CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NC_009050	Rhodobacter sphaeroides ATCC 17029 chromosome 2, complete sequence	0 crisprs	csa3	0	2
NC_009049	Rhodobacter sphaeroides ATCC 17029 chromosome 1, complete sequence	1 crisprs	csa3,WYL,DEDDh,cas3	0	5
NC_009040	Rhodobacter sphaeroides ATCC 17029 plasmid pRSPH01, complete sequence	1 crisprs	NA	1	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

223158 : 278189

Mannheimia_phage(25.0%)

integrase,transposase

attL 232651:232668|attR 283611:283628

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011841288.1\|223158_224205_+\|transposase	IS481-like element ISRhsp3 family transposase	A0A0M3LS26	Mannheimia_phage	6.8e-58	38.7
WP_011842159.1\|224188_224383_-\|transposase	transposase	NA	NA	NA	NA
WP_011842160.1\|224762_225797_+	ATP-binding protein	NA	NA	NA	NA
WP_160147995.1\|225789_226335_+	hypothetical protein	NA	NA	NA	NA
WP_011842162.1\|226415_228542_-	hypothetical protein	NA	NA	NA	NA
WP_002720344.1\|228666_229713_-\|transposase	IS481-like element ISRhsp3 family transposase	A0A0M3LS26	Mannheimia_phage	6.8e-58	38.7
WP_043828431.1\|229954_232825_-	DUF3427 domain-containing protein	A0A2I5ARD8	Synechococcus_phage	9.3e-41	34.8
232651:232668	attL	NA	NA	NA	NA
WP_043828595.1\|233479_233866_+	hypothetical protein	NA	NA	NA	NA
WP_011842165.1\|233972_235844_+	TniQ family protein	NA	NA	NA	NA
WP_011842166.1\|237742_238093_-	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	2.7e-27	53.3
WP_011842167.1\|238089_238497_-	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_043828597.1\|238715_240041_+	SIR2 family protein	NA	NA	NA	NA
WP_011842169.1\|240037_242017_+	ATP-binding protein	NA	NA	NA	NA
WP_011842170.1\|242520_244353_-	TniQ family protein	NA	NA	NA	NA
WP_011842171.1\|244613_245642_-	TniB family NTP-binding protein	NA	NA	NA	NA
WP_011842172.1\|246233_252605_-	DUF4011 domain-containing protein	NA	NA	NA	NA
WP_043828433.1\|253004_253340_-	hypothetical protein	NA	NA	NA	NA
WP_043828435.1\|253792_254581_-	hypothetical protein	NA	NA	NA	NA
WP_011842175.1\|255004_256669_-	ATP-binding domain-containing protein	A0A068EQC7	Bacillus_phage	8.7e-07	23.3
WP_043828437.1\|256782_258030_+	hypothetical protein	NA	NA	NA	NA
WP_011842177.1\|258039_259779_+	DUF87 domain-containing protein	NA	NA	NA	NA
WP_011842178.1\|261365_262058_+	hypothetical protein	NA	NA	NA	NA
WP_011842179.1\|262054_264403_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_011842180.1\|264579_265005_-	hypothetical protein	NA	NA	NA	NA
WP_002724415.1\|265077_265458_-	hypothetical protein	NA	NA	NA	NA
WP_011842182.1\|265994_266948_-	TniB family NTP-binding protein	NA	NA	NA	NA
WP_011842183.1\|266944_269287_-\|transposase	Mu transposase C-terminal domain-containing protein	NA	NA	NA	NA
WP_011842185.1\|270596_271697_-	AAA family ATPase	A0A0N9R2V4	Chrysochromulina_ericina_virus	8.3e-06	27.5
WP_049763404.1\|271781_271967_-	hypothetical protein	NA	NA	NA	NA
WP_049763405.1\|272044_272233_-	hypothetical protein	NA	NA	NA	NA
WP_043828439.1\|272524_272704_+	hypothetical protein	NA	NA	NA	NA
WP_080517353.1\|272920_273907_-	DMT family transporter	NA	NA	NA	NA
WP_011842189.1\|273862_275152_+	DUF3696 domain-containing protein	Q2P9X8	Enterobacteria_phage	6.3e-21	28.3
WP_011842190.1\|275148_275676_+	hypothetical protein	NA	NA	NA	NA
WP_080517354.1\|275901_276525_+	RNA ligase family protein	A0A292GKV8	Xanthomonas_phage	1.3e-45	45.8
WP_011842192.1\|276806_278189_-\|transposase	IS1182 family transposase	NA	NA	NA	NA
283611:283628	attR	NA	NA	NA	NA

DBSCAN-SWA_2

340289 : 433903

110

Paracoccus_phage(10.42%)

tail,portal,head,capsid,terminase,protease,tRNA,integrase

attL 336602:336621|attR 408594:408613

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
336602:336621	attL	NA	NA	NA	NA
WP_011842230.1\|340289_341015_-\|tRNA	tRNA (guanosine(46)-N7)-methyltransferase TrmB	NA	NA	NA	NA
WP_002724556.1\|341280_341817_+	peptidoglycan-binding protein	NA	NA	NA	NA
WP_002724558.1\|341946_343113_-	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	5.2e-99	50.4
WP_011842231.1\|343201_344689_-	apolipoprotein N-acyltransferase	NA	NA	NA	NA
WP_011842232.1\|344856_345804_-	HlyC/CorC family transporter	NA	NA	NA	NA
WP_011339443.1\|345843_346347_-	rRNA maturation RNase YbeY	NA	NA	NA	NA
WP_011339444.1\|346330_347371_-	PhoH family protein	L7TP00	Rhizobium_phage	7.3e-44	46.8
WP_011842233.1\|347513_348824_-\|tRNA	tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB	NA	NA	NA	NA
WP_043828454.1\|348995_349682_-	arylesterase	NA	NA	NA	NA
WP_009564266.1\|349680_350370_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	1.1e-29	37.1
WP_011842235.1\|350366_352874_+	ABC transporter permease	NA	NA	NA	NA
WP_002724575.1\|352938_353292_+	hypothetical protein	H2BCR0	Synechococcus_phage	1.5e-12	46.3
WP_011842236.1\|353613_354666_+\|tRNA	tRNA 2-selenouridine(34) synthase MnmH	NA	NA	NA	NA
WP_011842237.1\|354666_355767_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_011842238.1\|355854_357153_+	RNA polymerase factor sigma-54	NA	NA	NA	NA
WP_011842239.1\|357252_359280_+	hydantoinase/oxoprolinase family protein	NA	NA	NA	NA
WP_049763407.1\|359388_360510_-\|integrase	tyrosine-type recombinase/integrase	F8TUV0	EBPR_podovirus	2.4e-101	53.8
WP_011842241.1\|360651_360906_-	hypothetical protein	NA	NA	NA	NA
WP_011842242.1\|360902_361664_-	site-specific DNA-methyltransferase	O03956	Myxococcus_phage	8.1e-61	52.5
WP_011842243.1\|361660_362320_-	hypothetical protein	A0A291AUT5	Sinorhizobium_phage	3.2e-90	70.0
WP_043828455.1\|362312_362495_-	hypothetical protein	NA	NA	NA	NA
WP_043828456.1\|362494_362749_-	hypothetical protein	NA	NA	NA	NA
WP_011842245.1\|362741_363002_-	hypothetical protein	NA	NA	NA	NA
WP_043828459.1\|363232_363496_-	hypothetical protein	NA	NA	NA	NA
WP_011842247.1\|363763_364027_-	hypothetical protein	NA	NA	NA	NA
WP_160147998.1\|364266_365118_-	DUF2303 family protein	NA	NA	NA	NA
WP_011842249.1\|365137_365464_-	hypothetical protein	NA	NA	NA	NA
WP_011842250.1\|365576_365909_-	hypothetical protein	NA	NA	NA	NA
WP_160147999.1\|365905_366064_-	hypothetical protein	NA	NA	NA	NA
WP_160148000.1\|366319_366688_-	helix-turn-helix domain-containing protein	G8DH86	Emiliania_huxleyi_virus	5.7e-20	46.1
WP_011842251.1\|367131_367392_+	hypothetical protein	A0A1X9HW32	Ruegeria_phage	1.0e-07	52.2
WP_011842252.1\|367388_367640_+	hypothetical protein	NA	NA	NA	NA
WP_011842253.1\|367782_368301_+	DUF1937 family protein	I3UM60	Rhodobacter_phage	4.6e-23	41.8
WP_011842254.1\|368297_368765_+	hypothetical protein	NA	NA	NA	NA
WP_011842255.1\|368761_369055_+	chromosomal replication initiator protein DnaA	NA	NA	NA	NA
WP_011842256.1\|369044_369689_+	hypothetical protein	NA	NA	NA	NA
WP_011842257.1\|369897_370482_+	hypothetical protein	NA	NA	NA	NA
WP_011842258.1\|370478_371141_+	hypothetical protein	G8DGC1	Emiliania_huxleyi_virus	9.0e-40	41.2
WP_011842259.1\|371247_372147_+	AAA family ATPase	I3ULZ4	Rhodobacter_phage	7.9e-31	56.1
WP_011842260.1\|372189_372666_+	hypothetical protein	NA	NA	NA	NA
WP_011842261.1\|372667_374377_+\|terminase	terminase large subunit	Q3HQS7	Burkholderia_phage	3.3e-134	45.2
WP_011842262.1\|374376_375627_+\|portal	phage portal protein	M4QP41	Tetraselmis_viridis_virus	7.5e-80	40.3
WP_011842263.1\|375623_376463_+\|protease	Clp protease ClpP	K7PH05	Enterobacteria_phage	2.4e-69	58.1
WP_011842264.1\|376475_377777_+\|capsid	phage major capsid protein	Q6JIM7	Burkholderia_virus	7.9e-80	42.9
WP_011842265.1\|377847_378258_+	hypothetical protein	NA	NA	NA	NA
WP_011337205.1\|378254_378596_+\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
WP_011842266.1\|378592_378928_+\|head	phage head closure protein	A0A0U2BXJ0	Paracoccus_phage	2.3e-23	53.2
WP_011842267.1\|379042_379603_+	HK97 gp10 family phage protein	A0A0U2C0P4	Paracoccus_phage	5.9e-16	37.5
WP_160148001.1\|379754_379931_+	hypothetical protein	NA	NA	NA	NA
WP_011842269.1\|379934_380315_+	DUF3168 domain-containing protein	A0A0U2BX31	Paracoccus_phage	2.4e-29	54.8
WP_011842270.1\|380324_380768_+	hypothetical protein	A0A2P1N076	Streptomyces_phage	4.3e-06	33.0
WP_011842271.1\|380764_381145_+	hypothetical protein	NA	NA	NA	NA
WP_011842272.1\|381219_381465_+	hypothetical protein	NA	NA	NA	NA
WP_043828462.1\|381461_381773_-	hypothetical protein	NA	NA	NA	NA
WP_011842273.1\|381826_386725_+	hypothetical protein	A0A0H4ADF4	Pseudoalteromonas_phage	1.9e-46	39.1
WP_011842274.1\|386724_387615_+	hypothetical protein	A0A2H4J8C7	uncultured_Caudovirales_phage	4.0e-27	32.5
WP_011842275.1\|387631_389116_+	hypothetical protein	A0A1S5R1J5	Pseudomonas_phage	7.7e-15	28.9
WP_011842276.1\|389122_389440_+	hypothetical protein	NA	NA	NA	NA
WP_011842277.1\|389443_389782_+	hypothetical protein	NA	NA	NA	NA
WP_160148010.1\|389784_390147_+	hypothetical protein	NA	NA	NA	NA
WP_011842279.1\|390149_390602_+	hypothetical protein	NA	NA	NA	NA
WP_011842280.1\|390605_390959_+	hypothetical protein	NA	NA	NA	NA
WP_011842281.1\|391025_391826_+	M15 family metallopeptidase	A0A0B5A5A2	Paracoccus_phage	2.3e-66	51.3
WP_011842282.1\|391838_392336_+	hypothetical protein	F8TVB7	EBPR_siphovirus	4.6e-12	56.0
WP_011842283.1\|392480_392825_+	hypothetical protein	NA	NA	NA	NA
WP_011842285.1\|393295_395206_+	hypothetical protein	NA	NA	NA	NA
WP_011842286.1\|395219_396110_+	glycoside hydrolase family 16 protein	NA	NA	NA	NA
WP_011842287.1\|396171_396567_-	type II toxin-antitoxin system HicB family antitoxin	NA	NA	NA	NA
WP_080517396.1\|396618_396801_-	type II toxin-antitoxin system HicA family toxin	NA	NA	NA	NA
WP_043828464.1\|397064_398159_-\|integrase	tyrosine-type recombinase/integrase	F8TUV0	EBPR_podovirus	3.1e-106	55.2
WP_012641281.1\|398130_398331_-	hypothetical protein	NA	NA	NA	NA
WP_043828466.1\|398327_398705_-	hypothetical protein	NA	NA	NA	NA
WP_011842290.1\|398701_400513_-	ParB N-terminal domain-containing protein	G8DH78	Emiliania_huxleyi_virus	2.8e-91	38.6
WP_011842291.1\|400637_401033_-	DUF2312 domain-containing protein	A0A1X9HX62	Ruegeria_phage	5.4e-24	60.6
WP_011842292.1\|401032_401365_-	hypothetical protein	NA	NA	NA	NA
WP_011842293.1\|401361_401559_-	hypothetical protein	NA	NA	NA	NA
WP_002719229.1\|401897_402245_-	helix-turn-helix transcriptional regulator	A0A0U4B0B5	Bacillus_phage	6.9e-07	50.9
WP_080517362.1\|402339_402576_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002719227.1\|402656_402914_+	hypothetical protein	A0A1X9HW32	Ruegeria_phage	1.7e-07	44.0
WP_043828467.1\|402910_403159_+	hypothetical protein	NA	NA	NA	NA
WP_043828469.1\|403155_403707_+	DUF1937 family protein	H6WBR3	Rhodobacter_phage	2.3e-20	40.3
WP_043828470.1\|403746_404403_+	DUF1376 domain-containing protein	A9YWY6	Burkholderia_phage	1.1e-05	39.2
WP_043828472.1\|404595_405180_+	hypothetical protein	NA	NA	NA	NA
WP_011842297.1\|405176_405839_+	hypothetical protein	G8DGC1	Emiliania_huxleyi_virus	1.2e-36	41.5
WP_011842298.1\|405930_406647_+	hypothetical protein	A0A291AUL1	Sinorhizobium_phage	8.0e-18	30.9
WP_043828474.1\|406775_407432_+\|terminase	terminase small subunit	NA	NA	NA	NA
WP_011842300.1\|407431_409594_+\|terminase	phage terminase large subunit family protein	A0A291AUS9	Sinorhizobium_phage	1.6e-101	35.4
408594:408613	attR	NA	NA	NA	NA
WP_002723266.1\|409590_409800_+	hypothetical protein	NA	NA	NA	NA
WP_011842301.1\|409799_411290_+\|portal	phage portal protein	K4I1F2	Acidithiobacillus_phage	1.4e-178	68.3
WP_011842302.1\|411286_412642_+	S49 family peptidase	A0A068CE01	Rhizobium_phage	2.0e-57	47.3
WP_011842303.1\|412774_413164_+\|head	head decoration protein	K4ICP8	Acidithiobacillus_phage	2.1e-20	45.7
WP_002723262.1\|413244_414267_+\|capsid	major capsid protein	K4I3Z3	Acidithiobacillus_phage	9.5e-105	55.7
WP_011842304.1\|414277_414604_+	hypothetical protein	NA	NA	NA	NA
WP_011842305.1\|414600_415023_+	hypothetical protein	NA	NA	NA	NA
WP_011842306.1\|415133_415604_+	hypothetical protein	M4QQ74	Salicola_phage	9.0e-18	39.5
WP_011842307.1\|415705_416146_+	hypothetical protein	NA	NA	NA	NA
WP_011842308.1\|416208_416571_+	hypothetical protein	NA	NA	NA	NA
WP_011842309.1\|416619_421794_+	hypothetical protein	F1C5E9	Cronobacter_phage	2.2e-08	25.4
WP_011842310.1\|421793_422684_+	hypothetical protein	A0A2H4J8C7	uncultured_Caudovirales_phage	9.0e-27	30.3
WP_011842311.1\|422699_424184_+	hypothetical protein	A0A1S5R1J5	Pseudomonas_phage	8.5e-14	28.9
WP_011842312.1\|424190_424508_+	hypothetical protein	NA	NA	NA	NA
WP_011842313.1\|424511_424847_+	hypothetical protein	NA	NA	NA	NA
WP_011842314.1\|425079_425397_+	hypothetical protein	I3UM16	Rhodobacter_phage	4.8e-23	58.9
WP_011842315.1\|425595_425973_+	hypothetical protein	NA	NA	NA	NA
WP_160148002.1\|426230_426710_-	hypothetical protein	NA	NA	NA	NA
WP_011842317.1\|427064_427871_+	DNA adenine methylase	A0A291AUP9	Sinorhizobium_phage	2.1e-83	57.8
WP_011842318.1\|427925_428735_+	M15 family metallopeptidase	A0A0B5A5A2	Paracoccus_phage	1.3e-64	50.6
WP_011842319.1\|428747_429230_+	hypothetical protein	F8TVB7	EBPR_siphovirus	2.9e-11	52.4
WP_011842320.1\|429479_430289_-	hypothetical protein	NA	NA	NA	NA
WP_011842321.1\|430291_433903_-	DEAD/DEAH box helicase	A0A0N9R1K5	Chrysochromulina_ericina_virus	5.5e-06	29.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NC_009049

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_009049_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_009049_1

826779-826863

Orphan

Consensus_repeat	Method
GACAACGCTGCCCGCGCGGGGGCT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_009049_1

>merge|NC_009049|1|826779-826863|CRISPRCasFinder
GACAACGCTGCCCGCGCGGGGGCTTTTCTGGCGACCTGTCCCGGCTGGGCGAGATCTTCGAGACAACGCTGCCCGCCCGGGGGCT

>NC_009049|1|1|826779-826863|CRISPRCasFinder
GACAACGCTGCCCGCGCGGGGGCT	TTTCTGGCGACCTGTCCCGGCTGGGCGAGATCTTCGA
GACAACGCTGCCCGCCCGGGGGCT

Protein	Signature genes	Signature genes Name	Protein_function
NC_009049.1\|WP_011840616.1\|821381_821603_-\|ribbon-helix-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|372613
NC_009049.1\|WP_002719293.1\|823363_823822_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226335
NC_009049.1\|WP_011840614.1\|819410_820157_+\|cytochrome-C-biogenesis-protein-CcdA	unknown	unknown	gnl\|CDD\|280792
NC_009049.1\|WP_011840624.1\|831466_832552_+\|tellurite-resistance-ADP-ribose-pyrophosphatase-TrgB	unknown	unknown	gnl\|CDD\|182682
NC_009049.1\|WP_049763396.1\|823924_824581_-\|DUF1194-domain-containing-protein	unknown	unknown	gnl\|CDD\|369046
NC_009049.1\|WP_011840617.1\|821599_821803_-\|DUF4169-family-protein	unknown	unknown	gnl\|CDD\|372717
NC_009049.1\|WP_011337257.1\|819038_819266_-\|sulfurtransferase-TusA-family-protein	unknown	unknown	gnl\|CDD\|238180
NC_009049.1\|WP_002719301.1\|832887_833922_+\|cysteine-synthase-A	unknown	unknown	gnl\|CDD\|182672
NC_009049.1\|WP_011840623.1\|831026_831467_+\|tellurite-resistance-protein-TrgA	unknown	unknown	unknown
NC_009049.1\|WP_011840627.1\|837313_838018_-\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|133022
NC_009049.1\|WP_011840626.1\|836468_837188_+\|alanyl-tRNA-editing-protein	unknown	unknown	gnl\|CDD\|225427
NC_009049.1\|WP_011840620.1\|825503_826550_-\|extracellular-solute-binding-protein	unknown	unknown	gnl\|CDD\|270306
NC_009049.1\|WP_009562946.1\|829789_831001_+\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|225139
NC_009049.1\|WP_011840621.1\|826951_828190_+\|aminotransferase-class-V-fold-PLP-dependent-enzyme	unknown	unknown	gnl\|CDD\|273906
NC_009049.1\|WP_011840618.1\|821802_823197_-\|class-II-fumarate-hydratase	unknown	unknown	gnl\|CDD\|234779
NC_009049.1\|WP_011840612.1\|816185_818858_+\|ribonuclease-E/G	unknown	unknown	gnl\|CDD\|224447
NC_009049.1\|WP_011840628.1\|838014_838566_-\|VTT-domain-containing-protein	unknown	unknown	gnl\|CDD\|223659
NC_009049.1\|WP_011840625.1\|833925_836469_+\|mechanosensitive-ion-channel-family-protein	unknown	unknown	gnl\|CDD\|225803
NC_009049.1\|WP_011840615.1\|820185_821400_+\|hypothetical-protein	unknown	unknown	unknown
NC_009049.1\|WP_011840622.1\|828340_829756_+\|deoxyribodipyrimidine-photo-lyase	unknown	unknown	gnl\|CDD\|223492

Protein	Function_ID	Function_description	E-value
NC_009049.1\|WP_011840616.1\|821381_821603_-\|ribbon-helix-helix-domain-containing-protein	gnl\|CDD\|372613	pfam13467, RHH_4, Ribbon-helix-helix domain. This short bacterial protein contains a ribbon-helix-helix domain that is likely to be DNA-binding.	8.39057e-29
NC_009049.1\|WP_002719293.1\|823363_823822_-\|hypothetical-protein	gnl\|CDD\|226335	COG3814, COG3814, Uncharacterized protein conserved in bacteria [Function unknown].	8.82784e-48
NC_009049.1\|WP_011840614.1\|819410_820157_+\|cytochrome-C-biogenesis-protein-CcdA	gnl\|CDD\|280792	pfam02683, DsbD, Cytochrome C biogenesis protein transmembrane region. This family consists of the transmembrane (i.e. non-catalytic) region of Cytochrome C biogenesis proteins also known as disulphide interchange proteins. These proteins posses a protein disulphide isomerase like domain that is not found within the aligned region of this family.	9.6446e-45
NC_009049.1\|WP_011840624.1\|831466_832552_+\|tellurite-resistance-ADP-ribose-pyrophosphatase-TrgB	gnl\|CDD\|182682	PRK10729, nudF, ADP-ribose pyrophosphatase NudF; Provisional.	2.65503e-43
NC_009049.1\|WP_049763396.1\|823924_824581_-\|DUF1194-domain-containing-protein	gnl\|CDD\|369046	pfam06707, DUF1194, Protein of unknown function (DUF1194). This family consists of several hypothetical Rhizobiales specific proteins of around 270 residues in length. The function of this family is unknown.	1.1117e-67
NC_009049.1\|WP_011840617.1\|821599_821803_-\|DUF4169-family-protein	gnl\|CDD\|372717	pfam13770, DUF4169, Domain of unknown function (DUF4169).	1.69941e-05
NC_009049.1\|WP_011337257.1\|819038_819266_-\|sulfurtransferase-TusA-family-protein	gnl\|CDD\|238180	cd00291, SirA_YedF_YeeD, SirA, YedF, and YeeD. Two-layered alpha/beta sandwich domain. SirA (also known as UvrY, and YhhP) belongs to a family of bacterial two-component response regulators that controls secondary metabolism and virulence. The other member of this two-component system is a sensor kinase called BarA which phosphorylates SirA. A variety of microorganisms have similar proteins, all of which contain a common CPxP sequence motif in the N-terminal region. YhhP is suggested to be important for normal cell division and growth in rich nutrient medium. Moreover, despite a low primary sequence similarity, the YccP structure closely resembles the non-homologous C-terminal RNA-binding domain of E. coli translation initiation factor IF3. The signature CPxP motif serves to stabilize the N-terminal helix as part of the N-capping box and might be important in mRNA-binding.	1.76343e-23
NC_009049.1\|WP_002719301.1\|832887_833922_+\|cysteine-synthase-A	gnl\|CDD\|182672	PRK10717, PRK10717, cysteine synthase A; Provisional.	0
NC_009049.1\|WP_011840626.1\|836468_837188_+\|alanyl-tRNA-editing-protein	gnl\|CDD\|225427	COG2872, COG2872, Predicted metal-dependent hydrolases related to alanyl-tRNA synthetase HxxxH domain [General function prediction only].	6.66929e-87
NC_009049.1\|WP_011840627.1\|837313_838018_-\|glycosyltransferase-family-2-protein	gnl\|CDD\|133022	cd04179, DPM_DPG-synthase_like, DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily.	8.57159e-26
NC_009049.1\|WP_011840620.1\|825503_826550_-\|extracellular-solute-binding-protein	gnl\|CDD\|270306	cd13588, PBP2_polyamine_1, The periplasmic-binding component of an uncharacterized ABC transporter involved in uptake of polyamines; contains the type 2 periplasmic binding fold. This group represents the periplasmic binding domain that functions as the primary high-affinity receptor of an uncharactertized ABC-type polyamine transport system. Polyamine transport plays an essential role in the regulation of intracellular polyamine levels which are known to be elevated in rapidly proliferating cells and tumors. Natural polyamines are putrescine, spermindine, and spermine. They are polycations that play multiple roles in cell growth, survival and proliferation, and plant stress and disease resistance. They can interact with negatively charged molecules, such as nucleic acids, to modulate their functions. Members of this family belong to the type 2 periplasmic-binding fold superfamily. PBP2 is comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	2.30902e-75
NC_009049.1\|WP_009562946.1\|829789_831001_+\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|225139	COG2230, Cfa, Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane].	2.00845e-113
NC_009049.1\|WP_011840621.1\|826951_828190_+\|aminotransferase-class-V-fold-PLP-dependent-enzyme	gnl\|CDD\|273906	TIGR01976, am_tr_V_VC1184, cysteine desulfurase family protein, VC1184 subfamily. This model describes a subfamily of probable pyridoxal phosphate-dependent enzymes in the aminotransferase class V family (pfam00266). The most closely related characterized proteins are active as cysteine desulfurases, selenocysteine lyases, or both; some are involved in FeS cofactor biosynthesis and are designated NifS. An active site Cys residue present in those sequences, in motifs resembling GHHC or GSAC, is not found in this family. The function of members of this family is unknown, but seems unlike to be as an aminotransferase. [Unknown function, Enzymes of unknown specificity].	3.0092e-74
NC_009049.1\|WP_011840618.1\|821802_823197_-\|class-II-fumarate-hydratase	gnl\|CDD\|234779	PRK00485, fumC, fumarate hydratase; Reviewed.	0
NC_009049.1\|WP_011840612.1\|816185_818858_+\|ribonuclease-E/G	gnl\|CDD\|224447	COG1530, CafA, Ribonucleases G and E [Translation, ribosomal structure and biogenesis].	2.9677e-147
NC_009049.1\|WP_011840628.1\|838014_838566_-\|VTT-domain-containing-protein	gnl\|CDD\|223659	COG0586, DedA, Uncharacterized membrane-associated protein [Function unknown].	1.58414e-10
NC_009049.1\|WP_011840625.1\|833925_836469_+\|mechanosensitive-ion-channel-family-protein	gnl\|CDD\|225803	COG3264, COG3264, Small-conductance mechanosensitive channel [Cell envelope biogenesis, outer membrane].	2.02878e-104
NC_009049.1\|WP_011840622.1\|828340_829756_+\|deoxyribodipyrimidine-photo-lyase	gnl\|CDD\|223492	COG0415, PhrB, Deoxyribodipyrimidine photolyase [DNA replication, recombination, and repair].	8.72072e-134

>NC_009049.1|WP_011840620.1|825503_826550_-|extracellular-solute-binding-protein
MIRRTTLLASAAALVALPALAADPDLIVFDWAGFESEGLMKSYIEKNGQMPTYALYGDDDEAFQKVASGFKSDVTHPCSQMVSKYRDAGLIEPWDVSRIPEYDNIAPRFKDSRIFNDDQGVWYIPTDYAYTAIAYNTDSVPAEDVASVQSFLDPKYAGRISLPDNTDDIWSLALLATGVSDWTNLTEEQFQAGAQWLRQAHENVRAYWADPSELAQLMATGEVQLAWTWNDAIALMRQEGFPVGFQRQSKEGSATWFCGYVNMKDAPGSEDKAYDFINSWLAHSSAASLLETHGYALTNEAAMAEITPEALKAAELDPVDTTLLAQTPLDPAMRDRMLEEFEKIKAGF
>NC_009049.1|WP_049763396.1|823924_824581_-|DUF1194-domain-containing-protein
MIRALALALSLACSGPARACETALLLAIDVSGSIDRGEYALQAEGLALALSDPAVADLLLAGESALAIVHWSGVGRQALALPWRRMLAPSDVAAFAGASRTLPRAFTASDTAVGEAISFSLAQFAAVADCRRRVIDISGDGPENAGFTVARARRAAEAAAVEINAIAIEDMGAPAPITAFYRRWAVTRTGFVLTARGLQDYRRAIREKLLRELGKPAS
>NC_009049.1|WP_002719293.1|823363_823822_-|hypothetical-protein
MARSIDYGNLMHRAMRGLIQSVLEDVAEHGLPGAHHFFITFDTTHPDVAMADWLRARYPQEMTVVIQHWYENLSADDHGFSVTLNFGNQPEPLVIPFDAVRTFVDPSVEFGLRFETHEEDEEEETGGDEDPDGDDEPPRHDAQVVSLDKFRK
>NC_009049.1|WP_011840618.1|821802_823197_-|class-II-fumarate-hydratase
MTATRTETDSFGPLEVPADKYWGAQTQRSIQNFPIGWEKQPVAIVRALGVIKKACALVNVAQGDMPEELAQAIAAAATEVIEGRFDDNFPLVVWQTGSGTQSNMNANEVISNRAIEMLGGTMGSKKPVHPNDHVNMGQSSNDTFPTAMHVAIGMMARDVLLPGLEKLHAALVAKSEEFKDIIKIGRTHTQDATPLTLGQEFSGYAKQVEKGIARVKACLPDIYELAQGGTAVGTGLNTRQGWDSRVAAKIAEITGLPFVTAENKFEALAAHDAMVMFSGALKTVAASLFKIANDMRLLGSGPRSGLGELILPENEPGSSIMPGKVNPTQAEALTMVCAHVMGNDAAIGFAGSQGHFELNVYNPMMSYNVLQSMQLLGDAAGSFTDNMVVGTQANVARIDKLMKESLMLVTALAPTIGYDNATKVAKTAHRNGTTLREEAIALGLVDAETFDRVVRPEDMIGPKG
>NC_009049.1|WP_011840617.1|821599_821803_-|DUF4169-family-protein
MAEIVNLRARRKAAERDARRRKGDENAAKHGRIKAARRLEETRAEQARAHLEGHRRETDAPDEPTDP
>NC_009049.1|WP_011840616.1|821381_821603_-|ribbon-helix-helix-domain-containing-protein
MNGRPEKHSLTLRGHRTSVSLEADFWRAFREIAAERGLPLNALAAEVDEARDPEVGLASALRVFVLRHYRTGR
>NC_009049.1|WP_011840615.1|820185_821400_+|hypothetical-protein
MDLLAEPKLRRPFRRRVFLIPGGEPVPPAFYRELYLRQGTAQADLAEMALALRPGRGPASWRVSGAMEAGFCDTEVELLPWADLVPGAAGQAILPALAGRIGTLWIYLATGALLRLFWLRPVAVLAILVPPAVLSGLAALALGAGLLLAQALAALIWPPAGWLAGLLLAGILLLRVRFPPLPFADLGLLAGQRGAVPPALAERMGRFRAALSEALRSECDELLVVGHSTGAALAVSLMADLLRGGLPGRRPALALLTLGQRVPLLSFLPEARQVRRDLNALAAAAELTWVDVSAPEDPLCFALCDPVSVSGVAPEGQLWPLAIPAALAETLSPARRRRLRGRPGLRHLQYLCAYDRPGDYDVFRVTAGPKPLAERFPGRGRIDRVSSGHGTTGAPRAEAQRPVR
>NC_009049.1|WP_011840614.1|819410_820157_+|cytochrome-C-biogenesis-protein-CcdA
MFGLDLIDAGLLPAMLIALVAGVLSFLSPCVLPIVPPYLAYMGGISMKELNQGARRGPLMAALFFVLGLSTVFLFLGFTASAFGAFFLSNAETFATLAGVIVMGFGAHFVGVYRIPFLDREMRMDAGDRGGSAFGAYVLGLAFAFGWTPCIGPQLGAILTLAASEASIARGTTLLAIYAAGLGIPFLLVAAFFPRLTGVMGWMKRHMERIERIMGLLLWTIGLLMLTGGFSSFSYWLLETFPALARLG
>NC_009049.1|WP_011337257.1|819038_819266_-|sulfurtransferase-TusA-family-protein
MEFDEDLDCAGLLCPLPVLRARKRLMAMAPGRVLRVTATDPMAVIDLPHFCAEAGHEVLSCDREGAESVWLIRRG
>NC_009049.1|WP_011840612.1|816185_818858_+|ribonuclease-E/G
MAKKMLIDATHPEETRVVVVDGNKVEEFDFETVNKRQLAGNIYLAKVTRVEPSLQAAFVDYGGNRHGFLAFAEIHPDYYQIPVADRKALLEEERAYARAEDDEDHGRSRRRSRPAPAAAASGDAVQSGDVAGMDVVDLGEETGADALYETDGSDAGAADSGQPEAPDADEKPYRAMDHASDGDDEIESVADEDVAEEIPAPRKPRSRRYKIQEVIKVRQIMLVQVVKEERGNKGAALTTYLSLAGRYCVLMPNTARGGGISRKITQAADRKKLKEIASELEVPEGAGLIIRTAGAKRTKQEIRRDYEYLLRLWEQIRDLTLKSVAPAPIYEEGDLIKRTIRDLFNREIEEVLVEGETGYRTAKDFMRMIMPAHARQVIRYDEPMPLFARYQVESYLSGMFNPVVQLKSGGYIVIGVTEALVAIDVNSGRATKEGSIEETALKTNLEAAEEVARQLRLRDLAGLIVIDFIDMEERKNNAAVEKRLKDKLKTDRARIQVGRISGFGLMEMSRQRLRPGMLESTTQPCAHCHGTGLIRSDDSLALQVLRQLEEEGTRKRSKEVLLRAPIAVVNFLMNSKREHIAMIEARYGMAVRVEADPSLSSPDYVIEKFKTATRVVPEAVKVISGSADLMGAPVDEPEDDWVEEEPEIVEEAEEVAEAAEAAPAEGQPKKKRRRRRRRRNGVNGANGSDAQENGDEGDESDEDEGDAADEPEAVEAAAAVPELAPEAVVSAPEPAAAEPEPTPAEPVAAPAAEEPAAPRKRTRTRKPKVTEEAPAEAAAEAPAAEAPAKEPKKPRTRTSRSRKTAAAAEAVPAVEVAVTVDETPAEASLEIARTTEAVPETTPEAPAAEAPAAEAPVAETPAPQPEPVAEEAGEGEDNKPKRRGWWSIGR
>NC_009049.1|WP_011840621.1|826951_828190_+|aminotransferase-class-V-fold-PLP-dependent-enzyme
MTLLDIGYVRSCFPAFSEPALAGQAFFENAGGSYTCRPVIDRLSRFYHQRKVQPYAPYAASHAAGAEMDEARSRLAALMGVEEDELSFGPSTSANTYVLAQAVRGWLSREGGAIVVTNQDHEANSGVWRRLAHEGIEVREWRIDPGTGHLDPAGLPPLLADGRVRLVCFPHCSNVVGEINPVAEICATARAAGAFTCVDGVSYAPHGLPDMGALGADIYLFSAYKTYGPHQGILLMRRALAELLPAQGHWFNADTLFKRFTPAGPDHAQVAACAGLADYVDALAAHHGAGGAAPLERSRAVHRLMREHEIRLLRPLLDQLAARNDLRLIGPRTPETRAPTVALALDRPVAPVAAALAAHGIMASAGDFYAVRPLEALGIDPARGVLRLSFVHYTSEAEVAQLMLALDAVLGR
>NC_009049.1|WP_011840622.1|828340_829756_+|deoxyribodipyrimidine-photo-lyase
MMADAPLILWFRRDLRLADNPMLAEAAATGRPLIPLFILDPETEALGAAPKWRLGLGVEAFAQALEGLGSRLVLRRGPALAVLKTLVAETGAAGVHWSRLWEPDWRARDEGVTAGLRQAGIEAARHAGHTIFEPREVETGQGGFYRVYTPFWKAVKDRPVAASFPPPARLPSPAEWPVSERLASWDLGRAMNRGAAVVAPHLAVGEAAAAERLARFLSGPLDRYAAERDRPDAPVTSRLSENLTYGEISARSLWHAGMRARAEGRAGAEKFLQELAWREFGWHLLYHTPEIARRNWRGDWDAFPWRGDNPDAERWRRGMTGEPFVDAAMRELFVTGTMHNRARLIAGSYLTKHLLTDWRVGKAWFEDCLIDWDPASNALGWQWVAGSGPDASPYFRIFNPATQAEKFDPESAYRRRFLAEIARRPGPEALAFFEAVPRSWGLRPDRCYPRPVVGLAEGRERALAAYGRRNN
>NC_009049.1|WP_009562946.1|829789_831001_+|class-I-SAM-dependent-methyltransferase
MTALTSTRGQQDLPRYFSQVFDVMQGLRHGRLDFVLDDGRRFRVEGQGPGPVAELDIHDADLFARLIREGDLGFCEAYLDGGWSTPDLQAFMDLIHADNDDVYDGFPGQGLLRAYENLRHWLRGNSKRQARRNIAAHYDLGNDFYALWLDESMTYSSALFRTGQESLEEAQRAKYASMVDRIGAKPGEHVLEIGCGWGGFAEYAARERGLRVTGLTISQAQHDYAVERIARAGLSDRVEIRLQDYRDERGSFDGIASIEMFEAVGEKYWPVYFQTLRERLKPGRNATLQIITVQDKRWEVYRRGVDFIQKYIFPGGMLPSPTALRVEVAKAGLHVTDSVEFGESYSMTLRRWHETFNDRWDRVAALGFDERFRRMWNFYLTSCAGSFDGGNCDVTQITVTRAA
>NC_009049.1|WP_011840623.1|831026_831467_+|tellurite-resistance-protein-TrgA
MPTAAKLVAALAFAALGYLGGRLFAGEVPEGTPTALFGPWGALAGLFCGWAISGARAGRGYWPALGTGVRTVVTGVFLALLGYSLYIMVLRAMRMLYDGPIEALLGVFDLMLDQAQLLARPEILGTLALGGMIAGSLTEWAGRRWK
>NC_009049.1|WP_011840624.1|831466_832552_+|tellurite-resistance-ADP-ribose-pyrophosphatase-TrgB
MRVFLCGPLASDGLRQRVLGSAPDGVTARLADHALGAAGATVSPMPAPGASVAGLVMELDAEAGARLLHYQTATGHEARTLTVAGAPALVFFAPPEGLEPWDEAAWGALWGPIVAATAGDVMALWPEVPAERIARRYRLMLVQGASRVRAAADPGPARRRHAAQPGDVRIVRRSQPYANFFAVEEYDLSFRSFGGGMSPTLNRAVFISGDAVTVVPYDPVRDRVLLIEQFRPGPLGRGDAQPWLLEPIAGRVDPGETPEAAARREAVEEAGLNLGALLPVASYYPTPAAKAEYLYSYVALAQLDDGIEGIFGMEGEGEDIRGHLMSFDEMMALIRSGEICNGPLLLTALWLDRERPRLRGE
>NC_009049.1|WP_002719301.1|832887_833922_+|cysteine-synthase-A
MRIQRDLAEAIGNTPLIRLRKASELTGCEILGKCEFLNPGQSVKDRAALYIIRDAVAKGLLQPGGTIVEGTAGNTGIGLSLVGASMGFRTVIVIPETQSQEKKDMLRLAGAHLVQVPAAPYRNPNNYVRYSGRLAEALARTEERGAIWANQFDNTANRQAHVETTGPEIWEQTDGKVDGFICAVGSGGTLAGVAMALQPRGVKIGLADPEGAALHSFYTEGTFEAPGSSITEGIGQGRITANLEGLTPDFSYRIPDAEALPIIFDLMQEEGLCLGGSSGVNIAGAIRMAREMGPGHRIVTVLCDYGNRYQSKLFNPQFLRDKGLPVPQWLDEAPPAIPAVFEDL
>NC_009049.1|WP_011840625.1|833925_836469_+|mechanosensitive-ion-channel-family-protein
MKALRSMRLWLVWACLACAALHAFAPAPALAQGILGPATSADELAPPDYKQWEKTATRAEREIADRETDSVAYEAMRGYLVEWRDTFLRAQGINASRIASVRGQVDALGPAPAEGATEPDDIAQRRKELTEQLAELRAPVVSAEEAYQRADGLIREIDRVVRERQTQELLRLWPMPLNPANWPAAASETSTLAVDLWNEGATRFGSERARATARDNLPAILGLLVVGLLLIARGRALMERLTQTLQDQASARGRKVGSLLVSLGQIVAPVAGVVAVSHAITLSAMAGPRTTLVIEVLPAISFILYAAGWLAGRVFPKNGLQTSPLNLSEDRRREGRFHTAMFGVVMALDALRTVALPPARVGEAATSVMAFPFIVVAGLLLFRIGQLMLASVRNDLGDDEPSSFRNSVIDLLGRGAIAIGVIAPLLALPGYIAAATALVYPAGLTLGLIGVLFVLQTLVVDLYGLATRNEDGGRDALLPVLIGFLLALALVPLLALVWGARVADLTEIWARFREGYQVGSTRISPTSFLLLAIVFSIGYGITRLLQGALKSQILPKTRLDQGGRNAVVSGVGYLGIILAALVAVNSAGLDLSNLAIVAGALSVGIGFGLQNIVGNFVSGIILLIERPVSEGDWIEVGGVQGTVKSISVRSTRIQTFDRTDVIVPNQDLVAGQVTNWTRYNMTGRLIVPVGVAYGSDTRHVERVLREIAEAQPLAILNPPPSIVFMGFTQEFLSFEIRVILRDVNFSLSVRSDINHMIAKRFAEEGIGLTHIPREIWPAPEPEVENGLTEAEIAALLVVEPPHRPQKDNVPKGTHVVDLHRQTEEEEDADGDGEADAEGASEGTGSTR
>NC_009049.1|WP_011840626.1|836468_837188_+|alanyl-tRNA-editing-protein
MTEPLFRTDPYLREAEARVLGLTPEGGILVDRSIFYATGGGQPGDSGFLDWEGGRIDVATAVKADGGRIALVPAEAGPLPPEGASVRQTLDWERRHRHMRVHTALHLLSVVIPLPVTGGQIGAERGRLDFDMPEPPADPAALEAELNALIARDLAVTEDWITDEELLADPSIVKTMSVMPPTGQGRVRLVRIGQGAEQVDLQPCGGTHVARTGEIGRVLLGKIEKKGRQNRRVTIALAD
>NC_009049.1|WP_011840627.1|837313_838018_-|glycosyltransferase-family-2-protein
MRVACLIPAYNEAARIGAVLAVVRDHPALDRVLVVDDGSTDGTAEVARAAGAEVLALPRNGGKTSAVAAGIAALEARWILMLDSDLQGLDRAAVSALLAPVLCGEAEVAISLRGNAPLLWRLIGLDYISGERVLPRAQIARQGPALAALPRFGLEVFLNRLWIAEGCRVAVVRWPGVASPPKARKRGLWRGIRADLAMLADIFRTIPAPEALHQIRALRRLSRGPLPEPRHQPG
>NC_009049.1|WP_011840628.1|838014_838566_-|VTT-domain-containing-protein
MIEPGTALSLIAAHGIALVAPLALVEGPIVTIIAAWLAQRDLLDLRAVVAVVVLADLVGDALVYAAGRTGGDRVARLLRLRPARVEALALRLRQNAGRLLIGAKLTHAAGAAVLFAAGAARVPFGWFMLCNTAATLPKSLAFVALGWWAGESYDRIGAWILPVSLALILTAGAAVLLARRRCP

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

297942 : 306319

Stx2-converting_phage(16.67%)

portal,tail,head,capsid,protease,terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011840285.1\|297942_299121_+\|portal	phage portal protein	A0A0P0ZDD0	Stx2-converting_phage	3.7e-20	26.4
WP_011840286.1\|299110_299506_+	hypothetical protein	NA	NA	NA	NA
WP_011840287.1\|299505_300012_+\|head,protease	HK97 family phage prohead protease	A0A0U2BX10	Paracoccus_phage	1.4e-21	44.0
WP_160147954.1\|300020_301169_+\|capsid	phage major capsid protein	Q3HQT0	Burkholderia_phage	1.4e-40	31.8
WP_011840289.1\|301181_301559_+	hypothetical protein	NA	NA	NA	NA
WP_011840290.1\|301561_301921_+	HNH endonuclease	B5WZZ4	Pseudomonas_phage	5.8e-17	52.5
WP_011840291.1\|301917_302391_+	hypothetical protein	A0A2H4JDL7	uncultured_Caudovirales_phage	1.4e-10	30.3
WP_011840292.1\|302395_302824_+	hypothetical protein	NA	NA	NA	NA
WP_011840293.1\|302820_303135_+\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
WP_011840294.1\|303134_303548_+	HK97 gp10 family phage protein	NA	NA	NA	NA
WP_002720361.1\|303544_303958_+	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_160147955.1\|303954_304281_+\|head	phage head closure protein	NA	NA	NA	NA
WP_011840296.1\|304280_304715_+\|terminase	phage terminase small subunit P27 family	NA	NA	NA	NA
WP_011840297.1\|304711_306319_+\|terminase	terminase large subunit	A0A2K5B285	Erysipelothrix_phage	8.0e-74	35.0

DBSCAN-SWA_2

454597 : 463647

uncultured_Mediterranean_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011840358.1\|454597_456820_+	cadmium-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	9.8e-115	41.3
WP_009563714.1\|456943_457465_-	single-stranded DNA-binding protein	A0A0U2C0X4	Paracoccus_phage	4.6e-47	77.6
WP_011840359.1\|457678_458293_+	lytic transglycosylase domain-containing protein	A0A0S2SXL7	Bacillus_phage	3.8e-24	45.3
WP_011840360.1\|458416_459709_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	9.5e-94	45.8
WP_011840361.1\|459815_460373_-	superoxide dismutase family protein	NA	NA	NA	NA
WP_002722646.1\|460656_460983_+	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	4.3e-19	54.4
WP_002722648.1\|460998_462663_+	protein translocase subunit SecD	NA	NA	NA	NA
WP_011840362.1\|462672_463647_+	protein translocase subunit SecF	A0A1B1IVP7	uncultured_Mediterranean_phage	1.0e-52	42.3

DBSCAN-SWA_3

631162 : 666036

Paracoccus_phage(33.33%)

portal,tail,head,transposase,capsid,protease,integrase,terminase

attL 630769:630785|attR 667927:667943

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
630769:630785	attL	NA	NA	NA	NA
WP_043827916.1\|631162_631681_-\|transposase	transposase	NA	NA	NA	NA
WP_080517258.1\|631814_632021_+	hypothetical protein	NA	NA	NA	NA
WP_037087394.1\|632298_632751_+	hypothetical protein	NA	NA	NA	NA
WP_011840470.1\|633113_633344_-	hypothetical protein	NA	NA	NA	NA
WP_011840471.1\|633616_633934_+\|transposase	transposase	NA	NA	NA	NA
WP_011840472.1\|635013_635415_+	hypothetical protein	NA	NA	NA	NA
WP_011840473.1\|635407_636598_+	HlyD family secretion protein	NA	NA	NA	NA
WP_160147961.1\|637254_638001_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_160147962.1\|638215_638527_-	hypothetical protein	NA	NA	NA	NA
WP_011840476.1\|639255_640191_-	glycoside hydrolase family 16 protein	NA	NA	NA	NA
WP_011840477.1\|640204_642115_-	hypothetical protein	NA	NA	NA	NA
WP_160147988.1\|642107_642539_-	collagen-like protein	NA	NA	NA	NA
WP_011840479.1\|642772_643204_-	hypothetical protein	NA	NA	NA	NA
WP_043827922.1\|643339_643567_-	hypothetical protein	NA	NA	NA	NA
WP_043827923.1\|643563_643761_-	hypothetical protein	NA	NA	NA	NA
WP_011840480.1\|643762_644392_-	lysozyme	F8TV87	EBPR_siphovirus	5.7e-36	51.0
WP_160147963.1\|644453_644732_-	hypothetical protein	NA	NA	NA	NA
WP_011840482.1\|644766_645222_-	hypothetical protein	NA	NA	NA	NA
WP_011840483.1\|645218_645578_-	hypothetical protein	NA	NA	NA	NA
WP_049763372.1\|646086_649758_-	hypothetical protein	A0A0U2C146	Paracoccus_phage	5.4e-94	36.7
WP_011840486.1\|649852_650266_-	hypothetical protein	NA	NA	NA	NA
WP_011840487.1\|650262_650877_-	hypothetical protein	NA	NA	NA	NA
WP_011840488.1\|650873_651479_-	hypothetical protein	NA	NA	NA	NA
WP_011840489.1\|651479_653555_-	hypothetical protein	A0A0U4JEA4	Pseudomonas_phage	3.0e-49	52.9
WP_043827929.1\|653876_654215_-	hypothetical protein	NA	NA	NA	NA
WP_011840492.1\|654214_654643_-	hypothetical protein	NA	NA	NA	NA
WP_011840493.1\|654632_655025_-	hypothetical protein	NA	NA	NA	NA
WP_043827932.1\|655024_655204_-	hypothetical protein	NA	NA	NA	NA
WP_011840494.1\|655207_655672_-	HK97 gp10 family phage protein	A0A0U2C0P4	Paracoccus_phage	4.1e-23	42.5
WP_011840495.1\|655668_655992_-\|head,tail	head-tail adaptor protein	A0A0U2BXJ0	Paracoccus_phage	1.2e-21	52.9
WP_011840496.1\|655991_656528_-	hypothetical protein	I3UM02	Rhodobacter_phage	1.6e-07	28.9
WP_160147964.1\|656524_656695_-	hypothetical protein	NA	NA	NA	NA
WP_011840497.1\|656749_657961_-\|capsid	phage major capsid protein	A0A0U4JIW8	Pseudomonas_phage	4.8e-140	66.7
WP_011840498.1\|657985_658834_-\|protease	Clp protease ClpP	A0A0U4B0J0	Pseudomonas_phage	8.5e-75	58.2
WP_011840499.1\|658830_660036_-\|portal	phage portal protein	M4QP41	Tetraselmis_viridis_virus	1.1e-70	37.3
WP_043827935.1\|660035_661835_-\|terminase	terminase large subunit	A0A0U2C138	Paracoccus_phage	4.0e-191	58.8
WP_011840501.1\|661791_662277_-\|terminase	phage terminase small subunit P27 family	Q6DMU4	Streptococcus_phage	3.2e-26	45.0
WP_011840502.1\|662364_662586_+	hypothetical protein	NA	NA	NA	NA
WP_011840503.1\|662632_662851_+	hypothetical protein	NA	NA	NA	NA
WP_011840504.1\|662919_663087_+	hypothetical protein	NA	NA	NA	NA
WP_011840505.1\|663083_663275_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_011840506.1\|663271_663949_+	hypothetical protein	A0A142KC03	Gordonia_phage	4.6e-23	37.5
WP_160147989.1\|663945_664137_-	hypothetical protein	K4I1E3	Acidithiobacillus_phage	2.2e-07	57.6
WP_080517330.1\|664136_665513_-	site-specific DNA-methyltransferase	A0A2H4JGF1	uncultured_Caudovirales_phage	3.4e-105	48.4
WP_080517260.1\|665673_666036_-	HNH endonuclease	A0A0U2C119	Paracoccus_phage	3.5e-22	58.2
667927:667943	attR	NA	NA	NA	NA

DBSCAN-SWA_4

1116608 : 1187240

Paracoccus_phage(23.53%)

portal,tail,head,protease,capsid

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002719573.1\|1116608_1117334_+\|protease	proteasome-type protease	NA	NA	NA	NA
WP_011840790.1\|1117323_1118277_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_002719575.1\|1118273_1118558_-	SCP2 sterol-binding domain-containing protein	NA	NA	NA	NA
WP_037086838.1\|1118666_1119206_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_002719578.1\|1122110_1122407_+	RNA-binding S4 domain-containing protein	NA	NA	NA	NA
WP_002719579.1\|1122461_1122800_+	ferredoxin family protein	NA	NA	NA	NA
WP_002719580.1\|1123079_1123589_+	CarD family transcriptional regulator	NA	NA	NA	NA
WP_011840793.1\|1123777_1124527_-	adenosylcobinamide-GDP ribazoletransferase	NA	NA	NA	NA
WP_011840794.1\|1124608_1125625_+	nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase	NA	NA	NA	NA
WP_002719583.1\|1125680_1127549_-	cation:proton antiporter	NA	NA	NA	NA
WP_011840795.1\|1127723_1130600_-	hypothetical protein	NA	NA	NA	NA
WP_002719585.1\|1130763_1131456_+	SIMPL domain-containing protein	NA	NA	NA	NA
WP_011840796.1\|1131501_1132794_-	O-acetylhomoserine aminocarboxypropyltransferase/cysteine synthase	NA	NA	NA	NA
WP_011840797.1\|1133039_1133387_-	hypothetical protein	NA	NA	NA	NA
WP_002719588.1\|1133383_1133770_-	response regulator	Q56AR1	Bacillus_thuringiensis_phage	2.6e-07	33.1
WP_011840799.1\|1133747_1134665_-	protein-glutamate O-methyltransferase	NA	NA	NA	NA
WP_011337487.1\|1134661_1135120_-	chemotaxis protein CheW	NA	NA	NA	NA
WP_011840800.1\|1135121_1137182_-	chemotaxis protein CheA	NA	NA	NA	NA
WP_002719592.1\|1137189_1137558_-	response regulator	Q56AR1	Bacillus_thuringiensis_phage	1.7e-11	35.3
WP_011337490.1\|1137548_1137833_-	STAS domain-containing protein	NA	NA	NA	NA
WP_160476486.1\|1137829_1138252_-	chemotaxis protein CheD	NA	NA	NA	NA
WP_011840802.1\|1138486_1140865_-	chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	6.0e-09	62.7
WP_011840803.1\|1140971_1142759_-	hypothetical protein	NA	NA	NA	NA
WP_011337494.1\|1142862_1144545_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	3.9e-07	31.4
WP_002719598.1\|1144633_1145002_-	response regulator	Q56AR1	Bacillus_thuringiensis_phage	1.5e-12	38.5
WP_011337495.1\|1144998_1145328_-	STAS domain-containing protein	NA	NA	NA	NA
WP_049763387.1\|1145660_1147613_+	alpha-1,4-glucan--maltose-1-phosphate maltosyltransferase	NA	NA	NA	NA
WP_011840806.1\|1147609_1150918_+	maltose alpha-D-glucosyltransferase	NA	NA	NA	NA
WP_011840807.1\|1150914_1153101_+	1,4-alpha-glucan branching protein GlgB	NA	NA	NA	NA
WP_011840808.1\|1153097_1155164_+	glycogen debranching protein GlgX	NA	NA	NA	NA
WP_011840809.1\|1155160_1156939_+	malto-oligosyltrehalose trehalohydrolase	NA	NA	NA	NA
WP_011840810.1\|1156935_1158753_+	4-alpha-glucanotransferase	NA	NA	NA	NA
WP_011840811.1\|1158749_1161365_+	malto-oligosyltrehalose synthase	NA	NA	NA	NA
WP_011840812.1\|1161423_1162089_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_011840813.1\|1162209_1163673_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	8.9e-48	32.0
WP_002719609.1\|1163757_1164372_-	CvpA family protein	NA	NA	NA	NA
WP_011840814.1\|1164390_1165749_-	DNA repair protein RadA	NA	NA	NA	NA
WP_011840815.1\|1165921_1166347_-	paraquat-inducible protein A	NA	NA	NA	NA
WP_002719612.1\|1166347_1167094_-	ATP-binding cassette domain-containing protein	F2Y1V5	Organic_Lake_phycodnavirus	8.7e-07	25.6
WP_002719613.1\|1167090_1167873_-	ABC transporter permease	NA	NA	NA	NA
WP_009564494.1\|1167869_1168919_-	alanine racemase	NA	NA	NA	NA
WP_011840816.1\|1169147_1169885_+	3-oxoacyl-ACP reductase FabG	NA	NA	NA	NA
WP_002719616.1\|1170063_1170297_+	acyl carrier protein	I1TR04	Pseudomonas_phage	7.3e-05	43.9
WP_011840817.1\|1170793_1172056_+	beta-ketoacyl-ACP synthase II	NA	NA	NA	NA
WP_011840818.1\|1172055_1173234_+	endolytic transglycosylase MltG	NA	NA	NA	NA
WP_011840819.1\|1173305_1173749_+	hypothetical protein	NA	NA	NA	NA
WP_043828264.1\|1173741_1175040_+	DNA-packaging protein	A0A0K1LMR9	Caulobacter_phage	1.3e-71	41.7
WP_011840820.1\|1175112_1176285_+\|portal	phage portal protein	W8ECU7	Geobacillus_phage	1.5e-58	38.4
WP_002719622.1\|1176286_1176520_+	hypothetical protein	NA	NA	NA	NA
WP_002719623.1\|1176530_1177088_+\|head,protease	HK97 family phage prohead protease	A0A0U2BX10	Paracoccus_phage	1.1e-30	49.3
WP_043828013.1\|1177153_1178350_+\|capsid	phage major capsid protein	B0VK33	Azospirillum_phage	3.0e-62	41.9
WP_011840823.1\|1178444_1179044_+	hypothetical protein	NA	NA	NA	NA
WP_011840824.1\|1179043_1179379_+\|head,tail	head-tail adaptor protein	NA	NA	NA	NA
WP_011840825.1\|1179375_1179774_+	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_011840826.1\|1179811_1180225_+\|tail	phage major tail protein, TP901-1 family	NA	NA	NA	NA
WP_002719629.1\|1180224_1180542_+	gene transfer agent family protein	NA	NA	NA	NA
WP_011840827.1\|1180543_1180744_+\|tail	phage tail assembly chaperone	NA	NA	NA	NA
WP_011840828.1\|1180736_1181387_+\|tail	phage tail tape measure protein	D6PFD6	uncultured_phage	6.0e-12	29.3
WP_011840829.1\|1181396_1182029_+	DUF2460 domain-containing protein	A0A0B5A2K3	Paracoccus_phage	6.1e-62	51.9
WP_011840830.1\|1182028_1182913_+	DUF2163 domain-containing protein	A0A0B5A5B8	Paracoccus_phage	1.2e-60	43.3
WP_011840831.1\|1182909_1183350_+	peptidase	A0A1V0DYB6	Dinoroseobacter_phage	2.0e-27	47.1
WP_011840832.1\|1183349_1187240_+	glycoside hydrolase TIM-barrel-like domain-containing protein	A0A0B5A7K5	Paracoccus_phage	1.1e-222	39.4

DBSCAN-SWA_5

2117281 : 2152241

Burkholderia_phage(25.0%)

transposase,protease,integrase

attL 2132997:2133013|attR 2162626:2162642

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_043828108.1\|2117281_2118763_-\|protease	DegQ family serine endoprotease	A0A1B1IT49	uncultured_Mediterranean_phage	1.1e-26	28.7
WP_011841371.1\|2118915_2119938_-\|protease	protease modulator HflC	NA	NA	NA	NA
WP_009565600.1\|2119937_2121119_-\|protease	FtsH protease activity modulator HflK	NA	NA	NA	NA
WP_011841372.1\|2121174_2122533_-	glutathione-disulfide reductase	NA	NA	NA	NA
WP_011841373.1\|2122537_2123326_-	ribose-5-phosphate isomerase RpiA	NA	NA	NA	NA
WP_011841375.1\|2123970_2125350_+	L-serine ammonia-lyase	NA	NA	NA	NA
WP_011841376.1\|2125718_2126642_+	DMT family transporter	NA	NA	NA	NA
WP_011841377.1\|2126583_2127282_-	thiamine diphosphokinase	NA	NA	NA	NA
WP_043828110.1\|2127423_2128311_+	hypothetical protein	NA	NA	NA	NA
WP_011841379.1\|2128317_2128560_-	DUF2842 domain-containing protein	NA	NA	NA	NA
WP_011841380.1\|2128639_2129932_-	adenylosuccinate synthase	A0A291AUF9	Pandoravirus	2.1e-53	31.6
WP_015920909.1\|2129947_2130178_+	hypothetical protein	NA	NA	NA	NA
WP_011841381.1\|2130242_2130854_+	preprotein translocase subunit SecG	NA	NA	NA	NA
WP_002720532.1\|2131016_2132660_+	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	7.4e-152	48.6
WP_011841382.1\|2132838_2133621_+	23S rRNA (adenine(2030)-N(6))-methyltransferase RlmJ	NA	NA	NA	NA
2132997:2133013	attL	NA	NA	NA	NA
WP_011841383.1\|2133698_2134136_+	TerB family tellurite resistance protein	NA	NA	NA	NA
WP_011338188.1\|2134299_2135097_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.1e-28	37.6
WP_002720536.1\|2135139_2135865_+	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_002720537.1\|2135904_2136786_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_011841384.1\|2136782_2137610_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_002720539.1\|2137614_2138952_+	glutamine synthetase	NA	NA	NA	NA
WP_011841385.1\|2139011_2139689_+	type 1 glutamine amidotransferase	NA	NA	NA	NA
WP_011841386.1\|2139804_2140068_-	pyocin activator PrtN family protein	I6NSR8	Burkholderia_phage	1.1e-17	52.9
WP_080517306.1\|2140137_2140290_-	S26 family signal peptidase	NA	NA	NA	NA
WP_080517338.1\|2140291_2140618_-	HNH endonuclease	A0A291AY26	Shigella_phage	3.3e-19	51.6
WP_011841388.1\|2140599_2141421_-\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_011841389.1\|2141417_2141735_-\|transposase	transposase	NA	NA	NA	NA
WP_160147979.1\|2141619_2141847_-	HNH endonuclease	NA	NA	NA	NA
WP_162470176.1\|2141768_2141981_-	hypothetical protein	NA	NA	NA	NA
WP_160147980.1\|2142048_2142933_-	hypothetical protein	NA	NA	NA	NA
WP_011841390.1\|2144900_2145833_+	DUF2971 domain-containing protein	NA	NA	NA	NA
WP_160147981.1\|2146198_2146657_+	hypothetical protein	NA	NA	NA	NA
WP_160147982.1\|2146680_2146887_+	hypothetical protein	NA	NA	NA	NA
WP_011841391.1\|2147150_2147708_-	recombinase family protein	M9Q1K0	Clostridium_phage	7.8e-29	43.2
WP_160147983.1\|2148026_2148893_+	DUF1837 domain-containing protein	NA	NA	NA	NA
WP_011841393.1\|2148889_2151025_+	helicase domain-containing protein	NA	NA	NA	NA
WP_011841394.1\|2151143_2152241_-\|integrase	site-specific integrase	I6NSG1	Burkholderia_phage	3.5e-81	43.8
2162626:2162642	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NC_009040

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_009040_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_009040_1

21527-21605

Orphan

Consensus_repeat	Method
TTGTTTCGCGCGCGAAACAAATC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_009040_1

>merge|NC_009040|1|21527-21605|CRISPRCasFinder
TTGTTTCGCGCGCGAAACAAATCGGGGGGTCGGCAGGGCGGCACGGCGGGGGCAAATTGTTTCGCGCGCGAAACAAATC

>NC_009040|1|1|21527-21605|CRISPRCasFinder
TTGTTTCGCGCGCGAAACAAATC	GGGGGGTCGGCAGGGCGGCACGGCGGGGGCAAA
TTGTTTCGCGCGCGAAACAAATC

Protein	Signature genes	Signature genes Name	Protein_function
NC_009040.1\|WP_002724812.1\|14004_14895_-\|glucose-1-phosphate-thymidylyltransferase-RfbA	unknown	unknown	gnl\|CDD\|130274
NC_009040.1\|WP_011840034.1\|21635_22742_+\|ParB-N-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|274586
NC_009040.1\|WP_011840033.1\|20056_21511_+\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|274585
NC_009040.1\|WP_011840031.1\|14891_15743_-\|dTDP-4-dehydrorhamnose-reductase	unknown	unknown	gnl\|CDD\|367904
NC_009040.1\|WP_011840040.1\|33434_34376_+\|calcium-binding-protein	unknown	unknown	gnl\|CDD\|380205
NC_009040.1\|WP_011840038.1\|29990_31349_-\|sulfotransferase	unknown	unknown	gnl\|CDD\|226081
NC_009040.1\|WP_002724637.1\|11117_11954_-\|3-deoxy-8-phosphooctulonate-synthase	unknown	unknown	gnl\|CDD\|235363
NC_009040.1\|WP_011840030.1\|13247_14030_+\|sulfotransferase	unknown	unknown	gnl\|CDD\|366246
NC_009040.1\|WP_009565051.1\|28840_29833_+\|hypothetical-protein	unknown	unknown	unknown
NC_009040.1\|WP_011836184.1\|12155_12881_+\|sulfotransferase	unknown	unknown	gnl\|CDD\|379204
NC_009040.1\|WP_002724808.1\|15739_16780_-\|dTDP-glucose-4,6-dehydratase	unknown	unknown	gnl\|CDD\|224013
NC_009040.1\|WP_002724803.1\|18400_19363_-\|replication-initiator-protein-A	unknown	unknown	gnl\|CDD\|370826
NC_009040.1\|WP_011840036.1\|23867_25007_-\|sugar-transporter	unknown	unknown	gnl\|CDD\|226055
NC_009040.1\|WP_011840037.1\|26584_28840_+\|glycoside-hydrolase-family-99-like-domain-containing-protein	unknown	unknown	gnl\|CDD\|379549
NC_009040.1\|WP_002724798.1\|25720_26521_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224596
NC_009040.1\|WP_011840032.1\|16783_17347_-\|dTDP-4-dehydrorhamnose-3,5-epimerase	unknown	unknown	gnl\|CDD\|376414
NC_009040.1\|WP_011840035.1\|23041_23851_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213187
NC_009040.1\|WP_009565056.1\|34491_35799_+\|hypothetical-protein	unknown	unknown	unknown
NC_009040.1\|WP_002724804.1\|17410_18349_-\|glycosyltransferase	unknown	unknown	gnl\|CDD\|133039
NC_009040.1\|WP_011840039.1\|31951_33253_+\|DUF2793-domain-containing-protein	unknown	unknown	gnl\|CDD\|371324

Protein	Function_ID	Function_description	E-value
NC_009040.1\|WP_002724812.1\|14004_14895_-\|glucose-1-phosphate-thymidylyltransferase-RfbA	gnl\|CDD\|130274	TIGR01207, Glucose-1-phosphate_thymidylyltransferase_1, glucose-1-phosphate thymidylyltransferase, short form. Alternate name: dTDP-D-glucose synthase homotetramer This model describes a tightly conserved but broadly distributed subfamily (here designated as short form) of known and putative bacterial glucose-1-phosphate thymidylyltransferases. It is well characterized in several species as the first of four enzymes involved in the biosynthesis of dTDP-L-rhamnose, a cell wall constituent and a feedback inhibitor of the enzyme. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides].	2.32712e-162
NC_009040.1\|WP_011840034.1\|21635_22742_+\|ParB-N-terminal-domain-containing-protein	gnl\|CDD\|274586	TIGR03454, partition_RepB, plasmid partitioning protein RepB. Members of this family are the RepB protein involved in replicon partitioning. RepB is found, in general, as part of a repABC operon in plasmids and small chromosomes, separate from the main chromosome, in various bacteria. This model describes a rather narrow clade of proteins; it should be noted that additional homologs scoring below the trusted cutoff have very similar functions, although they may be named differently. [Mobile and extrachromosomal element functions, Plasmid functions].	5.31068e-11
NC_009040.1\|WP_011840033.1\|20056_21511_+\|AAA-family-ATPase	gnl\|CDD\|274585	TIGR03453, partition_RepA, plasmid partitioning protein RepA. Members of this family are the RepA (or ParA) protein involved in replicon partitioning. All known examples occur in bacterial species with two or more replicons, on a plasmid or the smaller chromosome. Note that an apparent exception may be seen as a pseudomolecule from assembly of an incompletely sequenced genome. Members of this family belong to a larger family that also includes the enzyme cobyrinic acid a,c-diamide synthase, but assignment of that name to members of this family would be in error. [Mobile and extrachromosomal element functions, Plasmid functions].	3.48216e-59
NC_009040.1\|WP_011840031.1\|14891_15743_-\|dTDP-4-dehydrorhamnose-reductase	gnl\|CDD\|367904	pfam04321, RmlD_sub_bind, RmlD substrate binding domain. L-rhamnose is a saccharide required for the virulence of some bacteria. Its precursor, dTDP-L-rhamnose, is synthesized by four different enzymes the final one of which is RmlD. The RmlD substrate binding domain is responsible for binding a sugar nucleotide.	7.61692e-122
NC_009040.1\|WP_011840040.1\|33434_34376_+\|calcium-binding-protein	gnl\|CDD\|380205	NF033203, entero_EhxA, enterohemolysin EhxA. Members of this family are the RTX toxin called enterohemolysin or EhxA, because it is found in enterohemorrhagic Escherichia coli (EHEC) strains such as O157:H7.	9.98636e-15
NC_009040.1\|WP_002724637.1\|11117_11954_-\|3-deoxy-8-phosphooctulonate-synthase	gnl\|CDD\|235363	PRK05198, PRK05198, 2-dehydro-3-deoxyphosphooctonate aldolase; Provisional.	0
NC_009040.1\|WP_011840030.1\|13247_14030_+\|sulfotransferase	gnl\|CDD\|366246	pfam00685, Sulfotransfer_1, Sulfotransferase domain.	1.08511e-10
NC_009040.1\|WP_011840038.1\|29990_31349_-\|sulfotransferase	gnl\|CDD\|226081	COG3551, COG3551, Uncharacterized protein conserved in bacteria [Function unknown].	1.26428e-49
NC_009040.1\|WP_011836184.1\|12155_12881_+\|sulfotransferase	gnl\|CDD\|379204	pfam13469, Sulfotransfer_3, Sulfotransferase family.	2.53227e-11
NC_009040.1\|WP_002724808.1\|15739_16780_-\|dTDP-glucose-4,6-dehydratase	gnl\|CDD\|224013	COG1088, RfbB, dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane].	0
NC_009040.1\|WP_002724803.1\|18400_19363_-\|replication-initiator-protein-A	gnl\|CDD\|370826	pfam10134, RPA, Replication initiator protein A. Members of this family of bacterial proteins are single-stranded DNA binding proteins that are involved in DNA replication, repair and recombination.	2.32126e-121
NC_009040.1\|WP_011840036.1\|23867_25007_-\|sugar-transporter	gnl\|CDD\|226055	COG3524, KpsE, Capsule polysaccharide export protein [Cell envelope biogenesis, outer membrane].	1.23505e-72
NC_009040.1\|WP_011840037.1\|26584_28840_+\|glycoside-hydrolase-family-99-like-domain-containing-protein	gnl\|CDD\|379549	pfam14307, Glyco_tran_WbsX, Glycosyltransferase WbsX. Members of this family are found in within O-antigen biosynthesis clusters in Gram negative bacteria, where they are predicted to function as glycosyltransferases.	9.66467e-151
NC_009040.1\|WP_002724798.1\|25720_26521_+\|ABC-transporter-permease	gnl\|CDD\|224596	COG1682, TagG, ABC-type polysaccharide/polyol phosphate export systems, permease component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane].	2.5419e-33
NC_009040.1\|WP_011840032.1\|16783_17347_-\|dTDP-4-dehydrorhamnose-3,5-epimerase	gnl\|CDD\|376414	pfam00908, dTDP_sugar_isom, dTDP-4-dehydrorhamnose 3,5-epimerase. This family catalyze the isomerisation of dTDP-4-dehydro-6-deoxy -D-glucose with dTDP-4-dehydro-6-deoxy-L-mannose. The EC number of this enzyme is 5.1.3.13.	3.65992e-99
NC_009040.1\|WP_011840035.1\|23041_23851_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|213187	cd03220, ABC_KpsT_Wzt, ATP-binding cassette component of polysaccharide transport system. The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export. Among the variety of membrane-linked or extracellular polysaccharides excreted by bacteria, only capsular polysaccharides, lipopolysaccharides, and teichoic acids have been shown to be exported by ABC transporters. A typical system is made of a conserved integral membrane and an ABC. In addition to these proteins, capsular polysaccharide exporter systems require two 'accessory' proteins to perform their function: a periplasmic (E.coli) or a lipid-anchored outer membrane protein called OMA (Neisseria meningitidis and Haemophilus influenza) and a cytoplasmic membrane protein MPA2.	1.03099e-89
NC_009040.1\|WP_002724804.1\|17410_18349_-\|glycosyltransferase	gnl\|CDD\|133039	cd04196, GT_2_like_d, Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.	3.06441e-72
NC_009040.1\|WP_011840039.1\|31951_33253_+\|DUF2793-domain-containing-protein	gnl\|CDD\|371324	pfam10983, DUF2793, Protein of unknown function (DUF2793). This is a bacterial family of proteins with unknown function.	4.53158e-32

>NC_009040.1|WP_011840033.1|20056_21511_+|AAA-family-ATPase
MAETRGRKTAGRGRVEMRKSPPAREPQVPLPPYFNISPDAALAELEAPLTTGGFAEIARSCAQGRDDLAARGLDAEGRRSLRLFSTWEITRYLIPVATAHFRRVLKANPDLPQGVSETEGGAKWFTLDEVLRLRAHFAAEGSKAKEYRPYRPAGLPAKLVAVANFKGGVGKTSTAAHLAMSAALDGYRVLVIDLDSQGSMTSIFGGRVADEWGTVFPLLARHYAAHLQAENRARVARGDPPVPMDETLTEAQKIRAGDLIAKTHWPNIDLIGAQLNLYWAEFQIPVWRMQGRSWKLWDALTDVLAEDGVLDRYDVIFLDTPPALGYLTINGLAAADILLVPLGASFLEFDSTGRFFDMLHSTFRSIEEGENIAARALGREELAFEWDAVRAVLTRYDGAQQAEMAALMQAYMGRTMAPERQDFTALIGQAGEQVNGIYEADYRDFNRDTYIRGRETFDATYAAFKRLLVGIWRREELAAVDAAE
>NC_009040.1|WP_002724803.1|18400_19363_-|replication-initiator-protein-A
MADFFICDILDALPKDDMASMEHPVFSLATRPDLRVLDYAHNGVRITVTPSVRGLATLFDKDILIYCVSQLMAALNAGRAISRTLHLTAHDLMTATHRETSGDGYQRLREAFERLAGTRITTNMEVGGREITTGFGLIESWQIVRRSRGGRMVQVMVTLSEWLFQAVLTKSVLTLSRDYFRLRKPLERRIYELARKHCGQQPEWRVSIATLAKKSGSASPLRVFRKMIRDMIAADSLPGYSLAEEPGDLLCVTRRAAVLAPGLAPALRDTTLERVRARMPGWDVHALVAEWHAFWHSSGQPRLRSADAAFLGWIERRVPG
>NC_009040.1|WP_002724804.1|17410_18349_-|glycosyltransferase
MTDAPPPRIALLLATYNGAANLEAQLESFAAQTLRPTWLVVSDDGSTDATRALLAAFAARHPWLALRLVEGPCRGSAQNFLHLLGQVPPEADMAALSDQDDVWLPEKLARGAAAMADLPADLPVLYGGSSWICDAELGNRRPYPLPVRPPGFRHALVQNIAGGNTMMLNRGAIALLAAASREPERIVVHDWWIYQIVSGAGGRVIFDPVPLLLYRQHGGNLIGANDGFRAKYRRLRMLLSGGFRQWNAINIRALSASAHRFTPENRRLLAEFEALRRAGPWGRLRQLKRIGLYRQGLPGRLSLWLAAVLGRI
>NC_009040.1|WP_011840032.1|16783_17347_-|dTDP-4-dehydrorhamnose-3,5-epimerase
MQIEETELPGVLILTPRVFGDARGSFCEAWNRATLQGLGIDLDFVQDNQSISAPVGTVRGLHYQAPPHAQDKLVRVGHGAILDVAVDVRVGSPTYGRWVGVELTAGNARQLLVPKGFLHGFVTREPDTVVLYKTTDVYAPDCDGAVHFADPDLGIDWGIDPASAVLSDKDARAPRFADWTSPFSIEA
>NC_009040.1|WP_002724808.1|15739_16780_-|dTDP-glucose-4,6-dehydratase
MKLIVTGGAGFIGSAVVRKAVADGHHVVNLDCLTYAACLDNLASVAGAPNYVFEKADIRDAEAMARVFATHRPDAVMHLAAESHVDRSIDGPGAFIDTNVRGTYVLLEAARAYWVGQGRPEGFRFHHISTDEVFGTLGETGQFTEETPYAPNSPYSASKAASDHLVRAWGETYGLPYVLTNCSNNYGPFHFPEKLIPVVILKALAGAPIPVYGKGENVRDWLYVEDHADALLTVLARGENHRSYNIGGENEAKNIDIVRKICAILDARRPKATPYADQIAFVTDRPGHDLRYAIDPTRIRTELGWRPSVTLDEGLERTVDWYLANEPWWRALQDRAGVGERLGVKA
>NC_009040.1|WP_011840031.1|14891_15743_-|dTDP-4-dehydrorhamnose-reductase
MILVFGRTGQVARELARQAPDARFLGRDEADLADPEACARAIREAKPDAAINAAAWTAVDRAEEEEAPATVVNGEAPGAMARACAALGIPFVQISTDYVFDGSGTRPWQPGDPVGPLGAYGRSKLAGEEAVRAAGGPHAILRTSWVFSAHGANFVKTMLRLGATRDRLTVVCDQVGGPTPAADIAAACLAMARGLAARPDLSGTYHLSGGPDVSWADFAREIFRQAELDCLVADIASADYPQKAHRPANSRMDCSDLARFGLTRPDWRQGLARVLADLQEVSE
>NC_009040.1|WP_002724812.1|14004_14895_-|glucose-1-phosphate-thymidylyltransferase-RfbA
MSVRKGIILAGGSGTRLYPLTIGVSKQLMPVYDKPMIYYPLSVLMLAGIREIAIITTPQDQEQFRRALGTGAQWGISLTYLVQPRPEGLAQAYTIAEEFLAGSPSCMVLGDNIFFGHGLPDLLALADAKTEGGTVFGYHVADPERYGVVAMDERGRVTQIVEKPKVAPSNYAVTGIYFLDARAPDLVHGIRPSERGELEIVSLLEIYLEEGLLDVQRMGRGFAWLDTGTHASLLDAGNFVRTLQLRQGMQTGCPEEIAFARGWVDAEALTGMAAQLSKNDYGRYLQGLLTDRMMEG
>NC_009040.1|WP_011840030.1|13247_14030_+|sulfotransferase
MRAASPQVRFLVAGAQKCGTTALHRFLSAHPGLFLPAGKELHFFDRPLPDDWSGPEGPLYETAFAEARPDQLCGEATPVYLFHTPSLQRIRAYNPAMRLILLLRDPVLRAYSHWRMERTRGAETLPFPEAIRAGRARVAEDWRTFSYVERGFYGAQLTRLERLFPREQRLVLWTDEMQRDHAGTLARIWRFLGCAAPSVPPPPAEIRPLDPAPGLAPLAEEDARYLRSLYAPDIALTEALTGRDLSLWREGALSPPSSGR
>NC_009040.1|WP_011836184.1|12155_12881_+|sulfotransferase
MDRDLPETPALVLGASGGSGTRVAGQLLRAAGGYLGGARNEAGDSLALVAAIEALAARGARLLEGGRPEEADLALWRAALTEHLALHAGEPFWGWKNPRSMFLLPFSVALVPGLRFIHMVRDGRDMALSGNRRQYERHVPEGPGTPADRARFWAESNLRVKRHAEAVLGDRYAILRFEDLCRDPEGCMARLGRQFGLRLEPAGTGIEVRPPDGVGRHRALPAADRAAVEAAAAPAMEAFGY
>NC_009040.1|WP_002724637.1|11117_11954_-|3-deoxy-8-phosphooctulonate-synthase
MTETPTIVTIGDIAIGGGHPIALITGPCQLESLDHARMMAERIAEACAPTGTKFIFKASYDKANRSSLSTARGLGMEKGLEILGRIREEFGVPVLTDVHEPGHCATAAEVCDVLQIPAFLCRQTDLLLAAGETGRAVNVKKGQFLAPWDMKNVADKVASTGNRRILLCERGTSFGYNTLVTDFRGLPTMAATGWPVVFDATHSVQQPGGLGGSSGGQREFAPVLARAACAVGVSALFIETHEDPDRAPSDGPNMIPVDRMGRLIADLCAFDALAKSLA
>NC_009040.1|WP_011840034.1|21635_22742_+|ParB-N-terminal-domain-containing-protein
MAKRKRLTLPPLGGFAPGPASASEASPAPASAAALGPGLAPAPISRVTGEAAATAALREVAEELGAARSEGRLVLRLELDRIEEGWLVRDRIGLEAEELASLMTSLAAHGQRSPIEVTDMGEGRFGLISGWRRVTALRRLHAETGEERFATVLALLRRPDTAAAAYVAMVEENEIRAGLSYFERARIAAKAVEAGVFATDKLALQQLYGSASRAKRSKIGSFLGIYRALEGALRYPSALPERLGLALARRLEEEAAFAAEVAAALAAAVPDSAEAELALIADLLAPAAEAAPEQEPARPSAPDPAPEAPAPVPASAPAARPARPQAPAAELRPGLFLKADGAGSLHLYGPAVDEAFRARLRDWLASEG
>NC_009040.1|WP_011840035.1|23041_23851_-|ABC-transporter-ATP-binding-protein
MIELRNVSKSYVLNGTRKVVARDLNFTFPSGESVGLLGRNGAGKSSLLRMLAGTMLPDTGEILSSGTISWPVGFSGSFHPELTGAQNVRFVARLYGVDTEAMIAFVRDFAEIGQHFHLPVRSYSSGMRSRLAFGISMAVPFDTYLIDEVTAVGDAAFSAKSNAILRARLEESGAVIVSHSMPLLKKLCRSGAVLHDGQLFYYERIEQAIRHHESMMRGALPRWMRGDLDEGEGGDAGAAAPGPRARAARAGGGRAARPGPASGTSEPQG
>NC_009040.1|WP_011840036.1|23867_25007_-|sugar-transporter
MPAAAPRAAARLRHHGLLASFLGLVLAPTLASGLYLFAIAEDQYTSTVGFSVRTEEMGSALDLLGGLSSFGLTGGGSASDSDILYQFIQSQELVQRINERIDLRAIYSKPGFDPVFSFDPDGGIEDLVDYWKDMVRISYDSTTGLIELRVHAFTPEDAQAVAQGILDESNRMINDLSAIARADATRYAREELDNAVERLRVQRVAMTEFRSRTQIVDPSADIQAQMGLLNTLQQQLASASIDLNLLRQTTQPSDPRIAQNERRIGVIEELIQREREKFGLGGGTGTGASTYSTMIAEFERLTVDLDFAEKAYIAALTNHDAAIAEAQRMSRYLATYVRPTLAQQSLYPQRGLLTLMIGGFALMLWAIGMLIYYSVRDRR
>NC_009040.1|WP_002724798.1|25720_26521_+|ABC-transporter-permease
MTGLSGLLAGRRFLWGRSVLSLMLREMATSYGRSPGGYLWAVAEPVAALTLLTVVFSFLMRSPPLGNNFPLFYATGYLPFMYYTALTAKIGQAIRFSRPLLAYPAVSFFDAILSRFLLNTLTNLVVFVIVMVGIIAFYDLNVSLDLPAILEAFSMAAALAMGVGTLNCYLFSVAPVWERVWAILNRPMFLLSGIFFLMETVPEPFRTLLSYNPLTHVIAKMRQGFFATYDARLVDPLYAYSVSLVCLFFGMLLLNRHHRMLLNEGA
>NC_009040.1|WP_011840037.1|26584_28840_+|glycoside-hydrolase-family-99-like-domain-containing-protein
MLKFHRLRRFARILVLTGEERRYLRAIRKSGLFDRTYYRGAYPGLNPIYLKYPEKHYIAYGERLGYRPNPDFSPQAYLRYHPDVAEAGVPPFLHYVRVGHAEQRLTKELPEVVALPARGMPQVRFEHGRQTAPYAVAVHVYYPDLWPEFAARLRRLRIPFDLYVTLTYRGEETDALAEEIRADFPGAFVTPMPNRGRDILPFVTLLNAGAFDGYRAVCKFHTKKSPHRQDGDLWRKHLIEGILPETGLEEKLEAFVEAPEAGFWVADGQHYTGTQWWGSNVEATRHLLQRIEIPLDREALSFPAGSIYWVKPLVLGLLRSLQLRLEDFDIEEGQVDGTLAHAIERVLGYLTARAGQKVLQTSELRPAAAAAPAKPAFVSAFYLPQFHPVPENDAWWGKGFTEWRSVVKAPSMFEGHLQPMLPADLGFYDLRATEVMGEQAAMAREAGIDAFCVYHYWFDGRRILEAPIDRLMARPEIDFPFYLCWANESWRRNWDGLSGTVLLEQTYGAGFEEKLAADTAPYLRDPRYARPDGRRPRFVIYRPEDMPDPQASVARLREGWRRAGIGEVELGAVRFHVEGAHPVPEGLFDFWVEMPPHGLVKGPDYLFGGPDGNRMPAAMNPAFSGLIYDYAAVARRALSETYVRTLPKATIAGVMPGWDNTARRGAAGHVAYGANPATFNVWLAGALERRVPASYRRELFVNAWNEWAEKAVLEPSLTFGDLNLQVMRQHLGAAEPATHLAEPPAHGMRSH
>NC_009040.1|WP_009565051.1|28840_29833_+|hypothetical-protein
MARVVLHIGTHKTATTTIQDMFAHNADLLRQHGVIYPRLSRVAGHHGLVMEWNKLPDMYALPQGSIATLKQLTRDYAHVPGTLVLSSEEFSRGKPGAQVDFRAVRELLSDFESVSVVCVLREQWQFMQSIYLQASKERQPPKPSTMVDSVLKRDMTDGLWIDYNLLYDHLLSAFAPEEITFLDFDACRRHRDGVVGAMLDTLGCGLSASSLQVVHDGLSNVSPLALPTFAACVITEPDQAAPWVIDCATGAFRIEYGEEAKSCLWTYPEFQQLFAYAKERNGRLSERRKAVQPEFRISESDPEENRVYRDGLNTSFWIRCSRWIYRARRG
>NC_009040.1|WP_011840038.1|29990_31349_-|sulfotransferase
MTSDQTPARPALLVLGMHRSGTSALAGVLGRAGFALPQELMPPTEHNPRGYFESTRIFRLNDALLAAAGSSWDDWRVFDADWHLSPAAEPFHAEAQEALAAEFPGTAPIVLKDPRICRLLPFWTRALTEAGFRPLAVCTHRPAREVGASLARRNGWPEARGLLLWLRHVLDAEAQTRGRPRVFVSYDGLLADWRGTLGRIAEAFDLALPRPLDEAAPEIEAFLSADLRHAPETPAAAAGLSDWIARPEEILDRKAAGEDRPGDRETLDRIAAEVAAAAPLLADLSGAVEEQGARLEREAALRHEAQTILQQERQRLDDLTAELQLQLHHRTLHVAELERHAGELAQQLRQKTQHEAELERHAEELAQQLRQQRSHAAELERHAGELSALTHELRQQVHHKGRHVQELEAHSGDLEARLVALEAEHAALLGSTSWKVTHPLRRMSLALRRPKT
>NC_009040.1|WP_011840039.1|31951_33253_+|DUF2793-domain-containing-protein
MSDASPILSLPYILPSQAQKHVTHNEALQRLDVLVQPAVLDRDRSAPPAAPAAGARHLVGPGAEGAWAGREEAFAVWDAEAAVWRFLAPQPGWQTFVLAEGAGLVFTAQGWRTLIGLLPEFPSLGIATPADATNRLAVAGPATLFTHAGAGHRIKVNKAAEAETASLLFQSDWSGRAEIGLAGSDDFALKVSPDGTSFRTALSADRASGRVALPQGAVVTGSLTGSAVQASAADATPGRLLTVGAFGLGAPAPLVGNAGAVDGALAPGFYGYDSAQGSSGGPAGVQAGLLLHQSRGAGEVQLFLVEAGGGGLMPGILFSRARGEGAWSPWVAGGIVESAGNANGRYIRHQDGTQSCWQKVTTSASADVVAPFPAAFSTATGLVTVSSVVSNGAQALSPRLTGRTTTSVGVSVFSATNTRLAAQVELISMGRWY
>NC_009040.1|WP_011840040.1|33434_34376_+|calcium-binding-protein
MPEVSPFPSLSPLSAPLAQSALAQTPAGTPGNDLLNGGPGADRLVGGDGNDTINGRDGVDRLYGGNGDDLLDGGFYHDACYGQAGNDTFRIRGVDLADDVYGGAGTDTLDLSGYTNLRLGFRVDLAAGRYDFRPEPFGPYVVKSIEIVIGSARADVLLGSRLAETLSGGLGNDRLEGRGGADVLRGMEGADALFGGTGNDLLLGGAGNDRLDGQWERDVLVGGAGNDILIGGGGADRFVFAGNFGRDRIRDFSPDMAGEWIDLRGVGAITGFGDLMANHLSEVNGHVVIDVGANRITLEGISSEMLTRDDFLF
>NC_009040.1|WP_009565056.1|34491_35799_+|hypothetical-protein
MTLLRTTLLTALLSLALGAGAEAAPEAIYGPGPRALDNREIFAAANLPLWQELDRAGVEGIVLNASFLMTTDFRGMRGDHQNWPRPKDTYLSDDDLAGLAQIVARTGLEVTYEAGVGLSGDRCDASLSPEALGREAAAFEFERNVRRLTDAGIPVSAINVDGPMLRLLPDSGKRASCQVTVGTGFPLPVAARIAQAYMTYMRDRLEATQGGRPVEVRWLVNLPNWQAGRVPRLGNGKGEPTTDFAEVLKAFAQVQAENRLLAQPLEISEIVIDYPYAYVLQNFSYFGVRVRNLWNASRDLNPSGRPPPLGFIVNSRSYSHPCLKREGEPDLAFLTFRRGEGAVSEACQRAQIGEDTAANAQDGAMDNDTDYLRDSFTYVDGLKPGGELAKRLVLRDGTRIADHVAHLYYQSWGVNPLSNAWYMERLIERLEHGDR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_009040_1	1.1\|21550\|33\|NC_009040\|CRISPRCasFinder	21550-21582	33	NZ_CP030273	Rhodobacter sphaeroides 2.4.1 plasmid pA, complete sequence	67220-67252	0	1.0
NC_009040_1	1.1\|21550\|33\|NC_009040\|CRISPRCasFinder	21550-21582	33	CP047033	Rhodobacter sphaeroides strain DSM 158 plasmid pEA, complete sequence	60898-60930	0	1.0
NC_009040_1	1.1\|21550\|33\|NC_009040\|CRISPRCasFinder	21550-21582	33	NC_009040	Rhodobacter sphaeroides ATCC 17029 plasmid pRSPH01, complete sequence	21550-21582	0	1.0
NC_009040_1	1.1\|21550\|33\|NC_009040\|CRISPRCasFinder	21550-21582	33	NZ_CP047039	Rhodobacter sphaeroides strain 2.4.1 substr. H2 plasmid pEA, complete sequence	60874-60906	0	1.0
NC_009040_1	1.1\|21550\|33\|NC_009040\|CRISPRCasFinder	21550-21582	33	NZ_CP015213	Rhodobacter sphaeroides strain MBTLJ-13 plasmid b, complete sequence	104690-104722	0	1.0
NC_009040_1	1.1\|21550\|33\|NC_009040\|CRISPRCasFinder	21550-21582	33	NZ_CP051470	Rhodobacter sphaeroides strain CH10 plasmid pRspCH10A, complete sequence	19476-19508	0	1.0
NC_009040_1	1.1\|21550\|33\|NC_009040\|CRISPRCasFinder	21550-21582	33	NZ_CP015290	Rhodobacter sphaeroides strain MBTLJ-20 plasmid b, complete sequence	3847-3879	0	1.0
NC_009040_1	1.1\|21550\|33\|NC_009040\|CRISPRCasFinder	21550-21582	33	NC_011960	Rhodobacter sphaeroides KD131 plasmid pRSKD131B, complete sequence	72598-72630	2	0.939
NC_009040_1	1.1\|21550\|33\|NC_009040\|CRISPRCasFinder	21550-21582	33	CP036421	Rhodobacter sphaeroides strain HJ plasmid unnamed1, complete sequence	28105-28137	2	0.939
NC_009040_1	1.1\|21550\|33\|NC_009040\|CRISPRCasFinder	21550-21582	33	NZ_CP033321	Azospirillum brasilense strain Cd plasmid p3, complete sequence	291403-291435	7	0.788
NC_009040_1	1.1\|21550\|33\|NC_009040\|CRISPRCasFinder	21550-21582	33	NZ_CP012915	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence	1573927-1573959	7	0.788
NC_009040_1	1.1\|21550\|33\|NC_009040\|CRISPRCasFinder	21550-21582	33	NZ_CP032340	Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence	558458-558490	7	0.788
NC_009040_1	1.1\|21550\|33\|NC_009040\|CRISPRCasFinder	21550-21582	33	MK864266	Gordonia phage Arri, complete genome	8692-8724	9	0.727
NC_009040_1	1.1\|21550\|33\|NC_009040\|CRISPRCasFinder	21550-21582	33	MN284907	Gordonia phage Fireball, complete genome	8624-8656	10	0.697
NC_009040_1	1.1\|21550\|33\|NC_009040\|CRISPRCasFinder	21550-21582	33	MK864264	Gordonia phage VanDeWege, complete genome	8812-8844	10	0.697
NC_009040_1	1.1\|21550\|33\|NC_009040\|CRISPRCasFinder	21550-21582	33	MH479910	Gordonia phage Danyall, complete genome	8520-8552	10	0.697
NC_009040_1	1.1\|21550\|33\|NC_009040\|CRISPRCasFinder	21550-21582	33	MT639651	Gordonia phage Portcullis, complete genome	8580-8612	10	0.697
NC_009040_1	1.1\|21550\|33\|NC_009040\|CRISPRCasFinder	21550-21582	33	MH479917	Gordonia phage KimmyK, complete genome	8648-8680	10	0.697
NC_009040_1	1.1\|21550\|33\|NC_009040\|CRISPRCasFinder	21550-21582	33	MH669015	Gordonia phage TillyBobJoe, complete genome	8335-8367	10	0.697
NC_009040_1	1.1\|21550\|33\|NC_009040\|CRISPRCasFinder	21550-21582	33	MK814761	Gordonia phage SmokingBunny, complete genome	8499-8531	10	0.697
NC_009040_1	1.1\|21550\|33\|NC_009040\|CRISPRCasFinder	21550-21582	33	KX557286	Gordonia phage Twister6, complete genome	8431-8463	10	0.697
NC_009040_1	1.1\|21550\|33\|NC_009040\|CRISPRCasFinder	21550-21582	33	MK864267	Gordonia phage Valary, complete genome	8884-8916	10	0.697
NC_009040_1	1.1\|21550\|33\|NC_009040\|CRISPRCasFinder	21550-21582	33	MK967381	Gordonia phage RogerDodger, complete genome	8884-8916	10	0.697
NC_009040_1	1.1\|21550\|33\|NC_009040\|CRISPRCasFinder	21550-21582	33	MT310872	Gordonia phage Evamon, complete genome	8501-8533	10	0.697
NC_009040_1	1.1\|21550\|33\|NC_009040\|CRISPRCasFinder	21550-21582	33	MT521998	Gordonia phage Jambalaya, complete genome	8332-8364	10	0.697
NC_009040_1	1.1\|21550\|33\|NC_009040\|CRISPRCasFinder	21550-21582	33	MK864265	Gordonia phage Barb, complete genome	8648-8680	10	0.697
NC_009040_1	1.1\|21550\|33\|NC_009040\|CRISPRCasFinder	21550-21582	33	NC_030913	Gordonia phage Wizard, complete genome	8624-8656	10	0.697
NC_009040_1	1.1\|21550\|33\|NC_009040\|CRISPRCasFinder	21550-21582	33	MK305889	Gordonia phage Mutzi, complete genome	8520-8552	10	0.697
NC_009040_1	1.1\|21550\|33\|NC_009040\|CRISPRCasFinder	21550-21582	33	MN010760	Gordonia phage Nubi, complete genome	8521-8553	10	0.697

1. spacer 1.1|21550|33|NC_009040|CRISPRCasFinder matches to NZ_CP030273 (Rhodobacter sphaeroides 2.4.1 plasmid pA, complete sequence) position: , mismatch: 0, identity: 1.0

ggggggtcggcagggcggcacggcgggggcaaa	CRISPR spacer
ggggggtcggcagggcggcacggcgggggcaaa	Protospacer
*********************************

2. spacer 1.1|21550|33|NC_009040|CRISPRCasFinder matches to CP047033 (Rhodobacter sphaeroides strain DSM 158 plasmid pEA, complete sequence) position: , mismatch: 0, identity: 1.0

ggggggtcggcagggcggcacggcgggggcaaa	CRISPR spacer
ggggggtcggcagggcggcacggcgggggcaaa	Protospacer
*********************************

3. spacer 1.1|21550|33|NC_009040|CRISPRCasFinder matches to NC_009040 (Rhodobacter sphaeroides ATCC 17029 plasmid pRSPH01, complete sequence) position: , mismatch: 0, identity: 1.0

ggggggtcggcagggcggcacggcgggggcaaa	CRISPR spacer
ggggggtcggcagggcggcacggcgggggcaaa	Protospacer
*********************************

4. spacer 1.1|21550|33|NC_009040|CRISPRCasFinder matches to NZ_CP047039 (Rhodobacter sphaeroides strain 2.4.1 substr. H2 plasmid pEA, complete sequence) position: , mismatch: 0, identity: 1.0

ggggggtcggcagggcggcacggcgggggcaaa	CRISPR spacer
ggggggtcggcagggcggcacggcgggggcaaa	Protospacer
*********************************

5. spacer 1.1|21550|33|NC_009040|CRISPRCasFinder matches to NZ_CP015213 (Rhodobacter sphaeroides strain MBTLJ-13 plasmid b, complete sequence) position: , mismatch: 0, identity: 1.0

ggggggtcggcagggcggcacggcgggggcaaa	CRISPR spacer
ggggggtcggcagggcggcacggcgggggcaaa	Protospacer
*********************************

6. spacer 1.1|21550|33|NC_009040|CRISPRCasFinder matches to NZ_CP051470 (Rhodobacter sphaeroides strain CH10 plasmid pRspCH10A, complete sequence) position: , mismatch: 0, identity: 1.0

ggggggtcggcagggcggcacggcgggggcaaa	CRISPR spacer
ggggggtcggcagggcggcacggcgggggcaaa	Protospacer
*********************************

7. spacer 1.1|21550|33|NC_009040|CRISPRCasFinder matches to NZ_CP015290 (Rhodobacter sphaeroides strain MBTLJ-20 plasmid b, complete sequence) position: , mismatch: 0, identity: 1.0

ggggggtcggcagggcggcacggcgggggcaaa	CRISPR spacer
ggggggtcggcagggcggcacggcgggggcaaa	Protospacer
*********************************

8. spacer 1.1|21550|33|NC_009040|CRISPRCasFinder matches to NC_011960 (Rhodobacter sphaeroides KD131 plasmid pRSKD131B, complete sequence) position: , mismatch: 2, identity: 0.939

ggggggtcggcagggcggcacggcgggggcaaa	CRISPR spacer
cgggggccggcagggcggcacggcgggggcaaa	Protospacer
 *****.**************************

9. spacer 1.1|21550|33|NC_009040|CRISPRCasFinder matches to CP036421 (Rhodobacter sphaeroides strain HJ plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.939

ggggggtcggcagggcggcacggcgggggcaaa	CRISPR spacer
cgggggccggcagggcggcacggcgggggcaaa	Protospacer
 *****.**************************

10. spacer 1.1|21550|33|NC_009040|CRISPRCasFinder matches to NZ_CP033321 (Azospirillum brasilense strain Cd plasmid p3, complete sequence) position: , mismatch: 7, identity: 0.788

ggggggtcggcagggcggcacggcgggggcaaa	CRISPR spacer
gccgggtcgccagggcggcaaggcgggcgaaca	Protospacer
*  ****** ********** ****** * * *

11. spacer 1.1|21550|33|NC_009040|CRISPRCasFinder matches to NZ_CP012915 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence) position: , mismatch: 7, identity: 0.788

ggggggtcggcagggcggcacggcgggggcaaa	CRISPR spacer
gccgggtcgccagggcggcaaggcgggcgaaca	Protospacer
*  ****** ********** ****** * * *

12. spacer 1.1|21550|33|NC_009040|CRISPRCasFinder matches to NZ_CP032340 (Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.788

ggggggtcggcagggcggcacggcgggggcaaa	CRISPR spacer
gccgggtcgccagggcggcaaggcgggcgaaca	Protospacer
*  ****** ********** ****** * * *

13. spacer 1.1|21550|33|NC_009040|CRISPRCasFinder matches to MK864266 (Gordonia phage Arri, complete genome) position: , mismatch: 9, identity: 0.727

ggggggtcggcagggcggcacggcgggggcaaa	CRISPR spacer
agatccttggcagggcggtccggcgggggcaac	Protospacer
.*.   *.**********. ************

14. spacer 1.1|21550|33|NC_009040|CRISPRCasFinder matches to MN284907 (Gordonia phage Fireball, complete genome) position: , mismatch: 10, identity: 0.697

ggggggtcggcagggcggcacggcgggggcaaa	CRISPR spacer
agactcctggcagggcggtccggcgggggcaac	Protospacer
.*.   ..**********. ************

15. spacer 1.1|21550|33|NC_009040|CRISPRCasFinder matches to MK864264 (Gordonia phage VanDeWege, complete genome) position: , mismatch: 10, identity: 0.697

ggggggtcggcagggcggcacggcgggggcaaa	CRISPR spacer
agactcctggcagggcggtccggcgggggcaac	Protospacer
.*.   ..**********. ************

16. spacer 1.1|21550|33|NC_009040|CRISPRCasFinder matches to MH479910 (Gordonia phage Danyall, complete genome) position: , mismatch: 10, identity: 0.697

ggggggtcggcagggcggcacggcgggggcaaa	CRISPR spacer
agactcctggcagggcggtccggcgggggcaac	Protospacer
.*.   ..**********. ************

17. spacer 1.1|21550|33|NC_009040|CRISPRCasFinder matches to MT639651 (Gordonia phage Portcullis, complete genome) position: , mismatch: 10, identity: 0.697

ggggggtcggcagggcggcacggcgggggcaaa	CRISPR spacer
agactcctggcagggcggtccggcgggggcaac	Protospacer
.*.   ..**********. ************

18. spacer 1.1|21550|33|NC_009040|CRISPRCasFinder matches to MH479917 (Gordonia phage KimmyK, complete genome) position: , mismatch: 10, identity: 0.697

ggggggtcggcagggcggcacggcgggggcaaa	CRISPR spacer
agactcctggcagggcggtccggcgggggcaac	Protospacer
.*.   ..**********. ************

19. spacer 1.1|21550|33|NC_009040|CRISPRCasFinder matches to MH669015 (Gordonia phage TillyBobJoe, complete genome) position: , mismatch: 10, identity: 0.697

ggggggtcggcagggcggcacggcgggggcaaa	CRISPR spacer
agactcctggcagggcggtccggcgggggcaac	Protospacer
.*.   ..**********. ************

20. spacer 1.1|21550|33|NC_009040|CRISPRCasFinder matches to MK814761 (Gordonia phage SmokingBunny, complete genome) position: , mismatch: 10, identity: 0.697

ggggggtcggcagggcggcacggcgggggcaaa	CRISPR spacer
agactcctggcagggcggtccggcgggggcaac	Protospacer
.*.   ..**********. ************

21. spacer 1.1|21550|33|NC_009040|CRISPRCasFinder matches to KX557286 (Gordonia phage Twister6, complete genome) position: , mismatch: 10, identity: 0.697

ggggggtcggcagggcggcacggcgggggcaaa	CRISPR spacer
agactcctggcagggcggtccggcgggggcaac	Protospacer
.*.   ..**********. ************

22. spacer 1.1|21550|33|NC_009040|CRISPRCasFinder matches to MK864267 (Gordonia phage Valary, complete genome) position: , mismatch: 10, identity: 0.697

ggggggtcggcagggcggcacggcgggggcaaa	CRISPR spacer
agactcctggcagggcggtccggcgggggcaac	Protospacer
.*.   ..**********. ************

23. spacer 1.1|21550|33|NC_009040|CRISPRCasFinder matches to MK967381 (Gordonia phage RogerDodger, complete genome) position: , mismatch: 10, identity: 0.697

ggggggtcggcagggcggcacggcgggggcaaa	CRISPR spacer
agactcctggcagggcggtccggcgggggcaac	Protospacer
.*.   ..**********. ************

24. spacer 1.1|21550|33|NC_009040|CRISPRCasFinder matches to MT310872 (Gordonia phage Evamon, complete genome) position: , mismatch: 10, identity: 0.697

ggggggtcggcagggcggcacggcgggggcaaa	CRISPR spacer
agactcctggcagggcggtccggcgggggcaac	Protospacer
.*.   ..**********. ************

25. spacer 1.1|21550|33|NC_009040|CRISPRCasFinder matches to MT521998 (Gordonia phage Jambalaya, complete genome) position: , mismatch: 10, identity: 0.697

ggggggtcggcagggcggcacggcgggggcaaa	CRISPR spacer
agactcctggcagggcggtccggcgggggcaac	Protospacer
.*.   ..**********. ************

26. spacer 1.1|21550|33|NC_009040|CRISPRCasFinder matches to MK864265 (Gordonia phage Barb, complete genome) position: , mismatch: 10, identity: 0.697

ggggggtcggcagggcggcacggcgggggcaaa	CRISPR spacer
agactcctggcagggcggtccggcgggggcaac	Protospacer
.*.   ..**********. ************

27. spacer 1.1|21550|33|NC_009040|CRISPRCasFinder matches to NC_030913 (Gordonia phage Wizard, complete genome) position: , mismatch: 10, identity: 0.697

ggggggtcggcagggcggcacggcgggggcaaa	CRISPR spacer
agactcctggcagggcggtccggcgggggcaac	Protospacer
.*.   ..**********. ************

28. spacer 1.1|21550|33|NC_009040|CRISPRCasFinder matches to MK305889 (Gordonia phage Mutzi, complete genome) position: , mismatch: 10, identity: 0.697

ggggggtcggcagggcggcacggcgggggcaaa	CRISPR spacer
agactcctggcagggcggtccggcgggggcaac	Protospacer
.*.   ..**********. ************

29. spacer 1.1|21550|33|NC_009040|CRISPRCasFinder matches to MN010760 (Gordonia phage Nubi, complete genome) position: , mismatch: 10, identity: 0.697

ggggggtcggcagggcggcacggcgggggcaaa	CRISPR spacer
agactcctggcagggcggtccggcgggggcaac	Protospacer
.*.   ..**********. ************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

11117 : 21511

Enterobacteria_phage(42.86%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002724637.1\|11117_11954_-	3-deoxy-8-phosphooctulonate synthase	E3T537	Cafeteria_roenbergensis_virus	6.0e-49	41.1
WP_011836184.1\|12155_12881_+	sulfotransferase	NA	NA	NA	NA
WP_011840030.1\|13247_14030_+	sulfotransferase	NA	NA	NA	NA
WP_002724812.1\|14004_14895_-	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	7.7e-87	54.9
WP_011840031.1\|14891_15743_-	dTDP-4-dehydrorhamnose reductase	I7HXC9	Enterobacteria_phage	9.8e-31	38.1
WP_002724808.1\|15739_16780_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	2.7e-91	51.8
WP_011840032.1\|16783_17347_-	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A291LA62	Escherichia_phage	1.0e-31	43.5
WP_002724804.1\|17410_18349_-	glycosyltransferase	NA	NA	NA	NA
WP_002724803.1\|18400_19363_-	replication initiator protein A	A0A0K1Y6J9	Rhodobacter_phage	1.3e-58	39.1
WP_011840033.1\|20056_21511_+	AAA family ATPase	A0A0K2FLP4	Brevibacillus_phage	2.2e-06	26.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_009050

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NC_009049

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NC_009040

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection