

tRNA,integrase,portal,tail,terminase,plate,capsid

attL 1085006:1085025|attR 1137582:1137601

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011667812.1\|1065562_1066201_-\|tRNA	DUF4479 and tRNA-binding domain-containing protein	NA	NA	NA	NA
WP_011667813.1\|1066224_1066557_-	thioredoxin family protein	NA	NA	NA	NA
WP_011667814.1\|1066735_1067062_+	hypothetical protein	NA	NA	NA	NA
WP_011667815.1\|1067167_1068526_-	amino acid permease	NA	NA	NA	NA
WP_011667816.1\|1068560_1069670_-	alanine dehydrogenase	NA	NA	NA	NA
WP_011667817.1\|1069881_1070388_-	universal stress protein	NA	NA	NA	NA
WP_011667818.1\|1070425_1071826_-	dipeptidase PepV	NA	NA	NA	NA
WP_011667819.1\|1071967_1072801_+	NAD(P)H-hydrate dehydratase	NA	NA	NA	NA
WP_011667820.1\|1072847_1073537_-	16S rRNA uridine-516 pseudouridylate synthase related pseudouridylate synthase	NA	NA	NA	NA
WP_011667821.1\|1073548_1075183_-	polysaccharide biosynthesis protein	NA	NA	NA	NA
WP_011667822.1\|1075404_1075725_+	hypothetical protein	NA	NA	NA	NA
WP_011667823.1\|1075830_1076595_+	flavodoxin family protein	NA	NA	NA	NA
WP_011667824.1\|1076660_1077335_-	AAA family ATPase	NA	NA	NA	NA
WP_011667825.1\|1077783_1080213_-\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	0.0e+00	68.4
WP_011667826.1\|1080654_1081296_+	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_011667827.1\|1081292_1081859_+	class I SAM-dependent methyltransferase	A0A2H4PQV0	Staphylococcus_phage	8.0e-37	46.0
WP_011667829.1\|1082188_1083511_-	glycosyltransferase	NA	NA	NA	NA
WP_011667830.1\|1083519_1084029_-	hypothetical protein	NA	NA	NA	NA
1085006:1085025	attL	NA	NA	NA	NA
WP_011667831.1\|1085688_1086048_+	hypothetical protein	NA	NA	NA	NA
WP_148201724.1\|1086293_1087445_-	ImmA/IrrE family metallo-endopeptidase	A0A0U4JD08	Gordonia_phage	3.5e-23	25.8
WP_011667833.1\|1087441_1088122_-	hypothetical protein	NA	NA	NA	NA
WP_011667834.1\|1088268_1089321_-	lysozyme M1 (1,4-beta-N-acetylmuramidase)	D6PSS2	Lactobacillus_phage	1.3e-170	91.0
WP_011667835.1\|1089320_1089839_-	hypothetical protein	D6PSS1	Lactobacillus_phage	1.5e-79	91.9
WP_011667836.1\|1089831_1090134_-	hypothetical protein	NA	NA	NA	NA
WP_011667837.1\|1090130_1090517_-	hypothetical protein	NA	NA	NA	NA
WP_011667838.1\|1090574_1090745_-	hypothetical protein	D6PSR8	Lactobacillus_phage	2.5e-18	83.9
WP_011667840.1\|1090903_1091356_-	hypothetical protein	NA	NA	NA	NA
WP_011667841.1\|1091374_1091956_-	hypothetical protein	NA	NA	NA	NA
WP_011667843.1\|1093755_1094364_-	hypothetical protein	D6PT00	Lactobacillus_phage	1.5e-25	45.7
WP_011667844.1\|1094353_1095517_-\|plate	baseplate J/gp47 family protein	E5DV64	Deep-sea_thermophilic_phage	5.6e-61	35.2
WP_011667845.1\|1095513_1095888_-	DUF2634 domain-containing protein	NA	NA	NA	NA
WP_011667846.1\|1095884_1096259_-	hypothetical protein	A8ATI0	Listeria_phage	3.1e-05	36.0
WP_011667847.1\|1096255_1097215_-	hypothetical protein	NA	NA	NA	NA
WP_011667848.1\|1097207_1097594_-	hypothetical protein	NA	NA	NA	NA
WP_011667849.1\|1097607_1098909_-	LysM peptidoglycan-binding domain-containing protein	A8ATH7	Listeria_phage	8.0e-08	31.2
WP_011667850.1\|1098920_1104608_-\|tail	phage tail tape measure protein	D6PSZ2	Lactobacillus_phage	3.6e-60	62.2
WP_011667852.1\|1104845_1105472_-	hypothetical protein	D6PSY5	Lactobacillus_phage	4.0e-13	43.2
WP_011667853.1\|1105602_1106085_-	hypothetical protein	NA	NA	NA	NA
WP_011667854.1\|1106102_1107254_-	DUF3383 family protein	NA	NA	NA	NA
WP_011667855.1\|1107271_1107760_-	hypothetical protein	NA	NA	NA	NA
WP_011667856.1\|1107743_1108127_-	hypothetical protein	NA	NA	NA	NA
WP_011667857.1\|1108145_1108445_-	hypothetical protein	NA	NA	NA	NA
WP_011667858.1\|1108459_1108972_-	hypothetical protein	L7TME2	Rhizobium_phage	1.8e-08	35.2
WP_011667859.1\|1108968_1109319_-	DUF4054 domain-containing protein	NA	NA	NA	NA
WP_011667860.1\|1109491_1110613_-\|capsid	major capsid protein	S5MNB6	Brevibacillus_phage	7.6e-47	33.5
WP_011667861.1\|1110630_1111032_-	hypothetical protein	A0A0K2CNR0	Brevibacillus_phage	8.5e-09	31.9
WP_011667862.1\|1111043_1111697_-	DUF4355 domain-containing protein	A0A0P0ID10	Lactobacillus_phage	3.5e-28	53.1
WP_011667863.1\|1111890_1112826_-	hypothetical protein	A0A2P1JTW9	Anoxybacillus_phage	1.0e-17	23.1
WP_011667864.1\|1112746_1114270_-\|portal	phage portal protein	A0A0P0IJV3	Lactobacillus_phage	1.8e-75	37.4
WP_148201725.1\|1114281_1115598_-\|terminase	PBSX family phage terminase large subunit	V5UQR5	Oenococcus_phage	6.4e-162	62.4
WP_011667866.1\|1115743_1116331_+\|integrase	site-specific integrase	A0A0S2GLG4	Bacillus_phage	1.5e-22	34.6
WP_011667867.1\|1116337_1117096_-\|terminase	terminase small subunit	V5URT8	Oenococcus_phage	3.1e-60	50.6
WP_011667868.1\|1117127_1117310_-	hypothetical protein	NA	NA	NA	NA
WP_011667869.1\|1117329_1117575_-	hypothetical protein	NA	NA	NA	NA
WP_011667870.1\|1117586_1117913_-	hypothetical protein	NA	NA	NA	NA
WP_108477668.1\|1119339_1119792_-	transcriptional regulator	D6PSV8	Lactobacillus_phage	3.7e-45	56.9
WP_011667873.1\|1119888_1120212_-	hypothetical protein	NA	NA	NA	NA
WP_011667874.1\|1120241_1120499_-	hypothetical protein	A0A2H4PB64	Lactobacillus_phage	6.0e-16	55.2
WP_011667875.1\|1120639_1120939_-	hypothetical protein	NA	NA	NA	NA
WP_011667876.1\|1120972_1121317_-	hypothetical protein	NA	NA	NA	NA
WP_011667877.1\|1121441_1121696_-	hypothetical protein	NA	NA	NA	NA
WP_011667878.1\|1121696_1121954_-	hypothetical protein	A0A0P0IJX1	Lactobacillus_phage	6.8e-20	68.4
WP_011667879.1\|1121968_1122166_-	hypothetical protein	NA	NA	NA	NA
WP_011667880.1\|1122179_1122641_-	DUF1064 domain-containing protein	A0A2P0ZKV6	Lactobacillus_phage	8.8e-26	46.9
WP_011667881.1\|1122637_1122883_-	hypothetical protein	D6PSU9	Lactobacillus_phage	1.8e-14	56.8
WP_011667882.1\|1123051_1123249_-	hypothetical protein	NA	NA	NA	NA
WP_011667883.1\|1123260_1123476_-	hypothetical protein	NA	NA	NA	NA
WP_080504807.1\|1123468_1123903_-	hypothetical protein	D6PSU8	Lactobacillus_phage	9.1e-17	53.7
WP_011667885.1\|1123899_1124601_-	hypothetical protein	A0A0D4DC57	Staphylococcus_phage	4.9e-28	34.9
WP_011667886.1\|1124601_1125015_-	hypothetical protein	NA	NA	NA	NA
WP_011667887.1\|1125007_1126252_-	replicative DNA helicase	A0A2D1GP91	Lactobacillus_phage	5.2e-57	35.3
WP_011667888.1\|1126252_1127005_-	conserved phage C-terminal domain-containing protein	U5U793	Lactobacillus_phage	2.4e-33	39.1
WP_011667889.1\|1127005_1127203_-	hypothetical protein	NA	NA	NA	NA
WP_011667890.1\|1127272_1127857_-	DUF669 domain-containing protein	D2KRE3	Lactobacillus_phage	1.0e-31	45.5
WP_011667891.1\|1127853_1128552_-	AAA family ATPase	E9LUU1	Lactobacillus_phage	7.2e-88	72.9
WP_011667892.1\|1128552_1129446_-	DUF1351 domain-containing protein	A0A0P0IV40	Lactobacillus_phage	1.5e-26	31.1
WP_011667893.1\|1129438_1129618_-	hypothetical protein	NA	NA	NA	NA
WP_011667895.1\|1129944_1130223_-	hypothetical protein	NA	NA	NA	NA
WP_011667896.1\|1130311_1130566_-	hypothetical protein	NA	NA	NA	NA
WP_011667897.1\|1130578_1130776_-	hypothetical protein	NA	NA	NA	NA
WP_011667898.1\|1130788_1131571_-	ORF6N domain-containing protein	A0A1B0YEA7	Lactobacillus_phage	1.6e-75	55.0
WP_011667899.1\|1131583_1131802_-	hypothetical protein	NA	NA	NA	NA
WP_011667900.1\|1132060_1132477_+	helix-turn-helix transcriptional regulator	E3W8B9	Leuconostoc_phage	2.3e-09	37.4
1137582:1137601	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr_ID: NC_008497.1|WP_011667869.1|1117329_1117575_-|hypothetical-protein

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

NC_008497.1|WP_011667869.1|1117329_1117575_-|hypothetical-protein

1117329_1117575_-

81 aa aa

1065562-1132477

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
NC_008497_1	Orphan	1.1\|944713\|32\|NC_008497\|CRISPRCasFinder	944713-944744	32	1129413-1129444	0
NC_008497_1	Orphan	1.6\|944713\|33\|NC_008497\|CRT	944713-944745	33	1129413-1129445	0

1. spacer 1.1|944713|32|NC_008497|CRISPRCasFinder matches to NC_008497 position: 1129413-1129444, mismatch: 0

ttggttcaaatgctacaagctcgttttcagcc	CRISPR spacer
ttggttcaaatgctacaagctcgttttcagcc	Protospacer
********************************

2. spacer 1.6|944713|33|NC_008497|CRT matches to NC_008497 position: 1129413-1129445, mismatch: 0

ttggttcaaatgctacaagctcgttttcagcca	CRISPR spacer
ttggttcaaatgctacaagctcgttttcagcca	Protospacer
*********************************

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_008498

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NC_008497

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

Click the colored protein region to show detailed information