CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number
NC_008269	Rhodococcus jostii RHA1 plasmid pRHL1, complete sequence	0 crisprs	RT,csa3	0	0	2
NC_008270	Rhodococcus jostii RHA1 plasmid pRHL2, complete sequence	0 crisprs	DEDDh,csf1gr8,csf4gr11,csf2gr7,csf3gr5,RT	0	0	1
NC_008268	Rhodococcus jostii RHA1, complete sequence	1 crisprs	WYL,cas4,DEDDh,csa3,Cas9_archaeal,DinG,c2c9_V-U4,cas3,Cas14u_CAS-V,cas14j	4	3	1
NC_008271	Rhodococcus jostii RHA1 plasmid pRHL3, complete sequence	0 crisprs	csf3gr5,csf2gr7,csf4gr11,csf1gr8,csa3	0	0	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

405930 : 469635

Staphylococcus_phage(25.0%)

integrase,transposase

attL 426871:426888|attR 470439:470456

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011599256.1\|405930_407238_+\|transposase	IS256-like element ISRjo4 family transposase	A0A2P1JQX9	Mycobacterium_phage	5.6e-211	83.8
WP_167540986.1\|407160_407886_-	LuxR family transcriptional regulator	NA	NA	NA	NA
WP_007296163.1\|408673_409696_-	NADPH:quinone reductase	NA	NA	NA	NA
WP_007296162.1\|409810_411082_-	acyl-CoA dehydrogenase family protein	NA	NA	NA	NA
WP_007296161.1\|411188_412787_-	AMP-binding protein	A0A2H4PQM9	Staphylococcus_phage	5.4e-22	24.6
WP_007296160.1\|412783_413815_-	ABC transporter permease	NA	NA	NA	NA
WP_007296159.1\|413811_415350_-	sugar ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.2e-10	25.3
WP_007296158.1\|415346_416474_-	substrate-binding domain-containing protein	NA	NA	NA	NA
WP_007296157.1\|416671_417847_+	iron-containing alcohol dehydrogenase	NA	NA	NA	NA
WP_011599260.1\|417959_418580_-	TetR family transcriptional regulator	NA	NA	NA	NA
WP_007296155.1\|418653_419631_-	NADPH:quinone oxidoreductase family protein	NA	NA	NA	NA
WP_011599261.1\|419763_420813_+	phosphotransferase family protein	NA	NA	NA	NA
WP_007296153.1\|420958_421837_+	MaoC family dehydratase N-terminal domain-containing protein	NA	NA	NA	NA
WP_007296152.1\|421920_422682_+	glucose 1-dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	1.0e-15	30.6
WP_007296151.1\|422801_423563_+	3-hydroxyacyl-CoA dehydrogenase	NA	NA	NA	NA
WP_011599262.1\|423785_424934_+	citrate synthase 2	NA	NA	NA	NA
WP_007296148.1\|426554_427007_+	hypothetical protein	NA	NA	NA	NA
426871:426888	attL	NA	NA	NA	NA
WP_007296147.1\|427378_427960_+	dihydrofolate reductase family protein	NA	NA	NA	NA
WP_039950611.1\|428554_428749_-	hypothetical protein	NA	NA	NA	NA
WP_148228509.1\|429884_430616_-	hypothetical protein	NA	NA	NA	NA
WP_148228468.1\|430740_431364_+	hypothetical protein	NA	NA	NA	NA
WP_007296143.1\|431752_432370_+	DUF4193 domain-containing protein	NA	NA	NA	NA
WP_007296141.1\|433394_434702_-	ArgE/DapE family deacylase	NA	NA	NA	NA
WP_011599273.1\|434826_436425_-	AMP-binding protein	A0A2H4PQM9	Staphylococcus_phage	2.0e-40	27.5
WP_007296139.1\|436792_438349_-	aminomethyl-transferring glycine dehydrogenase subunit GcvPB	NA	NA	NA	NA
WP_007296138.1\|438338_439748_-	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	NA	NA	NA	NA
WP_148228510.1\|439784_440864_-	NAD(+)/NADH kinase	NA	NA	NA	NA
WP_007296136.1\|441054_441861_-	SDR family oxidoreductase	A0A0N9R355	Chrysochromulina_ericina_virus	4.5e-09	25.0
WP_167540987.1\|442572_443940_-	amino acid permease	NA	NA	NA	NA
WP_162130643.1\|444587_445487_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_007296133.1\|445773_446289_-	hypothetical protein	NA	NA	NA	NA
WP_007296132.1\|446450_447938_-	ethanolamine permease	NA	NA	NA	NA
WP_007296131.1\|447940_449878_-	primary-amine oxidase	NA	NA	NA	NA
WP_050787564.1\|450320_451808_+	APC family permease	NA	NA	NA	NA
WP_011599280.1\|451804_452554_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_011599281.1\|452837_453866_-	hypothetical protein	NA	NA	NA	NA
WP_041813407.1\|454892_456569_-	ribbon-helix-helix protein, CopG family	NA	NA	NA	NA
WP_041813174.1\|456732_456951_-	hypothetical protein	NA	NA	NA	NA
WP_081437558.1\|457049_457412_-	DUF1016 family protein	Q9JMP5	Wolbachia_phage	2.5e-12	35.6
WP_007298607.1\|457743_458877_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_007298608.1\|458873_459809_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_011599287.1\|461127_462393_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	9.2e-33	35.2
WP_011599290.1\|463582_464122_+	Helicase associated domain protein	NA	NA	NA	NA
WP_011599291.1\|464237_464951_-	HNH endonuclease	NA	NA	NA	NA
WP_007296749.1\|465590_465815_+	hypothetical protein	NA	NA	NA	NA
WP_041813177.1\|465873_466113_+	hypothetical protein	NA	NA	NA	NA
WP_011599293.1\|466357_466849_+	hypothetical protein	NA	NA	NA	NA
WP_011599198.1\|466961_468044_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_011599295.1\|468195_469635_-\|transposase	ISNCY family transposase	NA	NA	NA	NA
470439:470456	attR	NA	NA	NA	NA

DBSCAN-SWA_2

494748 : 569382

Gordonia_phage(16.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011595195.1\|494748_496008_+\|transposase	IS701 family transposase	NA	NA	NA	NA
WP_011599313.1\|496222_496993_-	ATP-binding protein	A0A2L1IVB6	Escherichia_phage	3.5e-27	31.6
WP_011599314.1\|497001_498516_-\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_007297898.1\|498764_499271_+	hypothetical protein	NA	NA	NA	NA
WP_011599318.1\|500585_501572_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_007297810.1\|504578_506927_-	ATP-binding cassette domain-containing protein	W5SAS9	Pithovirus	1.7e-24	36.4
WP_007297808.1\|507707_508382_-	hypothetical protein	NA	NA	NA	NA
WP_007297807.1\|508625_510587_+	protein kinase	A0A2I2L395	Orpheovirus	5.1e-14	27.8
WP_085996103.1\|510737_511969_-\|transposase	IS3-like element ISRhosp5 family transposase	A0A1B3AZE5	Gordonia_phage	2.3e-36	33.8
WP_011599323.1\|512368_513409_+	iron ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_011599324.1\|513429_514995_+	iron ABC transporter permease	NA	NA	NA	NA
WP_007297804.1\|514991_516032_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.9e-21	31.7
WP_007297803.1\|516643_517291_+	methyltransferase	NA	NA	NA	NA
WP_007297802.1\|517421_521882_+	non-ribosomal peptide synthetase	A0A2K9KZV5	Tupanvirus	1.6e-55	23.3
WP_007297801.1\|522013_522490_+	hypothetical protein	NA	NA	NA	NA
WP_007297800.1\|522533_523226_+	response regulator transcription factor	W8CYM9	Bacillus_phage	1.2e-29	32.7
WP_007297799.1\|523191_524583_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	4.1e-18	28.8
WP_007297798.1\|524777_525611_+	SGNH/GDSL hydrolase family protein	A0A160DD06	Gordonia_phage	1.3e-51	47.5
WP_007297797.1\|525854_526565_-	VTT domain-containing protein	NA	NA	NA	NA
WP_011599327.1\|526561_527578_-	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_007297795.1\|527820_528198_+	CD225/dispanin family protein	NA	NA	NA	NA
WP_148228469.1\|528363_529167_+	hypothetical protein	NA	NA	NA	NA
WP_011599330.1\|529328_530309_+	VWA domain-containing protein	NA	NA	NA	NA
WP_148228511.1\|530421_531108_-	hypothetical protein	NA	NA	NA	NA
WP_148228470.1\|531198_531579_-	hypothetical protein	NA	NA	NA	NA
WP_007297791.1\|531932_533231_+	esterase	NA	NA	NA	NA
WP_007297790.1\|533384_534194_-	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_007297789.1\|534662_535364_+	MspA family porin	NA	NA	NA	NA
WP_011599335.1\|536631_539286_-	FtsX-like permease family protein	NA	NA	NA	NA
WP_007297787.1\|539282_539996_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	1.6e-18	31.0
WP_148228512.1\|539995_540646_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.6e-20	34.0
WP_039951422.1\|540666_541254_-	hypothetical protein	NA	NA	NA	NA
WP_167541009.1\|541549_542761_+	hypothetical protein	NA	NA	NA	NA
WP_007297783.1\|543231_543891_+	hypothetical protein	NA	NA	NA	NA
WP_007299981.1\|544740_544920_-	hypothetical protein	NA	NA	NA	NA
WP_050998689.1\|545149_545452_+	hypothetical protein	NA	NA	NA	NA
WP_007299983.1\|545550_546738_+	AI-2E family transporter	NA	NA	NA	NA
WP_007299985.1\|547275_548298_-	YihY/virulence factor BrkB family protein	NA	NA	NA	NA
WP_007299986.1\|549505_549814_-	hypothetical protein	NA	NA	NA	NA
WP_041813183.1\|549810_550203_-	hypothetical protein	NA	NA	NA	NA
WP_081437560.1\|550477_550999_+	MaoC family dehydratase N-terminal domain-containing protein	NA	NA	NA	NA
WP_011599346.1\|551175_551367_+	hypothetical protein	NA	NA	NA	NA
WP_007299989.1\|551695_552175_+	hypothetical protein	NA	NA	NA	NA
WP_007299990.1\|552365_552590_-	hypothetical protein	NA	NA	NA	NA
WP_007299991.1\|552735_553197_+	DinB family protein	NA	NA	NA	NA
WP_007299992.1\|553576_554173_+	hypothetical protein	NA	NA	NA	NA
WP_007299993.1\|554787_555063_-	LuxR family transcriptional regulator	NA	NA	NA	NA
WP_011599352.1\|555328_557329_+	RNB domain-containing ribonuclease	NA	NA	NA	NA
WP_007299995.1\|557373_558171_-	hypothetical protein	NA	NA	NA	NA
WP_007299996.1\|559755_559983_+	cold shock domain-containing protein	NA	NA	NA	NA
WP_011599355.1\|560288_561728_+\|transposase	ISNCY-like element ISRjo3 family transposase	NA	NA	NA	NA
WP_011599356.1\|561880_562963_+\|transposase	IS630-like element ISRjo2 family transposase	NA	NA	NA	NA
WP_007297325.1\|563000_563777_-	VOC family protein	NA	NA	NA	NA
WP_007297326.1\|564185_564362_-	hypothetical protein	NA	NA	NA	NA
WP_011599256.1\|568074_569382_+\|transposase	IS256-like element ISRjo4 family transposase	A0A2P1JQX9	Mycobacterium_phage	5.6e-211	83.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NC_008270

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

183018 : 292657

Trichoplusia_ni_ascovirus(20.0%)

transposase,integrase

attL 259083:259142|attR 292654:294080

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_167541023.1\|183018_184026_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	9.2e-36	34.0
WP_050787678.1\|184169_184985_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_050787644.1\|185874_187347_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	1.4e-45	31.9
WP_072943915.1\|189005_189314_-	pentapeptide repeat-containing protein	NA	NA	NA	NA
WP_007297316.1\|189347_189551_+	hypothetical protein	NA	NA	NA	NA
WP_011599113.1\|190336_191716_-	MFS transporter	NA	NA	NA	NA
WP_011599112.1\|191773_192784_-	2Fe-2S iron-sulfur cluster binding domain-containing protein	A0A0E3HET2	Synechococcus_phage	6.7e-10	44.7
WP_011599111.1\|192780_193797_-	4-hydroxythreonine-4-phosphate dehydrogenase PdxA	NA	NA	NA	NA
WP_005256013.1\|193793_194264_-	aromatic-ring-hydroxylating dioxygenase subunit beta	NA	NA	NA	NA
WP_011599110.1\|194260_195526_-	Rieske 2Fe-2S domain-containing protein	NA	NA	NA	NA
WP_041813146.1\|195690_196425_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_011599107.1\|197071_198058_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_007297307.1\|198072_198885_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.9e-32	38.2
WP_007297306.1\|198989_199691_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_011599105.1\|199687_200503_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_011599104.1\|200578_201244_+	isochorismatase family protein	NA	NA	NA	NA
WP_007297303.1\|201291_202086_-	IclR family transcriptional regulator	NA	NA	NA	NA
WP_007297302.1\|202288_203719_+	aromatic ring-hydroxylating dioxygenase subunit alpha	NA	NA	NA	NA
WP_007297301.1\|203790_204342_+	3-phenylpropionate/cinnamic acid dioxygenase subunit beta	NA	NA	NA	NA
WP_007297300.1\|204338_204650_+	hypothetical protein	NA	NA	NA	NA
WP_011599100.1\|204646_205453_+	3-(cis-5,6-dihydroxycyclohexa-1, 3-dien-1-yl)propanoate dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	6.3e-11	31.6
WP_005256000.1\|205490_205685_+	ferredoxin	NA	NA	NA	NA
WP_011599099.1\|205684_206926_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_011599098.1\|206922_207654_+	class II aldolase/adducin family protein	NA	NA	NA	NA
WP_148228566.1\|208586_209285_+\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	2.3e-25	37.2
WP_011600055.1\|210013_211048_-	NADP-dependent oxidoreductase	NA	NA	NA	NA
WP_193384960.1\|211334_211817_+	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_011600057.1\|211813_212275_+	DUF3237 domain-containing protein	NA	NA	NA	NA
WP_041813603.1\|213264_214203_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_050787647.1\|214549_215113_+	cupin domain-containing protein	NA	NA	NA	NA
WP_081437608.1\|215161_216667_+	CoA-acylating methylmalonate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_041813605.1\|216738_217134_+	hypothetical protein	NA	NA	NA	NA
WP_011600063.1\|217311_218181_+	mycofactocin-coupled SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	2.7e-12	30.5
WP_050787680.1\|218324_218999_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_011600065.1\|219570_221073_+	long-chain fatty acid--CoA ligase	A0A1V0SBX8	Catovirus	2.1e-23	27.8
WP_011600066.1\|221452_224725_+	protein kinase	G9BWE0	Planktothrix_phage	5.3e-16	28.9
WP_050787650.1\|225899_226130_+	hypothetical protein	NA	NA	NA	NA
WP_011600070.1\|228189_228939_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_081437594.1\|229555_230350_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_081437595.1\|231572_231773_-	hypothetical protein	NA	NA	NA	NA
WP_041813610.1\|232937_233078_+	hypothetical protein	NA	NA	NA	NA
WP_050787651.1\|235441_236059_+	cutinase family protein	NA	NA	NA	NA
WP_050787653.1\|239703_240141_+	OB-fold domain-containing protein	NA	NA	NA	NA
WP_011600082.1\|240718_241414_+	hypothetical protein	NA	NA	NA	NA
WP_011600084.1\|242015_242297_-	hypothetical protein	NA	NA	NA	NA
WP_050787681.1\|242835_243060_-	hypothetical protein	NA	NA	NA	NA
WP_050787654.1\|243194_243389_-	hypothetical protein	NA	NA	NA	NA
WP_050787655.1\|243652_243985_-	hypothetical protein	NA	NA	NA	NA
WP_085996104.1\|246729_247952_-\|transposase	IS3-like element ISRhosp1 family transposase	Q8W6R2	Burkholderia_virus	1.3e-36	35.9
WP_167541015.1\|247992_248451_+\|transposase	transposase	NA	NA	NA	NA
WP_167541016.1\|248709_249504_+\|transposase	transposase	NA	NA	NA	NA
WP_011600092.1\|249811_250411_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_011600096.1\|251846_253478_+	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
WP_011600097.1\|253517_254414_+	NAD(P)H-binding protein	NA	NA	NA	NA
WP_011600099.1\|255558_256422_+	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_148228541.1\|256483_256861_-	hypothetical protein	NA	NA	NA	NA
WP_011600101.1\|257146_258208_+	2,3-butanediol dehydrogenase	NA	NA	NA	NA
WP_081437611.1\|258411_258624_+	WhiB family transcriptional regulator	NA	NA	NA	NA
WP_041813614.1\|258881_259094_-	hypothetical protein	NA	NA	NA	NA
259083:259142	attL	NA	NA	NA	NA
WP_011598806.1\|259138_260383_-\|transposase	IS256 family transposase	A0A220NQR7	Corynebacterium_phage	1.0e-81	44.6
WP_085996104.1\|261819_263042_-\|transposase	IS3-like element ISRhosp1 family transposase	Q8W6R2	Burkholderia_virus	1.3e-36	35.9
WP_011600104.1\|263149_264370_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_011600105.1\|264366_266814_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_148228568.1\|267506_267782_+\|transposase	transposase	NA	NA	NA	NA
WP_148228569.1\|268743_269025_-	DoxX family membrane protein	NA	NA	NA	NA
WP_167541017.1\|269162_270278_-	alpha-hydroxy-acid oxidizing protein	NA	NA	NA	NA
WP_011600112.1\|271276_271753_-	SgcJ/EcaC family oxidoreductase	NA	NA	NA	NA
WP_011600113.1\|271753_272539_-	2-dehydro-3-deoxyglucarate aldolase	NA	NA	NA	NA
WP_011600114.1\|272535_274053_-	MFS transporter	NA	NA	NA	NA
WP_148228570.1\|274098_275067_-	oxidoreductase	NA	NA	NA	NA
WP_011600116.1\|275078_276197_-	amidohydrolase family protein	NA	NA	NA	NA
WP_011600117.1\|276198_276567_-	Rieske (2Fe-2S) protein	NA	NA	NA	NA
WP_011600118.1\|276567_277842_-	amidohydrolase	NA	NA	NA	NA
WP_011600119.1\|277967_278654_+	FadR family transcriptional regulator	NA	NA	NA	NA
WP_011600120.1\|278661_278874_-	Zn-binding dehydrogenase	NA	NA	NA	NA
WP_011600121.1\|278882_280145_-	FAD-binding protein	NA	NA	NA	NA
WP_011600122.1\|280253_280952_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_011600124.1\|282757_284302_-	AMP-binding protein	Q75ZG1	Hepacivirus	3.6e-23	23.0
WP_011600125.1\|284330_285200_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	6.5e-06	25.4
WP_011600126.1\|285190_286891_-	AMP-binding protein	NA	NA	NA	NA
WP_011600127.1\|286901_287594_-	hypothetical protein	NA	NA	NA	NA
WP_011600128.1\|287590_288937_-	phenylacetate--CoA ligase family protein	NA	NA	NA	NA
WP_011600129.1\|288938_290426_-	aldehyde dehydrogenase	NA	NA	NA	NA
WP_011600130.1\|290470_290665_-	ferredoxin	NA	NA	NA	NA
WP_011600131.1\|290689_291001_-	cytochrome P453	NA	NA	NA	NA
WP_011598806.1\|291412_292657_+\|transposase	IS256 family transposase	A0A220NQR7	Corynebacterium_phage	1.0e-81	44.6
292654:294080	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NC_008268

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_008268_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_008268_1

746299-746862

Orphan

Consensus_repeat	Method
TCCGGNTNCTCCTCCTCGGGCTCCTCCTCC	CRT

8 spacers

The CRISPR arrays of NC_008268_1

>merge|NC_008268|1|746299-746862|CRT
TCGCCGGTCTCCTCCTCGGGCTCCTCCTCCTCGTACTCGCCGGTCTCCTCCTCCGGCTCCTCCTCCCCCGGCTCCTCCTCCTCGTACTCGCCGGCCTCGTCCTCCGGGTTCTCCTCCTCGGGCTCCTCCTCCGGCTCCTCCTCCCCCGGCTCCTCCTCCTCGTACTCGCCGGCCTCGTCCTCCGGGTTCTCCTCCTCGGGCTCCTCCTCCGGCTCCTCCTCCCCCGGCTCCTCCTCCTCGTACTCGCCGGCCTCGTCTTCCGGCTCCTCCTCCTCGGGCTCCTCCTCCGGCTCCTCCTCCTCGTACTCGCCGGTCTCCTCCTCCGGCTCCTCCTCCTCGGGCTCCTCCTCCTCGTACTCGCCGGCCTCGTCTTCCGGCTCCTCCTCCTCGGGCTCCTCCTCCGATTCCTCGTCCTCGTACTCGCCGGTCTCCTCCTCGGGCTCCTCCTCCTCGTACTCGCCGGTCTCCTCCTCCGGCTCCTCCTCCTCGGGCTCCTCCTCCGGCTCCTCCTCCTCGTACTCGCCGGCCTCGTCCTCCGGCTCCTCCTCCTCGTACTCGCCGGCC

>NC_008268|1|1|746299-746862|CRT
TCGCCGGTCTCCTCCTCGGGCTCCTCCTCC	TCGTACTCGCCGGTCTCCTCCTCCGGCTCCTCCTCCCCCGGCTCCTCCTCCTCGTACTCGCCGGCCTCGTCC
TCCGGGTTCTCCTCCTCGGGCTCCTCCTCC	GGCTCCTCCTCCCCCGGCTCCTCCTCCTCGTACTCGCCGGCCTCGTCC
TCCGGGTTCTCCTCCTCGGGCTCCTCCTCC	GGCTCCTCCTCCCCCGGCTCCTCCTCCTCGTACTCGCCGGCCTCGTCT
TCCGGCTCCTCCTCCTCGGGCTCCTCCTCC	GGCTCCTCCTCCTCGTACTCGCCGGTCTCCTCC
TCCGGCTCCTCCTCCTCGGGCTCCTCCTCC	TCGTACTCGCCGGCCTCGTCT
TCCGGCTCCTCCTCCTCGGGCTCCTCCTCC	GATTCCTCGTCCTCGTAC
TCGCCGGTCTCCTCCTCGGGCTCCTCCTCC	TCGTACTCGCCGGTCTCCTCC
TCCGGCTCCTCCTCCTCGGGCTCCTCCTCC	GGCTCCTCCTCCTCGTACTCGCCGGCCTCGTCC
TCCGGCTCCTCCTCCTCGTACTCGCCGGCC

Protein	Signature genes	Signature genes Name	Protein_function
NC_008268.1\|WP_011593927.1\|737334_738333_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|368712
NC_008268.1\|WP_009473316.1\|752617_752983_-\|gas-vesicle-structural-protein-GvpA	unknown	unknown	gnl\|CDD\|236485
NC_008268.1\|WP_011593942.1\|749815_751336_+\|diguanylate-cyclase	unknown	unknown	gnl\|CDD\|143635
NC_008268.1\|WP_009473321.1\|757022_757418_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|176908
NC_008268.1\|WP_011593943.1\|751820_752621_-\|GvpL/GvpF-family-gas-vesicle-protein	unknown	unknown	gnl\|CDD\|377652
NC_008268.1\|WP_009473303.1\|742699_742957_+\|hypothetical-protein	unknown	unknown	unknown
NC_008268.1\|WP_009473318.1\|755391_755679_-\|hypothetical-protein	unknown	unknown	unknown
NC_008268.1\|WP_011593935.1\|743899_744553_+\|ANTAR-domain-containing-protein	unknown	unknown	gnl\|CDD\|377145
NC_008268.1\|WP_011593932.1\|742231_742489_-\|hypothetical-protein	unknown	unknown	unknown
NC_008268.1\|WP_011593937.1\|745440_745824_-\|gas-vesicle-structural-protein-GvpA	unknown	unknown	gnl\|CDD\|236485
NC_008268.1\|WP_016881707.1\|741425_741599_-\|hypothetical-protein	unknown	unknown	unknown
NC_008268.1\|WP_085996103.1\|739359_740591_-\|IS3-like-element-ISRhosp5-family-transposase	unknown	unknown	gnl\|CDD\|222853
NC_008268.1\|WP_011593933.1\|743054_743342_-\|hypothetical-protein	unknown	unknown	unknown
NC_008268.1\|WP_011593934.1\|743360_743615_-\|hypothetical-protein	unknown	unknown	unknown
NC_008268.1\|WP_009473324.1\|758301_758664_-\|gas-vesicle-structural-protein-GvpA	unknown	unknown	gnl\|CDD\|236485
NC_008268.1\|WP_011593948.1\|759644_760058_+\|PAS-domain-containing-protein	unknown	unknown	gnl\|CDD\|379177
NC_008268.1\|WP_041812304.1\|756462_756948_+\|DUF4190-domain-containing-protein	unknown	unknown	gnl\|CDD\|379388
NC_008268.1\|WP_011593944.1\|753566_754871_+\|serine/threonine-protein-kinase	unknown	unknown	gnl\|CDD\|270916
NC_008268.1\|WP_011593939.1\|747874_748507_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|367156
NC_008268.1\|WP_011593936.1\|744664_745441_-\|GvpL/GvpF-family-gas-vesicle-protein	unknown	unknown	gnl\|CDD\|377652

Protein	Function_ID	Function_description	E-value
NC_008268.1\|WP_011593927.1\|737334_738333_-\|hypothetical-protein	gnl\|CDD\|368712	pfam06030, DUF916, Bacterial protein of unknown function (DUF916). This family consists of several hypothetical bacterial proteins of unknown function.	0.000291116
NC_008268.1\|WP_009473316.1\|752617_752983_-\|gas-vesicle-structural-protein-GvpA	gnl\|CDD\|236485	PRK09368, PRK09368, gas vesicle structural protein GvpA.	2.56313e-41
NC_008268.1\|WP_009473321.1\|757022_757418_-\|hypothetical-protein	gnl\|CDD\|176908	cd08899, SRPBCC_CalC_Aha1-like_6, Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins. SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain of a functionally uncharacterized subgroup of CalC- and Aha1-like proteins. This group shows similarity to the SRPBCC domains of Micromonospora echinospora CalC (a protein which confers resistance to enediynes) and human Aha1 (one of several co-chaperones which regulate the dimeric chaperone Hsp90), and belongs to the SRPBCC domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket and they bind diverse ligands.	8.09207e-05
NC_008268.1\|WP_011593943.1\|751820_752621_-\|GvpL/GvpF-family-gas-vesicle-protein	gnl\|CDD\|377652	pfam06386, GvpL_GvpF, Gas vesicle synthesis protein GvpL/GvpF. This family consists of several bacterial and archaeal gas vesicle synthesis protein (GvpL/GvpF) sequences. The exact function of this family is unknown.	1.45783e-66
NC_008268.1\|WP_011593935.1\|743899_744553_+\|ANTAR-domain-containing-protein	gnl\|CDD\|377145	pfam03861, ANTAR, ANTAR domain. ANTAR (AmiR and NasR transcription antitermination regulators) is an RNA-binding domain found in bacterial transcription antitermination regulatory proteins. The majority of the domain consists of a coiled-coil.	3.79324e-16
NC_008268.1\|WP_011593942.1\|749815_751336_+\|diguanylate-cyclase	gnl\|CDD\|143635	cd01949, GGDEF, Diguanylate-cyclase (DGC) or GGDEF domain. Diguanylate-cyclase (DGC) or GGDEF domain: Originally named after a conserved residue pattern, and initially described as a domain of unknown function 1 (DUF1). This domain is widely present in bacteria, linked to a wide range of non-homologous domains in a variety of cell signaling proteins. The domain shows homology to the adenylyl cyclase catalytic domain. This correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate. Together with the EAL domain, GGDEF might be involved in regulating cell surface adhesion in bacteria.	4.41109e-53
NC_008268.1\|WP_011593937.1\|745440_745824_-\|gas-vesicle-structural-protein-GvpA	gnl\|CDD\|236485	PRK09368, PRK09368, gas vesicle structural protein GvpA.	1.65222e-46
NC_008268.1\|WP_085996103.1\|739359_740591_-\|IS3-like-element-ISRhosp5-family-transposase	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	7.63376e-59
NC_008268.1\|WP_009473324.1\|758301_758664_-\|gas-vesicle-structural-protein-GvpA	gnl\|CDD\|236485	PRK09368, PRK09368, gas vesicle structural protein GvpA.	2.72268e-43
NC_008268.1\|WP_011593948.1\|759644_760058_+\|PAS-domain-containing-protein	gnl\|CDD\|379177	pfam13426, PAS_9, PAS domain.	1.29119e-08
NC_008268.1\|WP_041812304.1\|756462_756948_+\|DUF4190-domain-containing-protein	gnl\|CDD\|379388	pfam13828, DUF4190, Domain of unknown function (DUF4190). This integral membrane domain is functionally uncharacterized. One of the membrane helices contains two GXXG motifs that are usually associated with dimerization.	1.36429e-08
NC_008268.1\|WP_011593944.1\|753566_754871_+\|serine/threonine-protein-kinase	gnl\|CDD\|270916	cd14014, STKc_PknB_like, Catalytic domain of bacterial Serine/Threonine kinases, PknB and similar proteins. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This subfamily includes many bacterial eukaryotic-type STKs including Staphylococcus aureus PknB (also called PrkC or Stk1), Bacillus subtilis PrkC, and Mycobacterium tuberculosis Pkn proteins (PknB, PknD, PknE, PknF, PknL, and PknH), among others. S. aureus PknB is the only eukaryotic-type STK present in this species, although many microorganisms encode for several such proteins. It is important for the survival and pathogenesis of S. aureus as it is involved in the regulation of purine and pyrimidine biosynthesis, cell wall metabolism, autolysis, virulence, and antibiotic resistance. M. tuberculosis PknB is essential for growth and it acts on diverse substrates including proteins involved in peptidoglycan synthesis, cell division, transcription, stress responses, and metabolic regulation. B. subtilis PrkC is located at the inner membrane of endospores and functions to trigger spore germination. Bacterial STKs in this subfamily show varied domain architectures. The well-characterized members such as S. aureus and M. tuberculosis PknB, and B. subtilis PrkC, contain an N-terminal cytosolic kinase domain, a transmembrane (TM) segment, and mutliple C-terminal extracellular PASTA domains. The PknB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.	3.84388e-106
NC_008268.1\|WP_011593939.1\|747874_748507_-\|hypothetical-protein	gnl\|CDD\|367156	pfam02724, CDC45, CDC45-like protein. CDC45 is an essential gene required for initiation of DNA replication in S. cerevisiae, forming a complex with MCM5/CDC46. homologs of CDC45 have been identified in human, mouse and smut fungus, among others.	4.88144e-05
NC_008268.1\|WP_011593936.1\|744664_745441_-\|GvpL/GvpF-family-gas-vesicle-protein	gnl\|CDD\|377652	pfam06386, GvpL_GvpF, Gas vesicle synthesis protein GvpL/GvpF. This family consists of several bacterial and archaeal gas vesicle synthesis protein (GvpL/GvpF) sequences. The exact function of this family is unknown.	1.3718e-61

>NC_008268.1|WP_011593937.1|745440_745824_-|gas-vesicle-structural-protein-GvpA
MTTAGGPSSSSLADVIDTILDKGLVIDAYVRVSLVGIELLTIDARVVVASVDTYLRFAEAVNRLEIGSEPKGLSEIVSGATEGGAKSKTKGALESAGDKLGGLLGGGEEEEEPERERVSRKSTRGDR
>NC_008268.1|WP_011593936.1|744664_745441_-|GvpL/GvpF-family-gas-vesicle-protein
MATSEQTKPTTGVYVYGIVPADVEVAEDATGVADGTVEVVTHGDIAALVSGLSVDRALGAPGDLRAHADLLDAVAGVAPVLPLRFGAVLTDADAVQEELLSAHVDEFSTALEKLEGRAQYIVKGRYVEKAILQEILDEDDQAAALREEIRDKSEDAGRQARMALGELVSNAIAAKREQDTRRVVEALDDLAASVNVREPTHEEEAAQVAILADVERQGELEQVLSELAQAWNERVEMKLLGPQAAYDFVVTPKPEGQG
>NC_008268.1|WP_011593935.1|743899_744553_+|ANTAR-domain-containing-protein
MGVDSEQVFGGEPQRVGSFRFLLDGQRWEWSDAVAQMHGYQPGEVTPTTDLLLSHKHPEDHPRVARVLDRMVTDAEPFSSKHRIIDTTGKVRHVVVVGDHLHDDTGQVIGTTGFYIDITDTHQNDVKDSVDEAVAELAQSRAVIEQAKGALMLVYGITADRAFDVLTWRSQETNTRLRTIAEQIVAGFREFDPDTGLRARFDHLLLTAHQRVGTWRR
>NC_008268.1|WP_011593934.1|743360_743615_-|hypothetical-protein
MKFREHLASGVGVLGLAVDAGIALASIVVAVPVAFIVSEVGKDRAQARRQTSPTVPPASTTHDLGTVFTYRERTGGGRSSLGGS
>NC_008268.1|WP_011593933.1|743054_743342_-|hypothetical-protein
MAEMSEKTPELGDALRVGARVLVRRPSETAATGAAVEDCADLVPAQDRGHEWAPVPRWAVALDDGRLVFADTEDLTVNPSPGAPEGEIGKAVEPK
>NC_008268.1|WP_009473303.1|742699_742957_+|hypothetical-protein
MDVTERQHLDAVRAQLVRRYEFLDPHLVGEMVDTAHHRFDGCRIRDFVPLLVERAAIRSLDAALAAGATTSATLPAAARVEHHML
>NC_008268.1|WP_011593932.1|742231_742489_-|hypothetical-protein
MAPIEHDPDIAQAQVFLHLLNTEIDILTARIEETEADAHRAGSWDRLGARVRPEEDTLQEQLSEAHHLVARLTARYPELRDVERN
>NC_008268.1|WP_016881707.1|741425_741599_-|hypothetical-protein
MKKPGEETSRESGAVVPNDHLSSDDLAGVVEALTGERVTPRSATGNLAGATRRAAKN
>NC_008268.1|WP_085996103.1|739359_740591_-|IS3-like-element-ISRhosp5-family-transposase
MAMKAYSAEFKADAVALYLSDPSHTFEGIGNDLGVSRETLRNWVRAERKRTGTSTAELRADGAARPASRAGEVSSESVLEEENKQLKAQIRKLETEREILRKAAKYFGGRDELVSRFQFVDDHCDTVPVKWLCQILEVSRSGFYRWRTSGPARAARARADEELAERIRAIHADFDGTYGAPRITAELREAGIEVNHKRVERVMREHGIVGVHLRKPVRTTVPDPDAAAVPDLIRRDFTASAPNTRYVGDITYLPVGDGEFLYLATVLDLGSRRLAGWSIADHMRTELVTDAMRAAAACRGAAGLEGSIFHSDNGAQYASAEFADLCRELGVTRSRGAVGTSADNAAAESLNATLKRETLQGRKRWNSAGEARAAIFRWITRYNTRRRHSTLGQICPIEFEQRSATLATAA
>NC_008268.1|WP_011593927.1|737334_738333_-|hypothetical-protein
MRYVMSLLVLAAAWSVATLAYATPHHAQDPAGQTGLGIRLAEVPVELKDDPRALSYIVDNVNPGTTIQRRIEIQNHTGAPQKVELYAGAANLTDSQFTIEDGRAVNELTTWTTVDPKEAELADGTSTDAVVTVAVPEDAPEGEQYAVVWAQITGPPPTGTGTQLVSRVGIRLYLNVGPGNGSPADFSIAEVTPQRNSEGIAQLVAEVENTGGRALDMAGEVRLSGGPGSLSAGPFNAVNGTTIAPGATALVTIDLSPDLPNGPWTADLTLRSGLVNHLTSASVTFPDSGVGTPVGTGDNGSGFPWVISFAVLLVALIVTVVLLLRQRSRQNT
>NC_008268.1|WP_011593939.1|747874_748507_-|hypothetical-protein
MTGKGQMALAVGAGYMLGRSHKMKLALMLAGAGASSRFPSGSLGVLGQGGKLLANSPEVAKLGETVRKELMRAAKTAAVTAASRRIDSLSSRLQSGGGDLHLVDSVGTAADGRRSKRRRAEEPDDEYDDAEVEEGPGTDEDESEEDDSERAPRARKRPAARRRSSSSGGSRPTRSRSSTKNDDEDEAPTRARKTRAKATTDSAPVRRTRR
>NC_008268.1|WP_011593942.1|749815_751336_+|diguanylate-cyclase
MTELFGPYRVPEGAAQSRSPEEVTRSETGSFPGAAMSAQLAAALECAPTPVGLWEFGSGRLRYLNPAAAALLGFEDGSEVPGRTVADVRTDTAMAQASEVFAALTDRGRWCGRTELRHLRTGAPIPTVLSVFVTERDENGRPLLIGAIAREPSTAGVREHPLLAALAAADQRCREQHALAELSRLAVTADLDTLPTAATGTVTALLGTRCAAVARVPGASGAVLPVLGYHGPGPRPSTVAAGRGSLTGYAATETAVVCCPDRADERRFATADMAAHGLGSGIGVPIGHDPIWGVLTAHFAGPRVTREHEVALVRAVAAVLSTAIGRIEVEERLRHQSLHDPLTGLPNRTLALERITAALDQAAHTGIRVAVLVIDLDNFRHLNARLGHAGGDAALVRLADRLRSLVRPTDIVARLGGDEFLILCPAVTGPADATAIADRIATVDPHPGAAPITASVGIAVTGVAVTGAAVSPHELIHHADRAMYRAKATGPGRYALHHPDPADPGR
>NC_008268.1|WP_011593943.1|751820_752621_-|GvpL/GvpF-family-gas-vesicle-protein
MTSANDTGDHDDDNGEGAAASVMYVYAIVPADVQPEEDATGIHDAPIEIVTHGDIAALVSEIDTDDRLGTPADLQAHARILDGTSHVAPVLPLRFGAVVSDRDAVVNELLAEHHDEFASALDELEGFAQYMIKGRYVEESIVQEIVDENPKASALLESIRGRPEELTHDARIALGEIIGHTLEAKRDADTRITLEALSPLTDTVTVRDPTHDEDAVQIAILLEVDRQDELEQTVGDLAERWDNRVAMRILGPMAPYDFVVRAKPED
>NC_008268.1|WP_009473316.1|752617_752983_-|gas-vesicle-structural-protein-GvpA
MTTAGGPSSSSLADVIDTILDKGLVIDAYVRISLVGIELLTIDARIVVASVDTYLRFAEAANRLEIGSEPKGLSDLVSDVKGSGSTKSKTKGVLEGVGETLGELLSGSASEREPAPRRRRK
>NC_008268.1|WP_011593944.1|753566_754871_+|serine/threonine-protein-kinase
MSVSVVLAGRYELRGVLGRGGLADVYDGWDQRLARAVAVKVLRPEMASEPQTRRRFESEARLAATLNHPNVVAVHDSGDDHGAPYIVMERLPGRTLLDDLLAGPLPAPRARTILTQTLDALGAAHAAGILHRDIKPGNILFDAHGTVKVTDFGIAKSADTTHTTAGEVLGTVAYLSPDRITGKPASVTDDLYAVGVVGYEALAGHRPYTGDTILSLAHAIVHGHHEPLTAVRPDLAPTLTTVIERALSCDPQQRFATADQMRNDLANPRRMSPPPPTRVVTPVPSVAVPPRPPAPPRRSPGAGVILGAVAAVLVTIALLVLAVASQDEGSTTGSTSVPPPTAPAPSSYLTPAASPPATMISSEPTAPAPQIVAPNGTAPGAGVDTGGGNGNQGGGNQGNGQGGPGNGNQGNGNGGNGNSNGGNSGGGRGNGGGN
>NC_008268.1|WP_009473318.1|755391_755679_-|hypothetical-protein
MTSHRHITTDHDEIRGWIQAHHGVPARTATTTDTAAALHIDFAAVRPGELEHISWEEWFTAFDAQGLALCYPEPHLRGGASAWFELVPRRGGIDP
>NC_008268.1|WP_041812304.1|756462_756948_+|DUF4190-domain-containing-protein
MSKPLTGPGRDGDPRRMEPGVDNRPVDDRPVDDRPVAVAVEERVVTKPARTSAAAAFALAFRVAAFVCVLIVILSPVGLVLGIIGLILGVIGLRAARRVGITGKGVAIAGLVLSGLAIVISIAFAAGVVTVLNNDSAVDRIEQEVDKMRDTVPDNVEVPQP
>NC_008268.1|WP_009473321.1|757022_757418_-|hypothetical-protein
MTDIVTVTENGRYRLHLERRLHHNCDEVWRVLRRLHPECVGTGMACRARPPNLLEYACGEIVLRWDITSDGHSRSVLRFSHCCPSRQDGIEEMGWWLTELDVLGELLDGVNVTDFRRRAEDMIDRCRRAFE
>NC_008268.1|WP_009473324.1|758301_758664_-|gas-vesicle-structural-protein-GvpA
MTTGGPSSSSLADVIDTILDKGLVIDAYVRVSLVGIELLTIDARIVVASVDTYLRFAEAVNRLEIGSEPKGLTDVVSDIKGSGSTKSKTKGVLEGVGETLSELLSGSGSEREPERRRRRK
>NC_008268.1|WP_011593948.1|759644_760058_+|PAS-domain-containing-protein
MDERRRPDPDTALGYLERLPALVLLERLPVPVLAVQHDGVVVYSNRAFERMLDYPPNEVDSQLIGDLMQTASPGPSAVAELRESAGKLVALTHRDGSTVRAFVSESVLERHDDPVTLVCFHDVTELLWDGAPAKDFG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NC_008268_1	1.4\|746587\|33\|NC_008268\|CRT	746587-746619	33	NC_008268.1	746281-746313	0	1.0
NC_008268_1	1.7\|746749\|21\|NC_008268\|CRT	746749-746769	21	NC_008268.1	746293-746313	0	1.0
NC_008268_1	1.8\|746800\|33\|NC_008268\|CRT	746800-746832	33	NC_008268.1	746836-746868	0	1.0
NC_008268_1	1.4\|746587\|33\|NC_008268\|CRT	746587-746619	33	NC_008268.1	746836-746868	2	0.939
NC_008268_1	1.5\|746650\|21\|NC_008268\|CRT	746650-746670	21	NC_008268.1	3602442-3602462	2	0.905
NC_008268_1	1.5\|746650\|21\|NC_008268\|CRT	746650-746670	21	NC_008268.1	3603845-3603865	2	0.905
NC_008268_1	1.5\|746650\|21\|NC_008268\|CRT	746650-746670	21	NC_008268.1	762032-762052	2	0.905
NC_008268_1	1.7\|746749\|21\|NC_008268\|CRT	746749-746769	21	NC_008268.1	746848-746868	2	0.905
NC_008268_1	1.8\|746800\|33\|NC_008268\|CRT	746800-746832	33	NC_008268.1	746281-746313	2	0.939

1. spacer 1.4|746587|33|NC_008268|CRT matches to position: 746281-746313, mismatch: 0, identity: 1.0

ggctcctcctcctcgtactcgccggtctcctcc	CRISPR spacer
ggctcctcctcctcgtactcgccggtctcctcc	Protospacer
*********************************

2. spacer 1.7|746749|21|NC_008268|CRT matches to position: 746293-746313, mismatch: 0, identity: 1.0

tcgtactcgccggtctcctcc	CRISPR spacer
tcgtactcgccggtctcctcc	Protospacer
*********************

3. spacer 1.8|746800|33|NC_008268|CRT matches to position: 746836-746868, mismatch: 0, identity: 1.0

ggctcctcctcctcgtactcgccggcctcgtcc	CRISPR spacer
ggctcctcctcctcgtactcgccggcctcgtcc	Protospacer
*********************************

4. spacer 1.4|746587|33|NC_008268|CRT matches to position: 746836-746868, mismatch: 2, identity: 0.939

ggctcctcctcctcgtactcgccggtctcctcc	CRISPR spacer
ggctcctcctcctcgtactcgccggcctcgtcc	Protospacer
*************************.*** ***

5. spacer 1.5|746650|21|NC_008268|CRT matches to position: 3602442-3602462, mismatch: 2, identity: 0.905

tcgtactcgccggcctcgtct	CRISPR spacer
tcgtcctcgtcggcctcgtct	Protospacer
**** ****.***********

6. spacer 1.5|746650|21|NC_008268|CRT matches to position: 3603845-3603865, mismatch: 2, identity: 0.905

tcgtactcgccggcctcgtct	CRISPR spacer
tcgtagtcgtcggcctcgtct	Protospacer
***** ***.***********

7. spacer 1.5|746650|21|NC_008268|CRT matches to position: 762032-762052, mismatch: 2, identity: 0.905

tcgtactcgccggcctcgtct	CRISPR spacer
tcgtagtcgtcggcctcgtct	Protospacer
***** ***.***********

8. spacer 1.7|746749|21|NC_008268|CRT matches to position: 746848-746868, mismatch: 2, identity: 0.905

tcgtactcgccggtctcctcc	CRISPR spacer
tcgtactcgccggcctcgtcc	Protospacer
*************.*** ***

9. spacer 1.8|746800|33|NC_008268|CRT matches to position: 746281-746313, mismatch: 2, identity: 0.939

ggctcctcctcctcgtactcgccggcctcgtcc	CRISPR spacer
ggctcctcctcctcgtactcgccggtctcctcc	Protospacer
*************************.*** ***

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_008268_1	1.7\|746749\|21\|NC_008268\|CRT	746749-746769	21	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	910719-910739	1	0.952
NC_008268_1	1.4\|746587\|33\|NC_008268\|CRT	746587-746619	33	MT498063	Microbacterium phage Mercedes, complete genome	21322-21354	7	0.788
NC_008268_1	1.8\|746800\|33\|NC_008268\|CRT	746800-746832	33	CP054921	Streptomyces sp. NA03103 plasmid unnamed1, complete sequence	41460-41492	7	0.788
NC_008268_1	1.8\|746800\|33\|NC_008268\|CRT	746800-746832	33	NZ_LR134454	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 12, complete sequence	122877-122909	7	0.788
NC_008268_1	1.8\|746800\|33\|NC_008268\|CRT	746800-746832	33	MT498063	Microbacterium phage Mercedes, complete genome	21322-21354	7	0.788
NC_008268_1	1.4\|746587\|33\|NC_008268\|CRT	746587-746619	33	NZ_LR134454	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 12, complete sequence	122877-122909	8	0.758
NC_008268_1	1.4\|746587\|33\|NC_008268\|CRT	746587-746619	33	NZ_CP003988	Streptomyces sp. 769 plasmid pSGZL, complete sequence	28224-28256	8	0.758
NC_008268_1	1.8\|746800\|33\|NC_008268\|CRT	746800-746832	33	NZ_CP032230	Streptomyces seoulensis strain KCTC 9819 plasmid unnamed	9017-9049	8	0.758
NC_008268_1	1.8\|746800\|33\|NC_008268\|CRT	746800-746832	33	JX006077	Saccharomonospora phage PIS 136, complete genome	46777-46809	8	0.758
NC_008268_1	1.4\|746587\|33\|NC_008268\|CRT	746587-746619	33	MN617843	Mycobacterium phage Quesadilla, complete genome	20602-20634	9	0.727
NC_008268_1	1.4\|746587\|33\|NC_008268\|CRT	746587-746619	33	CP054921	Streptomyces sp. NA03103 plasmid unnamed1, complete sequence	41460-41492	9	0.727
NC_008268_1	1.8\|746800\|33\|NC_008268\|CRT	746800-746832	33	MH825712	Microbacterium phage ValentiniPuff, complete genome	42726-42758	9	0.727
NC_008268_1	1.8\|746800\|33\|NC_008268\|CRT	746800-746832	33	NZ_CP016619	Microvirga ossetica strain V5/3m plasmid unnamed2, complete sequence	530803-530835	10	0.697

1. spacer 1.7|746749|21|NC_008268|CRT matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

tcgtactcgccggtctcctcc	CRISPR spacer
tcgtactcgccggtctactcc	Protospacer
**************** ****

2. spacer 1.4|746587|33|NC_008268|CRT matches to MT498063 (Microbacterium phage Mercedes, complete genome) position: , mismatch: 7, identity: 0.788

ggctcctcctcctcgtactcgccggtctcctcc	CRISPR spacer
ggctcctcctcctcgtcctcgtcgtcgaactcc	Protospacer
**************** ****.** .   ****

3. spacer 1.8|746800|33|NC_008268|CRT matches to CP054921 (Streptomyces sp. NA03103 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.788

ggctcctcctcctcgtactcgccggcctcgtcc	CRISPR spacer
agctcctcctcgtcgtacacgccggcgaggtcg	Protospacer
.********** ****** *******   ***

4. spacer 1.8|746800|33|NC_008268|CRT matches to NZ_LR134454 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 12, complete sequence) position: , mismatch: 7, identity: 0.788

ggctcctcctcctcgtactcgccggcctcgtcc--	CRISPR spacer
ggctcctgctcctcgtcctcgccg--cgcggctgg	Protospacer
******* ******** *******  * ** *.

5. spacer 1.8|746800|33|NC_008268|CRT matches to MT498063 (Microbacterium phage Mercedes, complete genome) position: , mismatch: 7, identity: 0.788

ggctcctcctcctcgtactcgccggcctcgtcc	CRISPR spacer
ggctcctcctcctcgtcctcgtcgtcgaactcc	Protospacer
**************** ****.** *    ***

6. spacer 1.4|746587|33|NC_008268|CRT matches to NZ_LR134454 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 12, complete sequence) position: , mismatch: 8, identity: 0.758

ggctcctcctcctcgtactcgccggtctcctcc	CRISPR spacer
ggctcctgctcctcgtcctcgccgcgcggctgg	Protospacer
******* ******** *******  *  **

7. spacer 1.4|746587|33|NC_008268|CRT matches to NZ_CP003988 (Streptomyces sp. 769 plasmid pSGZL, complete sequence) position: , mismatch: 8, identity: 0.758

ggctcctcctcctcgtactcgccggtctcctcc	CRISPR spacer
gagacctccccctcgtactcgccgggctggttc	Protospacer
*.  *****.*************** **  *.*

8. spacer 1.8|746800|33|NC_008268|CRT matches to NZ_CP032230 (Streptomyces seoulensis strain KCTC 9819 plasmid unnamed) position: , mismatch: 8, identity: 0.758

ggctcctcctcctcgtactcgccggcctcgtcc	CRISPR spacer
atgtacgcctcctggtattcgccggcctcgtcg	Protospacer
.  * * ****** ***.**************

9. spacer 1.8|746800|33|NC_008268|CRT matches to JX006077 (Saccharomonospora phage PIS 136, complete genome) position: , mismatch: 8, identity: 0.758

ggctcctcctcctcgtactcgccggcctcgtcc	CRISPR spacer
acttcggcctcctcgtactcgccggacgcgtgc	Protospacer
. .**  ****************** * *** *

10. spacer 1.4|746587|33|NC_008268|CRT matches to MN617843 (Mycobacterium phage Quesadilla, complete genome) position: , mismatch: 9, identity: 0.727

ggctcctcctcctcgtactcgccggtctcctcc	CRISPR spacer
agcggggtctcctcgacctcgccggtctcctcg	Protospacer
.**    .*******  ***************

11. spacer 1.4|746587|33|NC_008268|CRT matches to CP054921 (Streptomyces sp. NA03103 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.727

ggctcctcctcctcgtactcgccggtctcctcc	CRISPR spacer
agctcctcctcgtcgtacacgccggcgaggtcg	Protospacer
.********** ****** ******.    **

12. spacer 1.8|746800|33|NC_008268|CRT matches to MH825712 (Microbacterium phage ValentiniPuff, complete genome) position: , mismatch: 9, identity: 0.727

ggctcctcctcctcgtactcgccggcctcgtcc	CRISPR spacer
ttcgactcctcctcggactcggcggcctcagcg	Protospacer
  *  ********** ***** *******. *

13. spacer 1.8|746800|33|NC_008268|CRT matches to NZ_CP016619 (Microvirga ossetica strain V5/3m plasmid unnamed2, complete sequence) position: , mismatch: 10, identity: 0.697

ggctcctcctcctcgtactcgccggcctcgtcc	CRISPR spacer
acggcatcctcggcgtactcgccggcctcgaag	Protospacer
.   * *****  *****************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

733131 : 794658

Gordonia_phage(60.0%)

integrase,transposase

attL 727008:727024|attR 750375:750391

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
727008:727024	attL	NA	NA	NA	NA
WP_011593922.1\|733131_734541_-\|integrase	integrase	NA	NA	NA	NA
WP_011593923.1\|734741_735056_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_011593924.1\|735045_736107_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_011593926.1\|736628_737324_-	hypothetical protein	NA	NA	NA	NA
WP_011593927.1\|737334_738333_-	hypothetical protein	NA	NA	NA	NA
WP_085996103.1\|739359_740591_-\|transposase	IS3-like element ISRhosp5 family transposase	A0A1P8CWQ3	Bacillus_phage	4.1e-30	33.1
WP_016881707.1\|741425_741599_-	hypothetical protein	NA	NA	NA	NA
WP_011593932.1\|742231_742489_-	hypothetical protein	NA	NA	NA	NA
WP_009473303.1\|742699_742957_+	hypothetical protein	NA	NA	NA	NA
WP_011593933.1\|743054_743342_-	hypothetical protein	NA	NA	NA	NA
WP_011593934.1\|743360_743615_-	hypothetical protein	NA	NA	NA	NA
WP_011593935.1\|743899_744553_+	ANTAR domain-containing protein	NA	NA	NA	NA
WP_011593936.1\|744664_745441_-	GvpL/GvpF family gas vesicle protein	NA	NA	NA	NA
WP_011593937.1\|745440_745824_-	gas vesicle structural protein GvpA	NA	NA	NA	NA
WP_193384921.1\|745820_747878_-	SRPBCC family protein	NA	NA	NA	NA
WP_011593939.1\|747874_748507_-	hypothetical protein	NA	NA	NA	NA
WP_011593942.1\|749815_751336_+	diguanylate cyclase	NA	NA	NA	NA
750375:750391	attR	NA	NA	NA	NA
WP_011593943.1\|751820_752621_-	GvpL/GvpF family gas vesicle protein	NA	NA	NA	NA
WP_009473316.1\|752617_752983_-	gas vesicle structural protein GvpA	NA	NA	NA	NA
WP_011593944.1\|753566_754871_+	serine/threonine protein kinase	Q6XLZ2	Feldmannia_irregularis_virus	9.8e-14	23.5
WP_009473318.1\|755391_755679_-	hypothetical protein	NA	NA	NA	NA
WP_041812304.1\|756462_756948_+	DUF4190 domain-containing protein	NA	NA	NA	NA
WP_009473321.1\|757022_757418_-	hypothetical protein	NA	NA	NA	NA
WP_009473324.1\|758301_758664_-	gas vesicle structural protein GvpA	NA	NA	NA	NA
WP_011593948.1\|759644_760058_+	PAS domain-containing protein	NA	NA	NA	NA
WP_167540921.1\|760159_760765_-	hypothetical protein	NA	NA	NA	NA
WP_016884872.1\|760739_761126_+	hypothetical protein	NA	NA	NA	NA
WP_041811011.1\|761588_762353_+	hypothetical protein	NA	NA	NA	NA
WP_041812305.1\|762358_763648_+	SRPBCC family protein	NA	NA	NA	NA
WP_011593952.1\|763644_764019_+	gas vesicle structural protein GvpA	NA	NA	NA	NA
WP_009480808.1\|764018_764825_+	GvpL/GvpF family gas vesicle protein	NA	NA	NA	NA
WP_011593954.1\|764829_765081_+	gas vesicle protein GvpG	NA	NA	NA	NA
WP_011593955.1\|765088_765367_+	gas vesicle protein	NA	NA	NA	NA
WP_011593956.1\|765363_765768_+	gas vesicle protein	NA	NA	NA	NA
WP_041811013.1\|765754_766003_+	GvpL/GvpF family gas vesicle protein	NA	NA	NA	NA
WP_043777865.1\|765999_766218_+	gas vesicle protein	NA	NA	NA	NA
WP_011593959.1\|766916_767192_-	hypothetical protein	NA	NA	NA	NA
WP_011593966.1\|769585_769861_-	hypothetical protein	NA	NA	NA	NA
WP_011593967.1\|770088_770244_+	hypothetical protein	NA	NA	NA	NA
WP_081437399.1\|770950_774460_-	indolepyruvate ferredoxin oxidoreductase family protein	NA	NA	NA	NA
WP_011593970.1\|774495_775272_-	RraA family protein	NA	NA	NA	NA
WP_011593971.1\|775264_775882_-	3-isopropylmalate dehydratase small subunit	NA	NA	NA	NA
WP_011593972.1\|775888_777292_-	3-isopropylmalate dehydratase large subunit	NA	NA	NA	NA
WP_011593973.1\|777534_778008_+	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_041811018.1\|778321_779737_+	C4-dicarboxylate ABC transporter	NA	NA	NA	NA
WP_148228369.1\|780716_780974_+	hypothetical protein	NA	NA	NA	NA
WP_016884888.1\|781177_782428_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_011593978.1\|782553_784563_+	fatty acid desaturase	NA	NA	NA	NA
WP_081437401.1\|785633_786971_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_016880668.1\|788103_789225_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_011593984.1\|789332_790352_+	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_011593985.1\|790379_791507_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_081437514.1\|792321_792567_-	DUF2630 family protein	NA	NA	NA	NA
WP_029538082.1\|793015_793456_+	VOC family protein	NA	NA	NA	NA
WP_081437515.1\|793482_793749_-\|transposase	IS3 family transposase	A0A1B3AZE5	Gordonia_phage	6.6e-34	79.0
WP_167540922.1\|793852_794452_-\|transposase	IS3 family transposase	A0A1B3AZE5	Gordonia_phage	1.2e-72	80.1
WP_009473361.1\|794454_794658_-\|transposase	transposase	A0A1B3AZF8	Gordonia_phage	4.0e-15	79.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NC_008271

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

44250 : 121132

Mycobacterium_phage(16.67%)

integrase,transposase

attL 37012:37029|attR 127492:127509

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
37012:37029	attL	NA	NA	NA	NA
WP_050787697.1\|44250_44676_-\|transposase	IS1380 family transposase	A0A222ZN33	Mycobacterium_phage	2.1e-29	52.3
WP_011600325.1\|44952_45264_-	hypothetical protein	NA	NA	NA	NA
WP_011600327.1\|45999_46467_-	nitroreductase family deazaflavin-dependent oxidoreductase	NA	NA	NA	NA
WP_011600328.1\|46581_47391_-	N-acyl homoserine lactonase family protein	NA	NA	NA	NA
WP_148228583.1\|47514_49269_-	GAF domain-containing protein	NA	NA	NA	NA
WP_081437615.1\|49265_49742_-	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_011600331.1\|50746_52201_+	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_041813718.1\|52684_53317_-\|transposase	transposase	NA	NA	NA	NA
WP_011600333.1\|53501_56771_+	protein kinase	A0A1E1EXG0	Acanthamoeba_castellanii_mimivirus	1.4e-13	28.1
WP_050787734.1\|57611_58379_-	DeoR/GlpR transcriptional regulator	NA	NA	NA	NA
WP_011600336.1\|58567_59464_+	decarboxylating 6-phosphogluconate dehydrogenase	V5UT40	Synechococcus_phage	2.5e-61	41.2
WP_011600337.1\|59457_60465_+	glucose-6-phosphate dehydrogenase (coenzyme-F420)	NA	NA	NA	NA
WP_011600338.1\|60461_62117_+	glucose-6-phosphate isomerase	NA	NA	NA	NA
WP_011600339.1\|62104_62461_+	WhiB family transcriptional regulator	A0A2H4PFS1	Mycobacterium_phage	1.2e-11	41.8
WP_148228584.1\|64426_65785_-	FAD-dependent oxidoreductase	A0A2K5B2C5	Erysipelothrix_phage	2.6e-09	32.6
WP_148228585.1\|65750_66137_-	2Fe-2S iron-sulfur cluster binding domain-containing protein	NA	NA	NA	NA
WP_011600344.1\|66163_67411_-	cytochrome P450	NA	NA	NA	NA
WP_011600346.1\|68061_68928_+	3-hydroxyacyl-CoA dehydrogenase	NA	NA	NA	NA
WP_167541031.1\|69168_69432_+	hypothetical protein	NA	NA	NA	NA
WP_041813720.1\|70364_70568_-	hypothetical protein	NA	NA	NA	NA
WP_011600350.1\|70578_71454_-	hypothetical protein	NA	NA	NA	NA
WP_011600351.1\|71715_74316_-	S8 family peptidase	NA	NA	NA	NA
WP_041813721.1\|74333_75311_-	ATP-binding protein	G8DDJ2	Micromonas_pusilla_virus	9.3e-17	32.1
WP_011600353.1\|75528_76125_-	acyl carrier protein	NA	NA	NA	NA
WP_011600354.1\|76117_77137_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_167541032.1\|77389_77536_+	hypothetical protein	NA	NA	NA	NA
WP_167541033.1\|77817_77988_-	hypothetical protein	NA	NA	NA	NA
WP_011600358.1\|79179_80130_+	hypothetical protein	NA	NA	NA	NA
WP_011600359.1\|80318_80870_+	hypothetical protein	NA	NA	NA	NA
WP_011600205.1\|80957_81287_-	hypothetical protein	NA	NA	NA	NA
WP_011600360.1\|81303_81648_-	Lsr2 family protein	A0A160DEV0	Gordonia_phage	8.6e-18	44.3
WP_041813723.1\|81879_83181_-	ribbon-helix-helix protein, CopG family	NA	NA	NA	NA
WP_081437617.1\|83618_85358_-	Lsr2 family protein	NA	NA	NA	NA
WP_011600365.1\|86843_88178_+	patatin-like phospholipase family protein	NA	NA	NA	NA
WP_011600367.1\|89229_89400_-	hypothetical protein	NA	NA	NA	NA
WP_050787700.1\|90393_90648_-	hypothetical protein	NA	NA	NA	NA
WP_167541027.1\|90973_91219_-	hypothetical protein	NA	NA	NA	NA
WP_041813816.1\|92401_93505_-	FHA domain-containing protein	NA	NA	NA	NA
WP_011600370.1\|93758_94460_+	hypothetical protein	NA	NA	NA	NA
WP_041813727.1\|95127_97485_+	ATP-binding cassette domain-containing protein	A0A2R8FG22	Brazilian_cedratvirus	3.8e-32	37.5
WP_011600374.1\|97752_99669_-	serine/threonine protein kinase	M1HHG8	Acanthocystis_turfacea_Chlorella_virus	5.3e-16	29.8
WP_011600375.1\|100002_100491_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_050787736.1\|100633_102553_-	protein kinase	A0A1B1IUU3	uncultured_Mediterranean_phage	6.1e-20	34.7
WP_050787701.1\|103038_103392_-	DUF732 domain-containing protein	NA	NA	NA	NA
WP_041813729.1\|104692_104875_-	hypothetical protein	NA	NA	NA	NA
WP_011600380.1\|105132_105291_+	hypothetical protein	NA	NA	NA	NA
WP_050787702.1\|105349_105829_+\|transposase	transposase	NA	NA	NA	NA
WP_011600383.1\|107328_107646_-	hypothetical protein	NA	NA	NA	NA
WP_081437618.1\|107834_108350_-	hypothetical protein	NA	NA	NA	NA
WP_011600385.1\|108485_108896_-	helix-turn-helix domain-containing protein	K4ICM4	Acidithiobacillus_phage	1.4e-11	38.6
WP_050787703.1\|112096_112282_+	hypothetical protein	NA	NA	NA	NA
WP_011600389.1\|112596_113412_-	AAA family ATPase	NA	NA	NA	NA
WP_041813732.1\|113408_114893_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	Q38013	Pseudomonas_phage	3.8e-06	29.7
WP_011600391.1\|114932_115589_-	hypothetical protein	NA	NA	NA	NA
WP_011600393.1\|116296_117391_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_011600394.1\|117387_117693_-	hypothetical protein	NA	NA	NA	NA
WP_041813734.1\|117689_118073_-	hypothetical protein	NA	NA	NA	NA
WP_011600398.1\|119956_121132_+\|transposase	IS110-like element ISRhosp8 family transposase	NA	NA	NA	NA
127492:127509	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_008269

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NC_008270

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NC_008268

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. NC_008271

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection