CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NC_009439	Pseudomonas mendocina ymp, complete genome	3 crisprs	csa3,DEDDh,cas3,DinG,cas2,cas1,cas6e,cas5,cas7,cse2gr11,cas8e	0	56	3	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_009439_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_009439_1

3437657-3437746

Orphan

Consensus_repeat	Method
CCGTAGGGTGCGCCATGCGCACC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_009439_1

>merge|NC_009439|1|3437657-3437746|CRISPRCasFinder
CCGTAGGGTGCGCCATGCGCACCAAAACCGAGGGCATCAACCGGACCATTGGGATACCGCCGCGATCCCGTAGGGTGCGCCGTGCGCACC

>NC_009439|1|1|3437657-3437746|CRISPRCasFinder
CCGTAGGGTGCGCCATGCGCACC	AAAACCGAGGGCATCAACCGGACCATTGGGATACCGCCGCGATC
CCGTAGGGTGCGCCGTGCGCACC

Protein	Signature genes	Signature genes Name	Protein_function
NC_009439.1\|WP_004374086.1\|3434744_3436706_-\|acetate--CoA-ligase	unknown	unknown	gnl\|CDD\|234677
NC_009439.1\|WP_012019233.1\|3439607_3440393_+\|phenylalanine-4-monooxygenase	unknown	unknown	gnl\|CDD\|237020
NC_009439.1\|WP_012019235.1\|3442232_3443147_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270334
NC_009439.1\|WP_003241910.1\|3437800_3439354_-\|sigma-54-dependent-phenylalanine-hydroxylase-transcriptional-regulator-PhhR	unknown	unknown	gnl\|CDD\|225821
NC_009439.1\|WP_012019230.1\|3432937_3433615_+\|DUF4197-domain-containing-protein	unknown	unknown	gnl\|CDD\|379394
NC_009439.1\|WP_003241907.1\|3440514_3440868_+\|4a-hydroxytetrahydrobiopterin-dehydratase	unknown	unknown	gnl\|CDD\|234845
NC_009439.1\|WP_157045659.1\|3428342_3428483_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|236173
NC_009439.1\|WP_004374102.1\|3432420_3432822_-\|hypothetical-protein	unknown	unknown	unknown
NC_009439.1\|WP_003241895.1\|3446174_3447437_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|341030
NC_009439.1\|WP_012019232.1\|3437082_3437643_+\|nucleoside-deaminase	unknown	unknown	gnl\|CDD\|238612
NC_009439.1\|WP_012019231.1\|3433663_3434443_-\|EAL-domain-containing-protein	unknown	unknown	gnl\|CDD\|238923
NC_009439.1\|WP_012019227.1\|3431172_3431706_+\|DUF3833-domain-containing-protein	unknown	unknown	gnl\|CDD\|378992
NC_009439.1\|WP_012019228.1\|3431702_3432413_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|181609
NC_009439.1\|WP_012019226.1\|3430618_3431164_+\|chalcone-isomerase-family-protein	unknown	unknown	gnl\|CDD\|374318
NC_009439.1\|WP_012019239.1\|3447527_3449786_+\|glucosylglycerol-phosphate-synthase	unknown	unknown	gnl\|CDD\|131451
NC_009439.1\|WP_012019236.1\|3443156_3444317_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224095
NC_009439.1\|WP_012019225.1\|3428703_3430482_+\|acyl-CoA-dehydrogenase-C-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|185635
NC_009439.1\|WP_012019237.1\|3444313_3445252_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224050
NC_009439.1\|WP_012019238.1\|3445251_3445980_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224095
NC_009439.1\|WP_012019234.1\|3440864_3442061_+\|aspartate/tyrosine/aromatic-aminotransferase	unknown	unknown	gnl\|CDD\|181731

Protein	Function_ID	Function_description	E-value
NC_009439.1\|WP_004374086.1\|3434744_3436706_-\|acetate--CoA-ligase	gnl\|CDD\|234677	PRK00174, PRK00174, acetyl-CoA synthetase; Provisional.	0
NC_009439.1\|WP_012019233.1\|3439607_3440393_+\|phenylalanine-4-monooxygenase	gnl\|CDD\|237020	PRK11913, phhA, phenylalanine 4-monooxygenase; Reviewed.	4.8711e-155
NC_009439.1\|WP_012019235.1\|3442232_3443147_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|270334	cd13616, PBP2_OsmF, Substrate-binding domain OsmF of an osmoregulated ABC-type transporter; the type 2 periplasmic-binding protein fold. Osmoprotectant binding lipoprotein OsmF of an ABC transporter (YehZYXW) from Escherichia coli is predicted to be involved in uptake of compatible solutes such as choline, L-proline and glycine betaine, but the relative substrate preference is not known. To counteract the efflux of water, microorganisms accumulate the compatible solutes for a sustained adjustment to high osmolarity surroundings. OsmF belongs to the type 2 periplasmic binding fold protein superfamily (PBP2). The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	6.02703e-152
NC_009439.1\|WP_003241910.1\|3437800_3439354_-\|sigma-54-dependent-phenylalanine-hydroxylase-transcriptional-regulator-PhhR	gnl\|CDD\|225821	COG3283, TyrR, Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism].	0
NC_009439.1\|WP_012019230.1\|3432937_3433615_+\|DUF4197-domain-containing-protein	gnl\|CDD\|379394	pfam13852, DUF4197, Protein of unknown function (DUF4197). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 228 and 249 amino acids in length.	1.39851e-90
NC_009439.1\|WP_003241907.1\|3440514_3440868_+\|4a-hydroxytetrahydrobiopterin-dehydratase	gnl\|CDD\|234845	PRK00823, phhB, pterin-4-alpha-carbinolamine dehydratase; Validated.	1.71356e-43
NC_009439.1\|WP_157045659.1\|3428342_3428483_+\|hypothetical-protein	gnl\|CDD\|236173	PRK08177, PRK08177, SDR family oxidoreductase.	0.00217499
NC_009439.1\|WP_003241895.1\|3446174_3447437_+\|MFS-transporter	gnl\|CDD\|341030	cd17477, MFS_YcaD_like, YcaD and similar transporters of the Major Facilitator Superfamily. This family is composed of Escherichia coli MFS-type transporter YcaD, Bacillus subtilis MFS-type transporter YfkF, and similar proteins. They are uncharacterized transporters belonging to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	6.36909e-91
NC_009439.1\|WP_012019232.1\|3437082_3437643_+\|nucleoside-deaminase	gnl\|CDD\|238612	cd01285, nucleoside_deaminase, Nucleoside deaminases include adenosine, guanine and cytosine deaminases. These enzymes are Zn dependent and catalyze the deamination of nucleosides. The zinc ion in the active site plays a central role in the proposed catalytic mechanism, activating a water molecule to form a hydroxide ion that performs a nucleophilic attack on the substrate. The functional enzyme is a homodimer. Cytosine deaminase catalyzes the deamination of cytosine to uracil and ammonia and is a member of the pyrimidine salvage pathway. Cytosine deaminase is found in bacteria and fungi but is not present in mammals; for this reason, the enzyme is currently of interest for antimicrobial drug design and gene therapy applications against tumors. Some members of this family are tRNA-specific adenosine deaminases that generate inosine at the first position of their anticodon (position 34) of specific tRNAs; this modification is thought to enlarge the codon recognition capacity during protein synthesis. Other members of the family are guanine deaminases which deaminate guanine to xanthine as part of the utilization of guanine as a nitrogen source.	7.73474e-27
NC_009439.1\|WP_012019231.1\|3433663_3434443_-\|EAL-domain-containing-protein	gnl\|CDD\|238923	cd01948, EAL, EAL domain. This domain is found in diverse bacterial signaling proteins. It is called EAL after its conserved residues and is also known as domain of unknown function 2 (DUF2). The EAL domain has been shown to stimulate degradation of a second messenger, cyclic di-GMP, and is a good candidate for a diguanylate phosphodiesterase function. Together with the GGDEF domain, EAL might be involved in regulating cell surface adhesiveness in bacteria.	3.2543e-61
NC_009439.1\|WP_012019227.1\|3431172_3431706_+\|DUF3833-domain-containing-protein	gnl\|CDD\|378992	pfam12915, DUF3833, Protein of unknown function (DUF3833). This is a family of uncharacterized proteins found in Proteobacteria.	7.95294e-104
NC_009439.1\|WP_012019228.1\|3431702_3432413_+\|SDR-family-oxidoreductase	gnl\|CDD\|181609	PRK09009, PRK09009, SDR family oxidoreductase.	1.22545e-59
NC_009439.1\|WP_012019226.1\|3430618_3431164_+\|chalcone-isomerase-family-protein	gnl\|CDD\|374318	pfam16036, Chalcone_3, Chalcone isomerase-like. Chalcone_3 is a family of largely bacterial members.	4.70581e-16
NC_009439.1\|WP_012019239.1\|3447527_3449786_+\|glucosylglycerol-phosphate-synthase	gnl\|CDD\|131451	TIGR02398, Glucosylglycerol-phosphate_synthase, glucosylglycerol-phosphate synthase. Glucosylglycerol-phosphate synthase catalyzes the key step in the biosynthesis of the osmolyte glucosylglycerol. It is known in several cyanobacteria and in Pseudomonas anguilliseptica. The enzyme is closely related to the alpha,alpha-trehalose-phosphate synthase, likewise involved in osmolyte biosynthesis, of E. coli and many other bacteria. A close homolog from Xanthomonas campestris is excluded from this model and scores between trusted and noise.	0
NC_009439.1\|WP_012019236.1\|3443156_3444317_+\|ABC-transporter-permease	gnl\|CDD\|224095	COG1174, OpuBB, ABC-type proline/glycine betaine transport systems, permease component [Amino acid transport and metabolism].	2.26068e-60
NC_009439.1\|WP_012019225.1\|3428703_3430482_+\|acyl-CoA-dehydrogenase-C-terminal-domain-containing-protein	gnl\|CDD\|185635	PTZ00456, PTZ00456, acyl-CoA dehydrogenase; Provisional.	0
NC_009439.1\|WP_012019237.1\|3444313_3445252_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224050	COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism].	3.57736e-153
NC_009439.1\|WP_012019238.1\|3445251_3445980_+\|ABC-transporter-permease	gnl\|CDD\|224095	COG1174, OpuBB, ABC-type proline/glycine betaine transport systems, permease component [Amino acid transport and metabolism].	6.35703e-63
NC_009439.1\|WP_012019234.1\|3440864_3442061_+\|aspartate/tyrosine/aromatic-aminotransferase	gnl\|CDD\|181731	PRK09257, PRK09257, aromatic amino acid transaminase.	0

>NC_009439.1|WP_012019232.1|3437082_3437643_+|nucleoside-deaminase
MKPEHLALLQQAPAATRADDTWARLCCEQALLALEEGCYAVGAVLIDDAGELLCSGRNQVFAGHYASAAHAEMQVLDQLEAEHPQLDRSGLTLYVSLEPCLMCHSRILLAGIRRVRYLARDRDGGFAARPPRLPRAWANLASRLCVAQAAADPYWIGLAERVIDHLQDRRAMRERVVAAWRGGQAD
>NC_009439.1|WP_004374086.1|3434744_3436706_-|acetate--CoA-ligase
MSAASIYPVSPEAAARTLTDEATYKAMYQQSVVNPEGFWREQGKRIDWIKPYTKVKQTSFDDHHVDIKWFADGTLNVSYNCLDRHLEERGDQIAIIWEGDDPAEHKEITYRELHEQVCKFANALRGQDIHRGDVVTIYMPMIPEAVVAMLACARIGAIHSVVFGGFSPEALAGRIIDCQSKVVITADEGVRGGKKVALKANVDDALTNPETHSVQKVIVVQRTGSEIKWNQHRDIWYEDLMKVAGSVCAPKEMGAEEALFILYTSGSTGKPKGVLHTTGGYLVYASLTHERVFDYRPGEVFWCTADIGWVTGHSYLVYGPLANGATTVMFEGVPNYPDVTRVAKIVDKHKVNILYTAPTAIRAMMAEGKAAVAGADGSSLRLLGSVGEPINPEAWQWYYENVGQSRCPIVDTWWQTETGACLMTPLPGAHAMKPGSAARPFFGVQPALVDNLGNIIEGPAEGNLVIIDSWPGQARTLFGDHDRFVDTYFKTFKGMYFTGDGARRDEDGYWWITGRVDDVLNVSGHRMGTAEIESAMVAHPKVAEAAVVGVPHDIKGQGIYVYVTLNAGEESSEQLRQELRNWVRKEIGPIATPDVIQWAPGLPKTRSGKIMRRILRKIATAEYEALGDISTLADPGVVQHLIDTHRQMQAACA
>NC_009439.1|WP_012019231.1|3433663_3434443_-|EAL-domain-containing-protein
MSNASPSVFPQPFRALGCAECRNAEALGFDFTMAFQLIVDVQENRPFAYEALVRGSQGESAGEVLGRVNDSNRYRFDQACRVKAIEQAATLGLLDIPDCLLSINFLPNAVYRAETCIRATLEAAQRFDFPRERLMFEVTEGEQIHDAEHLKRIFAEYGKQGFTTAIDDFGAGYSGLNLLAEFQPHVLKLDMALTRGIDQDPVRQAIVAGIVLVAQRLDIRIIAEGIENAGERDALSELGIRYMQGYLFARPQLDRLCRP
>NC_009439.1|WP_012019230.1|3432937_3433615_+|DUF4197-domain-containing-protein
MLRLTTFAAGLLLSANVFALSLADLSQKDASGGLKDALIQGAQVAVKQLGTPGGFNNNPDVRIELPGKLGKAAKTMKMMGMGAQVEQLEASMNKAAEAAVPQAQALLVDAVKKMTVADAKSILSGPQDSATQYLNKSSREQIRAKFLPIVKQATDQVGLAQQYNAFAGQAASFGVVDAKSSTVENYVTEQALDGLFEIIAQQEANIRQNPAGAATSLAQKVFGAL
>NC_009439.1|WP_004374102.1|3432420_3432822_-|hypothetical-protein
MNSPLPLRNPCPPGACDCQRDELLERPGADLRVLLLTRHEEQRLLDRLESLQSLEDLERMQQRMFEQLGIRLHIEPSHGEVRSMRGIHMHFDTHPGLCRKTRQSIPAAIRRAMEKKPEIAWRLLDSFDLFGGL
>NC_009439.1|WP_012019228.1|3431702_3432413_+|SDR-family-oxidoreductase
MSEALALSSLGSGYRALVIGASGAIGQAFCQLLRADAGCAQVRELSRASSPALDLEDPASIAAAASALAAEGPYQLILHAAGLLHRPGIAPEKSLAAIEADALQAVFQVNALGPALVLRHFLPLLDKQGAMAMLSAKVGSIGDNRLGGWYAYRASKAALNMLIKTAAIELARSKPKARLLALHPGTVISPLSHPFRGASAARPAEQAAAEMLRVIDSLGPEHSGSFHAYDGQPLPW
>NC_009439.1|WP_012019227.1|3431172_3431706_+|DUF3833-domain-containing-protein
MRVLLILLGSLLLASCGQVPVERYANEKPVLDLPTYFSGPVQAWGMFQDRSGEVIKRFHVDIDSRREGDKLILDERFLYSDGTRQRRVWTLTPDGPGRWIGTADDVVGQAVGEVAGNALRWRYHLNLPVDDTTYVVYFDDWMYLMDDDTMINRSVMSKFGIELGQVTLFFRRGAAQP
>NC_009439.1|WP_012019226.1|3430618_3431164_+|chalcone-isomerase-family-protein
MAERSLHLLSALLLSLALATTSVHASTQSGWRERLPQASLIGSGDFSWFGFSVYNAKLWSPSAKVDFDQPFALELTYRRNISRDTLVDTSLDEIRRIDAQALQAGREAEWARQMRQAFVDVQDGTRITGVYLPGEGCRFYVDGQLQHVVDDPEFARAFFSIWLDPQTRSPKLRAALLGLNR
>NC_009439.1|WP_012019225.1|3428703_3430482_+|acyl-CoA-dehydrogenase-C-terminal-domain-containing-protein
MPSYRAPLRDMRFVFEELLDAYNVLQTLPEHGEFSADLGGAILEEAAKLAENVLAPLNGPGDKQGCQYDPNTYAVRTPDGFKAAYRQFAEGGWTALACTPEFGGQGLPHVLNMLVEEMTCSANLSLGMYPGLTHGAINALTSHGTPEQQAQYLPQLISGEWTGTMCLTEPQCGTDLGLIRTRAVPQADGSFALTGTKIWITGGEHDLVDNIIHLVLAKLPDAPDSVKGISLFLVPKFLADGTRNSAFCGGLEHKMGIKGSATCVMNFEGAKGWLIGEPNKGLSCMFTMMNSARLMVGMQGLGVAESAYQIALGFARERLQSRSIAGPKAADKPADPILVHPDVRRMLLRQKVMIEGCRALAYFAGLQQDIAHGAEDAEARTRADDLVQLLTPVVKAFLTDEGFTCANEGLQVLGGSGFTEDWGIEQLVRDSRITRIYEGTNGIQALDLVGRKLALGGGRAVRAFFALIDSWLKSNAEAPHAAAVTQTLRQLQQASLWLASEGSKDPEQAAAAATPYLRLFGLTSLAWLWAQMAQVARRQLDAGSPETHFYTAKLKSADFFMARILPEAGALLGEIQAGKQTLMAFSDEEFAA
>NC_009439.1|WP_157045659.1|3428342_3428483_+|hypothetical-protein
MAVKRRLLLCGASRGLGLGLVRDLIALQLGQPSCAFLDYQGQPLPW
>NC_009439.1|WP_003241910.1|3437800_3439354_-|sigma-54-dependent-phenylalanine-hydroxylase-transcriptional-regulator-PhhR
MRIKVHCQNRVGILRDILNLLVDYGINVARGEVGGEQGNAIYLHCPNLINLQFQSLRPKFEAIAGVFGVKRVGLMPSERRHLELNALLGALDFPVLSIDMAGSIVAANRSAAQLLGVRVDEVPGMALSRYAEDFDLPELVRANKTRINGLRVKIKGDVFLADIAPLQNEHDDSEALAGAVLTLHRADRVGERIYHVRKQELRGFDSIFQSSKVMAAVVKEARRMAPLDAPLLIEGETGTGKELLARACHLASPRGQSPFMALNCAGLPESMAETELFGYGPGAFEGARPEGKLGLLELTAGGTLFLDGVGEMSPRLQAKLLRFLQDGCFRRVGSDEEVYLDVRVICATQVDLSELCARGEFRQDLYHRLNVLSLHIPPLRECLDGLEPLVEHFLDSASRQIGCPLPKLAPQAFERMAHYHWPGNVRQLENVLFQAVSLCDGGTVKAEHIRLPDYGAPQPLGEFSVEGSLDDILGRFEKAVLERLFRDHPSSRQLGKRLGVSHTTIANKLRQHGLGRE
>NC_009439.1|WP_012019233.1|3439607_3440393_+|phenylalanine-4-monooxygenase
MKTTQYLAREPDESGFIHYPEAEHQVWNTLITRQLKVIENRACQEYLDGIEQLGLPHERIPQLGEINRVLEASTGWRVARVPALIPFQTFFELLASKQFPVATFIRTPEELDYLQEPDIFHEIFGHCPLLTNPWFAEFTHTYGRLGLKASKEERVYLARLYWLTIEFGLLDTPAGRRIYGGGILSSPKETLYALSDVPEHQAFDPLEAMRTPYRIDILQPVYFVLPELKRLFELAHEDIMALVHQAMQMGLHAPKFPPKAA
>NC_009439.1|WP_003241907.1|3440514_3440868_+|4a-hydroxytetrahydrobiopterin-dehydratase
MSLAQAQCEACRADAPKVSDEELAELIREIPDWNIEVRGDHMELERVYLFKNFRHALAFTNAVGAIAEEVGHHPALLTEWGKVTVTWWSHEMRGLHRNDFIMAARTDVLAAAAEGRK
>NC_009439.1|WP_012019234.1|3440864_3442061_+|aspartate/tyrosine/aromatic-aminotransferase
MSHFASVARVPGDPILSLMEAYRQDRNAAKLDLGVGVYKDAQGLTPIPRAVKLAEQRLIDSELTKTYVGGHGDAAFAERLSQLVLGADSPLLASQRAAATQTPGGTGALRLAGDFIRHCLPGRGIWLSDPTWPIHETLFAEAGLKVGHYPYVGADNRLDVEAMIAALTHLPKGDVVLLHACCHNPTGFDLGPRDFKRVLEVIKARELLPLIDFAYQGFGDGLEQDAWAVRLFAAELPELLITSSCSKNFGLYRERTGALIVCAGDADKLVDIRSQLAYLARNLWSTPPAHGAAVVAEILGDAELRKLWQDELESMRLRVASLRRGLVEALAPHGLSERFAHIAEQRGMFSYTGLTPVQVQRLREDFSVYMVGSGRANVAGLDATRLEQLAAAIARVCG
>NC_009439.1|WP_012019235.1|3442232_3443147_+|ABC-transporter-substrate-binding-protein
MSRSGLRLIPLLAALVFGSASAAAADPVVVSSKIDTEGAVLGNLIALRLERGGVPVEQRLQLGATNIVRKALIAGEIDLYPEYTGNGAFFFDQADSPVWKDAAKAYATVKRLDREAHDLVWLQPADANNTWAMSVRGDLARAHGLRSLDDLARYLAAGGDFKFAASAEFVESPSALPAFQKAYGFRLEPAQLVVLSGGNTAATLRAAAQGTNGVNAAMSYGTDGGLAALDLQVLSDPRAVQPVYQPAPLVRAEVLTAYPQIETLLRPLFTALSLETLQRLNGEVAVNGADPRQVAETFLDSLEQ
>NC_009439.1|WP_012019236.1|3443156_3444317_+|ABC-transporter-permease
MQPSNRRNPVLLSLALLLLAGLWLGDFAGLAANRIVPGQGHGLSDALGLPWALSLSAALLALAALAWRAEPHHLRLAQGLLALLLAQLPLALAWFAARHLDPALPQARIAPGFGVWSQLFVYGLMLIELRQRLGGRLWLIGPLLLLLLSAVLIASGAWDSLALMREYAGRSRQFWQALGGHLALVGGTLALSLGLGFALALTIGRWPRTQAALYGLLNLLQTIPSLALFGLLIPVLSYLATQSAALQALGVRGIGWAPALLALVAYSLLPVVRNTQVALQQVDAAVLEAARGMGMSRYQLFTRVRLPLALPVIIEGVRITSIQAIGLAAVAALVGAQGFGTFIFQGLGQGAMDLVLLGALPTIALALLADALFGALAHVLTRRRRA
>NC_009439.1|WP_012019237.1|3444313_3445252_+|ABC-transporter-ATP-binding-protein
MIELDRVSRRFGGVTAVDELSLRIASGEFCVLVGPSGCGKSTTLRMINRLVACSSGQIRIDGQDIATLDERLLRLRIGYAIQNTGLFPHWTVARNIALVPQLLGWPRSRIEARVGELLALFELPAAEFADKYPDQLSGGQAQRVGVARALAGDPEILLMDEPFGALDPITRDNLQNELLRIQSQIRKTIVFVTHDIDEALKLAERIVVMEHGRIVQHGSPQQLLDRPANALVEQLLGQSERGLKRAGLRRVETLMRPPSGEPPAQTIAATASLRQALSHMLSQHCERLAVRDTAGRWVGVVHLLDAVREEAD
>NC_009439.1|WP_012019238.1|3445251_3445980_+|ABC-transporter-permease
MRRWLPPLLWLALLLGASFAMERLEPLLRWLDPDSRQLLYQRASLAALLGRHLLIVACAGGLAVLLGVTAGILVTRSWGRDFLPLASQVASIGQTFPPVAVLALSVPLLGFGALPTIVALLLYGLLPVLRNSLAGLQGVPPAVLEAARGMGMSPLRVLWQVELPLARPVILAGVRTCLTLSIATAALGSTVGASTLGDPLIAGLVNGNNAYLLQGALLIGLLALCVDSLFGALSGPGPRSPG
>NC_009439.1|WP_003241895.1|3446174_3447437_+|MFS-transporter
MWSLIAPISSLLSGVALLLLGNGLLNTLLTLRGVAEGYSTTMLGLIMSGYFVGFLLGTWLAAPLVRRIGHIRAFACCAALAAIAALLHLLLVDPWVWLGLRVLYGLALVTLYMVVESWLNAQTPGEQRGRVFAVYMAVNLGALALAQQLLHLADPVQFTLFALAAILISAALMPITLTRQVQPSLPEAPRSNLLQLWRIAPLAIAAAGLSGLALGGFWGMAPVYASLAGFDASGVGLMMTATILGGALLQWPIGLYSDSRDRRWVLLWVVALAAGMALLLSLLPAGNALLMAIFVWGGLAFAIYPIAVAQLIDQLHKDEILAGSSGLLMVNGIGAVCGPLLAGLLMEHLGAAALPLYFAVTLGLLAAYCLYRLRHVSDLVSGDAAHFVPMLRTSPTVLELMPDAPPPEPCDTEESPTHAS
>NC_009439.1|WP_012019239.1|3447527_3449786_+|glucosylglycerol-phosphate-synthase
MLLATDLDGTFLAGDPEDRLSLYQTIAAHPEIQLAYVTGRSLEAVLPLLADPTLPQPDFIIADVGATLVHGDSLQPIQPLQSVVDALWPGESQVASAIAAFGLERQDVPQARRCSYFCTPEQAANPALREIADELGCDLLYSAELYLDFLPKGVNKGSSLRALADWLELDHDQVLAAGDTLNDLAMLSASFHGVCVGQSESALLEATANHSRTLHASRPGCGGILEAFAHFGFLGEHGIAAERRQAAQPGKAELVMVYHRLPYEEYRGASGKLQRRRPTSPNGIIPTLLSFFGDGRKGSWVAWAVHEDGDEPFDSHTTVDAERYPKLTAARVKLSKEEVDIFYKRFSKEAFWPTLHTFWERATFNEDDWQVYLKVNRAFAERTALEAAEGAIVWLHDYNLWMVPAYLRELRPDLRIAFFHHTYFPSADVFNVLPWRRQIVGSLLQCDYVGFHIPRQVENFVDVARGVFPLKTLSRQNCAPRFITYGCAVGLERMTTELDTGSRRVRLGAHPVGLDIDRVRSALEAPKIRELMAHLREEMQGVKLILSVERLDYTKGILEKLNAYERLLADNPELIGKVTLVSVCVPAAREMTIYDELQSQIEQAVGRINGRFARVGWTPLQFFFRSLPFEEVSAWYAMADVMWITPLRDGLNLVAKEFVAAQGLLGGRGVLVLSEFAGAAAELKGALLTNPHDAADLAQTCYLALNMPASEAKARLRELFDIVCFNDIRRWGEEFLAGVEPQQENKVLELVG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_009439_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_009439_2

4137496-4139847

TypeI-E

I-E

Consensus_repeat	Method
CGGTTCATCCCCGCTGGCGCGGGGAACAC	CRISPRCasFinder
CGGTTCATCCCCGCTGGCGCGGGGAACAC	CRT
CGGTTCATCCCCGCTGGCGCGGGGAACAC	PILER-CR

38 spacers

cas2,cas1,cas6e,cas5,cas7,cse2gr11,cas8e,cas3

The CRISPR arrays of NC_009439_2

>merge|NC_009439|2|4137496-4139847|CRISPRCasFinder,CRT,PILER-CR
CTCGACATCCCCGCTGGCGCGGGGAACACGGGTAGCCGTTGATCTTGGTCCAGCGCGGGTGCGGTTCATCCCCGCTGGCGCGGGAACACGGTCAGGTCGTCGCGGTTCATCCACTGCGCGACGGTTCATCCCCGCTGGCGCGGGGAACACGCCTCAAACGCCGCCCGCTCCGCATCCATCTTCGGTTCATCCCCGCTGGCGCGGGGAACACATAAGGCGCTTGCCTAACGACTCATGAAAGACCGGTTCATCCCCGCTGGCGCGGGGAACACATCGTTCACAGCAACAGCAGGTTCGGTTGCCACGGTTCATCCCCGCTGGCGCGGGGAACACGCAGGAACGCCGTGGGTTCGCGCGTTCAGCGACGGTTCATCCCCGCTGGCGCGGGGAACACAGGTGTACGGTCAGCGCGTGCTGCGGCGGTCGCGGTTCATCCCCGCTGGCGCGGGGAACACCACTGGTGATCTGGATCAGGGATTATCTCAATCCGGTTCATCCCCGCTGGCGCGGGGAACACGACCATCCTGAACAGCAGCGATGATTGGCTCAACGGTTCATCCCCGCTGGCGCGGGGAACACAGCGGTGACGGCTACCCGACCGTGGTGGTGGACGGTTCATCCCCGCTGGCGCGGGGAACACACATAGGTGCTTCTGGTAACGGTAGCATTGTACGGTTCATCCCCGCTGGCGCGGGGAACACCCGCGCTCTGAGCGCCGCGAGCTCTTCGCCAACGGTTCATCCCCGCTGGCGCGGGGAACACGGCGGTTCCAAGGCATCGAGGATGCGTTTCTGCGGTTCATCCCCGCTGGCGCGGGGAACACTCCCAGTCCTGGCGGTTGATCCACTCGACGGCCGGTTCATCCCCGCTGGCGCGGGGAACACGCTGATTTCCCGCCAAAGGAATGTGGTTGCAACGGTTCATCCCCGCTGGCGCGGGGAACACGCCTTCGCCGCCTCGATGCGGGCCTTGATGACCGGTTCATCCCCGCTGGCGCGGGGAACACGTGCGTGAGCGCTCCATGGACCGCGCTCTGATCGGTTCATCCCCGCTGGCGCGGGGAACACGCGCTCGCGCAGGTGACGCACAAGCGGGGTGACGGTTCATCCCCGCTGGCGCGGGGAACACGTGGTGCTGACCGACGAAGACGCCGACGCCAGCGGTTCATCCCCGCTGGCGCGGGGAACACTTGCAGCCCGCCAGCCGCAGCTTCGGGAGGGCCGGTTCATCCCCGCTGGCGCGGGGAACACGGAAGACGATATCAGCGCCGATGACTGGGAGTACGGTTCATCCCCGCTGGCGCGGGGAACACAACATCAAGGGGAGGGCCTGATATGGAATGCCCGGTTCATCCCCGCTGGCGCGGGGAACACTTGCTTTCATTGGTGCTGCCTCTTTCGGTTGACGGTTCATCCCCGCTGGCGCGGGGAACACCCGTATGCGAATTGGAGGATGGTGTGGGCCGGCGGTTCATCCCCGCTGGCGCGGGGAACACCTTGATGTCAGCCGTCACCTTGTTCGGGGTGCCGGTTCATCCCCGCTGGCGCGGGGAACACTTTGTGGACATGGCGGCCGAGCTGTGGAGCTGGCGGTTCATCCCCGCTGGCGCGGGGAACACTCGGTCGTGGCTATCTGGAGCGCCGCGATTGGTTGGTTCATCCCCGCTGGCGCGGGGAACACAGCATTCGAAGATTTTTCCCGCACGGTGCGGACGGTTCATCCCCGCTGGCGCGGGGAACACTTCACCAGTCTTCAGAATCTCGTAAATCTTACCGGTTCATCCCCGCTGGCGCGGGGAACACATCTAGCCTGTTTGGGGCCACCGTTTCTGATTCGGTTCATCCCCGCTGGCGCGGGGAACACACCCTTGTCCGCGTCGCCCTGGTCGGCGAGGTCGGTTCATCCCCGCTGGCGCGGGGAACACCTGGGGCCGCGCATCGACAAGATCGAGGCTCAGCGGTTCATCCCCGCTGGCGCGGGGAACACGTGACGTACACCGACCGGCCAACGCGAAGCGCCGGTTCATCCCCGCTGGCGCGGGGAACACCAAGCCGCACGCGGTTAACCGTAAGTGGCATTCGGTTCATCCCCGCTGGCGCGGGGAACACCTACATCCATCGGAGAAATGGTCCGCGTCAGCCGGTTCATCCCCGCTGGCGCGGGGAACACAAAACCTGTCTGGTACGCACGGCAACGTTGGGCGGTTCATCCCCGCTGGCGCGGGGAACACAAAAAGCCCGGCTCCGGGCCGGGCTTTCCTGACGGTTCATCCCCGCTGGCGCGGGGAACACGATCCACATTGCGATTGCGTATGTGCTCATACCGGTTCATCCCCGCTGGCGCGGGGAACAC

>NC_009439|2|2|4137496-4139847|CRISPRCasFinder
CTCGACATCCCCGCTGGCGCGGGGAACAC	GGGTAGCCGTTGATCTTGGTCCAGCGCGGGTG
CGGTTCATCCCCGCTGGCGCGGGAACACG	GTCAGGTCGTCGCGGTTCATCCACTGCGCGA
CGGTTCATCCCCGCTGGCGCGGGGAACAC	GCCTCAAACGCCGCCCGCTCCGCATCCATCTT
CGGTTCATCCCCGCTGGCGCGGGGAACAC	ATAAGGCGCTTGCCTAACGACTCATGAAAGAC
CGGTTCATCCCCGCTGGCGCGGGGAACAC	ATCGTTCACAGCAACAGCAGGTTCGGTTGCCA
CGGTTCATCCCCGCTGGCGCGGGGAACAC	GCAGGAACGCCGTGGGTTCGCGCGTTCAGCGA
CGGTTCATCCCCGCTGGCGCGGGGAACAC	AGGTGTACGGTCAGCGCGTGCTGCGGCGGTCG
CGGTTCATCCCCGCTGGCGCGGGGAACAC	CACTGGTGATCTGGATCAGGGATTATCTCAATC
CGGTTCATCCCCGCTGGCGCGGGGAACAC	GACCATCCTGAACAGCAGCGATGATTGGCTCAA
CGGTTCATCCCCGCTGGCGCGGGGAACAC	AGCGGTGACGGCTACCCGACCGTGGTGGTGGA
CGGTTCATCCCCGCTGGCGCGGGGAACAC	ACATAGGTGCTTCTGGTAACGGTAGCATTGTA
CGGTTCATCCCCGCTGGCGCGGGGAACAC	CCGCGCTCTGAGCGCCGCGAGCTCTTCGCCAA
CGGTTCATCCCCGCTGGCGCGGGGAACAC	GGCGGTTCCAAGGCATCGAGGATGCGTTTCTG
CGGTTCATCCCCGCTGGCGCGGGGAACAC	TCCCAGTCCTGGCGGTTGATCCACTCGACGGC
CGGTTCATCCCCGCTGGCGCGGGGAACAC	GCTGATTTCCCGCCAAAGGAATGTGGTTGCAA
CGGTTCATCCCCGCTGGCGCGGGGAACAC	GCCTTCGCCGCCTCGATGCGGGCCTTGATGAC
CGGTTCATCCCCGCTGGCGCGGGGAACAC	GTGCGTGAGCGCTCCATGGACCGCGCTCTGAT
CGGTTCATCCCCGCTGGCGCGGGGAACAC	GCGCTCGCGCAGGTGACGCACAAGCGGGGTGA
CGGTTCATCCCCGCTGGCGCGGGGAACAC	GTGGTGCTGACCGACGAAGACGCCGACGCCAG
CGGTTCATCCCCGCTGGCGCGGGGAACAC	TTGCAGCCCGCCAGCCGCAGCTTCGGGAGGGC
CGGTTCATCCCCGCTGGCGCGGGGAACAC	GGAAGACGATATCAGCGCCGATGACTGGGAGTA
CGGTTCATCCCCGCTGGCGCGGGGAACAC	AACATCAAGGGGAGGGCCTGATATGGAATGCC
CGGTTCATCCCCGCTGGCGCGGGGAACAC	TTGCTTTCATTGGTGCTGCCTCTTTCGGTTGA
CGGTTCATCCCCGCTGGCGCGGGGAACAC	CCGTATGCGAATTGGAGGATGGTGTGGGCCGG
CGGTTCATCCCCGCTGGCGCGGGGAACAC	CTTGATGTCAGCCGTCACCTTGTTCGGGGTGC
CGGTTCATCCCCGCTGGCGCGGGGAACAC	TTTGTGGACATGGCGGCCGAGCTGTGGAGCTGG
CGGTTCATCCCCGCTGGCGCGGGGAACAC	TCGGTCGTGGCTATCTGGAGCGCCGCGATTGGT
TGGTTCATCCCCGCTGGCGCGGGGAACAC	AGCATTCGAAGATTTTTCCCGCACGGTGCGGA
CGGTTCATCCCCGCTGGCGCGGGGAACAC	TTCACCAGTCTTCAGAATCTCGTAAATCTTAC
CGGTTCATCCCCGCTGGCGCGGGGAACAC	ATCTAGCCTGTTTGGGGCCACCGTTTCTGATT
CGGTTCATCCCCGCTGGCGCGGGGAACAC	ACCCTTGTCCGCGTCGCCCTGGTCGGCGAGGT
CGGTTCATCCCCGCTGGCGCGGGGAACAC	CTGGGGCCGCGCATCGACAAGATCGAGGCTCAG
CGGTTCATCCCCGCTGGCGCGGGGAACAC	GTGACGTACACCGACCGGCCAACGCGAAGCGC
CGGTTCATCCCCGCTGGCGCGGGGAACAC	CAAGCCGCACGCGGTTAACCGTAAGTGGCATT
CGGTTCATCCCCGCTGGCGCGGGGAACAC	CTACATCCATCGGAGAAATGGTCCGCGTCAGC
CGGTTCATCCCCGCTGGCGCGGGGAACAC	AAAACCTGTCTGGTACGCACGGCAACGTTGGG
CGGTTCATCCCCGCTGGCGCGGGGAACAC	AAAAAGCCCGGCTCCGGGCCGGGCTTTCCTGA
CGGTTCATCCCCGCTGGCGCGGGGAACAC	GATCCACATTGCGATTGCGTATGTGCTCATAC
CGGTTCATCCCCGCTGGCGCGGGGAACAC

>NC_009439|2|1|4137496-4139847|CRT
CTCGACATCCCCGCTGGCGCGGGGAACAC	GGGTAGCCGTTGATCTTGGTCCAGCGCGGGTG
CGGTTCATCCCCGCTGGCGCGGGAACACG	GTCAGGTCGTCGCGGTTCATCCACTGCGCGA
CGGTTCATCCCCGCTGGCGCGGGGAACAC	GCCTCAAACGCCGCCCGCTCCGCATCCATCTT
CGGTTCATCCCCGCTGGCGCGGGGAACAC	ATAAGGCGCTTGCCTAACGACTCATGAAAGAC
CGGTTCATCCCCGCTGGCGCGGGGAACAC	ATCGTTCACAGCAACAGCAGGTTCGGTTGCCA
CGGTTCATCCCCGCTGGCGCGGGGAACAC	GCAGGAACGCCGTGGGTTCGCGCGTTCAGCGA
CGGTTCATCCCCGCTGGCGCGGGGAACAC	AGGTGTACGGTCAGCGCGTGCTGCGGCGGTCG
CGGTTCATCCCCGCTGGCGCGGGGAACAC	CACTGGTGATCTGGATCAGGGATTATCTCAATC
CGGTTCATCCCCGCTGGCGCGGGGAACAC	GACCATCCTGAACAGCAGCGATGATTGGCTCAA
CGGTTCATCCCCGCTGGCGCGGGGAACAC	AGCGGTGACGGCTACCCGACCGTGGTGGTGGA
CGGTTCATCCCCGCTGGCGCGGGGAACAC	ACATAGGTGCTTCTGGTAACGGTAGCATTGTA
CGGTTCATCCCCGCTGGCGCGGGGAACAC	CCGCGCTCTGAGCGCCGCGAGCTCTTCGCCAA
CGGTTCATCCCCGCTGGCGCGGGGAACAC	GGCGGTTCCAAGGCATCGAGGATGCGTTTCTG
CGGTTCATCCCCGCTGGCGCGGGGAACAC	TCCCAGTCCTGGCGGTTGATCCACTCGACGGC
CGGTTCATCCCCGCTGGCGCGGGGAACAC	GCTGATTTCCCGCCAAAGGAATGTGGTTGCAA
CGGTTCATCCCCGCTGGCGCGGGGAACAC	GCCTTCGCCGCCTCGATGCGGGCCTTGATGAC
CGGTTCATCCCCGCTGGCGCGGGGAACAC	GTGCGTGAGCGCTCCATGGACCGCGCTCTGAT
CGGTTCATCCCCGCTGGCGCGGGGAACAC	GCGCTCGCGCAGGTGACGCACAAGCGGGGTGA
CGGTTCATCCCCGCTGGCGCGGGGAACAC	GTGGTGCTGACCGACGAAGACGCCGACGCCAG
CGGTTCATCCCCGCTGGCGCGGGGAACAC	TTGCAGCCCGCCAGCCGCAGCTTCGGGAGGGC
CGGTTCATCCCCGCTGGCGCGGGGAACAC	GGAAGACGATATCAGCGCCGATGACTGGGAGTA
CGGTTCATCCCCGCTGGCGCGGGGAACAC	AACATCAAGGGGAGGGCCTGATATGGAATGCC
CGGTTCATCCCCGCTGGCGCGGGGAACAC	TTGCTTTCATTGGTGCTGCCTCTTTCGGTTGA
CGGTTCATCCCCGCTGGCGCGGGGAACAC	CCGTATGCGAATTGGAGGATGGTGTGGGCCGG
CGGTTCATCCCCGCTGGCGCGGGGAACAC	CTTGATGTCAGCCGTCACCTTGTTCGGGGTGC
CGGTTCATCCCCGCTGGCGCGGGGAACAC	TTTGTGGACATGGCGGCCGAGCTGTGGAGCTGG
CGGTTCATCCCCGCTGGCGCGGGGAACAC	TCGGTCGTGGCTATCTGGAGCGCCGCGATTGGT
TGGTTCATCCCCGCTGGCGCGGGGAACAC	AGCATTCGAAGATTTTTCCCGCACGGTGCGGA
CGGTTCATCCCCGCTGGCGCGGGGAACAC	TTCACCAGTCTTCAGAATCTCGTAAATCTTAC
CGGTTCATCCCCGCTGGCGCGGGGAACAC	ATCTAGCCTGTTTGGGGCCACCGTTTCTGATT
CGGTTCATCCCCGCTGGCGCGGGGAACAC	ACCCTTGTCCGCGTCGCCCTGGTCGGCGAGGT
CGGTTCATCCCCGCTGGCGCGGGGAACAC	CTGGGGCCGCGCATCGACAAGATCGAGGCTCAG
CGGTTCATCCCCGCTGGCGCGGGGAACAC	GTGACGTACACCGACCGGCCAACGCGAAGCGC
CGGTTCATCCCCGCTGGCGCGGGGAACAC	CAAGCCGCACGCGGTTAACCGTAAGTGGCATT
CGGTTCATCCCCGCTGGCGCGGGGAACAC	CTACATCCATCGGAGAAATGGTCCGCGTCAGC
CGGTTCATCCCCGCTGGCGCGGGGAACAC	AAAACCTGTCTGGTACGCACGGCAACGTTGGG
CGGTTCATCCCCGCTGGCGCGGGGAACAC	AAAAAGCCCGGCTCCGGGCCGGGCTTTCCTGA
CGGTTCATCCCCGCTGGCGCGGGGAACAC	GATCCACATTGCGATTGCGTATGTGCTCATAC
CGGTTCATCCCCGCTGGCGCGGGGAACAC

>NC_009439|2|1|4137557-4139847|PILER-CR
CGGTTCATCCCCGCTGGCGCGGGAACACG	GTCAGGTCGTCGCGGTTCATCCACTGCGCGACGGTTC
ATCCCCGCTGGCGCGGGGAACACGCCTCA	AACGCCGCCCGCTCCGCATCCATCTTCGGTTC
ATCCCCGCTGGCGCGGGGAACACATAAGG	CGCTTGCCTAACGACTCATGAAAGACCGGTTC
ATCCCCGCTGGCGCGGGGAACACATCGTT	CACAGCAACAGCAGGTTCGGTTGCCACGGTTC
ATCCCCGCTGGCGCGGGGAACACGCAGGA	ACGCCGTGGGTTCGCGCGTTCAGCGACGGTTC
ATCCCCGCTGGCGCGGGGAACACAGGTGT	ACGGTCAGCGCGTGCTGCGGCGGTCGCGGTTC
ATCCCCGCTGGCGCGGGGAACACCACTGG	TGATCTGGATCAGGGATTATCTCAATCCGGTTC
ATCCCCGCTGGCGCGGGGAACACGACCAT	CCTGAACAGCAGCGATGATTGGCTCAACGGTTC
ATCCCCGCTGGCGCGGGGAACACAGCGGT	GACGGCTACCCGACCGTGGTGGTGGACGGTTC
ATCCCCGCTGGCGCGGGGAACACACATAG	GTGCTTCTGGTAACGGTAGCATTGTACGGTTC
ATCCCCGCTGGCGCGGGGAACACCCGCGC	TCTGAGCGCCGCGAGCTCTTCGCCAACGGTTC
ATCCCCGCTGGCGCGGGGAACACGGCGGT	TCCAAGGCATCGAGGATGCGTTTCTGCGGTTC
ATCCCCGCTGGCGCGGGGAACACTCCCAG	TCCTGGCGGTTGATCCACTCGACGGCCGGTTC
ATCCCCGCTGGCGCGGGGAACACGCTGAT	TTCCCGCCAAAGGAATGTGGTTGCAACGGTTC
ATCCCCGCTGGCGCGGGGAACACGCCTTC	GCCGCCTCGATGCGGGCCTTGATGACCGGTTC
ATCCCCGCTGGCGCGGGGAACACGTGCGT	GAGCGCTCCATGGACCGCGCTCTGATCGGTTC
ATCCCCGCTGGCGCGGGGAACACGCGCTC	GCGCAGGTGACGCACAAGCGGGGTGACGGTTC
ATCCCCGCTGGCGCGGGGAACACGTGGTG	CTGACCGACGAAGACGCCGACGCCAGCGGTTC
ATCCCCGCTGGCGCGGGGAACACTTGCAG	CCCGCCAGCCGCAGCTTCGGGAGGGCCGGTTC
ATCCCCGCTGGCGCGGGGAACACGGAAGA	CGATATCAGCGCCGATGACTGGGAGTACGGTTC
ATCCCCGCTGGCGCGGGGAACACAACATC	AAGGGGAGGGCCTGATATGGAATGCCCGGTTC
ATCCCCGCTGGCGCGGGGAACACTTGCTT	TCATTGGTGCTGCCTCTTTCGGTTGACGGTTC
ATCCCCGCTGGCGCGGGGAACACCCGTAT	GCGAATTGGAGGATGGTGTGGGCCGGCGGTTC
ATCCCCGCTGGCGCGGGGAACACCTTGAT	GTCAGCCGTCACCTTGTTCGGGGTGCCGGTTC
ATCCCCGCTGGCGCGGGGAACACTTTGTG	GACATGGCGGCCGAGCTGTGGAGCTGGCGGTTC
ATCCCCGCTGGCGCGGGGAACACTCGGTC	GTGGCTATCTGGAGCGCCGCGATTGGTTGGTTC
ATCCCCGCTGGCGCGGGGAACACAGCATT	CGAAGATTTTTCCCGCACGGTGCGGACGGTTC
ATCCCCGCTGGCGCGGGGAACACTTCACC	AGTCTTCAGAATCTCGTAAATCTTACCGGTTC
ATCCCCGCTGGCGCGGGGAACACATCTAG	CCTGTTTGGGGCCACCGTTTCTGATTCGGTTC
ATCCCCGCTGGCGCGGGGAACACACCCTT	GTCCGCGTCGCCCTGGTCGGCGAGGTCGGTTC
ATCCCCGCTGGCGCGGGGAACACCTGGGG	CCGCGCATCGACAAGATCGAGGCTCAGCGGTTC
ATCCCCGCTGGCGCGGGGAACACGTGACG	TACACCGACCGGCCAACGCGAAGCGCCGGTTC
ATCCCCGCTGGCGCGGGGAACACCAAGCC	GCACGCGGTTAACCGTAAGTGGCATTCGGTTC
ATCCCCGCTGGCGCGGGGAACACCTACAT	CCATCGGAGAAATGGTCCGCGTCAGCCGGTTC
ATCCCCGCTGGCGCGGGGAACACAAAACC	TGTCTGGTACGCACGGCAACGTTGGGCGGTTC
ATCCCCGCTGGCGCGGGGAACACAAAAAG	CCCGGCTCCGGGCCGGGCTTTCCTGACGGTTC
ATCCCCGCTGGCGCGGGGAACACGATCCA	CATTGCGATTGCGTATGTGCTCATACCGGTTC
ATCCCCGCTGGCGCGGGGAACAC

Protein	Signature genes	Signature genes Name	Protein_function
NC_009439.1\|WP_012019676.1\|4128459_4129080_-\|pseudouridine-synthase	unknown	unknown	gnl\|CDD\|211334
NC_009439.1\|WP_041773107.1\|4130302_4130743_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|182510
NC_009439.1\|WP_012019693.1\|4146119_4146401_+\|type-II-toxin-antitoxin-system-mRNA-interferase-toxin,-RelE/StbE-family	unknown	unknown	gnl\|CDD\|368240
NC_009439.1\|WP_041772965.1\|4144084_4145626_-\|type-I-E-CRISPR-associated-protein-Cse1/CasA	cas8e	pfam09481_cas8e_CAS-I-E	gnl\|CDD\|187860
NC_009439.1\|WP_012019687.1\|4141126_4141741_-\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	cas6e	pfam08798_cas6e_CAS-I-E:CAS-IV	gnl\|CDD\|187858
NC_009439.1\|WP_012019688.1\|4141715_4142378_-\|type-I-E-CRISPR-associated-protein-Cas5/CasD	cas5	cd09756_cas5_CAS-I-E	gnl\|CDD\|273842
NC_009439.1\|WP_012019675.1\|4127861_4128254_+\|globin	unknown	unknown	gnl\|CDD\|381254
NC_009439.1\|WP_041772964.1\|4140212_4141100_-\|type-I-E-CRISPR-associated-endonuclease-Cas1	cas1	cd09719_cas1_CAS-I-E	gnl\|CDD\|274693
NC_009439.1\|WP_012019677.1\|4129204_4130236_+\|NAD(P)-dependent-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|176186
NC_009439.1\|WP_012019682.1\|4134738_4135476_+\|hypothetical-protein	unknown	unknown	unknown
NC_009439.1\|WP_012019683.1\|4135486_4136170_-\|energy-coupling-factor-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376649
NC_009439.1\|WP_012019692.1\|4145832_4146123_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226420
NC_009439.1\|WP_012019690.1\|4143545_4144088_-\|type-I-E-CRISPR-associated-protein-Cse2/CasB	cse2gr11	pfam09485_cse2gr11_CAS-I-E	gnl\|CDD\|237559
NC_009439.1\|WP_012019681.1\|4133132_4134605_-\|AMP-nucleosidase	unknown	unknown	gnl\|CDD\|236222
NC_009439.1\|WP_012019689.1\|4142380_4143535_-\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	cas7	pfam09344_cas7_CAS-I-E	gnl\|CDD\|378153
NC_009439.1\|WP_041772963.1\|4130739_4132080_-\|PLP-dependent-aminotransferase-family-protein	unknown	unknown	gnl\|CDD\|224089
NC_009439.1\|WP_012019685.1\|4139913_4140213_-\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	cas2	cd09648_cas2_CAS-I-E	gnl\|CDD\|236930
NC_009439.1\|WP_012019680.1\|4132160_4133132_+\|threonine-dehydratase	unknown	unknown	gnl\|CDD\|235699
NC_009439.1\|WP_012019684.1\|4136706_4137450_+\|carbonic-anhydrase	unknown	unknown	gnl\|CDD\|239398
NC_009439.1\|WP_012019694.1\|4146403_4149061_-\|CRISPR-associated-helicase/endonuclease-Cas3	cas3	cd09639_cas3_CAS-I	gnl\|CDD\|182031

Protein	Function_ID	Function_description	E-value
NC_009439.1\|WP_012019676.1\|4128459_4129080_-\|pseudouridine-synthase	gnl\|CDD\|211334	cd02566, PseudoU_synth_RluE, Pseudouridine synthase, Escherichia coli RluE. This group is comprised of bacterial proteins similar to E. coli RluE. Pseudouridine synthases catalyze the isomerization of specific uridines in an RNA molecule to pseudouridines (5-ribosyluracil, psi). No cofactors are required. Escherichia coli RluE makes psi2457 in 23S RNA. psi2457 is not universally conserved.	9.9707e-90
NC_009439.1\|WP_041773107.1\|4130302_4130743_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|182510	PRK10514, PRK10514, putative acetyltransferase; Provisional.	7.99146e-45
NC_009439.1\|WP_012019693.1\|4146119_4146401_+\|type-II-toxin-antitoxin-system-mRNA-interferase-toxin,-RelE/StbE-family	gnl\|CDD\|368240	pfam05016, ParE_toxin, ParE toxin of type II toxin-antitoxin system, parDE. ParE is the toxin family of a type II toxin-antitoxin family. It is toxic towards DNA gyrase, but is neutralized by the antitoxin ParD. The family also encompasses RelE/ParE described in.	1.25025e-15
NC_009439.1\|WP_041772965.1\|4144084_4145626_-\|type-I-E-CRISPR-associated-protein-Cse1/CasA	gnl\|CDD\|187860	cd09729, Cse1_I-E, CRISPR/Cas system-associated protein Cse1. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Large proteins, some contain Zn-finger domain; subunit of the Cascade complex; signature gene for I-E subtype; also known as Cse1/CasA/YgcL family.	5.1149e-115
NC_009439.1\|WP_012019687.1\|4141126_4141741_-\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	gnl\|CDD\|187858	cd09727, Cas6_I-E, CRISPR/Cas system-associated RAMP superfamily protein Cas6e. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas6e is an endoribonuclease that generates crRNA; This family is specific for CRISPR/Cas system I-E subtype; Homologous to Cas6 (RAMP superfamily protein); Possesses double RRM/ferredoxin fold; also known as Cse3 family.	1.24569e-69
NC_009439.1\|WP_012019688.1\|4141715_4142378_-\|type-I-E-CRISPR-associated-protein-Cas5/CasD	gnl\|CDD\|273842	TIGR01868, hypothetical_protein, CRISPR-associated protein Cas5/CasD, subtype I-E/ECOLI. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family is part of the ECOLI subtype CRISPR/Cas locus, and now characterized as part of the CASCADE complex of that system. It shares a small N-terminal homology region with members of several other CRISPR/Cas subtypes, and we view the families that share this region as being Cas5.	1.465e-55
NC_009439.1\|WP_012019675.1\|4127861_4128254_+\|globin	gnl\|CDD\|381254	cd01040, Mb-like, myoglobin-like; M family globin domain. This family includes chimeric (FHbs/flavohemoglobins) and single-domain globins: FHbs, Ngbs/neuroglobins, Cygb/cytoglobins, GbE/avian eye specific globin E, GbX/globin X, amphibian GbY/globin Y, Mb/myoglobin, HbA/hemoglobin-alpha, HbB/hemoglobin-beta, SDgbs/single-domain globins related to FHbs, and Adgb/androglobin. The M family exhibits the canonical secondary structure of hemoglobins, a 3-over-3 alpha-helical sandwich structure (3/3 Mb-fold), built by eight alpha-helical segments (named A through H). In Adgbs, the globin domain is split into two: helices C-H are followed by helices A-B and the two parts are separated by the IQ motif. Although rearranged, the globin domain of most Adgbs contains a number of conserved residues which play critical roles in heme-coordination and gas ligand binding. Adgbs have been omitted from this A-H helix cd.	5.06555e-14
NC_009439.1\|WP_041772964.1\|4140212_4141100_-\|type-I-E-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|274693	TIGR03638, cas1_ECOLI, CRISPR-associated endonuclease Cas1, subtype I-E/ECOLI. The CRISPR-associated protein Cas1 is virtually universal to CRISPR systems. CRISPR, an acronym for Clustered Regularly Interspaced Short Palindromic Repeats, is prokaryotic immunity system for foreign DNA, mostly from phage. CRISPR systems belong to different subtypes, distinguished by both nature of the repeats, the makeup of the cohort of associated Cas proteins, and by molecular phylogeny within the more universal Cas proteins such as this one. This model is of type EXCEPTION and provides more specific information than the EQUIVALOG model TIGR00287. It describes the Cas1 protein particular to the ECOLI subtype of CRISPR/Cas system.	1.37572e-152
NC_009439.1\|WP_012019677.1\|4129204_4130236_+\|NAD(P)-dependent-alcohol-dehydrogenase	gnl\|CDD\|176186	cd05283, CAD1, Cinnamyl alcohol dehydrogenases (CAD). Cinnamyl alcohol dehydrogenases (CAD), members of the medium chain dehydrogenase/reductase family, reduce cinnamaldehydes to cinnamyl alcohols in the last step of monolignal metabolism in plant cells walls. CAD binds 2 zinc ions and is NADPH- dependent. CAD family members are also found in non-plant species, e.g. in yeast where they have an aldehyde reductase activity. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines.	2.41103e-172
NC_009439.1\|WP_012019683.1\|4135486_4136170_-\|energy-coupling-factor-ABC-transporter-permease	gnl\|CDD\|376649	pfam01891, CbiM, Cobalt uptake substrate-specific transmembrane region. This family of proteins forms part of the cobalt-transport complex in prokaryotes, CbiMNQO. CbiMNQO and NikMNQO are the most widespread groups of microbial transporters for cobalt and nickel ions and are unusual uptake systems as they consist of eg two transmembrane components (CbiM and CbiQ), a small membrane-bound component (CbiN) and an ATP-binding protein (CbiO) but no extracytoplasmic solute-binding protein. Similar components constitute the nickel transporters with some variability in the small membrane-bound component, either NikN or NikL, which are not similar to CbiN at the sequence level. CbiM is the substrate-specific component of the complex and is a seven-transmembrane protein. The CbiMNQO and NikMNQO systems form part of the coenzyme B12 biosynthesis pathway. The NikM protein is pfam10670.	0.000640696
NC_009439.1\|WP_012019692.1\|4145832_4146123_+\|hypothetical-protein	gnl\|CDD\|226420	COG3905, COG3905, Predicted transcriptional regulator [Transcription].	0.00150779
NC_009439.1\|WP_012019690.1\|4143545_4144088_-\|type-I-E-CRISPR-associated-protein-Cse2/CasB	gnl\|CDD\|237559	PRK13921, PRK13921, CRISPR-associated Cse2 family protein; Provisional.	2.39872e-84
NC_009439.1\|WP_012019681.1\|4133132_4134605_-\|AMP-nucleosidase	gnl\|CDD\|236222	PRK08292, PRK08292, AMP nucleosidase; Provisional.	0
NC_009439.1\|WP_012019689.1\|4142380_4143535_-\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	gnl\|CDD\|378153	pfam09344, Cas_CT1975, CT1975-like protein. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family is represented by CT1975 of Chlorobium tepidum.	1.39819e-151
NC_009439.1\|WP_041772963.1\|4130739_4132080_-\|PLP-dependent-aminotransferase-family-protein	gnl\|CDD\|224089	COG1167, ARO8, Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism].	1.24116e-87
NC_009439.1\|WP_012019685.1\|4139913_4140213_-\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	gnl\|CDD\|236930	PRK11558, PRK11558, putative ssRNA endonuclease; Provisional.	3.14917e-65
NC_009439.1\|WP_012019680.1\|4132160_4133132_+\|threonine-dehydratase	gnl\|CDD\|235699	PRK06110, PRK06110, threonine dehydratase.	0
NC_009439.1\|WP_012019684.1\|4136706_4137450_+\|carbonic-anhydrase	gnl\|CDD\|239398	cd03124, alpha_CA_prokaryotic_like, Carbonic anhydrase alpha, prokaryotic-like subfamily. Carbonic anhydrases (CAs) are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism: a nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site. They are ubiquitous enzymes involved in fundamental processes like photosynthesis, respiration, pH homeostasis and ion transport. Most alpha CAs are monomeric enzymes. The zinc ion is complexed by three histidines. This sub-family includes bacterial carbonic anhydrase alpha, as well as plant enzymes such as tobacco nectarin III and yam dioscorin and, carbonic anhydrases from molluscs, such as nacrein, which are part of the organic matrix layer in shells. Other members of this family may be involved in maintaining pH balance, in facilitating transport of carbon dioxide or carbonic acid, or in sensing carbon dioxide levels in the environment. Dioscorin is the major storage protein of yam tubers and may play a role as an antioxidant. Tobacco Nectarin may play a role in the maintenace of pH and oxidative balance in nectar. Mollusc nacrein may participate in calcium carbonate crystal formation of the nacreous layer. This subfamily also includes three alpha carbonic anhydrases from Chlamydomonas reinhardtii (CAH 1-3). CAHs1-2 are localized in the periplasmic space. CAH1 faciliates the movement of carbon dioxide across the plasma membrane when the medium is alkaline. CAH3 is localized to the thylakoid lumen and provides CO2 to Rubisco.	8.9459e-100
NC_009439.1\|WP_012019694.1\|4146403_4149061_-\|CRISPR-associated-helicase/endonuclease-Cas3	gnl\|CDD\|182031	PRK09694, PRK09694, CRISPR-associated helicase/endonuclease Cas3.	4.82789e-98

>NC_009439.1|WP_012019684.1|4136706_4137450_+|carbonic-anhydrase
MKKTLIVALTALFATGAMAAEQQPHWSYNGKEGPEHWAQLDTGYETCAIGHAQSPIDIRNATRASLPRIAFDYQASPAEVVNNGHTVQVNLANAGGIEIDGKPYRLVQFHFHTPSEEHIAGQAFPMVAHLVHQASDGRLAVVAVLFKEGAQNQALGQVFDTMPPKAGEKVELAGSFTPQAVLPQQQGYYAFAGSLTTPPCSENVQWRVLKQPVELSHAQLEQFQHLYAMNARPIQALYDREVLESDD
>NC_009439.1|WP_012019683.1|4135486_4136170_-|energy-coupling-factor-ABC-transporter-permease
MHIEPGVVEGAKIFLSYATAVGAFGLTAKLARDAIRDNGGVTALALRSLLTTALVFCFFEVLPHHPMGVSEVHLILGSTLLLLFGAGAAAIGLAAGLLLQGVLFAQFDLPQYGMNVTTLLLPLWGISLLAKRIVAPGTAYVDLSYKQALALSTAYQGGIVAWVAFWAFYGQGFAGENLVAVASFGLAYMSVILVEPLIDLGVLAAAKALSRFSQGPLFNVRLHHSAA
>NC_009439.1|WP_012019682.1|4134738_4135476_+|hypothetical-protein
MPRAIAPLLLALLCCCAQAGELDGHYRATLDGQPSELILRQNGDAVEGEYLENQRLRLIVKGRYDGELLRAEISEPQSGLLLANMNATYANAMLNTSIAARDPRNGQVLERQALFQRVAAAPAAQTPPAATSGKQDPALIGTWVHEKIINSGGASFASFTTLMTLQLNADGSVTQWTRSIGGGSDWSYDSPGEVQYSGHWRSQDGMLLVRLAGAADYQPAAYYRFSDQYLVTESNTGKMIWQRRR
>NC_009439.1|WP_012019681.1|4133132_4134605_-|AMP-nucleosidase
MKPCSDDFVIAHTPEEAVDRLSALHLQATNALSRALKRYLKERIRPDASEHCLFRYPELRLTYLCQGEVPTTVRAYAKVQVPGTYAITVTQPAAFRKYLLEQLRPLMNDFTLRVEVGVSQQNIPYPYVVEQGDELAGSGVTAAELARVFPSTDLSAATDGTADGLYDWENIDPLPLALFDAARTDFSLRRLVHYTGSDWRHVQPWILLTNYHRYVDQFVRHGLDMLVGDSRFTRMVLPGNVVIERGMAEGEMQAIIENVVWHRYQMPAYHLLAADGHGITLVNIGVGPSNAKNITDHLAVLRPHCWLMIGHCGGLRQSQTIGDYVLAHAYMRRDGILDRVLPPNIPLPALAEVQQALQEAAKLVTGEQGDELKKRLRTGTVLTYDDRNWELRWAQERPLINLARAVAVDMESGTIAAQGYRLRVPYGTLLCVSDKPLHSEIKLPGAAGAFYERAVNQHLRIGIAALELMRNQLDSLHSRKLRSFDEPPFR
>NC_009439.1|WP_012019680.1|4132160_4133132_+|threonine-dehydratase
MFDLAQLRQSAQLVHRHMAPTPQLAWPLLAQRLGCEVWVKHENHAPTAAFKVRGGLVYIDALLRREPQVRGLVTATRGNHGQSLALAARQAGLAIRILVPHGNAREKNAAMRALGAEVIEHGRDFDEARAEAARLAERDGLHWVPSLHEDLVRGVATYALELLEAVPNLRRVYVPIGLGSGICGMIRTRDLLGLDTEIVGVVASGADAYAQSFEQGREVQTERADTLADGMACRQPQPLALDMIRAGAARIVRVSDEEIRAAIRAYHEDTHNLAEGAGAAALAALMQERERNAGQRVAVVLSGANIDRRALAELLLDEEAAAA
>NC_009439.1|WP_041772963.1|4130739_4132080_-|PLP-dependent-aminotransferase-family-protein
MWLPDLQDSALPTYLALVEAIATAIGRGELKPGERLPPQRRLAWTLGINPSTVMLAYREAARRHLVSGEVGRGTYVLAGSREASLFRLKQPAAQGELIDLSTNVPVHDPDNRDLSASLAALAARGELDALQAYPSAALVERAHLAGATWLRRRGLELAPNGLLLCAGAQQGVSAALLALCEAGEPILVERYTAPGIKAAARQLRLPLHGVAMDERGILPDDLDRQARATGARVAVLTPCLQNPTGASLDTERRAAIAEVARRRGLWIVEDDVYGVLGSAAPLAVQVPERCLLISSLSKSVAPGLRLGFIAGAPELLERIDPEAQATRWAVTPLSLALACEWVESGVAERRLAWQIEELQQRWRLAARVLGPRMPQGRAVAPHLWLDGAPPTGLAEACRQHGVEVVPAEVFAVEANPGHAVRVSLAAAASRVELKRALEGIVAAWPV
>NC_009439.1|WP_041773107.1|4130302_4130743_+|GNAT-family-N-acetyltransferase
MPLTLDTPSPAELPILLDIWEAAVRATHHFLPESDLQVIKPLLREQYFPAVRLTCARDDAGRILGFLGTAEGMVEMLFVDPACHGQGVGKRLMLHAIDELGATRVDVNEQNPQAVGFYQHLGFVVTDRSRLDGGGRPFPILHMSLG
>NC_009439.1|WP_012019677.1|4129204_4130236_+|NAD(P)-dependent-alcohol-dehydrogenase
MSSSAELATFSGWAATAPKAPLERHSYDPGPLGAEEVEIAVEYCGICHSDQSMIDNEWGNARYPFIPGHEVVGTVVRLGEQARGLALGQRVGIGWYKGSCMHCGSCMEGSHQLCRSVKPTIVGSHGGFADRLRSHWAWAVPLPDGLDPALVGPLFCAGSTVFSPLLEFDIKPTDRVGVVGIGGLGHLALRFLNAWGCEVTAFTSSLNKQDEAKRLGAHKVVASTDSAAMKAIAGTLDFLLVTASADLDWQALIATLRGKGRLHFVGIVPSAIPVHVFNLIPQQKSLSGSPVGSPSTMATMLEFCARHQILPQVEQFPMSQVNAAIDHLRSGKARYRVVLDASK
>NC_009439.1|WP_012019676.1|4128459_4129080_-|pseudouridine-synthase
MSRPRPPASRRPATPHRVAKAPPAQPRLILLNKPFDVLTQFNDEQGRATLKDFVEVPGVYPAGRLDRDSEGLLLLTNDGRLQARIADPRHKLAKTYWVQVEGEPSEAQLQQLRDGVTLNDGPTLPAEARLLDEPQLWDRHPPVRFRKSVPTSWLELVIREGRNRQVRRMTAAVGLPTLRLVRVAIGPWALNGLQPGQWCEVPALLP
>NC_009439.1|WP_012019675.1|4127861_4128254_+|globin
MSAANLVMQSYGRCCASPAFFDDFYRHFLASSPLIREKFVNTDMSAQKQLLRQGIMNLVMHARGMPDTKLRALGESHSRQRLDIRPELYDLWLDALLLTISEHDKECDADIRQAWREVLNKGIAVIKGGY
>NC_009439.1|WP_012019685.1|4139913_4140213_-|type-I-E-CRISPR-associated-endoribonuclease-Cas2
MSFLVVVTENVPPRLRGRMAIWLLEVRAGVYIGDVSKRTREMIWEQLSQGHEDGNVVMAWASNHESGYEFQTLGPNRRLPVEFDGLHLVAFHPPENPDL
>NC_009439.1|WP_041772964.1|4140212_4141100_-|type-I-E-CRISPR-associated-endonuclease-Cas1
MKDRVSMIFVQYGQIDVQDGAFVVIDKTGVRMHIPVGSVACIMLEPGTRVSHAAVHLASTVGTLLVWVGESGVRLYASGQPGGARADRLLYQAKLALDDELRLKVVRKMYELRFQEPAPARRSVEQLRGIEGSRVRETYKLLAKQYGVDWRARNYDRNEWDAADIPNRCLSAATSCLYGITEAAVLAAGYAPAVGFIHTGKPLSFVYDIADLFKFETVVPLAFRIAAKAPHQPEREVRLGCRDLFRSSKILAKIIPTIEEVLSAGGISPPEAPPESVPPAIPNPESIGDAGHRAQ
>NC_009439.1|WP_012019687.1|4141126_4141741_-|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE
MYLTRLTLDPRSAQARRDLADAYEMHRTLARAFVTDEHSAPARFLWRLEAGSNAWATPVVLVQSTLAGDWSALQVLPNYLQREIESKPLEFQAWMEGGARYRFRLLANPTVTRQGKRYGLAGEQEQLAWLSRQGERHGFEVEAALVTASDVLASHKGDSRISLQRVCFEGRLQVRELASFSGALQQGIGPGKAFGCGLLSLGRC
>NC_009439.1|WP_012019688.1|4141715_4142378_-|type-I-E-CRISPR-associated-protein-Cas5/CasD
MATLLLRLQGPMQSWGTTSRFDERDTQLEPSKSGVLGLVCAALGRDRHEPVEDLAALRMGVRVDHEGAPMRDYQTATGVLIATGKSDLRRTVVSPRYYLADAAFLVGLEGTDDALLARIHAALRAPHWPLALGRKSFAPGMPVWLPDGLSSLSLEEALAQYPRLSGARRADSQPTLRCLLEDAQEGAIRLDQPVAPFAERRFGPRFVKSEVLHVPDQTDA
>NC_009439.1|WP_012019689.1|4142380_4143535_-|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC
MSLFVEFHLIQNFAPSNLNRDDTGAPKDALFGGHRRARVSSQCFKRAIRLAAQEHELVAPEFRGVRTKKLKTLLLERLAGRDPLEAEGKIEVALAAAGLKLKDDGKTEYLLFLGEAEIAGFATLIEQHWDELAGAPAGGEKKGEKKGKKEAKASAPAEVVKKAKALLDGGKAVDVALFGRMLADMPEVNQDAACQVAHAISTHRVEREFDYFTAVDDKGGPDETGAGMIGQVEFNSATLYRYAVVDAGKLLGNLQQDRELTLSALEAFTQAMVRAIPTGKQNTFAAHNLPSFVGVCLRHAGPLNLANAFEKPIAARQDAALSSLSVTELAKHEGKLAAVYADASDQWAYLDLSEAWPQQKGFAVQNLGELASWVRMQVAAQLEG
>NC_009439.1|WP_012019690.1|4143545_4144088_-|type-I-E-CRISPR-associated-protein-Cse2/CasB
MSEFAQSFIAHLQRLQERDRGTMATLRRSLSFEPGCYPPAYPYVERFVAAERHAQDASRLALYLTAGLYAAHPHHGARSLASSLGELMRKRDSASIEQRFIALLGADAENLAVYLRQIISLLAADDRPLDYGVLLRDLSVWLNPRIDAERRDNVRQRWARDFYRALAAPAADTPEQAAND
>NC_009439.1|WP_041772965.1|4144084_4145626_-|type-I-E-CRISPR-associated-protein-Cse1/CasA
MDEAFTLLDEPWLAVRMHDGQVGELGLLELFERSGEIGALAETSPPSLIAQYRLLLAITHRAITQAQGRWTDAERMRWHQNGLPLAAIRDYLERWRERFWLFHPQYPFMQVAALADAEETRDKLKPWTQISLASANGNAPVVFDHSCDLAPRSIGAADALCTLLGFLQFTPGGLVKTLRDSDKAGALANTAAVMPMGDSLAQSLCLALHPPTQTGHEDLPAWERSAPSIAQLCGEPELATGPNDRYTRQSRAVLLLADDERRVQWIRFAAGLALGDDVQAPDPMASYRAGSNSLVRLSFTEGRALWRDLPALLPDAEGKASQPAAVLEWAANLQFYLGNGVQPLLIAGLASDQAKLLRWRSERIALPAKLLASPDHANELRRYVRDAEELFSALRKLATGMLAETLPDPGSKDTWARARSLIDAGPASALFFAGAERQLGRVMALLGSDELDQAEALWRQSLHKAAHEAWQTVLTDLGRGAKALRAEARHYPRLLGLLGPLRETPTPDKEVRA
>NC_009439.1|WP_012019692.1|4145832_4146123_+|hypothetical-protein
MSEATFTFRVDEALKSEFAQAAKARDRTGAQLLRDFMRDFVRQQQEAAEHDAWLRRQVQMGLDSANAGELLSSEEVEAEAAAWRAEMRRKMDSSAS
>NC_009439.1|WP_012019693.1|4146119_4146401_+|type-II-toxin-antitoxin-system-mRNA-interferase-toxin,-RelE/StbE-family
MRLAWTRLALNDRKAIRSYIAQDNPMAALALDELFAEKASRLADHPGLGRAGRVSGTRELVVHQHYLMIYDLANDQVRILRVLHTARLWPSAD
>NC_009439.1|WP_012019694.1|4146403_4149061_-|CRISPR-associated-helicase/endonuclease-Cas3
MKGFVDLSDRARRLWAKSGDGFGHGVLAHLLDVAAVAERMLAHEPASTLDWAAQALGLEREHVARWVACLVGLHDFGKAIPGFQDKWLEGRQTDETLGLAFPARSLGVTDHACASAALLWEHLPRRGVRHMLWIRHALQAISAHHGYNFNQTELNRGKPSFEPPAWNEARGELFEAYWGVLAPPGAPQLEELAQPAVQWLAGLTSVADWIGSNPEWFPLGERHALLAEHHADACSRADQALQQIGWRPFQSLLTAPSTTDRLIGQIVQRPELTARPLQSEADRLLEGVRGPALLLVEAPMGEGKTELAFLAHLRLQAANQHRGLYVALPTQATGNALFSRALTFLHGFAADTALDVQLVHGGAALNEQVLKLRGIYGASGDSVASSAWFSQRRRPLLSPYGVGTVDQALFATLNVKHHFVRLWGLSNRVVVLDEVHAYDTYTSGLIEALLRWLKALGSSVVLMSATLPVPRRDALLRAWGVEVDEVPELAYPRLLLADERGLQGATCDSRPLSPIQLQAVAEDLDSLTAKAQLLVQQGGCGALIVNTVDRAQNVYLKLKAELGDAMPLLLFHARFPADQRSEQERAVLARFGQGGERPAKALLIATQVAEQSLDIDFDFMLTDLAPVDLILQRAGRLHRHQRERPEAHRQAILYVAGLDPAALPDLKSTAWEYVYEPYILGRTWALLSREQELHLPHDIDRLVQAVYDGENLPADLAETDRAFIEDHAYGAYLGKRQTERMMALNVAVDPQAEPQNAYTQKNRGYEEGEEGLGLPNYTRLGDDSVTLIPVHQVPGGWSLTPGGDAFDPDQLLSNALAKQLHVRQLKTSRPALVKHALGEDSPRAFSEHPLLRHLKPLLLTDGYLQIGRLTVRLDDELGLVYQRDA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_009439_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_009439_3

4149157-4150162

TypeI-E

I-E

Consensus_repeat	Method
CGGTTCATCCCCGCTGGCGCGGGGAACAC	CRISPRCasFinder
CGGTTCATCCCCGCTGGCGCGGGGAACAC	CRT
CGGTTCATCCCCGCTGGCGCGGGGAACAC	PILER-CR

16 spacers

cas3,cas8e,cse2gr11,cas7,cas5,cas6e,cas1,cas2

The CRISPR arrays of NC_009439_3

>merge|NC_009439|3|4149157-4150162|CRISPRCasFinder,CRT,PILER-CR
TTTTCCATCCCCGCATGTGCAGGGAACACATCTATTGCGGCATGTTCGCCGGTATCGGCTTCGGTTCAGCCCCGCTGGCGCGGGGAACACGCGCTGATCGACTGCAACGCGTTCTACTGCAGCGGTTCATCCCCGCTGGCGCGGGGAACACTGGTCTGGCCTGGCGTGCCAGCTCTTGGCGGTGCGGTTCATCCCCGCTGGCGCGGGGAACACTTTATCCAGGCGGCGGGGGCGGTGGGCAGCACCGGTTCATCCCCGCTGGCGCGGGGAACACGCGCCGGCGCCGCAGAGCCTGGCCGGCCGAGACGGTTCATCCCCGCTGGCGCGGGGAACACGCGGCCATTGAGCTTGCAATCGAACAGGGCACCGGTTCATCCCCGCTGGCGCGGGGAACACATCGTCGGCGGCGCTGACGTGTACGTGTCGGACGGTTCATCCCCGCTGGCGCGGGGAACACGGTCAGCCGATCACGCGGCTCAGAAATCCAGGCGGTTCATCCCCGCTGGCGCGGGGAACACCTGGTCTGTCGCCGCTCTCCGCACTGTCTGGCCGGTTCATCCCCGCTGGCGCGGGGAACACTCGAACATTTCCCACTCGCTCGCCTTCATGATCGGTTCATCCCCGCTGGCGCGGGGAACACAAAAAGCCCGGCTCCGGGCCGGGCTTTCCTGACGGTTCATCCCCGCTGGCGCGGGGAACACAAAAAGCCCGGCTCCGGGCCGGGCTTTCCTGACGGTTCATCCCCGCTGGCGCGGGGAACACCGCGGCGGCGCCGACGTCATGCACGGCCGGCCCGGTTCATCCCCGCTGGCGCGGGGAACACGAAGGCCTGGCAGTGAAGCTCGACAACGGCCGCGGTTCATCCCCGCTGGCGCGGGGAACACTCCTCGGTGAGGGCGGCGATCACATCGGCTGCCGGTTCATCCCCGCTGGCGCGGGGAACACGGCTCGGCGGTCATCCACATCGCTACAGGTGACGGTTCATCCCCGCTGGCGCGGGGAACAC

>NC_009439|3|3|4149157-4150162|CRISPRCasFinder
TTTTCCATCCCCGCATGTGCAGGGAACAC	ATCTATTGCGGCATGTTCGCCGGTATCGGCTT
CGGTTCAGCCCCGCTGGCGCGGGGAACAC	GCGCTGATCGACTGCAACGCGTTCTACTGCAG
CGGTTCATCCCCGCTGGCGCGGGGAACAC	TGGTCTGGCCTGGCGTGCCAGCTCTTGGCGGTG
CGGTTCATCCCCGCTGGCGCGGGGAACAC	TTTATCCAGGCGGCGGGGGCGGTGGGCAGCAC
CGGTTCATCCCCGCTGGCGCGGGGAACAC	GCGCCGGCGCCGCAGAGCCTGGCCGGCCGAGA
CGGTTCATCCCCGCTGGCGCGGGGAACAC	GCGGCCATTGAGCTTGCAATCGAACAGGGCAC
CGGTTCATCCCCGCTGGCGCGGGGAACAC	ATCGTCGGCGGCGCTGACGTGTACGTGTCGGA
CGGTTCATCCCCGCTGGCGCGGGGAACAC	GGTCAGCCGATCACGCGGCTCAGAAATCCAGG
CGGTTCATCCCCGCTGGCGCGGGGAACAC	CTGGTCTGTCGCCGCTCTCCGCACTGTCTGGC
CGGTTCATCCCCGCTGGCGCGGGGAACAC	TCGAACATTTCCCACTCGCTCGCCTTCATGAT
CGGTTCATCCCCGCTGGCGCGGGGAACAC	AAAAAGCCCGGCTCCGGGCCGGGCTTTCCTGA
CGGTTCATCCCCGCTGGCGCGGGGAACAC	AAAAAGCCCGGCTCCGGGCCGGGCTTTCCTGA
CGGTTCATCCCCGCTGGCGCGGGGAACAC	CGCGGCGGCGCCGACGTCATGCACGGCCGGCC
CGGTTCATCCCCGCTGGCGCGGGGAACAC	GAAGGCCTGGCAGTGAAGCTCGACAACGGCCG
CGGTTCATCCCCGCTGGCGCGGGGAACAC	TCCTCGGTGAGGGCGGCGATCACATCGGCTGC
CGGTTCATCCCCGCTGGCGCGGGGAACAC	GGCTCGGCGGTCATCCACATCGCTACAGGTGA
CGGTTCATCCCCGCTGGCGCGGGGAACAC

>NC_009439|3|2|4149157-4150162|CRT
TTTTCCATCCCCGCATGTGCAGGGAACAC	ATCTATTGCGGCATGTTCGCCGGTATCGGCTT
CGGTTCAGCCCCGCTGGCGCGGGGAACAC	GCGCTGATCGACTGCAACGCGTTCTACTGCAG
CGGTTCATCCCCGCTGGCGCGGGGAACAC	TGGTCTGGCCTGGCGTGCCAGCTCTTGGCGGTG
CGGTTCATCCCCGCTGGCGCGGGGAACAC	TTTATCCAGGCGGCGGGGGCGGTGGGCAGCAC
CGGTTCATCCCCGCTGGCGCGGGGAACAC	GCGCCGGCGCCGCAGAGCCTGGCCGGCCGAGA
CGGTTCATCCCCGCTGGCGCGGGGAACAC	GCGGCCATTGAGCTTGCAATCGAACAGGGCAC
CGGTTCATCCCCGCTGGCGCGGGGAACAC	ATCGTCGGCGGCGCTGACGTGTACGTGTCGGA
CGGTTCATCCCCGCTGGCGCGGGGAACAC	GGTCAGCCGATCACGCGGCTCAGAAATCCAGG
CGGTTCATCCCCGCTGGCGCGGGGAACAC	CTGGTCTGTCGCCGCTCTCCGCACTGTCTGGC
CGGTTCATCCCCGCTGGCGCGGGGAACAC	TCGAACATTTCCCACTCGCTCGCCTTCATGAT
CGGTTCATCCCCGCTGGCGCGGGGAACAC	AAAAAGCCCGGCTCCGGGCCGGGCTTTCCTGA
CGGTTCATCCCCGCTGGCGCGGGGAACAC	AAAAAGCCCGGCTCCGGGCCGGGCTTTCCTGA
CGGTTCATCCCCGCTGGCGCGGGGAACAC	CGCGGCGGCGCCGACGTCATGCACGGCCGGCC
CGGTTCATCCCCGCTGGCGCGGGGAACAC	GAAGGCCTGGCAGTGAAGCTCGACAACGGCCG
CGGTTCATCCCCGCTGGCGCGGGGAACAC	TCCTCGGTGAGGGCGGCGATCACATCGGCTGC
CGGTTCATCCCCGCTGGCGCGGGGAACAC	GGCTCGGCGGTCATCCACATCGCTACAGGTGA
CGGTTCATCCCCGCTGGCGCGGGGAACAC

>NC_009439|3|2|4149218-4150162|PILER-CR
CGGTTCAGCCCCGCTGGCGCGGGGAACAC	GCGCTGATCGACTGCAACGCGTTCTACTGCAG
CGGTTCATCCCCGCTGGCGCGGGGAACAC	TGGTCTGGCCTGGCGTGCCAGCTCTTGGCGGTG
CGGTTCATCCCCGCTGGCGCGGGGAACAC	TTTATCCAGGCGGCGGGGGCGGTGGGCAGCAC
CGGTTCATCCCCGCTGGCGCGGGGAACAC	GCGCCGGCGCCGCAGAGCCTGGCCGGCCGAGA
CGGTTCATCCCCGCTGGCGCGGGGAACAC	GCGGCCATTGAGCTTGCAATCGAACAGGGCAC
CGGTTCATCCCCGCTGGCGCGGGGAACAC	ATCGTCGGCGGCGCTGACGTGTACGTGTCGGA
CGGTTCATCCCCGCTGGCGCGGGGAACAC	GGTCAGCCGATCACGCGGCTCAGAAATCCAGG
CGGTTCATCCCCGCTGGCGCGGGGAACAC	CTGGTCTGTCGCCGCTCTCCGCACTGTCTGGC
CGGTTCATCCCCGCTGGCGCGGGGAACAC	TCGAACATTTCCCACTCGCTCGCCTTCATGAT
CGGTTCATCCCCGCTGGCGCGGGGAACAC	AAAAAGCCCGGCTCCGGGCCGGGCTTTCCTGA
CGGTTCATCCCCGCTGGCGCGGGGAACAC	AAAAAGCCCGGCTCCGGGCCGGGCTTTCCTGA
CGGTTCATCCCCGCTGGCGCGGGGAACAC	CGCGGCGGCGCCGACGTCATGCACGGCCGGCC
CGGTTCATCCCCGCTGGCGCGGGGAACAC	GAAGGCCTGGCAGTGAAGCTCGACAACGGCCG
CGGTTCATCCCCGCTGGCGCGGGGAACAC	TCCTCGGTGAGGGCGGCGATCACATCGGCTGC
CGGTTCATCCCCGCTGGCGCGGGGAACAC	GGCTCGGCGGTCATCCACATCGCTACAGGTGA
CGGTTCATCCCCGCTGGCGCGGGGAACAC

Protein	Signature genes	Signature genes Name	Protein_function
NC_009439.1\|WP_012019696.1\|4152671_4155080_-\|hybrid-sensor-histidine-kinase/response-regulator	unknown	unknown	gnl\|CDD\|274362
NC_009439.1\|WP_012019700.1\|4159781_4160942_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340883
NC_009439.1\|WP_012019699.1\|4158183_4158951_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224045
NC_009439.1\|WP_012019693.1\|4146119_4146401_+\|type-II-toxin-antitoxin-system-mRNA-interferase-toxin,-RelE/StbE-family	unknown	unknown	gnl\|CDD\|368240
NC_009439.1\|WP_041772965.1\|4144084_4145626_-\|type-I-E-CRISPR-associated-protein-Cse1/CasA	cas8e	pfam09481_cas8e_CAS-I-E	gnl\|CDD\|187860
NC_009439.1\|WP_003240253.1\|4158944_4159691_-\|siderophore-ferric-iron-reductase	unknown	unknown	gnl\|CDD\|274874
NC_009439.1\|WP_012019687.1\|4141126_4141741_-\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	cas6e	pfam08798_cas6e_CAS-I-E:CAS-IV	gnl\|CDD\|187858
NC_009439.1\|WP_012019694.1\|4146403_4149061_-\|CRISPR-associated-helicase/endonuclease-Cas3	cas3	cd09639_cas3_CAS-I	gnl\|CDD\|182031
NC_009439.1\|WP_012019695.1\|4150246_4151896_-\|acyl-CoA-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|183199
NC_009439.1\|WP_041772964.1\|4140212_4141100_-\|type-I-E-CRISPR-associated-endonuclease-Cas1	cas1	cd09719_cas1_CAS-I-E	gnl\|CDD\|274693
NC_009439.1\|WP_012019697.1\|4155317_4156208_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|236719
NC_009439.1\|WP_012019702.1\|4161879_4162509_+\|thiamine-phosphate-synthase	unknown	unknown	gnl\|CDD\|234590
NC_009439.1\|WP_012019701.1\|4161085_4161883_+\|hydroxymethylpyrimidine/phosphomethylpyrimidine-kinase	unknown	unknown	gnl\|CDD\|180561
NC_009439.1\|WP_012019692.1\|4145832_4146123_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226420
NC_009439.1\|WP_012019690.1\|4143545_4144088_-\|type-I-E-CRISPR-associated-protein-Cse2/CasB	cse2gr11	pfam09485_cse2gr11_CAS-I-E	gnl\|CDD\|237559
NC_009439.1\|WP_012019689.1\|4142380_4143535_-\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	cas7	pfam09344_cas7_CAS-I-E	gnl\|CDD\|378153
NC_009439.1\|WP_003240263.1\|4151892_4152534_-\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|184958
NC_009439.1\|WP_012019685.1\|4139913_4140213_-\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	cas2	cd09648_cas2_CAS-I-E	gnl\|CDD\|236930
NC_009439.1\|WP_012019688.1\|4141715_4142378_-\|type-I-E-CRISPR-associated-protein-Cas5/CasD	cas5	cd09756_cas5_CAS-I-E	gnl\|CDD\|273842
NC_009439.1\|WP_012019698.1\|4156204_4158181_-\|Fe(3+)-hydroxamate-ABC-transporter-permease-FhuB	unknown	unknown	gnl\|CDD\|236720

Protein	Function_ID	Function_description	E-value
NC_009439.1\|WP_012019696.1\|4152671_4155080_-\|hybrid-sensor-histidine-kinase/response-regulator	gnl\|CDD\|274362	TIGR02956, sensor_protein_TorS, TMAO reductase sytem sensor TorS. This protein, TorS, is part of a regulatory system for the torCAD operon that encodes the pterin molybdenum cofactor-containing enzyme trimethylamine-N-oxide (TMAO) reductase (TorA), a cognate chaperone (TorD), and a penta-haem cytochrome (TorC). TorS works together with the inducer-binding protein TorT and the response regulator TorR. TorS contains histidine kinase ATPase (pfam02518), HAMP (pfam00672), phosphoacceptor (pfam00512), and phosphotransfer (pfam01627) domains and a response regulator receiver domain (pfam00072). [Signal transduction, Two-component systems].	2.31862e-78
NC_009439.1\|WP_012019700.1\|4159781_4160942_-\|MFS-transporter	gnl\|CDD\|340883	cd17325, MFS_MdtG_SLC18_like, bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily of transporters. This family is composed of eukaryotic solute carrier 18 (SLC18) family transporters and related bacterial multidrug resistance (MDR) transporters including several proteins from Escherichia coli such as multidrug resistance protein MdtG, from Bacillus subtilis such as multidrug resistance proteins 1 (Bmr1) and 2 (Bmr2), and from Staphylococcus aureus such as quinolone resistance protein NorA. The family also includes Escherichia coli arabinose efflux transporters YfcJ and YhhS. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The SLC18 transporter family includes vesicular monoamine transporters (VAT1 and VAT2), vesicular acetylcholine transporter (VAChT), and SLC18B1, which is proposed to be a vesicular polyamine transporter (VPAT). The MdtG/SLC18 family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	2.42141e-20
NC_009439.1\|WP_012019699.1\|4158183_4158951_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224045	COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism].	5.05111e-102
NC_009439.1\|WP_012019693.1\|4146119_4146401_+\|type-II-toxin-antitoxin-system-mRNA-interferase-toxin,-RelE/StbE-family	gnl\|CDD\|368240	pfam05016, ParE_toxin, ParE toxin of type II toxin-antitoxin system, parDE. ParE is the toxin family of a type II toxin-antitoxin family. It is toxic towards DNA gyrase, but is neutralized by the antitoxin ParD. The family also encompasses RelE/ParE described in.	1.25025e-15
NC_009439.1\|WP_041772965.1\|4144084_4145626_-\|type-I-E-CRISPR-associated-protein-Cse1/CasA	gnl\|CDD\|187860	cd09729, Cse1_I-E, CRISPR/Cas system-associated protein Cse1. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Large proteins, some contain Zn-finger domain; subunit of the Cascade complex; signature gene for I-E subtype; also known as Cse1/CasA/YgcL family.	5.1149e-115
NC_009439.1\|WP_003240253.1\|4158944_4159691_-\|siderophore-ferric-iron-reductase	gnl\|CDD\|274874	TIGR03950, hypothetical_protein, siderophore ferric iron reductase, AHA_1954 family. Members of this protein family are 2Fe-2S cluster binding proteins, found regularly in the context of siderophore transporters. Members are distantly related to FhuF from E. coli, a ferric iron reductase linked to removal of iron from hydroxamate-type siderophores (). [Energy metabolism, Electron transport, Transport and binding proteins, Cations and iron carrying compounds].	4.8547e-92
NC_009439.1\|WP_012019687.1\|4141126_4141741_-\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	gnl\|CDD\|187858	cd09727, Cas6_I-E, CRISPR/Cas system-associated RAMP superfamily protein Cas6e. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas6e is an endoribonuclease that generates crRNA; This family is specific for CRISPR/Cas system I-E subtype; Homologous to Cas6 (RAMP superfamily protein); Possesses double RRM/ferredoxin fold; also known as Cse3 family.	1.24569e-69
NC_009439.1\|WP_012019694.1\|4146403_4149061_-\|CRISPR-associated-helicase/endonuclease-Cas3	gnl\|CDD\|182031	PRK09694, PRK09694, CRISPR-associated helicase/endonuclease Cas3.	4.82789e-98
NC_009439.1\|WP_012019695.1\|4150246_4151896_-\|acyl-CoA-dehydrogenase-family-protein	gnl\|CDD\|183199	PRK11561, PRK11561, isovaleryl CoA dehydrogenase; Provisional.	5.96404e-168
NC_009439.1\|WP_041772964.1\|4140212_4141100_-\|type-I-E-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|274693	TIGR03638, cas1_ECOLI, CRISPR-associated endonuclease Cas1, subtype I-E/ECOLI. The CRISPR-associated protein Cas1 is virtually universal to CRISPR systems. CRISPR, an acronym for Clustered Regularly Interspaced Short Palindromic Repeats, is prokaryotic immunity system for foreign DNA, mostly from phage. CRISPR systems belong to different subtypes, distinguished by both nature of the repeats, the makeup of the cohort of associated Cas proteins, and by molecular phylogeny within the more universal Cas proteins such as this one. This model is of type EXCEPTION and provides more specific information than the EQUIVALOG model TIGR00287. It describes the Cas1 protein particular to the ECOLI subtype of CRISPR/Cas system.	1.37572e-152
NC_009439.1\|WP_012019697.1\|4155317_4156208_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|236719	PRK10576, PRK10576, Fe(3+)-hydroxamate ABC transporter substrate-binding protein FhuD.	2.2238e-46
NC_009439.1\|WP_012019702.1\|4161879_4162509_+\|thiamine-phosphate-synthase	gnl\|CDD\|234590	PRK00043, thiE, thiamine phosphate synthase.	1.21255e-71
NC_009439.1\|WP_012019701.1\|4161085_4161883_+\|hydroxymethylpyrimidine/phosphomethylpyrimidine-kinase	gnl\|CDD\|180561	PRK06427, PRK06427, bifunctional hydroxy-methylpyrimidine kinase/ hydroxy-phosphomethylpyrimidine kinase; Reviewed.	1.27771e-114
NC_009439.1\|WP_012019692.1\|4145832_4146123_+\|hypothetical-protein	gnl\|CDD\|226420	COG3905, COG3905, Predicted transcriptional regulator [Transcription].	0.00150779
NC_009439.1\|WP_012019690.1\|4143545_4144088_-\|type-I-E-CRISPR-associated-protein-Cse2/CasB	gnl\|CDD\|237559	PRK13921, PRK13921, CRISPR-associated Cse2 family protein; Provisional.	2.39872e-84
NC_009439.1\|WP_012019689.1\|4142380_4143535_-\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	gnl\|CDD\|378153	pfam09344, Cas_CT1975, CT1975-like protein. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family is represented by CT1975 of Chlorobium tepidum.	1.39819e-151
NC_009439.1\|WP_003240263.1\|4151892_4152534_-\|TetR-family-transcriptional-regulator	gnl\|CDD\|184958	PRK14996, PRK14996, TetR family transcriptional regulator; Provisional.	1.47385e-09
NC_009439.1\|WP_012019685.1\|4139913_4140213_-\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	gnl\|CDD\|236930	PRK11558, PRK11558, putative ssRNA endonuclease; Provisional.	3.14917e-65
NC_009439.1\|WP_012019688.1\|4141715_4142378_-\|type-I-E-CRISPR-associated-protein-Cas5/CasD	gnl\|CDD\|273842	TIGR01868, hypothetical_protein, CRISPR-associated protein Cas5/CasD, subtype I-E/ECOLI. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family is part of the ECOLI subtype CRISPR/Cas locus, and now characterized as part of the CASCADE complex of that system. It shares a small N-terminal homology region with members of several other CRISPR/Cas subtypes, and we view the families that share this region as being Cas5.	1.465e-55
NC_009439.1\|WP_012019698.1\|4156204_4158181_-\|Fe(3+)-hydroxamate-ABC-transporter-permease-FhuB	gnl\|CDD\|236720	PRK10577, PRK10577, Fe(3+)-hydroxamate ABC transporter permease FhuB.	3.81625e-174

>NC_009439.1|WP_012019694.1|4146403_4149061_-|CRISPR-associated-helicase/endonuclease-Cas3
MKGFVDLSDRARRLWAKSGDGFGHGVLAHLLDVAAVAERMLAHEPASTLDWAAQALGLEREHVARWVACLVGLHDFGKAIPGFQDKWLEGRQTDETLGLAFPARSLGVTDHACASAALLWEHLPRRGVRHMLWIRHALQAISAHHGYNFNQTELNRGKPSFEPPAWNEARGELFEAYWGVLAPPGAPQLEELAQPAVQWLAGLTSVADWIGSNPEWFPLGERHALLAEHHADACSRADQALQQIGWRPFQSLLTAPSTTDRLIGQIVQRPELTARPLQSEADRLLEGVRGPALLLVEAPMGEGKTELAFLAHLRLQAANQHRGLYVALPTQATGNALFSRALTFLHGFAADTALDVQLVHGGAALNEQVLKLRGIYGASGDSVASSAWFSQRRRPLLSPYGVGTVDQALFATLNVKHHFVRLWGLSNRVVVLDEVHAYDTYTSGLIEALLRWLKALGSSVVLMSATLPVPRRDALLRAWGVEVDEVPELAYPRLLLADERGLQGATCDSRPLSPIQLQAVAEDLDSLTAKAQLLVQQGGCGALIVNTVDRAQNVYLKLKAELGDAMPLLLFHARFPADQRSEQERAVLARFGQGGERPAKALLIATQVAEQSLDIDFDFMLTDLAPVDLILQRAGRLHRHQRERPEAHRQAILYVAGLDPAALPDLKSTAWEYVYEPYILGRTWALLSREQELHLPHDIDRLVQAVYDGENLPADLAETDRAFIEDHAYGAYLGKRQTERMMALNVAVDPQAEPQNAYTQKNRGYEEGEEGLGLPNYTRLGDDSVTLIPVHQVPGGWSLTPGGDAFDPDQLLSNALAKQLHVRQLKTSRPALVKHALGEDSPRAFSEHPLLRHLKPLLLTDGYLQIGRLTVRLDDELGLVYQRDA
>NC_009439.1|WP_012019693.1|4146119_4146401_+|type-II-toxin-antitoxin-system-mRNA-interferase-toxin,-RelE/StbE-family
MRLAWTRLALNDRKAIRSYIAQDNPMAALALDELFAEKASRLADHPGLGRAGRVSGTRELVVHQHYLMIYDLANDQVRILRVLHTARLWPSAD
>NC_009439.1|WP_012019692.1|4145832_4146123_+|hypothetical-protein
MSEATFTFRVDEALKSEFAQAAKARDRTGAQLLRDFMRDFVRQQQEAAEHDAWLRRQVQMGLDSANAGELLSSEEVEAEAAAWRAEMRRKMDSSAS
>NC_009439.1|WP_041772965.1|4144084_4145626_-|type-I-E-CRISPR-associated-protein-Cse1/CasA
MDEAFTLLDEPWLAVRMHDGQVGELGLLELFERSGEIGALAETSPPSLIAQYRLLLAITHRAITQAQGRWTDAERMRWHQNGLPLAAIRDYLERWRERFWLFHPQYPFMQVAALADAEETRDKLKPWTQISLASANGNAPVVFDHSCDLAPRSIGAADALCTLLGFLQFTPGGLVKTLRDSDKAGALANTAAVMPMGDSLAQSLCLALHPPTQTGHEDLPAWERSAPSIAQLCGEPELATGPNDRYTRQSRAVLLLADDERRVQWIRFAAGLALGDDVQAPDPMASYRAGSNSLVRLSFTEGRALWRDLPALLPDAEGKASQPAAVLEWAANLQFYLGNGVQPLLIAGLASDQAKLLRWRSERIALPAKLLASPDHANELRRYVRDAEELFSALRKLATGMLAETLPDPGSKDTWARARSLIDAGPASALFFAGAERQLGRVMALLGSDELDQAEALWRQSLHKAAHEAWQTVLTDLGRGAKALRAEARHYPRLLGLLGPLRETPTPDKEVRA
>NC_009439.1|WP_012019690.1|4143545_4144088_-|type-I-E-CRISPR-associated-protein-Cse2/CasB
MSEFAQSFIAHLQRLQERDRGTMATLRRSLSFEPGCYPPAYPYVERFVAAERHAQDASRLALYLTAGLYAAHPHHGARSLASSLGELMRKRDSASIEQRFIALLGADAENLAVYLRQIISLLAADDRPLDYGVLLRDLSVWLNPRIDAERRDNVRQRWARDFYRALAAPAADTPEQAAND
>NC_009439.1|WP_012019689.1|4142380_4143535_-|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC
MSLFVEFHLIQNFAPSNLNRDDTGAPKDALFGGHRRARVSSQCFKRAIRLAAQEHELVAPEFRGVRTKKLKTLLLERLAGRDPLEAEGKIEVALAAAGLKLKDDGKTEYLLFLGEAEIAGFATLIEQHWDELAGAPAGGEKKGEKKGKKEAKASAPAEVVKKAKALLDGGKAVDVALFGRMLADMPEVNQDAACQVAHAISTHRVEREFDYFTAVDDKGGPDETGAGMIGQVEFNSATLYRYAVVDAGKLLGNLQQDRELTLSALEAFTQAMVRAIPTGKQNTFAAHNLPSFVGVCLRHAGPLNLANAFEKPIAARQDAALSSLSVTELAKHEGKLAAVYADASDQWAYLDLSEAWPQQKGFAVQNLGELASWVRMQVAAQLEG
>NC_009439.1|WP_012019688.1|4141715_4142378_-|type-I-E-CRISPR-associated-protein-Cas5/CasD
MATLLLRLQGPMQSWGTTSRFDERDTQLEPSKSGVLGLVCAALGRDRHEPVEDLAALRMGVRVDHEGAPMRDYQTATGVLIATGKSDLRRTVVSPRYYLADAAFLVGLEGTDDALLARIHAALRAPHWPLALGRKSFAPGMPVWLPDGLSSLSLEEALAQYPRLSGARRADSQPTLRCLLEDAQEGAIRLDQPVAPFAERRFGPRFVKSEVLHVPDQTDA
>NC_009439.1|WP_012019687.1|4141126_4141741_-|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE
MYLTRLTLDPRSAQARRDLADAYEMHRTLARAFVTDEHSAPARFLWRLEAGSNAWATPVVLVQSTLAGDWSALQVLPNYLQREIESKPLEFQAWMEGGARYRFRLLANPTVTRQGKRYGLAGEQEQLAWLSRQGERHGFEVEAALVTASDVLASHKGDSRISLQRVCFEGRLQVRELASFSGALQQGIGPGKAFGCGLLSLGRC
>NC_009439.1|WP_041772964.1|4140212_4141100_-|type-I-E-CRISPR-associated-endonuclease-Cas1
MKDRVSMIFVQYGQIDVQDGAFVVIDKTGVRMHIPVGSVACIMLEPGTRVSHAAVHLASTVGTLLVWVGESGVRLYASGQPGGARADRLLYQAKLALDDELRLKVVRKMYELRFQEPAPARRSVEQLRGIEGSRVRETYKLLAKQYGVDWRARNYDRNEWDAADIPNRCLSAATSCLYGITEAAVLAAGYAPAVGFIHTGKPLSFVYDIADLFKFETVVPLAFRIAAKAPHQPEREVRLGCRDLFRSSKILAKIIPTIEEVLSAGGISPPEAPPESVPPAIPNPESIGDAGHRAQ
>NC_009439.1|WP_012019685.1|4139913_4140213_-|type-I-E-CRISPR-associated-endoribonuclease-Cas2
MSFLVVVTENVPPRLRGRMAIWLLEVRAGVYIGDVSKRTREMIWEQLSQGHEDGNVVMAWASNHESGYEFQTLGPNRRLPVEFDGLHLVAFHPPENPDL
>NC_009439.1|WP_012019695.1|4150246_4151896_-|acyl-CoA-dehydrogenase-family-protein
MKPSLHAETHEVFNQVPSLDGANLYRLDLPLQEWVRRYDGAWAEERLSAYGALAGGALMQAGFLANENKPVFKSHDRYGNRIDLVEFHPAYHELMRTAIEHGLPSLPWTDPRAGAHVARAGLSYLHSQAESASGCPLTMTFAAVPAIRLQPNVAEQWLPKILASEYDPRNLPMEQKAGVTIGMAMTEKQGGTDVRANTTRAYPIGLGGPGQGYELVGHKWFCSAPMCDAFLTLAYTDKGLSCFLLPRHRPDGTRNQFYIQRLKNKLGNWANASSEVEYRGAFAWMLGEEGRGVPTIIEMVAMTRFDCMVGSSSLMRQALTQAAHHCAHRQVGGKLLADQPLMQNVLADLALESEAALALCMRMGRALDHLHDEQEDKFARLVTAVGKYWICKRAPEMVYEASECMGGAGYVEETIMPRLYREAPVNSIWEGSGNVQCLDVLRALSKEPGVLDALFDELGDGHGDARLKAHIQRLKTDFSDTADIQYRARQLTEDMAVALQAKLLLEAGNSVVSDAFIASRLEGRGRVYGTLPRGVDVEALVARSTPHLL
>NC_009439.1|WP_003240263.1|4151892_4152534_-|TetR-family-transcriptional-regulator
MAYRTTEARLDRDQALRERILACALQRVSAGGFAALTMQALADDVGIATGSLYRHFRSKGELAAEVFASASQREVDALAVQLRQPGSAAQRLREGLQQFAARAWHSRRLAFALIAEPVEPEVDEQRLLYREAYAELFIDLLEEGRRSGEFQVDQVGLVAACLVGAIAEALVGPLSPPARAARAAGHPSLELAQVSASLVTFCLRAVGAKESTR
>NC_009439.1|WP_012019696.1|4152671_4155080_-|hybrid-sensor-histidine-kinase/response-regulator
MYRLLLLFLSLVFSSLVGAVTFDEKMRALPLGQSMYVFEDVRGDASIDDVASPALQGSFRLHDKPVLNAGYSRSVFWLRLDLEYRPIQAQGPRNWLLELAYPPLDHLELYLPDDRGSFALAQRTGDALPFDTRQIRQNNYLFELNLEPGQSKRIYLRLESQGSIQAPLTLWAPNAYLEEQPGRIYVLGIIYGVLLVMLVYNLFIFLSVRDTSYLYYILYIASFGLYQVSVNGAGIEYFWPNSPWWANAATPFLIGSAALFGCQFARSFLHTAEHSSWVDRLLLLLMACGAVVMVLALSVSYATALRLATYLALLFTVVIFAAGVLAWLRGMRVARYFIFAWTAFLAGGIVNTLMVLGHLPNVFLTMYASQIGSALEVGLLSLALADRINAMKEERTRILQEAGRKLEALNQELADSNRFKDEFLATVTHELRTPMNGVIGSLELMQTVKMDVELEQYQKTAAASARDMMRMVNDILALTELQAGKLYPRRETFSLRGLFDGLRAQYAARADDKGLAFVLELDDSLPDTLEGDAAKLAQALGYLLDNAIKFTAEGSVTLQVGRAGSHADNLPLSVVVSDTGVGFEPGEGDLYQRFHQLDGSMTRKYGGLGIGLAICRQLVDLLGGALSHESQPGVGSRFRLDVPLTLPPQQPASTARPRSSGRVPLRQAQQCTVLIVEDNAINQLVTRGMLLKLGYRVRTADNGAEALDLLRSETVDAVLLDCQMPVMDGFATCRALRALPGCAEVPVLAITAHSHSGDRERCLAAGMSDYLAKPMKFEELRVLLHDWVLCRPPAVSQSPGMP
>NC_009439.1|WP_012019697.1|4155317_4156208_-|ABC-transporter-substrate-binding-protein
MRRWLLGVLLLWLAPVWADTAPRVAALSWEATEHLLMLDVAPLTVADAGDYRTWVVRPTLPAGVPSAGSRLEPNLELLAELQPELIVIPPLLEDIRPLLERIAPVQVYQGFSQQHDNLQAQREAFLDLARALDREALAEQRLQAMDAELARWRERLQAHYDGALPAVTVIRLSSPTAAFINGPNSMPQHALTLLGLQPAMQLAPSPWGITQVPITALGRIDRGAVLHIEPFAQEAQLFASPLWQAMPFVREQRFAGMPSTWTYGGVFSLQYLAEAMAQALLKLPSDAGKAPRQPLE
>NC_009439.1|WP_012019698.1|4156204_4158181_-|Fe(3+)-hydroxamate-ABC-transporter-permease-FhuB
MAAVSAPSRHVLTLLALLPLALLHLWLAADLDPFELGSMLGAAEQSFERLQLQLSALPRLSMALLVGAALGLSGSLLQQITQNRLVSPMTIGASSGAWLGLVLATLLVPAFAASHGQWAALGGALLAVGLVLLIAGRSGIGGLPLVLGGMAMNLLLGALAAGLVLINNQYTQGLFVWGAGDLAQIDWHWVQWLWPKLLLAVPLLILAPRPLSLLQLGSDAAQARGLALWPVMLVLFLAALWLCAVSITAVGLIGFIGLLTPNLAKMLGARTARDELSYSVLLGALLLLATDALALLANQLSGQLVPSGAAAALIGAPVLLWLARRHLAAEDPHGLRLPAGAERFGWRGALWLGLLAVLALVLALCLARGLDGWRLQWPSALVWSLRWPRVLTAASAGAGLAISGLLLQRLLRNPLASPDILGLSAGATLAVMLALTWFGGALLGAVAPLAAFVGCLAVLALLMLLGRRHHYSPALMALLGISLGALLNAALQFVLAKGTGDSFALLGWLAGSTYRATPAQALWLTLGVLLLGALALLFQRALTLIGIGDGVAASRGLDVPRLRLALLVLVALLCALVTSLLGPVAFLGLLAPHIAVMLGARRVAPQLSLAAALGALLMLLADWAGRTLIFPLQIPVGIVASVLCGGYFVLLLIRGRLA
>NC_009439.1|WP_012019699.1|4158183_4158951_-|ABC-transporter-ATP-binding-protein
MLTLRDIEVRRGERVTLALDELQLQGDRFTVILGHNGSGKSTLMNLLARQLQPTRGTLALDEQPLARFSARDFARRVAFLPQHLPDVAGLTVRELVRLGRFPWRGLVGRWRADDHAAVDQALAQTDVAHYADHLADSLSGGERQRAWIAMLLAQQSPLLLLDEPTSALDLAHQYELMGLLRQLNRDSGRGIVAILHDINLTARHADRVIALKQGRIFFDGSPDELLSGPLLSQLYEIDIQLIEQPGSARKIAVVA
>NC_009439.1|WP_003240253.1|4158944_4159691_-|siderophore-ferric-iron-reductase
MQDLHHLLDVISRSLPGLRGRIGAAGADLLVCGSEGNAQRIATLYRHWRQAHPEAGPHYWTVRSWTYLVWQPIYLTLLGVHLAQRAPCLSSLGQCVEGGVVSGFCLAEHSVQQAAQDQLIGLAARQLDDWLRRQHAEFCQVQNIHGKLAQRLAADYVLAALLLVQRQQNLGNQQLRTLAARWLDALGLRGASELLEVRLDDGRDCLTLERKACCQHFRRGDGELCSTCPKLRRDERLLRLREELALAC
>NC_009439.1|WP_012019700.1|4159781_4160942_-|MFS-transporter
MTLRTCLIMMTALAVITDNLIIPFYPQYFAERFDNPPEQHVGLYLAVVSLVVMAVFPLWARLAKRVHPVRILISAQLMAGSLTAACYFIDSLPLFWVVSLLMVVFKGSYLLMYPYVMSLQQQDNHTQTIGTLSVVVHFGAILGAALGGLILQVMNIGDVFLVMAAGDFIQMAICMHLVRGYLPAPGEQPASDEAPVKNEARSLPAIYRLCLVMLLFYFVGYVTRPFFAVYWQQVAHWNSEMAAGFVYALPGAVAVVALWWGRRATRQGNTRDGILAGLLLGAAATFIQGFGDQWLILLGRVLFGWALYQVTVRLDALLFELSSPEHYAVDFSKINIFQCLGNMGSAYGAGLLVSHYGQAMPFWVGAAGLLATAALFPLLVRKPRTA
>NC_009439.1|WP_012019701.1|4161085_4161883_+|hydroxymethylpyrimidine/phosphomethylpyrimidine-kinase
MKTPNSRPVVLCMSGHDPSGGAGLQADIEALLAQGCHAAPTVTALTVQDTVNVSDFRVLDRDWVLAQARAVIADMPVAAVKLGMLGSVEMVETVLEVMSQLPGVPLVCDPVLRAGGGGSLGKDDVGYAMRERLFAVSTIATPNLPEARILAELPQGSADECAEKLLPFIEHLLITGGHGDEAEVHNRLYCRDGSRHTFTCARLPGSYHGSGCTLASTLAGRLALGEELVSAVKSALDYTWRTLRDAEQPGHGQYVPRRLPLDFAQ
>NC_009439.1|WP_012019702.1|4161879_4162509_+|thiamine-phosphate-synthase
MTAALRGLYAITDTPLLAGGKLLPYAEAALIGGARLLQYRDKSGDAVRRLDEAQALAELCQRHGATLIINDDLELAAHLGVGLHLGQTDGSLAAARARLGADVVIGGTCHAQLELAERAVAEGASYIAFGRFFNSNTKPGAPAATVELLDQARTRFAQPIVAIGGVTLDNAPGLIARGASMVAVIHALFAADSALEVQDRARAFAALFD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_009439_2	2.10\|4138075\|32\|NC_009439\|CRISPRCasFinder,CRT	4138075-4138106	32	NZ_CP017750	Cupriavidus sp. USMAA2-4 plasmid unnamed1, complete sequence	180288-180319	5	0.844
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NZ_CP037915	Sphingomonas sp. AAP5 plasmid p150, complete sequence	4459-4490	5	0.844
NC_009439_2	2.47\|4138081\|32\|NC_009439\|PILER-CR	4138081-4138112	32	NZ_CP017750	Cupriavidus sp. USMAA2-4 plasmid unnamed1, complete sequence	180288-180319	5	0.844
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NZ_CP037915	Sphingomonas sp. AAP5 plasmid p150, complete sequence	4459-4490	5	0.844
NC_009439_3	3.5\|4149431\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149431-4149462	32	NZ_CP046573	Rhodococcus sp. WAY2 plasmid pRWAY01, complete sequence	72741-72772	5	0.844
NC_009439_3	3.9\|4149675\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149675-4149706	32	NZ_CP013071	Sphingobium indicum B90A plasmid pSRL1, complete sequence	35552-35583	5	0.844
NC_009439_3	3.10\|4149736\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149736-4149767	32	NZ_CP054609	Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed1, complete sequence	17969-18000	5	0.844
NC_009439_3	3.10\|4149736\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149736-4149767	32	NZ_CP054611	Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed3, complete sequence	34733-34764	5	0.844
NC_009439_2	2.2\|4137586\|31\|NC_009439\|CRISPRCasFinder,CRT	4137586-4137616	31	NZ_CP045385	Ruegeria sp. THAF33 plasmid pTHAF33_a, complete sequence	480391-480421	6	0.806
NC_009439_2	2.2\|4137586\|31\|NC_009439\|CRISPRCasFinder,CRT	4137586-4137616	31	NZ_CP033221	Parasedimentitalea marina strain W43 plasmid pW43B, complete sequence	200849-200879	6	0.806
NC_009439_2	2.10\|4138075\|32\|NC_009439\|CRISPRCasFinder,CRT	4138075-4138106	32	NZ_CP026745	Nocardia cyriacigeorgica strain MDA3349 isolate MDA3349 ancestor plasmid p_unnamed, complete sequence	65434-65465	6	0.812
NC_009439_2	2.10\|4138075\|32\|NC_009439\|CRISPRCasFinder,CRT	4138075-4138106	32	HQ332141	Halorubrum phage CGphi46 genomic sequence	19747-19778	6	0.812
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NZ_CP035092	Paracoccus denitrificans strain ATCC 19367 plasmid unnamed1, complete sequence	336200-336231	6	0.812
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NC_008688	Paracoccus denitrificans PD1222 plasmid 1, complete sequence	583548-583579	6	0.812
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NZ_CP044425	Paracoccus pantotrophus strain DSM 2944 plasmid pPAN2, complete sequence	503728-503759	6	0.812
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	CP021182	Sphingomonas wittichii DC-6 plasmid pDC01, complete sequence	143418-143449	6	0.812
NC_009439_2	2.47\|4138081\|32\|NC_009439\|PILER-CR	4138081-4138112	32	NZ_CP026745	Nocardia cyriacigeorgica strain MDA3349 isolate MDA3349 ancestor plasmid p_unnamed, complete sequence	65434-65465	6	0.812
NC_009439_2	2.47\|4138081\|32\|NC_009439\|PILER-CR	4138081-4138112	32	HQ332141	Halorubrum phage CGphi46 genomic sequence	19747-19778	6	0.812
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NZ_CP035092	Paracoccus denitrificans strain ATCC 19367 plasmid unnamed1, complete sequence	336200-336231	6	0.812
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NC_008688	Paracoccus denitrificans PD1222 plasmid 1, complete sequence	583548-583579	6	0.812
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NZ_CP044425	Paracoccus pantotrophus strain DSM 2944 plasmid pPAN2, complete sequence	503728-503759	6	0.812
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	CP021182	Sphingomonas wittichii DC-6 plasmid pDC01, complete sequence	143418-143449	6	0.812
NC_009439_3	3.2\|4149247\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149247-4149278	32	NZ_CP043508	Acetobacter sp. KACC 21233 plasmid unnamed2, complete sequence	27020-27051	6	0.812
NC_009439_3	3.2\|4149247\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149247-4149278	32	NZ_CP017563	Paraburkholderia sprentiae WSM5005 plasmid pl1WSM5005, complete sequence	130960-130991	6	0.812
NC_009439_3	3.5\|4149431\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149431-4149462	32	NZ_CP022760	Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence	1958017-1958048	6	0.812
NC_009439_3	3.5\|4149431\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149431-4149462	32	NZ_CP022789	Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence	1958019-1958050	6	0.812
NC_009439_3	3.10\|4149736\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149736-4149767	32	MN033529	Leviviridae sp. isolate H2_Bulk_36_scaffold_542_e_230 hypothetical protein (H2Bulk36542e230_000001) and RNA-dependent RNA polymerase (H2Bulk36542e230_000002) genes, complete cds	2190-2221	6	0.812
NC_009439_2	2.7\|4137890\|32\|NC_009439\|CRISPRCasFinder,CRT	4137890-4137921	32	NZ_CP019241	Rhodoferax antarcticus strain DSMZ24876 plasmid unnamed1	13209-13240	7	0.781
NC_009439_2	2.7\|4137890\|32\|NC_009439\|CRISPRCasFinder,CRT	4137890-4137921	32	NZ_AP018921	Pseudonocardia autotrophica strain NBRC 12743 plasmid pPA12743CP, complete sequence	49458-49489	7	0.781
NC_009439_2	2.10\|4138075\|32\|NC_009439\|CRISPRCasFinder,CRT	4138075-4138106	32	NZ_LN868941	Nocardia farcinica strain NCTC11134 plasmid 4, complete sequence	14124-14155	7	0.781
NC_009439_2	2.10\|4138075\|32\|NC_009439\|CRISPRCasFinder,CRT	4138075-4138106	32	NZ_CP031419	Nocardia farcinica strain W6977 plasmid unnamed1, complete sequence	52714-52745	7	0.781
NC_009439_2	2.10\|4138075\|32\|NC_009439\|CRISPRCasFinder,CRT	4138075-4138106	32	JX042578	Mycobacteriophage ElTiger69, complete genome	48033-48064	7	0.781
NC_009439_2	2.10\|4138075\|32\|NC_009439\|CRISPRCasFinder,CRT	4138075-4138106	32	MF141539	Mycobacterium phage MyraDee, complete genome	45689-45720	7	0.781
NC_009439_2	2.10\|4138075\|32\|NC_009439\|CRISPRCasFinder,CRT	4138075-4138106	32	NZ_CP032322	Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence	1913147-1913178	7	0.781
NC_009439_2	2.10\|4138075\|32\|NC_009439\|CRISPRCasFinder,CRT	4138075-4138106	32	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	1531955-1531986	7	0.781
NC_009439_2	2.10\|4138075\|32\|NC_009439\|CRISPRCasFinder,CRT	4138075-4138106	32	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	1135988-1136019	7	0.781
NC_009439_2	2.13\|4138258\|32\|NC_009439\|CRISPRCasFinder,CRT	4138258-4138289	32	MT553337	Mycobacterium phage DroogsArmy, complete genome	18872-18903	7	0.781
NC_009439_2	2.13\|4138258\|32\|NC_009439\|CRISPRCasFinder,CRT	4138258-4138289	32	JF957060	Mycobacterium phage Timshel, complete genome	19102-19133	7	0.781
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NC_010399	Clavibacter michiganensis subsp. sepedonicus plasmid pCS1, complete sequence	14919-14950	7	0.781
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NC_013930	Thioalkalivibrio sp. K90mix plasmid pTK9001, complete sequence	35525-35556	7	0.781
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NC_007765	Rhizobium etli CFN 42 plasmid p42e, complete sequence	454020-454051	7	0.781
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NC_021908	Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1d, complete sequence	460731-460762	7	0.781
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	NZ_CP007797	Azospirillum brasilense strain Az39 plasmid AbAZ39_p4, complete sequence	571754-571785	7	0.781
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	NZ_CP032343	Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence	617381-617412	7	0.781
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	NZ_CP012917	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence	110811-110842	7	0.781
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	NC_015595	Sphingobium chlorophenolicum L-1 plasmid pSPHCH01, complete sequence	64905-64936	7	0.781
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	NZ_CP018225	Tardibacter chloracetimidivorans strain JJ-A5 plasmid pHSL4, complete sequence	162508-162539	7	0.781
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	NZ_CP013265	Sphingobium baderi strain DE-13 plasmid pDE1, complete sequence	114205-114236	7	0.781
NC_009439_2	2.31\|4139359\|32\|NC_009439\|CRISPRCasFinder,CRT	4139359-4139390	32	CP040467	Streptomyces albidoflavus strain UYFA156 plasmid unnamed, complete sequence	102244-102275	7	0.781
NC_009439_2	2.31\|4139359\|32\|NC_009439\|CRISPRCasFinder,CRT	4139359-4139390	32	NZ_CP029831	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed7, complete sequence	113368-113399	7	0.781
NC_009439_2	2.31\|4139359\|32\|NC_009439\|CRISPRCasFinder,CRT	4139359-4139390	32	NZ_CP032325	Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence	431353-431384	7	0.781
NC_009439_2	2.31\|4139359\|32\|NC_009439\|CRISPRCasFinder,CRT	4139359-4139390	32	NZ_CP054622	Azospirillum oryzae strain KACC 14407 plasmid unnamed7, complete sequence	294293-294324	7	0.781
NC_009439_2	2.31\|4139359\|32\|NC_009439\|CRISPRCasFinder,CRT	4139359-4139390	32	NZ_CP039651	Azospirillum sp. TSA2s plasmid p1	337036-337067	7	0.781
NC_009439_2	2.32\|4139420\|33\|NC_009439\|CRISPRCasFinder,CRT	4139420-4139452	33	NZ_CP017753	Cupriavidus sp. USMAHM13 plasmid unnamed1, complete sequence	142079-142111	7	0.788
NC_009439_2	2.37\|4139726\|32\|NC_009439\|CRISPRCasFinder,CRT	4139726-4139757	32	NZ_CP028969	Aminobacter sp. MSH1 plasmid pUSP1, complete sequence	172443-172474	7	0.781
NC_009439_2	2.37\|4139726\|32\|NC_009439\|CRISPRCasFinder,CRT	4139726-4139757	32	NZ_CP026266	Aminobacter sp. MSH1 plasmid pAM01, complete sequence	169737-169768	7	0.781
NC_009439_2	2.37\|4139726\|32\|NC_009439\|CRISPRCasFinder,CRT	4139726-4139757	32	NC_008043	Ruegeria sp. TM1040 megaplasmid, complete sequence	600871-600902	7	0.781
NC_009439_2	2.37\|4139726\|32\|NC_009439\|CRISPRCasFinder,CRT	4139726-4139757	32	NZ_CP015231	Epibacterium mobile F1926 plasmid unnamed1, complete sequence	393442-393473	7	0.781
NC_009439_2	2.37\|4139726\|32\|NC_009439\|CRISPRCasFinder,CRT	4139726-4139757	32	MH576962	Streptomyces phage Satis, complete genome	62327-62358	7	0.781
NC_009439_2	2.37\|4139726\|32\|NC_009439\|CRISPRCasFinder,CRT	4139726-4139757	32	MK620894	Streptomyces phage Kradal, complete genome	62331-62362	7	0.781
NC_009439_2	2.37\|4139726\|32\|NC_009439\|CRISPRCasFinder,CRT	4139726-4139757	32	NC_004999	Pseudomonas putida NCIB 9816-4 plasmid pDTG1, complete sequence	58234-58265	7	0.781
NC_009439_2	2.37\|4139726\|32\|NC_009439\|CRISPRCasFinder,CRT	4139726-4139757	32	NZ_CP018320	Pseudomonas frederiksbergensis strain AS1 plasmid, complete sequence	45440-45471	7	0.781
NC_009439_2	2.37\|4139726\|32\|NC_009439\|CRISPRCasFinder,CRT	4139726-4139757	32	NC_012674	Pseudomonas fluorescens strain PC20 plasmid pNAH20, complete sequence	57038-57069	7	0.781
NC_009439_2	2.37\|4139726\|32\|NC_009439\|CRISPRCasFinder,CRT	4139726-4139757	32	NZ_CP026974	Achromobacter insolitus strain FDAARGOS_88 plasmid unnamed1, complete sequence	260625-260656	7	0.781
NC_009439_2	2.37\|4139726\|32\|NC_009439\|CRISPRCasFinder,CRT	4139726-4139757	32	NC_014642	Achromobacter xylosoxidans A8 plasmid pA82, complete sequence	38293-38324	7	0.781
NC_009439_2	2.44\|4137896\|32\|NC_009439\|PILER-CR	4137896-4137927	32	NZ_CP019241	Rhodoferax antarcticus strain DSMZ24876 plasmid unnamed1	13209-13240	7	0.781
NC_009439_2	2.44\|4137896\|32\|NC_009439\|PILER-CR	4137896-4137927	32	NZ_AP018921	Pseudonocardia autotrophica strain NBRC 12743 plasmid pPA12743CP, complete sequence	49458-49489	7	0.781
NC_009439_2	2.47\|4138081\|32\|NC_009439\|PILER-CR	4138081-4138112	32	NZ_LN868941	Nocardia farcinica strain NCTC11134 plasmid 4, complete sequence	14124-14155	7	0.781
NC_009439_2	2.47\|4138081\|32\|NC_009439\|PILER-CR	4138081-4138112	32	NZ_CP031419	Nocardia farcinica strain W6977 plasmid unnamed1, complete sequence	52714-52745	7	0.781
NC_009439_2	2.47\|4138081\|32\|NC_009439\|PILER-CR	4138081-4138112	32	JX042578	Mycobacteriophage ElTiger69, complete genome	48033-48064	7	0.781
NC_009439_2	2.47\|4138081\|32\|NC_009439\|PILER-CR	4138081-4138112	32	MF141539	Mycobacterium phage MyraDee, complete genome	45689-45720	7	0.781
NC_009439_2	2.47\|4138081\|32\|NC_009439\|PILER-CR	4138081-4138112	32	NZ_CP032322	Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence	1913147-1913178	7	0.781
NC_009439_2	2.47\|4138081\|32\|NC_009439\|PILER-CR	4138081-4138112	32	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	1531955-1531986	7	0.781
NC_009439_2	2.47\|4138081\|32\|NC_009439\|PILER-CR	4138081-4138112	32	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	1135988-1136019	7	0.781
NC_009439_2	2.50\|4138264\|32\|NC_009439\|PILER-CR	4138264-4138295	32	MT553337	Mycobacterium phage DroogsArmy, complete genome	18872-18903	7	0.781
NC_009439_2	2.50\|4138264\|32\|NC_009439\|PILER-CR	4138264-4138295	32	JF957060	Mycobacterium phage Timshel, complete genome	19102-19133	7	0.781
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NC_010399	Clavibacter michiganensis subsp. sepedonicus plasmid pCS1, complete sequence	14919-14950	7	0.781
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NC_013930	Thioalkalivibrio sp. K90mix plasmid pTK9001, complete sequence	35525-35556	7	0.781
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NC_007765	Rhizobium etli CFN 42 plasmid p42e, complete sequence	454020-454051	7	0.781
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NC_021908	Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1d, complete sequence	460731-460762	7	0.781
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	NZ_CP007797	Azospirillum brasilense strain Az39 plasmid AbAZ39_p4, complete sequence	571754-571785	7	0.781
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	NZ_CP032343	Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence	617381-617412	7	0.781
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	NZ_CP012917	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence	110811-110842	7	0.781
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	NC_015595	Sphingobium chlorophenolicum L-1 plasmid pSPHCH01, complete sequence	64905-64936	7	0.781
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	NZ_CP018225	Tardibacter chloracetimidivorans strain JJ-A5 plasmid pHSL4, complete sequence	162508-162539	7	0.781
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	NZ_CP013265	Sphingobium baderi strain DE-13 plasmid pDE1, complete sequence	114205-114236	7	0.781
NC_009439_2	2.68\|4139365\|32\|NC_009439\|PILER-CR	4139365-4139396	32	CP040467	Streptomyces albidoflavus strain UYFA156 plasmid unnamed, complete sequence	102244-102275	7	0.781
NC_009439_2	2.68\|4139365\|32\|NC_009439\|PILER-CR	4139365-4139396	32	NZ_CP029831	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed7, complete sequence	113368-113399	7	0.781
NC_009439_2	2.68\|4139365\|32\|NC_009439\|PILER-CR	4139365-4139396	32	NZ_CP032325	Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence	431353-431384	7	0.781
NC_009439_2	2.68\|4139365\|32\|NC_009439\|PILER-CR	4139365-4139396	32	NZ_CP054622	Azospirillum oryzae strain KACC 14407 plasmid unnamed7, complete sequence	294293-294324	7	0.781
NC_009439_2	2.68\|4139365\|32\|NC_009439\|PILER-CR	4139365-4139396	32	NZ_CP039651	Azospirillum sp. TSA2s plasmid p1	337036-337067	7	0.781
NC_009439_2	2.69\|4139426\|33\|NC_009439\|PILER-CR	4139426-4139458	33	NZ_CP017753	Cupriavidus sp. USMAHM13 plasmid unnamed1, complete sequence	142079-142111	7	0.788
NC_009439_2	2.74\|4139732\|32\|NC_009439\|PILER-CR	4139732-4139763	32	NZ_CP028969	Aminobacter sp. MSH1 plasmid pUSP1, complete sequence	172443-172474	7	0.781
NC_009439_2	2.74\|4139732\|32\|NC_009439\|PILER-CR	4139732-4139763	32	NZ_CP026266	Aminobacter sp. MSH1 plasmid pAM01, complete sequence	169737-169768	7	0.781
NC_009439_2	2.74\|4139732\|32\|NC_009439\|PILER-CR	4139732-4139763	32	NC_008043	Ruegeria sp. TM1040 megaplasmid, complete sequence	600871-600902	7	0.781
NC_009439_2	2.74\|4139732\|32\|NC_009439\|PILER-CR	4139732-4139763	32	NZ_CP015231	Epibacterium mobile F1926 plasmid unnamed1, complete sequence	393442-393473	7	0.781
NC_009439_2	2.74\|4139732\|32\|NC_009439\|PILER-CR	4139732-4139763	32	MH576962	Streptomyces phage Satis, complete genome	62327-62358	7	0.781
NC_009439_2	2.74\|4139732\|32\|NC_009439\|PILER-CR	4139732-4139763	32	MK620894	Streptomyces phage Kradal, complete genome	62331-62362	7	0.781
NC_009439_2	2.74\|4139732\|32\|NC_009439\|PILER-CR	4139732-4139763	32	NC_004999	Pseudomonas putida NCIB 9816-4 plasmid pDTG1, complete sequence	58234-58265	7	0.781
NC_009439_2	2.74\|4139732\|32\|NC_009439\|PILER-CR	4139732-4139763	32	NZ_CP018320	Pseudomonas frederiksbergensis strain AS1 plasmid, complete sequence	45440-45471	7	0.781
NC_009439_2	2.74\|4139732\|32\|NC_009439\|PILER-CR	4139732-4139763	32	NC_012674	Pseudomonas fluorescens strain PC20 plasmid pNAH20, complete sequence	57038-57069	7	0.781
NC_009439_2	2.74\|4139732\|32\|NC_009439\|PILER-CR	4139732-4139763	32	NZ_CP026974	Achromobacter insolitus strain FDAARGOS_88 plasmid unnamed1, complete sequence	260625-260656	7	0.781
NC_009439_2	2.74\|4139732\|32\|NC_009439\|PILER-CR	4139732-4139763	32	NC_014642	Achromobacter xylosoxidans A8 plasmid pA82, complete sequence	38293-38324	7	0.781
NC_009439_3	3.2\|4149247\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149247-4149278	32	CP013471	Acetobacter pasteurianus strain Ab3 plasmid ApAb3p3, complete sequence	23421-23452	7	0.781
NC_009439_3	3.2\|4149247\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149247-4149278	32	NZ_CP015169	Acetobacter ascendens strain LMG 1591 plasmid unnamed1, complete sequence	236479-236510	7	0.781
NC_009439_3	3.2\|4149247\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149247-4149278	32	JF412297	EBPR siphovirus 2, partial sequence	31084-31115	7	0.781
NC_009439_3	3.4\|4149370\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149370-4149401	32	NZ_CP049157	Caballeronia sp. SBC1 plasmid pSBC1_1, complete sequence	676265-676296	7	0.781
NC_009439_3	3.4\|4149370\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149370-4149401	32	NZ_CP049317	Caballeronia sp. SBC2 plasmid pSBC2-1, complete sequence	964781-964812	7	0.781
NC_009439_3	3.5\|4149431\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149431-4149462	32	NC_014310	Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence	2056739-2056770	7	0.781
NC_009439_3	3.5\|4149431\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149431-4149462	32	NC_016115	Streptomyces pratensis ATCC 33331 plasmid pSFLA02, complete sequence	74125-74156	7	0.781
NC_009439_3	3.5\|4149431\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149431-4149462	32	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	1693546-1693577	7	0.781
NC_009439_3	3.5\|4149431\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149431-4149462	32	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	119715-119746	7	0.781
NC_009439_3	3.11\|4149797\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149797-4149828	32	NZ_CP028969	Aminobacter sp. MSH1 plasmid pUSP1, complete sequence	172443-172474	7	0.781
NC_009439_3	3.11\|4149797\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149797-4149828	32	NZ_CP026266	Aminobacter sp. MSH1 plasmid pAM01, complete sequence	169737-169768	7	0.781
NC_009439_3	3.11\|4149797\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149797-4149828	32	NC_008043	Ruegeria sp. TM1040 megaplasmid, complete sequence	600871-600902	7	0.781
NC_009439_3	3.11\|4149797\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149797-4149828	32	NZ_CP015231	Epibacterium mobile F1926 plasmid unnamed1, complete sequence	393442-393473	7	0.781
NC_009439_3	3.11\|4149797\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149797-4149828	32	MH576962	Streptomyces phage Satis, complete genome	62327-62358	7	0.781
NC_009439_3	3.11\|4149797\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149797-4149828	32	MK620894	Streptomyces phage Kradal, complete genome	62331-62362	7	0.781
NC_009439_3	3.11\|4149797\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149797-4149828	32	NC_004999	Pseudomonas putida NCIB 9816-4 plasmid pDTG1, complete sequence	58234-58265	7	0.781
NC_009439_3	3.11\|4149797\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149797-4149828	32	NZ_CP018320	Pseudomonas frederiksbergensis strain AS1 plasmid, complete sequence	45440-45471	7	0.781
NC_009439_3	3.11\|4149797\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149797-4149828	32	NC_012674	Pseudomonas fluorescens strain PC20 plasmid pNAH20, complete sequence	57038-57069	7	0.781
NC_009439_3	3.11\|4149797\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149797-4149828	32	NZ_CP026974	Achromobacter insolitus strain FDAARGOS_88 plasmid unnamed1, complete sequence	260625-260656	7	0.781
NC_009439_3	3.11\|4149797\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149797-4149828	32	NC_014642	Achromobacter xylosoxidans A8 plasmid pA82, complete sequence	38293-38324	7	0.781
NC_009439_3	3.12\|4149858\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149858-4149889	32	NZ_CP028969	Aminobacter sp. MSH1 plasmid pUSP1, complete sequence	172443-172474	7	0.781
NC_009439_3	3.12\|4149858\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149858-4149889	32	NZ_CP026266	Aminobacter sp. MSH1 plasmid pAM01, complete sequence	169737-169768	7	0.781
NC_009439_3	3.12\|4149858\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149858-4149889	32	NC_008043	Ruegeria sp. TM1040 megaplasmid, complete sequence	600871-600902	7	0.781
NC_009439_3	3.12\|4149858\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149858-4149889	32	NZ_CP015231	Epibacterium mobile F1926 plasmid unnamed1, complete sequence	393442-393473	7	0.781
NC_009439_3	3.12\|4149858\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149858-4149889	32	MH576962	Streptomyces phage Satis, complete genome	62327-62358	7	0.781
NC_009439_3	3.12\|4149858\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149858-4149889	32	MK620894	Streptomyces phage Kradal, complete genome	62331-62362	7	0.781
NC_009439_3	3.12\|4149858\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149858-4149889	32	NC_004999	Pseudomonas putida NCIB 9816-4 plasmid pDTG1, complete sequence	58234-58265	7	0.781
NC_009439_3	3.12\|4149858\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149858-4149889	32	NZ_CP018320	Pseudomonas frederiksbergensis strain AS1 plasmid, complete sequence	45440-45471	7	0.781
NC_009439_3	3.12\|4149858\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149858-4149889	32	NC_012674	Pseudomonas fluorescens strain PC20 plasmid pNAH20, complete sequence	57038-57069	7	0.781
NC_009439_3	3.12\|4149858\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149858-4149889	32	NZ_CP026974	Achromobacter insolitus strain FDAARGOS_88 plasmid unnamed1, complete sequence	260625-260656	7	0.781
NC_009439_3	3.12\|4149858\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149858-4149889	32	NC_014642	Achromobacter xylosoxidans A8 plasmid pA82, complete sequence	38293-38324	7	0.781
NC_009439_3	3.13\|4149919\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149919-4149950	32	NZ_LR134463	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 21, complete sequence	72196-72227	7	0.781
NC_009439_3	3.13\|4149919\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149919-4149950	32	NC_011366	Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG202, complete sequence	229963-229994	7	0.781
NC_009439_3	3.13\|4149919\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149919-4149950	32	NZ_CP029831	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed7, complete sequence	379616-379647	7	0.781
NC_009439_3	3.15\|4150041\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4150041-4150072	32	NZ_CP020040	Streptomyces sp. 3211 isolate 3 plasmid p3211-1, complete sequence	97204-97235	7	0.781
NC_009439_2	2.2\|4137586\|31\|NC_009439\|CRISPRCasFinder,CRT	4137586-4137616	31	NC_018532	Arthrobacter sp. Rue61a plasmid p232, complete sequence	118630-118660	8	0.742
NC_009439_2	2.2\|4137586\|31\|NC_009439\|CRISPRCasFinder,CRT	4137586-4137616	31	MN329674	Mycobacterium phage JoieB, complete genome	9851-9881	8	0.742
NC_009439_2	2.2\|4137586\|31\|NC_009439\|CRISPRCasFinder,CRT	4137586-4137616	31	MK494123	Mycobacterium phage Blackbeetle, complete genome	9118-9148	8	0.742
NC_009439_2	2.2\|4137586\|31\|NC_009439\|CRISPRCasFinder,CRT	4137586-4137616	31	MN428061	Mycobacterium phage Corazon, complete genome	9780-9810	8	0.742
NC_009439_2	2.2\|4137586\|31\|NC_009439\|CRISPRCasFinder,CRT	4137586-4137616	31	MG757167	Mycobacterium phage Tesla, complete genome	9450-9480	8	0.742
NC_009439_2	2.2\|4137586\|31\|NC_009439\|CRISPRCasFinder,CRT	4137586-4137616	31	MH727562	Mycobacterium phage VasuNzinga, complete genome	9034-9064	8	0.742
NC_009439_2	2.2\|4137586\|31\|NC_009439\|CRISPRCasFinder,CRT	4137586-4137616	31	MK305892	Mycobacterium phage RedRaider77, complete genome	9601-9631	8	0.742
NC_009439_2	2.2\|4137586\|31\|NC_009439\|CRISPRCasFinder,CRT	4137586-4137616	31	KJ538721	Mycobacterium phage MosMoris, complete genome	9007-9037	8	0.742
NC_009439_2	2.2\|4137586\|31\|NC_009439\|CRISPRCasFinder,CRT	4137586-4137616	31	JF704100	Mycobacterium phage Marvin, complete sequence	9827-9857	8	0.742
NC_009439_2	2.2\|4137586\|31\|NC_009439\|CRISPRCasFinder,CRT	4137586-4137616	31	MN428056	Mycobacterium phage Pringar, complete genome	9457-9487	8	0.742
NC_009439_2	2.2\|4137586\|31\|NC_009439\|CRISPRCasFinder,CRT	4137586-4137616	31	MK279842	Mycobacterium phage Raela, complete genome	9673-9703	8	0.742
NC_009439_2	2.2\|4137586\|31\|NC_009439\|CRISPRCasFinder,CRT	4137586-4137616	31	MH727553	Mycobacterium phage LittleLaf, complete genome	9557-9587	8	0.742
NC_009439_2	2.2\|4137586\|31\|NC_009439\|CRISPRCasFinder,CRT	4137586-4137616	31	MK061407	Mycobacterium phage Beelzebub, complete genome	10126-10156	8	0.742
NC_009439_2	2.2\|4137586\|31\|NC_009439\|CRISPRCasFinder,CRT	4137586-4137616	31	MN329676	Mycobacterium phage Poise, complete genome	9118-9148	8	0.742
NC_009439_2	2.2\|4137586\|31\|NC_009439\|CRISPRCasFinder,CRT	4137586-4137616	31	KX159477	Mycobacterium phage Gattaca, complete genome	9007-9037	8	0.742
NC_009439_2	2.2\|4137586\|31\|NC_009439\|CRISPRCasFinder,CRT	4137586-4137616	31	NZ_CP007796	Azospirillum brasilense strain Az39 plasmid AbAZ39_p3, complete sequence	303709-303739	8	0.742
NC_009439_2	2.2\|4137586\|31\|NC_009439\|CRISPRCasFinder,CRT	4137586-4137616	31	NZ_CP033321	Azospirillum brasilense strain Cd plasmid p3, complete sequence	262277-262307	8	0.742
NC_009439_2	2.2\|4137586\|31\|NC_009439\|CRISPRCasFinder,CRT	4137586-4137616	31	NZ_CP033315	Azospirillum brasilense strain Sp 7 plasmid p3, complete sequence	231856-231886	8	0.742
NC_009439_2	2.2\|4137586\|31\|NC_009439\|CRISPRCasFinder,CRT	4137586-4137616	31	NZ_CP032325	Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence	377697-377727	8	0.742
NC_009439_2	2.2\|4137586\|31\|NC_009439\|CRISPRCasFinder,CRT	4137586-4137616	31	NZ_CP022369	Azospirillum sp. TSH58 plasmid TSH58_p05, complete sequence	493201-493231	8	0.742
NC_009439_2	2.2\|4137586\|31\|NC_009439\|CRISPRCasFinder,CRT	4137586-4137616	31	NZ_CP032342	Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence	502575-502605	8	0.742
NC_009439_2	2.2\|4137586\|31\|NC_009439\|CRISPRCasFinder,CRT	4137586-4137616	31	NZ_CP033323	Azospirillum brasilense strain Cd plasmid p5, complete sequence	90365-90395	8	0.742
NC_009439_2	2.3\|4137646\|32\|NC_009439\|CRISPRCasFinder,CRT	4137646-4137677	32	NZ_CP032322	Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence	1233259-1233290	8	0.75
NC_009439_2	2.3\|4137646\|32\|NC_009439\|CRISPRCasFinder,CRT	4137646-4137677	32	CP053412	Salmonella enterica strain 72-4606 plasmid unnamed, complete sequence	811-842	8	0.75
NC_009439_2	2.7\|4137890\|32\|NC_009439\|CRISPRCasFinder,CRT	4137890-4137921	32	NZ_CP026091	Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence	292514-292545	8	0.75
NC_009439_2	2.7\|4137890\|32\|NC_009439\|CRISPRCasFinder,CRT	4137890-4137921	32	NZ_CP026093	Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence	292481-292512	8	0.75
NC_009439_2	2.7\|4137890\|32\|NC_009439\|CRISPRCasFinder,CRT	4137890-4137921	32	NZ_CP021767	Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence	499716-499747	8	0.75
NC_009439_2	2.10\|4138075\|32\|NC_009439\|CRISPRCasFinder,CRT	4138075-4138106	32	MH051254	Mycobacterium phage Jabiru, complete genome	47187-47218	8	0.75
NC_009439_2	2.10\|4138075\|32\|NC_009439\|CRISPRCasFinder,CRT	4138075-4138106	32	MK494091	Mycobacterium phage Scorpia, complete genome	47349-47380	8	0.75
NC_009439_2	2.10\|4138075\|32\|NC_009439\|CRISPRCasFinder,CRT	4138075-4138106	32	MH020239	Mycobacterium phage Naca, complete genome	48251-48282	8	0.75
NC_009439_2	2.14\|4138319\|32\|NC_009439\|CRISPRCasFinder,CRT	4138319-4138350	32	NC_020062	Rhizobium tropici CIAT 899 plasmid pRtrCIAT899c, complete sequence	1671006-1671037	8	0.75
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NZ_CP032346	Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence	456493-456524	8	0.75
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NZ_CP017076	Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence	186246-186277	8	0.75
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NZ_CP016613	Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence	1545027-1545058	8	0.75
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NZ_CP050138	Sphingomonas sp. CL5.1 plasmid pTSSC1, complete sequence	71209-71240	8	0.75
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NZ_CP052069	Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence	1085886-1085917	8	0.75
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NZ_CP052095	Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence	1171432-1171463	8	0.75
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NZ_CP052097	Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence	1171432-1171463	8	0.75
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NZ_CP052093	Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence	1171432-1171463	8	0.75
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NZ_CP052101	Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence	1171432-1171463	8	0.75
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NZ_CP052099	Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence	1171432-1171463	8	0.75
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NZ_CP052129	Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence	1013728-1013759	8	0.75
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NZ_CP015989	Sphingobium sp. EP60837 plasmid pEP2, complete sequence	111466-111497	8	0.75
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NZ_CP052091	Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence	1171433-1171464	8	0.75
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NZ_LR134449	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 7, complete sequence	30606-30637	8	0.75
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NZ_CP035514	Haematobacter massiliensis strain OT1 plasmid pOT1-4, complete sequence	26990-27021	8	0.75
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NZ_AP022319	Burkholderia sp. THE68 plasmid BTHE68_p1, complete sequence	1166263-1166294	8	0.75
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NC_016626	Burkholderia sp. YI23 plasmid byi_1p, complete sequence	1054207-1054238	8	0.75
NC_009439_2	2.18\|4138563\|32\|NC_009439\|CRISPRCasFinder,CRT	4138563-4138594	32	NZ_CP023152	Mycobacterium chimaera strain FLAC0070 plasmid pFLAC0070_1, complete sequence	63949-63980	8	0.75
NC_009439_2	2.18\|4138563\|32\|NC_009439\|CRISPRCasFinder,CRT	4138563-4138594	32	NZ_AP012556	Mycobacterium avium subsp. hominissuis TH135 plasmid pMAH135, complete sequence	76137-76168	8	0.75
NC_009439_2	2.18\|4138563\|32\|NC_009439\|CRISPRCasFinder,CRT	4138563-4138594	32	MN694130	Marine virus AFVG_250M413, complete genome	10388-10419	8	0.75
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	NZ_CP032348	Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence	98864-98895	8	0.75
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	NZ_CP032324	Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence	424783-424814	8	0.75
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	NZ_CP016457	Sphingobium sp. RAC03 plasmid pBSY17_2, complete sequence	83391-83422	8	0.75
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	NZ_CP054620	Azospirillum oryzae strain KACC 14407 plasmid unnamed5, complete sequence	258443-258474	8	0.75
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	NZ_CP026242	Citrobacter freundii complex sp. CFNIH9 plasmid pCFR-eb27, complete sequence	174947-174978	8	0.75
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	NZ_CP009883	Pantoea sp. PSNIH1 plasmid pPSP-a3e, complete sequence	11698-11729	8	0.75
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	NZ_CP010380	Enterobacter hormaechei subsp. hormaechei strain 34983 plasmid p34983-328.905kb, complete sequence	94652-94683	8	0.75
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	NZ_CP026171	Leclercia sp. LSNIH1 plasmid pLEC-1cb1, complete sequence	63448-63479	8	0.75
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	NZ_CP026196	Enterobacteriaceae bacterium ENNIH1 plasmid pENT-1f0b, complete sequence	146431-146462	8	0.75
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	NZ_AP021845	Azospira sp. I09 plasmid pAZI09, complete sequence	341868-341899	8	0.75
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	CP009869	Pantoea sp. PSNIH2 plasmid pPSP-75c, complete sequence	45599-45630	8	0.75
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	NZ_CP042479	Citrobacter freundii strain C50 plasmid pC50_001, complete sequence	130600-130631	8	0.75
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	NC_015727	Cupriavidus necator N-1 plasmid pBB1, complete sequence	738929-738960	8	0.75
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	NC_009425	Enterobacter sp. 638 plasmid pENTE01, complete sequence	133106-133137	8	0.75
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	890163-890194	8	0.75
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	2255801-2255832	8	0.75
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	NZ_CP026208	Escherichia coli strain ECONIH5 plasmid pECO-109b, complete sequence	56271-56302	8	0.75
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	NC_021910	Rhizobium etli bv. mimosae str. Mim1 plasmid pRetNIM1c, complete sequence	213085-213116	8	0.75
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	NZ_CP032179	Citrobacter freundii strain AR_0116 plasmid unnamed1, complete sequence	59287-59318	8	0.75
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	NZ_CP026391	Leclercia sp. LSNIH3 plasmid pLEC-7c0d, complete sequence	12680-12711	8	0.75
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	NZ_CP029142	Klebsiella michiganensis strain AR375 plasmid unnamed2, complete sequence	250460-250491	8	0.75
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	NZ_CP031135	Escherichia coli strain CFSAN064035 plasmid pGMI17-003_1, complete sequence	41695-41726	8	0.75
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	NZ_CP011635	Klebsiella oxytoca strain CAV1374 plasmid pKPC_CAV1374, complete sequence	15690-15721	8	0.75
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	NZ_CP032344	Azospirillum brasilense strain MTCC4038 plasmid p5, complete sequence	36947-36978	8	0.75
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	NZ_CP013115	Shewanella xiamenensis strain T17 plasmid pSx1, complete sequence	178651-178682	8	0.75
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	NZ_CP033323	Azospirillum brasilense strain Cd plasmid p5, complete sequence	222350-222381	8	0.75
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	NZ_CP033317	Azospirillum brasilense strain Sp 7 plasmid p5, complete sequence	109207-109238	8	0.75
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	NZ_CP012919	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p5, complete sequence	146496-146527	8	0.75
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	NZ_CP044111	Klebsiella michiganensis strain FDAARGOS_647 plasmid unnamed2	378198-378229	8	0.75
NC_009439_2	2.22\|4138808\|32\|NC_009439\|CRISPRCasFinder,CRT	4138808-4138839	32	LC425512	Uncultured phage DNA, contig: NODE34	45697-45728	8	0.75
NC_009439_2	2.22\|4138808\|32\|NC_009439\|CRISPRCasFinder,CRT	4138808-4138839	32	NC_008562	Microcystis phage Ma-LMM01 DNA, complete genome	98004-98035	8	0.75
NC_009439_2	2.25\|4138991\|32\|NC_009439\|CRISPRCasFinder,CRT	4138991-4139022	32	CP054917	Streptomyces sp. NA02950 plasmid unnamed, complete sequence	57427-57458	8	0.75
NC_009439_2	2.31\|4139359\|32\|NC_009439\|CRISPRCasFinder,CRT	4139359-4139390	32	NZ_CP029777	Deinococcus actinosclerus strain Deinococcus actinosclerus SJTR plasmid unnamed3, complete sequence	206382-206413	8	0.75
NC_009439_2	2.31\|4139359\|32\|NC_009439\|CRISPRCasFinder,CRT	4139359-4139390	32	NC_016585	Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence	719069-719100	8	0.75
NC_009439_2	2.31\|4139359\|32\|NC_009439\|CRISPRCasFinder,CRT	4139359-4139390	32	NZ_CP032325	Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence	630143-630174	8	0.75
NC_009439_2	2.31\|4139359\|32\|NC_009439\|CRISPRCasFinder,CRT	4139359-4139390	32	NZ_CP015038	Burkholderia cenocepacia strain 895 plasmid pBcp895-1, complete sequence	135405-135436	8	0.75
NC_009439_2	2.31\|4139359\|32\|NC_009439\|CRISPRCasFinder,CRT	4139359-4139390	32	NZ_CP007130	Gemmatirosa kalamazoonesis strain KBS708 plasmid 2, complete sequence	537607-537638	8	0.75
NC_009439_2	2.31\|4139359\|32\|NC_009439\|CRISPRCasFinder,CRT	4139359-4139390	32	NZ_CP033583	Streptomyces sp. ADI95-16 plasmid pADI95-16b, complete sequence	203068-203099	8	0.75
NC_009439_2	2.31\|4139359\|32\|NC_009439\|CRISPRCasFinder,CRT	4139359-4139390	32	NC_017791	Deinococcus gobiensis I-0 plasmid P2, complete sequence	363082-363113	8	0.75
NC_009439_2	2.32\|4139420\|33\|NC_009439\|CRISPRCasFinder,CRT	4139420-4139452	33	MN234233	Corynebacterium phage Colleen, complete genome	2927-2959	8	0.758
NC_009439_2	2.32\|4139420\|33\|NC_009439\|CRISPRCasFinder,CRT	4139420-4139452	33	MH271317	Corynebacterium phage TouchMeNot, complete genome	2727-2759	8	0.758
NC_009439_2	2.32\|4139420\|33\|NC_009439\|CRISPRCasFinder,CRT	4139420-4139452	33	MF197383	Corynebacterium phage Poushou, complete genome	2727-2759	8	0.758
NC_009439_2	2.32\|4139420\|33\|NC_009439\|CRISPRCasFinder,CRT	4139420-4139452	33	MF063068	Pseudomonas phage Noxifer, complete genome	4635-4667	8	0.758
NC_009439_2	2.33\|4139482\|32\|NC_009439\|CRISPRCasFinder,CRT	4139482-4139513	32	NZ_CP011544	Corynebacterium mustelae strain DSM 45274 plasmid phiCmus45274, complete sequence	42460-42491	8	0.75
NC_009439_2	2.37\|4139726\|32\|NC_009439\|CRISPRCasFinder,CRT	4139726-4139757	32	NZ_CP018096	Chelatococcus daeguensis strain TAD1 plasmid pTAD1, complete sequence	515820-515851	8	0.75
NC_009439_2	2.37\|4139726\|32\|NC_009439\|CRISPRCasFinder,CRT	4139726-4139757	32	MK511040	Pseudomonas phage CF63, partial genome	44600-44631	8	0.75
NC_009439_2	2.37\|4139726\|32\|NC_009439\|CRISPRCasFinder,CRT	4139726-4139757	32	NZ_CP029987	Sphingomonas sp. FARSPH plasmid p02, complete sequence	74130-74161	8	0.75
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP016613	Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence	406560-406596	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP022775	Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence	221350-221386	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP021449	Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence	1852803-1852839	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP026091	Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence	238409-238445	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NC_014309	Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome	237694-237730	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	CP023013	Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence	219888-219924	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP021653	Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence	446187-446223	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NC_014310	Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence	213064-213100	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP022762	Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence	225484-225520	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP049790	Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence	239733-239769	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP049794	Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence	411910-411946	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP049788	Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence	1718116-1718152	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP022766	Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence	222519-222555	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP039340	Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence	692192-692228	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP021763	Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence	283900-283936	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP026093	Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence	238412-238448	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP021767	Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence	446268-446304	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP015116	Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence	375954-375990	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP016555	Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence	1950354-1950390	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP012940	Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence	1764078-1764114	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP012944	Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence	1780768-1780804	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP012688	Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence	446196-446232	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP049792	Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence	193386-193422	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP052069	Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence	223463-223499	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP016915	Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence	834547-834583	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP016905	Ralstonia solanacearum strain KACC 10709 plasmid unnamed1	1212540-1212576	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	89829-89865	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP022769	Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence	223777-223813	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP023017	Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence	207677-207713	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP015851	Ralstonia solanacearum strain YC40-M plasmid, complete sequence	167472-167508	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP022773	Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence	230812-230848	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP022783	Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence	220969-221005	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP022791	Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence	112295-112331	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP014703	Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence	225484-225520	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP022760	Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence	216939-216975	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP022789	Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence	216928-216964	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP022795	Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence	220102-220138	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP052071	Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence	236586-236622	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NC_017575	Ralstonia solanacearum Po82 megaplasmid, complete sequence	238230-238266	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP022771	Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence	225493-225529	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP022777	Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence	225511-225547	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP022799	Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence	225483-225519	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP022482	Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence	868563-868599	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP009763	Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence	216841-216877	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	CP023015	Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence	221229-221265	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP022779	Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence	223794-223830	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP052075	Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence	236586-236622	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP052085	Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence	238198-238234	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP052095	Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence	222487-222523	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP052105	Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence	236586-236622	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP021765	Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence	283975-284011	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP052077	Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence	215884-215920	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP052087	Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence	238198-238234	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP052097	Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence	222487-222523	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	CP047139	Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence	446939-446975	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP051295	Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence	1744002-1744038	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP052115	Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence	236586-236622	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP052127	Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence	238198-238234	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	CP047137	Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence	424002-424038	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP022764	Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence	221369-221405	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP052079	Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence	215884-215920	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP052089	Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence	238198-238234	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP052093	Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence	222487-222523	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP052101	Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence	222487-222523	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP052099	Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence	222487-222523	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP052107	Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence	236586-236622	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP045385	Ruegeria sp. THAF33 plasmid pTHAF33_a, complete sequence	480385-480421	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP022781	Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence	1874082-1874118	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP052117	Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence	236586-236622	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP052125	Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence	215884-215920	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP022793	Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence	230795-230831	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP022797	Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence	221367-221403	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP022785	Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence	230797-230833	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP022787	Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence	227397-227433	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP022756	Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence	225537-225573	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP052129	Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence	220998-221034	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP052121	Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence	236586-236622	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP052123	Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence	215884-215920	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP052131	Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence	238198-238234	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	CP011998	Ralstonia solanacearum strain YC45 plasmid, complete sequence	266056-266092	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP052073	Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence	236586-236622	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP052081	Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence	215884-215920	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP052083	Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence	215884-215920	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP052109	Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence	236586-236622	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP052091	Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence	222487-222523	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP052111	Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence	1856184-1856220	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP052103	Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence	236586-236622	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP052119	Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence	236586-236622	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP052113	Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence	1856184-1856220	8	0.784
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP022758	Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence	221364-221400	8	0.784
NC_009439_2	2.40\|4137652\|32\|NC_009439\|PILER-CR	4137652-4137683	32	NZ_CP032322	Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence	1233259-1233290	8	0.75
NC_009439_2	2.40\|4137652\|32\|NC_009439\|PILER-CR	4137652-4137683	32	CP053412	Salmonella enterica strain 72-4606 plasmid unnamed, complete sequence	811-842	8	0.75
NC_009439_2	2.44\|4137896\|32\|NC_009439\|PILER-CR	4137896-4137927	32	NZ_CP026091	Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence	292514-292545	8	0.75
NC_009439_2	2.44\|4137896\|32\|NC_009439\|PILER-CR	4137896-4137927	32	NZ_CP026093	Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence	292481-292512	8	0.75
NC_009439_2	2.44\|4137896\|32\|NC_009439\|PILER-CR	4137896-4137927	32	NZ_CP021767	Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence	499716-499747	8	0.75
NC_009439_2	2.47\|4138081\|32\|NC_009439\|PILER-CR	4138081-4138112	32	MH051254	Mycobacterium phage Jabiru, complete genome	47187-47218	8	0.75
NC_009439_2	2.47\|4138081\|32\|NC_009439\|PILER-CR	4138081-4138112	32	MK494091	Mycobacterium phage Scorpia, complete genome	47349-47380	8	0.75
NC_009439_2	2.47\|4138081\|32\|NC_009439\|PILER-CR	4138081-4138112	32	MH020239	Mycobacterium phage Naca, complete genome	48251-48282	8	0.75
NC_009439_2	2.51\|4138325\|32\|NC_009439\|PILER-CR	4138325-4138356	32	NC_020062	Rhizobium tropici CIAT 899 plasmid pRtrCIAT899c, complete sequence	1671006-1671037	8	0.75
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NZ_CP032346	Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence	456493-456524	8	0.75
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NZ_CP017076	Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence	186246-186277	8	0.75
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NZ_CP016613	Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence	1545027-1545058	8	0.75
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NZ_CP050138	Sphingomonas sp. CL5.1 plasmid pTSSC1, complete sequence	71209-71240	8	0.75
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NZ_CP052069	Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence	1085886-1085917	8	0.75
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NZ_CP052095	Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence	1171432-1171463	8	0.75
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NZ_CP052097	Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence	1171432-1171463	8	0.75
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NZ_CP052093	Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence	1171432-1171463	8	0.75
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NZ_CP052101	Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence	1171432-1171463	8	0.75
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NZ_CP052099	Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence	1171432-1171463	8	0.75
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NZ_CP052129	Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence	1013728-1013759	8	0.75
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NZ_CP015989	Sphingobium sp. EP60837 plasmid pEP2, complete sequence	111466-111497	8	0.75
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NZ_CP052091	Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence	1171433-1171464	8	0.75
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NZ_LR134449	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 7, complete sequence	30606-30637	8	0.75
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NZ_CP035514	Haematobacter massiliensis strain OT1 plasmid pOT1-4, complete sequence	26990-27021	8	0.75
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NZ_AP022319	Burkholderia sp. THE68 plasmid BTHE68_p1, complete sequence	1166263-1166294	8	0.75
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NC_016626	Burkholderia sp. YI23 plasmid byi_1p, complete sequence	1054207-1054238	8	0.75
NC_009439_2	2.55\|4138569\|32\|NC_009439\|PILER-CR	4138569-4138600	32	NZ_CP023152	Mycobacterium chimaera strain FLAC0070 plasmid pFLAC0070_1, complete sequence	63949-63980	8	0.75
NC_009439_2	2.55\|4138569\|32\|NC_009439\|PILER-CR	4138569-4138600	32	NZ_AP012556	Mycobacterium avium subsp. hominissuis TH135 plasmid pMAH135, complete sequence	76137-76168	8	0.75
NC_009439_2	2.55\|4138569\|32\|NC_009439\|PILER-CR	4138569-4138600	32	MN694130	Marine virus AFVG_250M413, complete genome	10388-10419	8	0.75
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	NZ_CP032348	Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence	98864-98895	8	0.75
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	NZ_CP032324	Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence	424783-424814	8	0.75
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	NZ_CP016457	Sphingobium sp. RAC03 plasmid pBSY17_2, complete sequence	83391-83422	8	0.75
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	NZ_CP054620	Azospirillum oryzae strain KACC 14407 plasmid unnamed5, complete sequence	258443-258474	8	0.75
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	NZ_CP026242	Citrobacter freundii complex sp. CFNIH9 plasmid pCFR-eb27, complete sequence	174947-174978	8	0.75
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	NZ_CP009883	Pantoea sp. PSNIH1 plasmid pPSP-a3e, complete sequence	11698-11729	8	0.75
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	NZ_CP010380	Enterobacter hormaechei subsp. hormaechei strain 34983 plasmid p34983-328.905kb, complete sequence	94652-94683	8	0.75
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	NZ_CP026171	Leclercia sp. LSNIH1 plasmid pLEC-1cb1, complete sequence	63448-63479	8	0.75
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	NZ_CP026196	Enterobacteriaceae bacterium ENNIH1 plasmid pENT-1f0b, complete sequence	146431-146462	8	0.75
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	NZ_AP021845	Azospira sp. I09 plasmid pAZI09, complete sequence	341868-341899	8	0.75
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	CP009869	Pantoea sp. PSNIH2 plasmid pPSP-75c, complete sequence	45599-45630	8	0.75
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	NZ_CP042479	Citrobacter freundii strain C50 plasmid pC50_001, complete sequence	130600-130631	8	0.75
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	NC_015727	Cupriavidus necator N-1 plasmid pBB1, complete sequence	738929-738960	8	0.75
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	NC_009425	Enterobacter sp. 638 plasmid pENTE01, complete sequence	133106-133137	8	0.75
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	890163-890194	8	0.75
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	2255801-2255832	8	0.75
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	NZ_CP026208	Escherichia coli strain ECONIH5 plasmid pECO-109b, complete sequence	56271-56302	8	0.75
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	NC_021910	Rhizobium etli bv. mimosae str. Mim1 plasmid pRetNIM1c, complete sequence	213085-213116	8	0.75
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	NZ_CP032179	Citrobacter freundii strain AR_0116 plasmid unnamed1, complete sequence	59287-59318	8	0.75
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	NZ_CP026391	Leclercia sp. LSNIH3 plasmid pLEC-7c0d, complete sequence	12680-12711	8	0.75
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	NZ_CP029142	Klebsiella michiganensis strain AR375 plasmid unnamed2, complete sequence	250460-250491	8	0.75
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	NZ_CP031135	Escherichia coli strain CFSAN064035 plasmid pGMI17-003_1, complete sequence	41695-41726	8	0.75
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	NZ_CP011635	Klebsiella oxytoca strain CAV1374 plasmid pKPC_CAV1374, complete sequence	15690-15721	8	0.75
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	NZ_CP032344	Azospirillum brasilense strain MTCC4038 plasmid p5, complete sequence	36947-36978	8	0.75
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	NZ_CP013115	Shewanella xiamenensis strain T17 plasmid pSx1, complete sequence	178651-178682	8	0.75
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	NZ_CP033323	Azospirillum brasilense strain Cd plasmid p5, complete sequence	222350-222381	8	0.75
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	NZ_CP033317	Azospirillum brasilense strain Sp 7 plasmid p5, complete sequence	109207-109238	8	0.75
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	NZ_CP012919	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p5, complete sequence	146496-146527	8	0.75
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	NZ_CP044111	Klebsiella michiganensis strain FDAARGOS_647 plasmid unnamed2	378198-378229	8	0.75
NC_009439_2	2.59\|4138814\|32\|NC_009439\|PILER-CR	4138814-4138845	32	LC425512	Uncultured phage DNA, contig: NODE34	45697-45728	8	0.75
NC_009439_2	2.59\|4138814\|32\|NC_009439\|PILER-CR	4138814-4138845	32	NC_008562	Microcystis phage Ma-LMM01 DNA, complete genome	98004-98035	8	0.75
NC_009439_2	2.62\|4138997\|32\|NC_009439\|PILER-CR	4138997-4139028	32	CP054917	Streptomyces sp. NA02950 plasmid unnamed, complete sequence	57427-57458	8	0.75
NC_009439_2	2.68\|4139365\|32\|NC_009439\|PILER-CR	4139365-4139396	32	NZ_CP029777	Deinococcus actinosclerus strain Deinococcus actinosclerus SJTR plasmid unnamed3, complete sequence	206382-206413	8	0.75
NC_009439_2	2.68\|4139365\|32\|NC_009439\|PILER-CR	4139365-4139396	32	NC_016585	Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence	719069-719100	8	0.75
NC_009439_2	2.68\|4139365\|32\|NC_009439\|PILER-CR	4139365-4139396	32	NZ_CP032325	Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence	630143-630174	8	0.75
NC_009439_2	2.68\|4139365\|32\|NC_009439\|PILER-CR	4139365-4139396	32	NZ_CP015038	Burkholderia cenocepacia strain 895 plasmid pBcp895-1, complete sequence	135405-135436	8	0.75
NC_009439_2	2.68\|4139365\|32\|NC_009439\|PILER-CR	4139365-4139396	32	NZ_CP007130	Gemmatirosa kalamazoonesis strain KBS708 plasmid 2, complete sequence	537607-537638	8	0.75
NC_009439_2	2.68\|4139365\|32\|NC_009439\|PILER-CR	4139365-4139396	32	NZ_CP033583	Streptomyces sp. ADI95-16 plasmid pADI95-16b, complete sequence	203068-203099	8	0.75
NC_009439_2	2.68\|4139365\|32\|NC_009439\|PILER-CR	4139365-4139396	32	NC_017791	Deinococcus gobiensis I-0 plasmid P2, complete sequence	363082-363113	8	0.75
NC_009439_2	2.69\|4139426\|33\|NC_009439\|PILER-CR	4139426-4139458	33	MN234233	Corynebacterium phage Colleen, complete genome	2927-2959	8	0.758
NC_009439_2	2.69\|4139426\|33\|NC_009439\|PILER-CR	4139426-4139458	33	MH271317	Corynebacterium phage TouchMeNot, complete genome	2727-2759	8	0.758
NC_009439_2	2.69\|4139426\|33\|NC_009439\|PILER-CR	4139426-4139458	33	MF197383	Corynebacterium phage Poushou, complete genome	2727-2759	8	0.758
NC_009439_2	2.69\|4139426\|33\|NC_009439\|PILER-CR	4139426-4139458	33	MF063068	Pseudomonas phage Noxifer, complete genome	4635-4667	8	0.758
NC_009439_2	2.70\|4139488\|32\|NC_009439\|PILER-CR	4139488-4139519	32	NZ_CP011544	Corynebacterium mustelae strain DSM 45274 plasmid phiCmus45274, complete sequence	42460-42491	8	0.75
NC_009439_2	2.74\|4139732\|32\|NC_009439\|PILER-CR	4139732-4139763	32	NZ_CP018096	Chelatococcus daeguensis strain TAD1 plasmid pTAD1, complete sequence	515820-515851	8	0.75
NC_009439_2	2.74\|4139732\|32\|NC_009439\|PILER-CR	4139732-4139763	32	MK511040	Pseudomonas phage CF63, partial genome	44600-44631	8	0.75
NC_009439_2	2.74\|4139732\|32\|NC_009439\|PILER-CR	4139732-4139763	32	NZ_CP029987	Sphingomonas sp. FARSPH plasmid p02, complete sequence	74130-74161	8	0.75
NC_009439_3	3.2\|4149247\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149247-4149278	32	MT701590	Klebsiella phage Miami, complete genome	51866-51897	8	0.75
NC_009439_3	3.4\|4149370\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149370-4149401	32	NZ_CP015095	Pelagibaca abyssi strain JLT2014 plasmid pPABY4, complete sequence	123920-123951	8	0.75
NC_009439_3	3.4\|4149370\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149370-4149401	32	NC_011143	Phenylobacterium zucineum HLK1 plasmid, complete sequence	107332-107363	8	0.75
NC_009439_3	3.4\|4149370\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149370-4149401	32	NC_017833	Streptomyces sp. FR1 plasmid pFP4, complete sequence	4763-4794	8	0.75
NC_009439_3	3.4\|4149370\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149370-4149401	32	NZ_CP030354	Novosphingobium sp. P6W plasmid pP6W1, complete sequence	351199-351230	8	0.75
NC_009439_3	3.4\|4149370\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149370-4149401	32	NZ_CP032695	Rhizobium jaguaris strain CCGE525 plasmid pRCCGE525c, complete sequence	2341457-2341488	8	0.75
NC_009439_3	3.5\|4149431\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149431-4149462	32	NC_011667	Thauera sp. MZ1T plasmid pTha01, complete sequence	42923-42954	8	0.75
NC_009439_3	3.11\|4149797\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149797-4149828	32	NZ_CP018096	Chelatococcus daeguensis strain TAD1 plasmid pTAD1, complete sequence	515820-515851	8	0.75
NC_009439_3	3.11\|4149797\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149797-4149828	32	MK511040	Pseudomonas phage CF63, partial genome	44600-44631	8	0.75
NC_009439_3	3.11\|4149797\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149797-4149828	32	NZ_CP029987	Sphingomonas sp. FARSPH plasmid p02, complete sequence	74130-74161	8	0.75
NC_009439_3	3.12\|4149858\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149858-4149889	32	NZ_CP018096	Chelatococcus daeguensis strain TAD1 plasmid pTAD1, complete sequence	515820-515851	8	0.75
NC_009439_3	3.12\|4149858\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149858-4149889	32	MK511040	Pseudomonas phage CF63, partial genome	44600-44631	8	0.75
NC_009439_3	3.12\|4149858\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149858-4149889	32	NZ_CP029987	Sphingomonas sp. FARSPH plasmid p02, complete sequence	74130-74161	8	0.75
NC_009439_3	3.13\|4149919\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149919-4149950	32	NZ_CP031080	Paracoccus yeei strain CCUG 32053 plasmid pYEE2, complete sequence	130065-130096	8	0.75
NC_009439_3	3.13\|4149919\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149919-4149950	32	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	585789-585820	8	0.75
NC_009439_3	3.13\|4149919\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149919-4149950	32	NC_023283	Streptomyces sp. FR1 plasmid pFRL3, complete sequence	432347-432378	8	0.75
NC_009439_3	3.13\|4149919\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149919-4149950	32	NZ_CP006989	Rhizobium sp. IE4771 plasmid pRetIE4771c, complete sequence	254858-254889	8	0.75
NC_009439_3	3.13\|4149919\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149919-4149950	32	NC_010998	Rhizobium etli CIAT 652 plasmid pA, complete sequence	246021-246052	8	0.75
NC_009439_3	3.13\|4149919\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149919-4149950	32	NZ_CP043960	Streptomyces tendae strain 139 plasmid unnamed1, complete sequence	159866-159897	8	0.75
NC_009439_3	3.13\|4149919\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149919-4149950	32	MT740747	Ralstonia phage Simangalove, complete genome	1650-1681	8	0.75
NC_009439_3	3.13\|4149919\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149919-4149950	32	MT740729	Ralstonia phage Bakoly, complete genome	42966-42997	8	0.75
NC_009439_3	3.13\|4149919\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149919-4149950	32	MT740744	Ralstonia phage Jenny, complete genome	1226-1257	8	0.75
NC_009439_3	3.13\|4149919\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149919-4149950	32	MT740735	Ralstonia phage Elie, complete genome	1633-1664	8	0.75
NC_009439_3	3.13\|4149919\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149919-4149950	32	MT740746	Ralstonia phage Sarlave, complete genome	12046-12077	8	0.75
NC_009439_3	3.13\|4149919\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149919-4149950	32	MT740725	Ralstonia phage Adzire, complete genome	1500-1531	8	0.75
NC_009439_3	3.15\|4150041\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4150041-4150072	32	NZ_CP023408	Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence	897963-897994	8	0.75
NC_009439_2	2.1\|4137525\|32\|NC_009439\|CRISPRCasFinder,CRT	4137525-4137556	32	MH744423	Mycobacterium phage Saguaro, complete genome	17453-17484	9	0.719
NC_009439_2	2.1\|4137525\|32\|NC_009439\|CRISPRCasFinder,CRT	4137525-4137556	32	MK059749	Mycobacterium phage CRB2, complete genome	17961-17992	9	0.719
NC_009439_2	2.2\|4137586\|31\|NC_009439\|CRISPRCasFinder,CRT	4137586-4137616	31	NZ_CP025552	Streptomyces rimosus strain WT5260 plasmid unnamed, complete sequence	116184-116214	9	0.71
NC_009439_2	2.3\|4137646\|32\|NC_009439\|CRISPRCasFinder,CRT	4137646-4137677	32	NZ_CP021653	Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence	801454-801485	9	0.719
NC_009439_2	2.3\|4137646\|32\|NC_009439\|CRISPRCasFinder,CRT	4137646-4137677	32	NZ_CP021767	Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence	801452-801483	9	0.719
NC_009439_2	2.3\|4137646\|32\|NC_009439\|CRISPRCasFinder,CRT	4137646-4137677	32	NZ_CP012688	Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence	801461-801492	9	0.719
NC_009439_2	2.3\|4137646\|32\|NC_009439\|CRISPRCasFinder,CRT	4137646-4137677	32	CP047139	Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence	817517-817548	9	0.719
NC_009439_2	2.3\|4137646\|32\|NC_009439\|CRISPRCasFinder,CRT	4137646-4137677	32	CP047137	Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence	780821-780852	9	0.719
NC_009439_2	2.5\|4137768\|32\|NC_009439\|CRISPRCasFinder,CRT	4137768-4137799	32	KC465901	Pelagibacter phage HTVC019P, complete genome	13613-13644	9	0.719
NC_009439_2	2.10\|4138075\|32\|NC_009439\|CRISPRCasFinder,CRT	4138075-4138106	32	MN586060	Mycobacterium phage PetterN, complete genome	47777-47808	9	0.719
NC_009439_2	2.12\|4138197\|32\|NC_009439\|CRISPRCasFinder,CRT	4138197-4138228	32	NZ_LR536452	Methylocella tundrae isolate MTUNDRAET4 annotated genome plasmid 3	168938-168969	9	0.719
NC_009439_2	2.12\|4138197\|32\|NC_009439\|CRISPRCasFinder,CRT	4138197-4138228	32	MG707188	Pseudomonas phage TC7, partial genome	35676-35707	9	0.719
NC_009439_2	2.12\|4138197\|32\|NC_009439\|CRISPRCasFinder,CRT	4138197-4138228	32	NC_030931	Pseudomonas phage phi2, complete genome	26280-26311	9	0.719
NC_009439_2	2.14\|4138319\|32\|NC_009439\|CRISPRCasFinder,CRT	4138319-4138350	32	MT939492	Xanthomonas phage Xoo-sp14, complete genome	176144-176175	9	0.719
NC_009439_2	2.15\|4138380\|32\|NC_009439\|CRISPRCasFinder,CRT	4138380-4138411	32	LT599585	Pseudomonas veronii 1YdBTEX2 genome assembly, plasmid: PVE_plasmid	283189-283220	9	0.719
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NZ_CP032346	Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence	57639-57670	9	0.719
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NZ_CP017148	Bosea vaviloviae strain Vaf18 plasmid unnamed1, complete sequence	187377-187408	9	0.719
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NC_019849	Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence	166088-166119	9	0.719
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NC_003078	Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence	1581179-1581210	9	0.719
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NZ_CP019586	Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence	1540370-1540401	9	0.719
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NC_017326	Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence	165883-165914	9	0.719
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NZ_CP021799	Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence	1646111-1646142	9	0.719
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NC_017323	Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence	1401171-1401202	9	0.719
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NZ_CP009146	Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence	160046-160077	9	0.719
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NC_018701	Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence	159933-159964	9	0.719
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NZ_CP023000	Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-B, complete sequence	1492799-1492830	9	0.719
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NZ_CP021828	Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence	1145702-1145733	9	0.719
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NZ_CP021802	Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence	426032-426063	9	0.719
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NZ_CP032342	Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence	405268-405299	9	0.719
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NZ_CP021820	Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence	504387-504418	9	0.719
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NZ_CP021831	Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence	411046-411077	9	0.719
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NZ_CP021823	Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence	1265522-1265553	9	0.719
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NZ_CP021814	Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence	39875-39906	9	0.719
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NZ_CP021795	Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence	803899-803930	9	0.719
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NZ_CP021810	Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence	948727-948758	9	0.719
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NZ_CP021806	Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence	855886-855917	9	0.719
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NZ_CP021218	Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence	313245-313276	9	0.719
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NZ_CP026527	Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence	162652-162683	9	0.719
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NZ_CP033321	Azospirillum brasilense strain Cd plasmid p3, complete sequence	413780-413811	9	0.719
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NZ_CP033315	Azospirillum brasilense strain Sp 7 plasmid p3, complete sequence	470543-470574	9	0.719
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NZ_CP019484	Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence	108533-108564	9	0.719
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NZ_CP019487	Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence	1472306-1472337	9	0.719
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NC_020560	Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence	1581193-1581224	9	0.719
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	NZ_CP022775	Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence	446300-446331	9	0.719
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	NZ_CP015585	Roseomonas gilardii strain U14-5 plasmid 1, complete sequence	89975-90006	9	0.719
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	NC_013859	Azospirillum sp. B510 plasmid pAB510e, complete sequence	6679-6710	9	0.719
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	NZ_CP032340	Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence	1494760-1494791	9	0.719
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	NZ_CP022764	Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence	446334-446365	9	0.719
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	NZ_CP012915	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence	637609-637640	9	0.719
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	NZ_CP022797	Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence	446334-446365	9	0.719
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	NZ_CP022758	Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence	446326-446357	9	0.719
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	KX765864	Salmonella phage ST-374, complete genome	8434-8465	9	0.719
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	KX765862	Salmonella phage ST-101, complete genome	42875-42906	9	0.719
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	AB916497	Ralstonia phage RS138 DNA, complete genome	3503-3534	9	0.719
NC_009439_2	2.20\|4138685\|32\|NC_009439\|CRISPRCasFinder,CRT	4138685-4138716	32	NZ_CP013072	Sphingobium indicum B90A plasmid pSRL2, complete sequence	49753-49784	9	0.719
NC_009439_2	2.20\|4138685\|32\|NC_009439\|CRISPRCasFinder,CRT	4138685-4138716	32	NC_008010	Deinococcus geothermalis DSM 11300 plasmid pDGEO01, complete sequence	15366-15397	9	0.719
NC_009439_2	2.23\|4138869\|32\|NC_009439\|CRISPRCasFinder,CRT	4138869-4138900	32	NZ_CP020504	Serratia marcescens strain 95 plasmid unnamed3, complete sequence	10291-10322	9	0.719
NC_009439_2	2.23\|4138869\|32\|NC_009439\|CRISPRCasFinder,CRT	4138869-4138900	32	NZ_CP026402	Escherichia coli strain ECONIH4 plasmid pECO-e618, complete sequence	5464-5495	9	0.719
NC_009439_2	2.26\|4139052\|33\|NC_009439\|CRISPRCasFinder,CRT	4139052-4139084	33	NC_008826	Methylibium petroleiphilum PM1 plasmid RPME01, complete sequence	400347-400379	9	0.727
NC_009439_2	2.26\|4139052\|33\|NC_009439\|CRISPRCasFinder,CRT	4139052-4139084	33	NC_008826	Methylibium petroleiphilum PM1 plasmid RPME01, complete sequence	432417-432449	9	0.727
NC_009439_2	2.31\|4139359\|32\|NC_009439\|CRISPRCasFinder,CRT	4139359-4139390	32	NC_016624	Azospirillum lipoferum 4B plasmid AZO_p5, complete sequence	396701-396732	9	0.719
NC_009439_2	2.31\|4139359\|32\|NC_009439\|CRISPRCasFinder,CRT	4139359-4139390	32	NZ_CP022369	Azospirillum sp. TSH58 plasmid TSH58_p05, complete sequence	547847-547878	9	0.719
NC_009439_2	2.31\|4139359\|32\|NC_009439\|CRISPRCasFinder,CRT	4139359-4139390	32	NC_012725	Burkholderia glumae BGR1 plasmid bglu_4p, complete sequence	70928-70959	9	0.719
NC_009439_2	2.31\|4139359\|32\|NC_009439\|CRISPRCasFinder,CRT	4139359-4139390	32	NC_012720	Burkholderia glumae BGR1 plasmid bglu_3p, complete sequence	68512-68543	9	0.719
NC_009439_2	2.31\|4139359\|32\|NC_009439\|CRISPRCasFinder,CRT	4139359-4139390	32	NZ_CP007796	Azospirillum brasilense strain Az39 plasmid AbAZ39_p3, complete sequence	245354-245385	9	0.719
NC_009439_2	2.31\|4139359\|32\|NC_009439\|CRISPRCasFinder,CRT	4139359-4139390	32	NZ_CP035902	Burkholderia glumae strain 257sh-1 plasmid plas1, complete sequence	113239-113270	9	0.719
NC_009439_2	2.31\|4139359\|32\|NC_009439\|CRISPRCasFinder,CRT	4139359-4139390	32	NC_023285	Streptomyces sp. F8 plasmid pFRL5, complete sequence	279094-279125	9	0.719
NC_009439_2	2.31\|4139359\|32\|NC_009439\|CRISPRCasFinder,CRT	4139359-4139390	32	NZ_CP029834	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed4, complete sequence	416115-416146	9	0.719
NC_009439_2	2.31\|4139359\|32\|NC_009439\|CRISPRCasFinder,CRT	4139359-4139390	32	NZ_CP038636	Cupriavidus oxalaticus strain X32 plasmid unnamed1, complete sequence	646980-647011	9	0.719
NC_009439_2	2.31\|4139359\|32\|NC_009439\|CRISPRCasFinder,CRT	4139359-4139390	32	NZ_CP052865	Burkholderia glumae strain HN1 plasmid pBGHN1-1, complete sequence	82890-82921	9	0.719
NC_009439_2	2.31\|4139359\|32\|NC_009439\|CRISPRCasFinder,CRT	4139359-4139390	32	NZ_CP032349	Azospirillum brasilense strain MTCC4039 plasmid p3, complete sequence	591968-591999	9	0.719
NC_009439_2	2.31\|4139359\|32\|NC_009439\|CRISPRCasFinder,CRT	4139359-4139390	32	NZ_CP047317	Burkholderia glumae AU6208 plasmid pwszb, complete sequence	62993-63024	9	0.719
NC_009439_2	2.33\|4139482\|32\|NC_009439\|CRISPRCasFinder,CRT	4139482-4139513	32	MK016493	Brevibacterium phage Cantare, complete genome	24772-24803	9	0.719
NC_009439_2	2.37\|4139726\|32\|NC_009439\|CRISPRCasFinder,CRT	4139726-4139757	32	KT898134	Aeromonas phage phiARM81mr, complete genome	33397-33428	9	0.719
NC_009439_2	2.37\|4139726\|32\|NC_009439\|CRISPRCasFinder,CRT	4139726-4139757	32	NZ_CP020399	Burkholderia multivorans strain FDAARGOS_246 plasmid unnamed, complete sequence	516995-517026	9	0.719
NC_009439_2	2.37\|4139726\|32\|NC_009439\|CRISPRCasFinder,CRT	4139726-4139757	32	NC_016634	Thermus sp. CCB_US3_UF1 plasmid pTCCB09, complete sequence	17622-17653	9	0.719
NC_009439_2	2.40\|4137652\|32\|NC_009439\|PILER-CR	4137652-4137683	32	NZ_CP021653	Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence	801454-801485	9	0.719
NC_009439_2	2.40\|4137652\|32\|NC_009439\|PILER-CR	4137652-4137683	32	NZ_CP021767	Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence	801452-801483	9	0.719
NC_009439_2	2.40\|4137652\|32\|NC_009439\|PILER-CR	4137652-4137683	32	NZ_CP012688	Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence	801461-801492	9	0.719
NC_009439_2	2.40\|4137652\|32\|NC_009439\|PILER-CR	4137652-4137683	32	CP047139	Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence	817517-817548	9	0.719
NC_009439_2	2.40\|4137652\|32\|NC_009439\|PILER-CR	4137652-4137683	32	CP047137	Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence	780821-780852	9	0.719
NC_009439_2	2.42\|4137774\|32\|NC_009439\|PILER-CR	4137774-4137805	32	KC465901	Pelagibacter phage HTVC019P, complete genome	13613-13644	9	0.719
NC_009439_2	2.47\|4138081\|32\|NC_009439\|PILER-CR	4138081-4138112	32	MN586060	Mycobacterium phage PetterN, complete genome	47777-47808	9	0.719
NC_009439_2	2.49\|4138203\|32\|NC_009439\|PILER-CR	4138203-4138234	32	NZ_LR536452	Methylocella tundrae isolate MTUNDRAET4 annotated genome plasmid 3	168938-168969	9	0.719
NC_009439_2	2.49\|4138203\|32\|NC_009439\|PILER-CR	4138203-4138234	32	MG707188	Pseudomonas phage TC7, partial genome	35676-35707	9	0.719
NC_009439_2	2.49\|4138203\|32\|NC_009439\|PILER-CR	4138203-4138234	32	NC_030931	Pseudomonas phage phi2, complete genome	26280-26311	9	0.719
NC_009439_2	2.51\|4138325\|32\|NC_009439\|PILER-CR	4138325-4138356	32	MT939492	Xanthomonas phage Xoo-sp14, complete genome	176144-176175	9	0.719
NC_009439_2	2.52\|4138386\|32\|NC_009439\|PILER-CR	4138386-4138417	32	LT599585	Pseudomonas veronii 1YdBTEX2 genome assembly, plasmid: PVE_plasmid	283189-283220	9	0.719
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NZ_CP032346	Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence	57639-57670	9	0.719
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NZ_CP017148	Bosea vaviloviae strain Vaf18 plasmid unnamed1, complete sequence	187377-187408	9	0.719
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NC_019849	Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence	166088-166119	9	0.719
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NC_003078	Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence	1581179-1581210	9	0.719
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NZ_CP019586	Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence	1540370-1540401	9	0.719
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NC_017326	Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence	165883-165914	9	0.719
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NZ_CP021799	Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence	1646111-1646142	9	0.719
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NC_017323	Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence	1401171-1401202	9	0.719
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NZ_CP009146	Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence	160046-160077	9	0.719
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NC_018701	Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence	159933-159964	9	0.719
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NZ_CP023000	Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-B, complete sequence	1492799-1492830	9	0.719
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NZ_CP021828	Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence	1145702-1145733	9	0.719
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NZ_CP021802	Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence	426032-426063	9	0.719
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NZ_CP032342	Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence	405268-405299	9	0.719
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NZ_CP021820	Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence	504387-504418	9	0.719
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NZ_CP021831	Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence	411046-411077	9	0.719
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NZ_CP021823	Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence	1265522-1265553	9	0.719
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NZ_CP021814	Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence	39875-39906	9	0.719
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NZ_CP021795	Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence	803899-803930	9	0.719
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NZ_CP021810	Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence	948727-948758	9	0.719
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NZ_CP021806	Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence	855886-855917	9	0.719
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NZ_CP021218	Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence	313245-313276	9	0.719
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NZ_CP026527	Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence	162652-162683	9	0.719
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NZ_CP033321	Azospirillum brasilense strain Cd plasmid p3, complete sequence	413780-413811	9	0.719
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NZ_CP033315	Azospirillum brasilense strain Sp 7 plasmid p3, complete sequence	470543-470574	9	0.719
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NZ_CP019484	Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence	108533-108564	9	0.719
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NZ_CP019487	Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence	1472306-1472337	9	0.719
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NC_020560	Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence	1581193-1581224	9	0.719
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	NZ_CP022775	Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence	446300-446331	9	0.719
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	NZ_CP015585	Roseomonas gilardii strain U14-5 plasmid 1, complete sequence	89975-90006	9	0.719
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	NC_013859	Azospirillum sp. B510 plasmid pAB510e, complete sequence	6679-6710	9	0.719
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	NZ_CP032340	Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence	1494760-1494791	9	0.719
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	NZ_CP022764	Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence	446334-446365	9	0.719
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	NZ_CP012915	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence	637609-637640	9	0.719
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	NZ_CP022797	Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence	446334-446365	9	0.719
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	NZ_CP022758	Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence	446326-446357	9	0.719
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	KX765864	Salmonella phage ST-374, complete genome	8434-8465	9	0.719
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	KX765862	Salmonella phage ST-101, complete genome	42875-42906	9	0.719
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	AB916497	Ralstonia phage RS138 DNA, complete genome	3503-3534	9	0.719
NC_009439_2	2.57\|4138691\|32\|NC_009439\|PILER-CR	4138691-4138722	32	NZ_CP013072	Sphingobium indicum B90A plasmid pSRL2, complete sequence	49753-49784	9	0.719
NC_009439_2	2.57\|4138691\|32\|NC_009439\|PILER-CR	4138691-4138722	32	NC_008010	Deinococcus geothermalis DSM 11300 plasmid pDGEO01, complete sequence	15366-15397	9	0.719
NC_009439_2	2.60\|4138875\|32\|NC_009439\|PILER-CR	4138875-4138906	32	NZ_CP020504	Serratia marcescens strain 95 plasmid unnamed3, complete sequence	10291-10322	9	0.719
NC_009439_2	2.60\|4138875\|32\|NC_009439\|PILER-CR	4138875-4138906	32	NZ_CP026402	Escherichia coli strain ECONIH4 plasmid pECO-e618, complete sequence	5464-5495	9	0.719
NC_009439_2	2.63\|4139058\|33\|NC_009439\|PILER-CR	4139058-4139090	33	NC_008826	Methylibium petroleiphilum PM1 plasmid RPME01, complete sequence	400347-400379	9	0.727
NC_009439_2	2.63\|4139058\|33\|NC_009439\|PILER-CR	4139058-4139090	33	NC_008826	Methylibium petroleiphilum PM1 plasmid RPME01, complete sequence	432417-432449	9	0.727
NC_009439_2	2.68\|4139365\|32\|NC_009439\|PILER-CR	4139365-4139396	32	NC_016624	Azospirillum lipoferum 4B plasmid AZO_p5, complete sequence	396701-396732	9	0.719
NC_009439_2	2.68\|4139365\|32\|NC_009439\|PILER-CR	4139365-4139396	32	NZ_CP022369	Azospirillum sp. TSH58 plasmid TSH58_p05, complete sequence	547847-547878	9	0.719
NC_009439_2	2.68\|4139365\|32\|NC_009439\|PILER-CR	4139365-4139396	32	NC_012725	Burkholderia glumae BGR1 plasmid bglu_4p, complete sequence	70928-70959	9	0.719
NC_009439_2	2.68\|4139365\|32\|NC_009439\|PILER-CR	4139365-4139396	32	NC_012720	Burkholderia glumae BGR1 plasmid bglu_3p, complete sequence	68512-68543	9	0.719
NC_009439_2	2.68\|4139365\|32\|NC_009439\|PILER-CR	4139365-4139396	32	NZ_CP007796	Azospirillum brasilense strain Az39 plasmid AbAZ39_p3, complete sequence	245354-245385	9	0.719
NC_009439_2	2.68\|4139365\|32\|NC_009439\|PILER-CR	4139365-4139396	32	NZ_CP035902	Burkholderia glumae strain 257sh-1 plasmid plas1, complete sequence	113239-113270	9	0.719
NC_009439_2	2.68\|4139365\|32\|NC_009439\|PILER-CR	4139365-4139396	32	NC_023285	Streptomyces sp. F8 plasmid pFRL5, complete sequence	279094-279125	9	0.719
NC_009439_2	2.68\|4139365\|32\|NC_009439\|PILER-CR	4139365-4139396	32	NZ_CP029834	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed4, complete sequence	416115-416146	9	0.719
NC_009439_2	2.68\|4139365\|32\|NC_009439\|PILER-CR	4139365-4139396	32	NZ_CP038636	Cupriavidus oxalaticus strain X32 plasmid unnamed1, complete sequence	646980-647011	9	0.719
NC_009439_2	2.68\|4139365\|32\|NC_009439\|PILER-CR	4139365-4139396	32	NZ_CP052865	Burkholderia glumae strain HN1 plasmid pBGHN1-1, complete sequence	82890-82921	9	0.719
NC_009439_2	2.68\|4139365\|32\|NC_009439\|PILER-CR	4139365-4139396	32	NZ_CP032349	Azospirillum brasilense strain MTCC4039 plasmid p3, complete sequence	591968-591999	9	0.719
NC_009439_2	2.68\|4139365\|32\|NC_009439\|PILER-CR	4139365-4139396	32	NZ_CP047317	Burkholderia glumae AU6208 plasmid pwszb, complete sequence	62993-63024	9	0.719
NC_009439_2	2.70\|4139488\|32\|NC_009439\|PILER-CR	4139488-4139519	32	MK016493	Brevibacterium phage Cantare, complete genome	24772-24803	9	0.719
NC_009439_2	2.74\|4139732\|32\|NC_009439\|PILER-CR	4139732-4139763	32	KT898134	Aeromonas phage phiARM81mr, complete genome	33397-33428	9	0.719
NC_009439_2	2.74\|4139732\|32\|NC_009439\|PILER-CR	4139732-4139763	32	NZ_CP020399	Burkholderia multivorans strain FDAARGOS_246 plasmid unnamed, complete sequence	516995-517026	9	0.719
NC_009439_2	2.74\|4139732\|32\|NC_009439\|PILER-CR	4139732-4139763	32	NC_016634	Thermus sp. CCB_US3_UF1 plasmid pTCCB09, complete sequence	17622-17653	9	0.719
NC_009439_3	3.1\|4149186\|32\|NC_009439\|CRISPRCasFinder,CRT	4149186-4149217	32	NZ_CP006990	Rhizobium sp. IE4771 plasmid pRetIE4771d, complete sequence	79713-79744	9	0.719
NC_009439_3	3.1\|4149186\|32\|NC_009439\|CRISPRCasFinder,CRT	4149186-4149217	32	NZ_CP007798	Azospirillum brasilense strain Az39 plasmid AbAZ39_p5, complete sequence	3351-3382	9	0.719
NC_009439_3	3.1\|4149186\|32\|NC_009439\|CRISPRCasFinder,CRT	4149186-4149217	32	NZ_CP021127	Rhizobium sp. Kim5 plasmid pRetKim5c, complete sequence	78245-78276	9	0.719
NC_009439_3	3.1\|4149186\|32\|NC_009439\|CRISPRCasFinder,CRT	4149186-4149217	32	CP007644	Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803c, complete sequence	79900-79931	9	0.719
NC_009439_3	3.1\|4149186\|32\|NC_009439\|CRISPRCasFinder,CRT	4149186-4149217	32	MG592505	Vibrio phage 1.134.O._10N.222.52.B8, partial genome	30687-30718	9	0.719
NC_009439_3	3.1\|4149186\|32\|NC_009439\|CRISPRCasFinder,CRT	4149186-4149217	32	MG592457	Vibrio phage 1.082.O._10N.261.49.E4, partial genome	31870-31901	9	0.719
NC_009439_3	3.1\|4149186\|32\|NC_009439\|CRISPRCasFinder,CRT	4149186-4149217	32	MG592543	Vibrio phage 1.176.O._10N.261.55.F5, partial genome	30762-30793	9	0.719
NC_009439_3	3.4\|4149370\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149370-4149401	32	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	278474-278505	9	0.719
NC_009439_3	3.4\|4149370\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149370-4149401	32	NZ_CP022363	Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence	704191-704222	9	0.719
NC_009439_3	3.4\|4149370\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149370-4149401	32	NZ_CP029833	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed3, complete sequence	491217-491248	9	0.719
NC_009439_3	3.4\|4149370\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149370-4149401	32	KX557283	Gordonia phage Remus, complete genome	32091-32122	9	0.719
NC_009439_3	3.4\|4149370\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149370-4149401	32	NC_041886	Gordonia phage Strosahl, complete genome	32091-32122	9	0.719
NC_009439_3	3.4\|4149370\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149370-4149401	32	LR606151	Rhizobium sp. Q54 genome assembly, plasmid: 8	133022-133053	9	0.719
NC_009439_3	3.4\|4149370\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149370-4149401	32	NZ_CP020372	Candidatus Thiodictyon syntrophicum strain Cad16T plasmid pTs485, complete sequence	290724-290755	9	0.719
NC_009439_3	3.4\|4149370\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149370-4149401	32	NZ_CP015040	Rhodovulum sp. P5 plasmid pRGUI01, complete sequence	49067-49098	9	0.719
NC_009439_3	3.4\|4149370\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149370-4149401	32	NZ_CP034186	Deinococcus sp. S14-83 strain S14-83T plasmid unnamed2, complete sequence	100067-100098	9	0.719
NC_009439_3	3.4\|4149370\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149370-4149401	32	MH651183	Mycobacterium phage Nivrat, complete genome	19347-19378	9	0.719
NC_009439_3	3.4\|4149370\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149370-4149401	32	MH834617	Mycobacterium phage Lizziana, complete genome	19348-19379	9	0.719
NC_009439_3	3.4\|4149370\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149370-4149401	32	MH399771	Mycobacterium phage ByChance, complete genome	19350-19381	9	0.719
NC_009439_3	3.5\|4149431\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149431-4149462	32	NZ_CP041223	Porphyrobacter sp. YT40 plasmid pYT40, complete sequence	71384-71415	9	0.719
NC_009439_3	3.5\|4149431\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149431-4149462	32	NC_018022	Mycolicibacterium chubuense NBB4 plasmid pMYCCH.01, complete sequence	584314-584345	9	0.719
NC_009439_3	3.5\|4149431\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149431-4149462	32	NZ_CP010861	Marinovum algicola DG 898 plasmid pMaD6, complete sequence	106412-106443	9	0.719
NC_009439_3	3.7\|4149553\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149553-4149584	32	NZ_CP019603	Croceicoccus marinus strain E4A9 plasmid pCME4A9I, complete sequence	400495-400526	9	0.719
NC_009439_3	3.11\|4149797\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149797-4149828	32	KT898134	Aeromonas phage phiARM81mr, complete genome	33397-33428	9	0.719
NC_009439_3	3.11\|4149797\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149797-4149828	32	NZ_CP020399	Burkholderia multivorans strain FDAARGOS_246 plasmid unnamed, complete sequence	516995-517026	9	0.719
NC_009439_3	3.11\|4149797\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149797-4149828	32	NC_016634	Thermus sp. CCB_US3_UF1 plasmid pTCCB09, complete sequence	17622-17653	9	0.719
NC_009439_3	3.12\|4149858\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149858-4149889	32	KT898134	Aeromonas phage phiARM81mr, complete genome	33397-33428	9	0.719
NC_009439_3	3.12\|4149858\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149858-4149889	32	NZ_CP020399	Burkholderia multivorans strain FDAARGOS_246 plasmid unnamed, complete sequence	516995-517026	9	0.719
NC_009439_3	3.12\|4149858\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149858-4149889	32	NC_016634	Thermus sp. CCB_US3_UF1 plasmid pTCCB09, complete sequence	17622-17653	9	0.719
NC_009439_3	3.13\|4149919\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149919-4149950	32	NZ_CP024424	Paracoccus yeei strain TT13 plasmid pTT13-2, complete sequence	202201-202232	9	0.719
NC_009439_3	3.13\|4149919\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149919-4149950	32	NZ_CP020440	Paracoccus yeei strain FDAARGOS_252 plasmid unnamed2, complete sequence	84242-84273	9	0.719
NC_009439_3	3.13\|4149919\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149919-4149950	32	NZ_CP044082	Paracoccus yeei strain FDAARGOS_643 plasmid unnamed4, complete sequence	238438-238469	9	0.719
NC_009439_3	3.13\|4149919\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149919-4149950	32	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	320399-320430	9	0.719
NC_009439_3	3.13\|4149919\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149919-4149950	32	CP007642	Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803a, complete sequence	243401-243432	9	0.719
NC_009439_3	3.15\|4150041\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4150041-4150072	32	NZ_CP015738	Shinella sp. HZN7 plasmid pShin-02, complete sequence	367769-367800	9	0.719
NC_009439_2	2.1\|4137525\|32\|NC_009439\|CRISPRCasFinder,CRT	4137525-4137556	32	NZ_CP015882	Ensifer adhaerens strain Casida A plasmid pCasidaAB, complete sequence	560344-560375	10	0.688
NC_009439_2	2.1\|4137525\|32\|NC_009439\|CRISPRCasFinder,CRT	4137525-4137556	32	NZ_CP030264	Ensifer adhaerens strain Corn53 plasmid AB, complete sequence	365561-365592	10	0.688
NC_009439_2	2.3\|4137646\|32\|NC_009439\|CRISPRCasFinder,CRT	4137646-4137677	32	NZ_CP025613	Niveispirillum cyanobacteriorum strain TH16 plasmid unnamed1, complete sequence	123050-123081	10	0.688
NC_009439_2	2.5\|4137768\|32\|NC_009439\|CRISPRCasFinder,CRT	4137768-4137799	32	MK504443	Lactobacillus phage 521B, complete genome	940-971	10	0.688
NC_009439_2	2.7\|4137890\|32\|NC_009439\|CRISPRCasFinder,CRT	4137890-4137921	32	NZ_CP045095	Streptomyces sp. GY16 plasmid unnamed1, complete sequence	50739-50770	10	0.688
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NZ_CP039697	Novosphingobium sp. ABRDHK2 plasmid pABRDHK22, complete sequence	523488-523519	10	0.688
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NC_015727	Cupriavidus necator N-1 plasmid pBB1, complete sequence	425645-425676	10	0.688
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NZ_CP044079	Paracoccus yeei strain FDAARGOS_643 plasmid unnamed2, complete sequence	226210-226241	10	0.688
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NZ_CP031079	Paracoccus yeei strain CCUG 32053 plasmid pYEE1, complete sequence	468971-469002	10	0.688
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	KY555147	Caulobacter phage Ccr34, complete genome	182699-182730	10	0.688
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	KY555145	Caulobacter phage Ccr29, complete genome	192109-192140	10	0.688
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	KY555143	Caulobacter phage Ccr2, complete genome	185256-185287	10	0.688
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NC_019410	Caulobacter phage CcrKarma, complete genome	187658-187689	10	0.688
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	KY555146	Caulobacter phage Ccr32, complete genome	182259-182290	10	0.688
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NC_019407	Caulobacter phage CcrMagneto, complete genome	184814-184845	10	0.688
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	KY555144	Caulobacter phage Ccr5, complete genome	185135-185166	10	0.688
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	JX163858	Caulobacter phage phiCbK, complete genome	25570-25601	10	0.688
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	KY555142	Caulobacter phage Ccr10, complete genome	184781-184812	10	0.688
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NC_019411	Caulobacter phage CcrSwift, complete genome	185187-185218	10	0.688
NC_009439_2	2.18\|4138563\|32\|NC_009439\|CRISPRCasFinder,CRT	4138563-4138594	32	MN183283	Arthrobacter phage BossLady, complete genome	10007-10038	10	0.688
NC_009439_2	2.18\|4138563\|32\|NC_009439\|CRISPRCasFinder,CRT	4138563-4138594	32	MF189176	Arthrobacter phage Jordan, complete genome	10013-10044	10	0.688
NC_009439_2	2.18\|4138563\|32\|NC_009439\|CRISPRCasFinder,CRT	4138563-4138594	32	MF189178	Arthrobacter phage Shade, complete genome	9992-10023	10	0.688
NC_009439_2	2.18\|4138563\|32\|NC_009439\|CRISPRCasFinder,CRT	4138563-4138594	32	KU160668	Arthrobacter phage TaeYoung, complete genome	10017-10048	10	0.688
NC_009439_2	2.18\|4138563\|32\|NC_009439\|CRISPRCasFinder,CRT	4138563-4138594	32	MT889388	Arthrobacter phage Pippa, complete genome	10052-10083	10	0.688
NC_009439_2	2.18\|4138563\|32\|NC_009439\|CRISPRCasFinder,CRT	4138563-4138594	32	MT114161	Arthrobacter phage JKerns, complete genome	10043-10074	10	0.688
NC_009439_2	2.18\|4138563\|32\|NC_009439\|CRISPRCasFinder,CRT	4138563-4138594	32	NC_041933	Arthrobacter phage Sonny, complete genome	10013-10044	10	0.688
NC_009439_2	2.18\|4138563\|32\|NC_009439\|CRISPRCasFinder,CRT	4138563-4138594	32	MK919479	Arthrobacter phage Grekaycon, complete genome	10016-10047	10	0.688
NC_009439_2	2.18\|4138563\|32\|NC_009439\|CRISPRCasFinder,CRT	4138563-4138594	32	NC_049468	Arthrobacter phage Zartrosa, complete genome	10016-10047	10	0.688
NC_009439_2	2.18\|4138563\|32\|NC_009439\|CRISPRCasFinder,CRT	4138563-4138594	32	KU160656	Arthrobacter phage Martha, complete genome	9954-9985	10	0.688
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	NZ_AP014579	Burkholderia sp. RPE67 plasmid p1, complete sequence	954050-954081	10	0.688
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	NC_016626	Burkholderia sp. YI23 plasmid byi_1p, complete sequence	809891-809922	10	0.688
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	NZ_CP045385	Ruegeria sp. THAF33 plasmid pTHAF33_a, complete sequence	175492-175523	10	0.688
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	MF377441	Arthrobacter phage Timinator, complete genome	14988-15019	10	0.688
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	MT310895	Arthrobacter phage StevieBAY, complete genome	14988-15019	10	0.688
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	KC139667	Salmonella phage FSL SP-099 hypothetical proteins, exonuclease RdgC, hypothetical proteins, putative DNA adenine methylase, hypothetical proteins, NinC protein, nucleoside phosphosulphate reductase, hypothetical proteins, lysis protein A, lysis protein B, hypothetical proteins, and tail fiber protein genes, complete cds; and hypothetical protein gene, partial cds	8424-8455	10	0.688
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	KP162168	Paracoccus phage vB_PmaS-R3, complete genome	31852-31883	10	0.688
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	NC_021780	Salmonella phage FSL SP-088, complete genome	8397-8428	10	0.688
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	KC139515	Salmonella phage FSL SP-124, complete genome	8436-8467	10	0.688
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	NC_025442	Salmonella phage Chi, complete genome	50920-50951	10	0.688
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	JN871591	Salmonella phage SPN19, complete genome	8541-8572	10	0.688
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	MN871450	UNVERIFIED: Serratia phage KpYy_1_41, complete genome	4374-4405	10	0.688
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	JX094499	Enterobacteria phage Chi, complete genome	12571-12602	10	0.688
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	KU647629	Arthrobacter phage BarretLemon, complete genome	14989-15020	10	0.688
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	KX452700	UNVERIFIED: Enterobacter phage KPN7 genomic sequence	12263-12294	10	0.688
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	KR296691	Salmonella phage 37, complete genome	51373-51404	10	0.688
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	LR026998	unidentified phage genome assembly, chromosome: 1	50252-50283	10	0.688
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	NC_031930	Salmonella phage 118970_sal1, complete genome	50867-50898	10	0.688
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	MK286578	Salmonella phage Season12, complete genome	50757-50788	10	0.688
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	NC_026608	Paracoccus phage vB_PmaS_IMEP1, complete genome	31852-31883	10	0.688
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	KR296689	Salmonella phage 35, complete genome	46811-46842	10	0.688
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	NC_048727	Salmonella phage Siskin, complete genome	50044-50075	10	0.688
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	NC_048666	Salmonella phage YSD1 strain YSD1_PHAGE genome assembly	50252-50283	10	0.688
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	KX452699	UNVERIFIED: Salmonella phage KPN6 genomic sequence	50321-50352	10	0.688
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	KC139585	Salmonella phage FSL SP-019 hypothetical protein gene, partial cds; hypothetical protein genes, complete cds; and hypothetical protein gene, partial cds	1321-1352	10	0.688
NC_009439_2	2.19\|4138624\|32\|NC_009439\|CRISPRCasFinder,CRT	4138624-4138655	32	MH825703	Arthrobacter phage LeeroyJ, complete genome	14988-15019	10	0.688
NC_009439_2	2.20\|4138685\|32\|NC_009439\|CRISPRCasFinder,CRT	4138685-4138716	32	NZ_CP054609	Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed1, complete sequence	250594-250625	10	0.688
NC_009439_2	2.31\|4139359\|32\|NC_009439\|CRISPRCasFinder,CRT	4139359-4139390	32	NZ_CP014519	Sinomonas atrocyanea strain KCTC 3377 plasmid pSA01, complete sequence	12744-12775	10	0.688
NC_009439_2	2.31\|4139359\|32\|NC_009439\|CRISPRCasFinder,CRT	4139359-4139390	32	NZ_CP016082	Streptomyces sp. SAT1 plasmid unnamed2, complete sequence	9080-9111	10	0.688
NC_009439_2	2.31\|4139359\|32\|NC_009439\|CRISPRCasFinder,CRT	4139359-4139390	32	CP054927	Streptomyces fulvissimus strain NA06532 plasmid unnamed1, complete sequence	299509-299540	10	0.688
NC_009439_2	2.31\|4139359\|32\|NC_009439\|CRISPRCasFinder,CRT	4139359-4139390	32	NC_006910	Micromonospora rosaria strain SCC2095 plasmid pMR2, complete sequence	4806-4837	10	0.688
NC_009439_2	2.32\|4139420\|33\|NC_009439\|CRISPRCasFinder,CRT	4139420-4139452	33	NZ_CP017941	Phyllobacterium zundukense strain Tri-48 plasmid unnamed1, complete sequence	216446-216478	10	0.697
NC_009439_2	2.32\|4139420\|33\|NC_009439\|CRISPRCasFinder,CRT	4139420-4139452	33	NC_007766	Rhizobium etli CFN 42 plasmid p42f, complete sequence	421072-421104	10	0.697
NC_009439_2	2.32\|4139420\|33\|NC_009439\|CRISPRCasFinder,CRT	4139420-4139452	33	NZ_CP006990	Rhizobium sp. IE4771 plasmid pRetIE4771d, complete sequence	397201-397233	10	0.697
NC_009439_2	2.32\|4139420\|33\|NC_009439\|CRISPRCasFinder,CRT	4139420-4139452	33	NZ_CP020911	Rhizobium etli strain NXC12 plasmid pRetNXC12e, complete sequence	551360-551392	10	0.697
NC_009439_2	2.32\|4139420\|33\|NC_009439\|CRISPRCasFinder,CRT	4139420-4139452	33	NZ_CP054022	Rhizobium sp. JKLM12A2 plasmid pPR12A201, complete sequence	647605-647637	10	0.697
NC_009439_2	2.32\|4139420\|33\|NC_009439\|CRISPRCasFinder,CRT	4139420-4139452	33	NZ_CP054032	Rhizobium sp. JKLM13E plasmid pPR13E01, complete sequence	341881-341913	10	0.697
NC_009439_2	2.32\|4139420\|33\|NC_009439\|CRISPRCasFinder,CRT	4139420-4139452	33	NZ_CP050092	Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b6, complete sequence	617634-617666	10	0.697
NC_009439_2	2.32\|4139420\|33\|NC_009439\|CRISPRCasFinder,CRT	4139420-4139452	33	NZ_CP050081	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b5, complete sequence	539678-539710	10	0.697
NC_009439_2	2.32\|4139420\|33\|NC_009439\|CRISPRCasFinder,CRT	4139420-4139452	33	NZ_CP049731	Rhizobium leguminosarum strain A1 plasmid pRL12, complete sequence	573881-573913	10	0.697
NC_009439_2	2.32\|4139420\|33\|NC_009439\|CRISPRCasFinder,CRT	4139420-4139452	33	NC_021911	Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1f, complete sequence	575519-575551	10	0.697
NC_009439_2	2.32\|4139420\|33\|NC_009439\|CRISPRCasFinder,CRT	4139420-4139452	33	NZ_CP053206	Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1D, complete sequence	575090-575122	10	0.697
NC_009439_2	2.37\|4139726\|32\|NC_009439\|CRISPRCasFinder,CRT	4139726-4139757	32	CP042641	Escherichia coli strain NCYU-24-74 plasmid pNCYU-24-74-3, complete sequence	46012-46043	10	0.688
NC_009439_2	2.37\|4139726\|32\|NC_009439\|CRISPRCasFinder,CRT	4139726-4139757	32	NC_008538	Arthrobacter sp. FB24 plasmid 2, complete sequence	66445-66476	10	0.688
NC_009439_2	2.37\|4139726\|32\|NC_009439\|CRISPRCasFinder,CRT	4139726-4139757	32	NZ_CP018229	Rhizobium leguminosarum strain Vaf-108 plasmid unnamed1, complete sequence	1064665-1064696	10	0.688
NC_009439_2	2.39\|4137586\|37\|NC_009439\|PILER-CR	4137586-4137622	37	NZ_CP026308	Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence	238228-238264	10	0.73
NC_009439_2	2.40\|4137652\|32\|NC_009439\|PILER-CR	4137652-4137683	32	NZ_CP025613	Niveispirillum cyanobacteriorum strain TH16 plasmid unnamed1, complete sequence	123050-123081	10	0.688
NC_009439_2	2.42\|4137774\|32\|NC_009439\|PILER-CR	4137774-4137805	32	MK504443	Lactobacillus phage 521B, complete genome	940-971	10	0.688
NC_009439_2	2.44\|4137896\|32\|NC_009439\|PILER-CR	4137896-4137927	32	NZ_CP045095	Streptomyces sp. GY16 plasmid unnamed1, complete sequence	50739-50770	10	0.688
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NZ_CP039697	Novosphingobium sp. ABRDHK2 plasmid pABRDHK22, complete sequence	523488-523519	10	0.688
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NC_015727	Cupriavidus necator N-1 plasmid pBB1, complete sequence	425645-425676	10	0.688
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NZ_CP044079	Paracoccus yeei strain FDAARGOS_643 plasmid unnamed2, complete sequence	226210-226241	10	0.688
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NZ_CP031079	Paracoccus yeei strain CCUG 32053 plasmid pYEE1, complete sequence	468971-469002	10	0.688
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	KY555147	Caulobacter phage Ccr34, complete genome	182699-182730	10	0.688
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	KY555145	Caulobacter phage Ccr29, complete genome	192109-192140	10	0.688
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	KY555143	Caulobacter phage Ccr2, complete genome	185256-185287	10	0.688
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NC_019410	Caulobacter phage CcrKarma, complete genome	187658-187689	10	0.688
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	KY555146	Caulobacter phage Ccr32, complete genome	182259-182290	10	0.688
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NC_019407	Caulobacter phage CcrMagneto, complete genome	184814-184845	10	0.688
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	KY555144	Caulobacter phage Ccr5, complete genome	185135-185166	10	0.688
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	JX163858	Caulobacter phage phiCbK, complete genome	25570-25601	10	0.688
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	KY555142	Caulobacter phage Ccr10, complete genome	184781-184812	10	0.688
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NC_019411	Caulobacter phage CcrSwift, complete genome	185187-185218	10	0.688
NC_009439_2	2.55\|4138569\|32\|NC_009439\|PILER-CR	4138569-4138600	32	MN183283	Arthrobacter phage BossLady, complete genome	10007-10038	10	0.688
NC_009439_2	2.55\|4138569\|32\|NC_009439\|PILER-CR	4138569-4138600	32	MF189176	Arthrobacter phage Jordan, complete genome	10013-10044	10	0.688
NC_009439_2	2.55\|4138569\|32\|NC_009439\|PILER-CR	4138569-4138600	32	MF189178	Arthrobacter phage Shade, complete genome	9992-10023	10	0.688
NC_009439_2	2.55\|4138569\|32\|NC_009439\|PILER-CR	4138569-4138600	32	KU160668	Arthrobacter phage TaeYoung, complete genome	10017-10048	10	0.688
NC_009439_2	2.55\|4138569\|32\|NC_009439\|PILER-CR	4138569-4138600	32	MT889388	Arthrobacter phage Pippa, complete genome	10052-10083	10	0.688
NC_009439_2	2.55\|4138569\|32\|NC_009439\|PILER-CR	4138569-4138600	32	MT114161	Arthrobacter phage JKerns, complete genome	10043-10074	10	0.688
NC_009439_2	2.55\|4138569\|32\|NC_009439\|PILER-CR	4138569-4138600	32	NC_041933	Arthrobacter phage Sonny, complete genome	10013-10044	10	0.688
NC_009439_2	2.55\|4138569\|32\|NC_009439\|PILER-CR	4138569-4138600	32	MK919479	Arthrobacter phage Grekaycon, complete genome	10016-10047	10	0.688
NC_009439_2	2.55\|4138569\|32\|NC_009439\|PILER-CR	4138569-4138600	32	NC_049468	Arthrobacter phage Zartrosa, complete genome	10016-10047	10	0.688
NC_009439_2	2.55\|4138569\|32\|NC_009439\|PILER-CR	4138569-4138600	32	KU160656	Arthrobacter phage Martha, complete genome	9954-9985	10	0.688
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	NZ_AP014579	Burkholderia sp. RPE67 plasmid p1, complete sequence	954050-954081	10	0.688
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	NC_016626	Burkholderia sp. YI23 plasmid byi_1p, complete sequence	809891-809922	10	0.688
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	NZ_CP045385	Ruegeria sp. THAF33 plasmid pTHAF33_a, complete sequence	175492-175523	10	0.688
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	MF377441	Arthrobacter phage Timinator, complete genome	14988-15019	10	0.688
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	MT310895	Arthrobacter phage StevieBAY, complete genome	14988-15019	10	0.688
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	KC139667	Salmonella phage FSL SP-099 hypothetical proteins, exonuclease RdgC, hypothetical proteins, putative DNA adenine methylase, hypothetical proteins, NinC protein, nucleoside phosphosulphate reductase, hypothetical proteins, lysis protein A, lysis protein B, hypothetical proteins, and tail fiber protein genes, complete cds; and hypothetical protein gene, partial cds	8424-8455	10	0.688
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	KP162168	Paracoccus phage vB_PmaS-R3, complete genome	31852-31883	10	0.688
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	NC_021780	Salmonella phage FSL SP-088, complete genome	8397-8428	10	0.688
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	KC139515	Salmonella phage FSL SP-124, complete genome	8436-8467	10	0.688
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	NC_025442	Salmonella phage Chi, complete genome	50920-50951	10	0.688
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	JN871591	Salmonella phage SPN19, complete genome	8541-8572	10	0.688
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	MN871450	UNVERIFIED: Serratia phage KpYy_1_41, complete genome	4374-4405	10	0.688
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	JX094499	Enterobacteria phage Chi, complete genome	12571-12602	10	0.688
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	KU647629	Arthrobacter phage BarretLemon, complete genome	14989-15020	10	0.688
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	KX452700	UNVERIFIED: Enterobacter phage KPN7 genomic sequence	12263-12294	10	0.688
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	KR296691	Salmonella phage 37, complete genome	51373-51404	10	0.688
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	LR026998	unidentified phage genome assembly, chromosome: 1	50252-50283	10	0.688
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	NC_031930	Salmonella phage 118970_sal1, complete genome	50867-50898	10	0.688
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	MK286578	Salmonella phage Season12, complete genome	50757-50788	10	0.688
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	NC_026608	Paracoccus phage vB_PmaS_IMEP1, complete genome	31852-31883	10	0.688
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	KR296689	Salmonella phage 35, complete genome	46811-46842	10	0.688
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	NC_048727	Salmonella phage Siskin, complete genome	50044-50075	10	0.688
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	NC_048666	Salmonella phage YSD1 strain YSD1_PHAGE genome assembly	50252-50283	10	0.688
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	KX452699	UNVERIFIED: Salmonella phage KPN6 genomic sequence	50321-50352	10	0.688
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	KC139585	Salmonella phage FSL SP-019 hypothetical protein gene, partial cds; hypothetical protein genes, complete cds; and hypothetical protein gene, partial cds	1321-1352	10	0.688
NC_009439_2	2.56\|4138630\|32\|NC_009439\|PILER-CR	4138630-4138661	32	MH825703	Arthrobacter phage LeeroyJ, complete genome	14988-15019	10	0.688
NC_009439_2	2.57\|4138691\|32\|NC_009439\|PILER-CR	4138691-4138722	32	NZ_CP054609	Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed1, complete sequence	250594-250625	10	0.688
NC_009439_2	2.68\|4139365\|32\|NC_009439\|PILER-CR	4139365-4139396	32	NZ_CP014519	Sinomonas atrocyanea strain KCTC 3377 plasmid pSA01, complete sequence	12744-12775	10	0.688
NC_009439_2	2.68\|4139365\|32\|NC_009439\|PILER-CR	4139365-4139396	32	NZ_CP016082	Streptomyces sp. SAT1 plasmid unnamed2, complete sequence	9080-9111	10	0.688
NC_009439_2	2.68\|4139365\|32\|NC_009439\|PILER-CR	4139365-4139396	32	CP054927	Streptomyces fulvissimus strain NA06532 plasmid unnamed1, complete sequence	299509-299540	10	0.688
NC_009439_2	2.68\|4139365\|32\|NC_009439\|PILER-CR	4139365-4139396	32	NC_006910	Micromonospora rosaria strain SCC2095 plasmid pMR2, complete sequence	4806-4837	10	0.688
NC_009439_2	2.69\|4139426\|33\|NC_009439\|PILER-CR	4139426-4139458	33	NZ_CP017941	Phyllobacterium zundukense strain Tri-48 plasmid unnamed1, complete sequence	216446-216478	10	0.697
NC_009439_2	2.69\|4139426\|33\|NC_009439\|PILER-CR	4139426-4139458	33	NC_007766	Rhizobium etli CFN 42 plasmid p42f, complete sequence	421072-421104	10	0.697
NC_009439_2	2.69\|4139426\|33\|NC_009439\|PILER-CR	4139426-4139458	33	NZ_CP006990	Rhizobium sp. IE4771 plasmid pRetIE4771d, complete sequence	397201-397233	10	0.697
NC_009439_2	2.69\|4139426\|33\|NC_009439\|PILER-CR	4139426-4139458	33	NZ_CP020911	Rhizobium etli strain NXC12 plasmid pRetNXC12e, complete sequence	551360-551392	10	0.697
NC_009439_2	2.69\|4139426\|33\|NC_009439\|PILER-CR	4139426-4139458	33	NZ_CP054022	Rhizobium sp. JKLM12A2 plasmid pPR12A201, complete sequence	647605-647637	10	0.697
NC_009439_2	2.69\|4139426\|33\|NC_009439\|PILER-CR	4139426-4139458	33	NZ_CP054032	Rhizobium sp. JKLM13E plasmid pPR13E01, complete sequence	341881-341913	10	0.697
NC_009439_2	2.69\|4139426\|33\|NC_009439\|PILER-CR	4139426-4139458	33	NZ_CP050092	Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b6, complete sequence	617634-617666	10	0.697
NC_009439_2	2.69\|4139426\|33\|NC_009439\|PILER-CR	4139426-4139458	33	NZ_CP050081	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b5, complete sequence	539678-539710	10	0.697
NC_009439_2	2.69\|4139426\|33\|NC_009439\|PILER-CR	4139426-4139458	33	NZ_CP049731	Rhizobium leguminosarum strain A1 plasmid pRL12, complete sequence	573881-573913	10	0.697
NC_009439_2	2.69\|4139426\|33\|NC_009439\|PILER-CR	4139426-4139458	33	NC_021911	Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1f, complete sequence	575519-575551	10	0.697
NC_009439_2	2.69\|4139426\|33\|NC_009439\|PILER-CR	4139426-4139458	33	NZ_CP053206	Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1D, complete sequence	575090-575122	10	0.697
NC_009439_2	2.74\|4139732\|32\|NC_009439\|PILER-CR	4139732-4139763	32	CP042641	Escherichia coli strain NCYU-24-74 plasmid pNCYU-24-74-3, complete sequence	46012-46043	10	0.688
NC_009439_2	2.74\|4139732\|32\|NC_009439\|PILER-CR	4139732-4139763	32	NC_008538	Arthrobacter sp. FB24 plasmid 2, complete sequence	66445-66476	10	0.688
NC_009439_2	2.74\|4139732\|32\|NC_009439\|PILER-CR	4139732-4139763	32	NZ_CP018229	Rhizobium leguminosarum strain Vaf-108 plasmid unnamed1, complete sequence	1064665-1064696	10	0.688
NC_009439_3	3.1\|4149186\|32\|NC_009439\|CRISPRCasFinder,CRT	4149186-4149217	32	NZ_CP032327	Azospirillum brasilense strain MTCC4035 plasmid p6, complete sequence	64547-64578	10	0.688
NC_009439_3	3.1\|4149186\|32\|NC_009439\|CRISPRCasFinder,CRT	4149186-4149217	32	NZ_CP023408	Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence	863378-863409	10	0.688
NC_009439_3	3.4\|4149370\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149370-4149401	32	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	943279-943310	10	0.688
NC_009439_3	3.4\|4149370\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149370-4149401	32	NZ_CP032054	Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence	545039-545070	10	0.688
NC_009439_3	3.4\|4149370\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149370-4149401	32	NZ_CP016560	Streptomyces clavuligerus strain F613-1 plasmid pSCL4, complete sequence	202295-202326	10	0.688
NC_009439_3	3.4\|4149370\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149370-4149401	32	NZ_CP034185	Deinococcus sp. S14-83 strain S14-83T plasmid unnamed1, complete sequence	94661-94692	10	0.688
NC_009439_3	3.5\|4149431\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149431-4149462	32	NZ_CP015092	Pelagibaca abyssi strain JLT2014 plasmid pPABY3, complete sequence	87331-87362	10	0.688
NC_009439_3	3.11\|4149797\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149797-4149828	32	CP042641	Escherichia coli strain NCYU-24-74 plasmid pNCYU-24-74-3, complete sequence	46012-46043	10	0.688
NC_009439_3	3.11\|4149797\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149797-4149828	32	NC_008538	Arthrobacter sp. FB24 plasmid 2, complete sequence	66445-66476	10	0.688
NC_009439_3	3.11\|4149797\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149797-4149828	32	NZ_CP018229	Rhizobium leguminosarum strain Vaf-108 plasmid unnamed1, complete sequence	1064665-1064696	10	0.688
NC_009439_3	3.12\|4149858\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149858-4149889	32	CP042641	Escherichia coli strain NCYU-24-74 plasmid pNCYU-24-74-3, complete sequence	46012-46043	10	0.688
NC_009439_3	3.12\|4149858\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149858-4149889	32	NC_008538	Arthrobacter sp. FB24 plasmid 2, complete sequence	66445-66476	10	0.688
NC_009439_3	3.12\|4149858\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149858-4149889	32	NZ_CP018229	Rhizobium leguminosarum strain Vaf-108 plasmid unnamed1, complete sequence	1064665-1064696	10	0.688
NC_009439_3	3.13\|4149919\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149919-4149950	32	NZ_CP012185	Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence	634510-634541	10	0.688
NC_009439_3	3.13\|4149919\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149919-4149950	32	NZ_CP040821	Paraoceanicella profunda strain D4M1 plasmid pD4M1C, complete sequence	156760-156791	10	0.688
NC_009439_3	3.13\|4149919\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4149919-4149950	32	NZ_CP012182	Pseudonocardia sp. EC080610-09 plasmid pBCI2-1, complete sequence	414027-414058	10	0.688
NC_009439_3	3.15\|4150041\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4150041-4150072	32	NZ_CP021355	Rhodococcus sp. S2-17 plasmid pRB98, complete sequence	89461-89492	10	0.688
NC_009439_3	3.15\|4150041\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4150041-4150072	32	MH697582	Mycobacterium phage Ejimix, complete genome	16168-16199	10	0.688
NC_009439_3	3.15\|4150041\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4150041-4150072	32	MK967402	Mycobacterium phage NihilNomen, complete genome	15479-15510	10	0.688
NC_009439_3	3.15\|4150041\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4150041-4150072	32	MH697583	Mycobacterium phage EricMillard, complete genome	15704-15735	10	0.688
NC_009439_3	3.15\|4150041\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4150041-4150072	32	MH727551	Mycobacterium phage Kalah2, complete genome	16019-16050	10	0.688
NC_009439_3	3.15\|4150041\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4150041-4150072	32	MF919504	Mycobacterium phage DmpstrDiver, complete genome	15594-15625	10	0.688
NC_009439_3	3.15\|4150041\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4150041-4150072	32	MH399772	Mycobacterium phage Constella, complete genome	14241-14272	10	0.688
NC_009439_3	3.15\|4150041\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4150041-4150072	32	MH077579	Mycobacterium phage Halley, complete genome	15417-15448	10	0.688
NC_009439_3	3.15\|4150041\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4150041-4150072	32	JF937090	Mycobacterium virus BAKA, complete genome	15063-15094	10	0.688
NC_009439_3	3.15\|4150041\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4150041-4150072	32	MH669017	Mycobacterium phage Zelink, complete genome	15582-15613	10	0.688
NC_009439_3	3.15\|4150041\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4150041-4150072	32	MK524521	Mycobacterium phage Schatzie, complete genome	14729-14760	10	0.688
NC_009439_3	3.15\|4150041\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4150041-4150072	32	MK524516	Mycobacterium phage Bobby, complete genome	15371-15402	10	0.688
NC_009439_3	3.15\|4150041\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4150041-4150072	32	MN062701	Mycobacterium phage Dallas, complete genome	14958-14989	10	0.688
NC_009439_3	3.15\|4150041\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4150041-4150072	32	NC_041844	Mycobacterium phage Optimus, complete genome	15057-15088	10	0.688
NC_009439_3	3.15\|4150041\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4150041-4150072	32	MK524527	Mycobacterium phage ThreeRngTarjay, complete genome	15554-15585	10	0.688
NC_009439_3	3.15\|4150041\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4150041-4150072	32	MK279849	Mycobacterium phage Duke13, complete genome	14992-15023	10	0.688
NC_009439_3	3.15\|4150041\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4150041-4150072	32	MN183286	Mycobacteriophage Yeet, complete genome	14730-14761	10	0.688
NC_009439_3	3.15\|4150041\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4150041-4150072	32	MK524529	Mycobacterium phage Phoebus, complete genome	15704-15735	10	0.688
NC_009439_3	3.15\|4150041\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4150041-4150072	32	JN201525	Mycobacterium phage Thibault, complete genome	14988-15019	10	0.688
NC_009439_3	3.15\|4150041\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4150041-4150072	32	MF919512	Mycobacterium phage Klein, complete genome	14997-15028	10	0.688
NC_009439_3	3.15\|4150041\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4150041-4150072	32	NC_026584	Mycobacterium phage Minerva, complete genome	15482-15513	10	0.688
NC_009439_3	3.15\|4150041\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4150041-4150072	32	KF114875	Mycobacterium phage Redno2, complete genome	15188-15219	10	0.688
NC_009439_3	3.15\|4150041\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4150041-4150072	32	NC_022067	Mycobacterium phage Wanda, complete genome	14997-15028	10	0.688
NC_009439_3	3.15\|4150041\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4150041-4150072	32	MK524504	Mycobacterium phage Hughesyang, complete genome	15600-15631	10	0.688
NC_009439_3	3.15\|4150041\|32\|NC_009439\|CRISPRCasFinder,CRT,PILER-CR	4150041-4150072	32	MK967379	Mycobacterium phage HokkenD, complete genome	14987-15018	10	0.688
NC_009439_2	2.3\|4137646\|32\|NC_009439\|CRISPRCasFinder,CRT	4137646-4137677	32	NZ_CP036407	Komagataeibacter saccharivorans strain JH1 plasmid p92689, complete sequence	83093-83124	11	0.656
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NZ_KX169264	Pseudomonas aeruginosa strain D5170990 plasmid pD5170990, complete sequence	15335-15366	11	0.656
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NZ_KP975076	Pseudomonas aeruginosa strain MRSN17623 plasmid pMRVIM0713, complete sequence	29690-29721	11	0.656
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	MN336501	Pseudomonas aeruginosa strain 164130 plasmid p4130-KPC, complete sequence	39962-39993	11	0.656
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NZ_CP014066	Achromobacter xylosoxidans strain FDAARGOS_162 plasmid unnamed, complete sequence	6209-6240	11	0.656
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NC_009739	Pseudomonas aeruginosa plasmid pMATVIM-7, complete sequence	16050-16081	11	0.656
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NZ_MK423762	Achromobacter ruhlandii strain 138R plasmid p138R, complete sequence	22923-22954	11	0.656
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NZ_CP033834	Pseudomonas aeruginosa strain FDAARGOS_570 plasmid unnamed, complete sequence	5577-5608	11	0.656
NC_009439_2	2.16\|4138441\|32\|NC_009439\|CRISPRCasFinder,CRT	4138441-4138472	32	NZ_AP013064	Serratia marcescens SM39 plasmid pSMC1, complete sequence	18148-18179	11	0.656
NC_009439_2	2.28\|4139176\|32\|NC_009439\|CRISPRCasFinder,CRT	4139176-4139207	32	NZ_AP017899	Sphingopyxis sp. FD7 plasmid pSFD01, complete sequence	176083-176114	11	0.656
NC_009439_2	2.32\|4139420\|33\|NC_009439\|CRISPRCasFinder,CRT	4139420-4139452	33	NZ_CP050098	Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b4, complete sequence	599145-599177	11	0.667
NC_009439_2	2.32\|4139420\|33\|NC_009439\|CRISPRCasFinder,CRT	4139420-4139452	33	NZ_CP053440	Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eF, complete sequence	670509-670541	11	0.667
NC_009439_2	2.32\|4139420\|33\|NC_009439\|CRISPRCasFinder,CRT	4139420-4139452	33	NC_012848	Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132501, complete sequence	374385-374417	11	0.667
NC_009439_2	2.32\|4139420\|33\|NC_009439\|CRISPRCasFinder,CRT	4139420-4139452	33	NZ_CP024310	Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3c, complete sequence	463929-463961	11	0.667
NC_009439_2	2.32\|4139420\|33\|NC_009439\|CRISPRCasFinder,CRT	4139420-4139452	33	NZ_CP023064	Sinorhizobium sp. CCBAU 05631 plasmid pSS05631b, complete sequence	284647-284679	11	0.667
NC_009439_2	2.40\|4137652\|32\|NC_009439\|PILER-CR	4137652-4137683	32	NZ_CP036407	Komagataeibacter saccharivorans strain JH1 plasmid p92689, complete sequence	83093-83124	11	0.656
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NZ_KX169264	Pseudomonas aeruginosa strain D5170990 plasmid pD5170990, complete sequence	15335-15366	11	0.656
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NZ_KP975076	Pseudomonas aeruginosa strain MRSN17623 plasmid pMRVIM0713, complete sequence	29690-29721	11	0.656
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	MN336501	Pseudomonas aeruginosa strain 164130 plasmid p4130-KPC, complete sequence	39962-39993	11	0.656
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NZ_CP014066	Achromobacter xylosoxidans strain FDAARGOS_162 plasmid unnamed, complete sequence	6209-6240	11	0.656
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NC_009739	Pseudomonas aeruginosa plasmid pMATVIM-7, complete sequence	16050-16081	11	0.656
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NZ_MK423762	Achromobacter ruhlandii strain 138R plasmid p138R, complete sequence	22923-22954	11	0.656
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NZ_CP033834	Pseudomonas aeruginosa strain FDAARGOS_570 plasmid unnamed, complete sequence	5577-5608	11	0.656
NC_009439_2	2.53\|4138447\|32\|NC_009439\|PILER-CR	4138447-4138478	32	NZ_AP013064	Serratia marcescens SM39 plasmid pSMC1, complete sequence	18148-18179	11	0.656
NC_009439_2	2.65\|4139182\|32\|NC_009439\|PILER-CR	4139182-4139213	32	NZ_AP017899	Sphingopyxis sp. FD7 plasmid pSFD01, complete sequence	176083-176114	11	0.656
NC_009439_2	2.69\|4139426\|33\|NC_009439\|PILER-CR	4139426-4139458	33	NZ_CP050098	Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b4, complete sequence	599145-599177	11	0.667
NC_009439_2	2.69\|4139426\|33\|NC_009439\|PILER-CR	4139426-4139458	33	NZ_CP053440	Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eF, complete sequence	670509-670541	11	0.667
NC_009439_2	2.69\|4139426\|33\|NC_009439\|PILER-CR	4139426-4139458	33	NC_012848	Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132501, complete sequence	374385-374417	11	0.667
NC_009439_2	2.69\|4139426\|33\|NC_009439\|PILER-CR	4139426-4139458	33	NZ_CP024310	Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3c, complete sequence	463929-463961	11	0.667
NC_009439_2	2.69\|4139426\|33\|NC_009439\|PILER-CR	4139426-4139458	33	NZ_CP023064	Sinorhizobium sp. CCBAU 05631 plasmid pSS05631b, complete sequence	284647-284679	11	0.667

1. spacer 2.10|4138075|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP017750 (Cupriavidus sp. USMAA2-4 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.844

-agcggtgacggctacccgaccgtggtggtgga	CRISPR spacer
cagcagcg-cggctaccaggccgtggtggtgga	Protospacer
 ***.*.* ******** *.*************

2. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP037915 (Sphingomonas sp. AAP5 plasmid p150, complete sequence) position: , mismatch: 5, identity: 0.844

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
tccttcgccgcctcgattcgggcctcgattag	Protospacer
 **************** *******.*** *

3. spacer 2.47|4138081|32|NC_009439|PILER-CR matches to NZ_CP017750 (Cupriavidus sp. USMAA2-4 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.844

-agcggtgacggctacccgaccgtggtggtgga	CRISPR spacer
cagcagcg-cggctaccaggccgtggtggtgga	Protospacer
 ***.*.* ******** *.*************

4. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NZ_CP037915 (Sphingomonas sp. AAP5 plasmid p150, complete sequence) position: , mismatch: 5, identity: 0.844

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
tccttcgccgcctcgattcgggcctcgattag	Protospacer
 **************** *******.*** *

5. spacer 3.5|4149431|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP046573 (Rhodococcus sp. WAY2 plasmid pRWAY01, complete sequence) position: , mismatch: 5, identity: 0.844

gcgccggcgccgcagagcctggccg-gccgaga	CRISPR spacer
ccgccggcgccgcagagccggaccgcaccgag-	Protospacer
 ****************** *.*** .*****

6. spacer 3.9|4149675|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013071 (Sphingobium indicum B90A plasmid pSRL1, complete sequence) position: , mismatch: 5, identity: 0.844

-ctggtctgtcgccgctctccgcactgtctggc	CRISPR spacer
actgg-ctgtccccgccctccgcactgtcttcc	Protospacer
 **** ***** ****.*************  *

7. spacer 3.10|4149736|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP054609 (Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.844

tcgaacatttcccactcgctcgccttcatgat	CRISPR spacer
ttgaatgcttcccactcgctcggcttcatgat	Protospacer
*.***...************** *********

8. spacer 3.10|4149736|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP054611 (Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed3, complete sequence) position: , mismatch: 5, identity: 0.844

tcgaacatttcccactcgctcgccttcatgat	CRISPR spacer
ttgaatgcttcccactcgctcggcttcatgat	Protospacer
*.***...************** *********

9. spacer 2.2|4137586|31|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP045385 (Ruegeria sp. THAF33 plasmid pTHAF33_a, complete sequence) position: , mismatch: 6, identity: 0.806

gtcaggtcgtcgcggttcatccactgcgcga	CRISPR spacer
gtcaggtcgtcgcgcttgatccacagatcca	Protospacer
************** ** ****** *  * *

10. spacer 2.2|4137586|31|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP033221 (Parasedimentitalea marina strain W43 plasmid pW43B, complete sequence) position: , mismatch: 6, identity: 0.806

gtcaggtcgtcgcggttcatccactgcgcga	CRISPR spacer
gtcagatcgtcgcgtttcatccaaagatcga	Protospacer
*****.******** ********  *  ***

11. spacer 2.10|4138075|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP026745 (Nocardia cyriacigeorgica strain MDA3349 isolate MDA3349 ancestor plasmid p_unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

agcggtgacggctacccgaccgtggtggtgga	CRISPR spacer
gccggtgacggctacctgaccgtggtgatcgt	Protospacer
. **************.**********.* *

12. spacer 2.10|4138075|32|NC_009439|CRISPRCasFinder,CRT matches to HQ332141 (Halorubrum phage CGphi46 genomic sequence) position: , mismatch: 6, identity: 0.812

agcggtgacggctacccgaccgtggtggtgga	CRISPR spacer
gccgaggacggctacccgaccgaggaggtgga	Protospacer
. **. **************** ** ******

13. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP035092 (Paracoccus denitrificans strain ATCC 19367 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.812

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
gcattcgccgcctcgatgcaggcctcggcgat	Protospacer
** ****************.*****.*..**.

14. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NC_008688 (Paracoccus denitrificans PD1222 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.812

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
gcattcgccgcctcgatgcaggcctcggcgat	Protospacer
** ****************.*****.*..**.

15. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP044425 (Paracoccus pantotrophus strain DSM 2944 plasmid pPAN2, complete sequence) position: , mismatch: 6, identity: 0.812

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
gccttcgccgcctcgatgcaggcttcggcgat	Protospacer
*******************.***.*.*..**.

16. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to CP021182 (Sphingomonas wittichii DC-6 plasmid pDC01, complete sequence) position: , mismatch: 6, identity: 0.812

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
ggtgtcatgaccgccgaagacgccgacggcag	Protospacer
*  **  ****** ************** ***

17. spacer 2.47|4138081|32|NC_009439|PILER-CR matches to NZ_CP026745 (Nocardia cyriacigeorgica strain MDA3349 isolate MDA3349 ancestor plasmid p_unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

agcggtgacggctacccgaccgtggtggtgga	CRISPR spacer
gccggtgacggctacctgaccgtggtgatcgt	Protospacer
. **************.**********.* *

18. spacer 2.47|4138081|32|NC_009439|PILER-CR matches to HQ332141 (Halorubrum phage CGphi46 genomic sequence) position: , mismatch: 6, identity: 0.812

agcggtgacggctacccgaccgtggtggtgga	CRISPR spacer
gccgaggacggctacccgaccgaggaggtgga	Protospacer
. **. **************** ** ******

19. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NZ_CP035092 (Paracoccus denitrificans strain ATCC 19367 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.812

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
gcattcgccgcctcgatgcaggcctcggcgat	Protospacer
** ****************.*****.*..**.

20. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NC_008688 (Paracoccus denitrificans PD1222 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.812

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
gcattcgccgcctcgatgcaggcctcggcgat	Protospacer
** ****************.*****.*..**.

21. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NZ_CP044425 (Paracoccus pantotrophus strain DSM 2944 plasmid pPAN2, complete sequence) position: , mismatch: 6, identity: 0.812

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
gccttcgccgcctcgatgcaggcttcggcgat	Protospacer
*******************.***.*.*..**.

22. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to CP021182 (Sphingomonas wittichii DC-6 plasmid pDC01, complete sequence) position: , mismatch: 6, identity: 0.812

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
ggtgtcatgaccgccgaagacgccgacggcag	Protospacer
*  **  ****** ************** ***

23. spacer 3.2|4149247|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP043508 (Acetobacter sp. KACC 21233 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.812

gcgctgatcgactgcaacgcgttctactgcag	CRISPR spacer
ggcctgatcgactgcaacgcattctactgttc	Protospacer
*  *****************.********.

24. spacer 3.2|4149247|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP017563 (Paraburkholderia sprentiae WSM5005 plasmid pl1WSM5005, complete sequence) position: , mismatch: 6, identity: 0.812

gcgctgatcgactgcaacgcgttctactgcag-----	CRISPR spacer
gcgctgatcgactgcaactcgt-----tgcaggaatg	Protospacer
****************** ***     *****

25. spacer 3.5|4149431|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP022760 (Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gcgccggcgccgcagagcctggccggccgaga	CRISPR spacer
gctgcggcgccgcagggcctggccggccgcat	Protospacer
**  ***********.************* .

26. spacer 3.5|4149431|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP022789 (Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

gcgccggcgccgcagagcctggccggccgaga	CRISPR spacer
gctgcggcgccgcagggcctggccggccgcat	Protospacer
**  ***********.************* .

27. spacer 3.10|4149736|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to MN033529 (Leviviridae sp. isolate H2_Bulk_36_scaffold_542_e_230 hypothetical protein (H2Bulk36542e230_000001) and RNA-dependent RNA polymerase (H2Bulk36542e230_000002) genes, complete cds) position: , mismatch: 6, identity: 0.812

tcgaacatttcccactcgctcgccttcatgat	CRISPR spacer
ccgaacatatcccactcgctcgacttcgtatt	Protospacer
.******* ************* ****.*. *

28. spacer 2.7|4137890|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP019241 (Rhodoferax antarcticus strain DSMZ24876 plasmid unnamed1) position: , mismatch: 7, identity: 0.781

aggtgtacggtcagcgcgtgctgcggcggtcg	CRISPR spacer
cagggtgcggtcagcgcgtgcggcggcggttt	Protospacer
 .* **.************** ********.

29. spacer 2.7|4137890|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_AP018921 (Pseudonocardia autotrophica strain NBRC 12743 plasmid pPA12743CP, complete sequence) position: , mismatch: 7, identity: 0.781

aggtgtacggtcagcgcgtgctgcggcggtcg	CRISPR spacer
accaggacggtcagcacgtgctgcggcagtgg	Protospacer
*   * *********.***********.** *

30. spacer 2.10|4138075|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_LN868941 (Nocardia farcinica strain NCTC11134 plasmid 4, complete sequence) position: , mismatch: 7, identity: 0.781

agcggtgacggctacccgaccgtggtggtgga	CRISPR spacer
gccggtgacggctatctgaccgtggtgatcgt	Protospacer
. ************.*.**********.* *

31. spacer 2.10|4138075|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP031419 (Nocardia farcinica strain W6977 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

agcggtgacggctacccgaccgtggtggtgga	CRISPR spacer
gccggtgacggctatctgaccgtggtgatcgt	Protospacer
. ************.*.**********.* *

32. spacer 2.10|4138075|32|NC_009439|CRISPRCasFinder,CRT matches to JX042578 (Mycobacteriophage ElTiger69, complete genome) position: , mismatch: 7, identity: 0.781

agcggtgacggctacccgaccgtggtggtgga	CRISPR spacer
tgcggtggcggctacccgaccatggtcgacgc	Protospacer
 ******.*************.**** *  *

33. spacer 2.10|4138075|32|NC_009439|CRISPRCasFinder,CRT matches to MF141539 (Mycobacterium phage MyraDee, complete genome) position: , mismatch: 7, identity: 0.781

agcggtgacggctacccgaccgtggtggtgga	CRISPR spacer
agcggtgacggcgaaccgaccgtgaccgaggt	Protospacer
************ * *********.. * **

34. spacer 2.10|4138075|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP032322 (Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.781

agcggtga-cggctacccgaccgtggtggtgga	CRISPR spacer
-atgctgaccggcttcccgatcgtggtggtggc	Protospacer
 ..* *** ***** *****.***********

35. spacer 2.10|4138075|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 7, identity: 0.781

agcggtga-cggctacccgaccgtggtggtgga	CRISPR spacer
-atgctgaccggcttcccgatcgtggtggtggc	Protospacer
 ..* *** ***** *****.***********

36. spacer 2.10|4138075|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 7, identity: 0.781

agcggtga-cggctacccgaccgtggtggtgga	CRISPR spacer
-atgctgaccggcttcccgatcgtggtggtggc	Protospacer
 ..* *** ***** *****.***********

37. spacer 2.13|4138258|32|NC_009439|CRISPRCasFinder,CRT matches to MT553337 (Mycobacterium phage DroogsArmy, complete genome) position: , mismatch: 7, identity: 0.781

ggcggttccaaggcatcgaggatgcgtttctg	CRISPR spacer
cgctgttccaaggcatcggggatgccctggtg	Protospacer
 ** **************.****** .*  **

38. spacer 2.13|4138258|32|NC_009439|CRISPRCasFinder,CRT matches to JF957060 (Mycobacterium phage Timshel, complete genome) position: , mismatch: 7, identity: 0.781

ggcggttccaaggcatcgaggatgcgtttctg	CRISPR spacer
cgctgttccaaggcatcggggatgccctggtg	Protospacer
 ** **************.****** .*  **

39. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NC_010399 (Clavibacter michiganensis subsp. sepedonicus plasmid pCS1, complete sequence) position: , mismatch: 7, identity: 0.781

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
gccttcgccgcgtcgatgctggccgacccgac	Protospacer
*********** ******* ****    .***

40. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NC_013930 (Thioalkalivibrio sp. K90mix plasmid pTK9001, complete sequence) position: , mismatch: 7, identity: 0.781

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
tcgtacgccccctcgatacgggccttgatcat	Protospacer
 * * **** *******.*********** *.

41. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NC_007765 (Rhizobium etli CFN 42 plasmid p42e, complete sequence) position: , mismatch: 7, identity: 0.781

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
gcacgcgccgcctcgatgccggcgttgacggc	Protospacer
** . ************** *** ****.*.*

42. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NC_021908 (Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1d, complete sequence) position: , mismatch: 7, identity: 0.781

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
gcacgcgccgcctcgatgccggcgttgacggc	Protospacer
** . ************** *** ****.*.*

43. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP007797 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p4, complete sequence) position: , mismatch: 7, identity: 0.781

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
gtgatgctgaccgacgacgacgccggcacgca	Protospacer
***.************* *******.*.*  .

44. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP032343 (Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence) position: , mismatch: 7, identity: 0.781

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
gtgatgctgaccgacgacgacgccggcacgca	Protospacer
***.************* *******.*.*  .

45. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP012917 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence) position: , mismatch: 7, identity: 0.781

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
gtgatgctgaccgacgacgacgccggcacgca	Protospacer
***.************* *******.*.*  .

46. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to NC_015595 (Sphingobium chlorophenolicum L-1 plasmid pSPHCH01, complete sequence) position: , mismatch: 7, identity: 0.781

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
ggtgtcatcaccgccgaagacgccgacggcag	Protospacer
*  **  * **** ************** ***

47. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP018225 (Tardibacter chloracetimidivorans strain JJ-A5 plasmid pHSL4, complete sequence) position: , mismatch: 7, identity: 0.781

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
ggtgtcatcaccgccgaagacgccgacggcag	Protospacer
*  **  * **** ************** ***

48. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP013265 (Sphingobium baderi strain DE-13 plasmid pDE1, complete sequence) position: , mismatch: 7, identity: 0.781

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
ggtgtcatcaccgccgaagacgccgacggcag	Protospacer
*  **  * **** ************** ***

49. spacer 2.31|4139359|32|NC_009439|CRISPRCasFinder,CRT matches to CP040467 (Streptomyces albidoflavus strain UYFA156 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

acccttgtccgcgtcgccctggtcggcgaggt	CRISPR spacer
ccccgccaccgcgtcgccgtggtcggcgaggg	Protospacer
 *** .  ********** ************

50. spacer 2.31|4139359|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP029831 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed7, complete sequence) position: , mismatch: 7, identity: 0.781

acccttgt-ccgcgtcgccctggtcggcgaggt	CRISPR spacer
-cacgggcaccgcatcgccctcgtcggcgaggt	Protospacer
 * *  *. ****.******* ***********

51. spacer 2.31|4139359|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP032325 (Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence) position: , mismatch: 7, identity: 0.781

acccttgtc-cgcgtcgccctggtcggcgaggt	CRISPR spacer
-ccggcgccgcgcgtcggcgtggtcggcgaggt	Protospacer
 **  .*.* ******* * *************

52. spacer 2.31|4139359|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP054622 (Azospirillum oryzae strain KACC 14407 plasmid unnamed7, complete sequence) position: , mismatch: 7, identity: 0.781

acccttgtccgcgtcgccctggtcggcgaggt	CRISPR spacer
acccgcgtccgcgtcgccctggtggtcaatgg	Protospacer
**** .***************** * *.* *

53. spacer 2.31|4139359|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP039651 (Azospirillum sp. TSA2s plasmid p1) position: , mismatch: 7, identity: 0.781

acccttgtccgcgtcgccctggtcggcgaggt	CRISPR spacer
acccgcgtccgcgtcgccctggtggtcaatgg	Protospacer
**** .***************** * *.* *

54. spacer 2.32|4139420|33|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP017753 (Cupriavidus sp. USMAHM13 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.788

ctggggccgcgcatcgacaagatcgaggctcag---	CRISPR spacer
cgggggccgcgcatcgacgagatcga---ccgggat	Protospacer
* ****************.*******   .*.*

55. spacer 2.37|4139726|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP028969 (Aminobacter sp. MSH1 plasmid pUSP1, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
aaaaagcccggcttctggccgggctttttctc	Protospacer
*************.* ***********...

56. spacer 2.37|4139726|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP026266 (Aminobacter sp. MSH1 plasmid pAM01, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
aaaaagcccggcttctggccgggctttttctc	Protospacer
*************.* ***********...

57. spacer 2.37|4139726|32|NC_009439|CRISPRCasFinder,CRT matches to NC_008043 (Ruegeria sp. TM1040 megaplasmid, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
caaaagcccggcaccgggccgggctcttaaca	Protospacer
 *********** ************.*.   *

58. spacer 2.37|4139726|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP015231 (Epibacterium mobile F1926 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
caaaagcccggcaccgggccgggctcttacca	Protospacer
 *********** ************.*. . *

59. spacer 2.37|4139726|32|NC_009439|CRISPRCasFinder,CRT matches to MH576962 (Streptomyces phage Satis, complete genome) position: , mismatch: 7, identity: 0.781

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
gaaaagcccggcacggggccgggcttccgcgt	Protospacer
.*********** * ***********.* .*

60. spacer 2.37|4139726|32|NC_009439|CRISPRCasFinder,CRT matches to MK620894 (Streptomyces phage Kradal, complete genome) position: , mismatch: 7, identity: 0.781

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
gaaaagcccggcacggggccgggcttccgcgt	Protospacer
.*********** * ***********.* .*

61. spacer 2.37|4139726|32|NC_009439|CRISPRCasFinder,CRT matches to NC_004999 (Pseudomonas putida NCIB 9816-4 plasmid pDTG1, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
aaaaagcccggcgctgggccgggctctagttg	Protospacer
************ *.**********.*  * .

62. spacer 2.37|4139726|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP018320 (Pseudomonas frederiksbergensis strain AS1 plasmid, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
aaaaagcccggcgctgggccgggctctagttg	Protospacer
************ *.**********.*  * .

63. spacer 2.37|4139726|32|NC_009439|CRISPRCasFinder,CRT matches to NC_012674 (Pseudomonas fluorescens strain PC20 plasmid pNAH20, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
aaaaagcccggcgctgggccgggctctagttg	Protospacer
************ *.**********.*  * .

64. spacer 2.37|4139726|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP026974 (Achromobacter insolitus strain FDAARGOS_88 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
agaaagcccggctcctgcccgggctggccagc	Protospacer
*.************* * *******  ** *

65. spacer 2.37|4139726|32|NC_009439|CRISPRCasFinder,CRT matches to NC_014642 (Achromobacter xylosoxidans A8 plasmid pA82, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
agaaagcccggctcctgcccgggctggccagc	Protospacer
*.************* * *******  ** *

66. spacer 2.44|4137896|32|NC_009439|PILER-CR matches to NZ_CP019241 (Rhodoferax antarcticus strain DSMZ24876 plasmid unnamed1) position: , mismatch: 7, identity: 0.781

aggtgtacggtcagcgcgtgctgcggcggtcg	CRISPR spacer
cagggtgcggtcagcgcgtgcggcggcggttt	Protospacer
 .* **.************** ********.

67. spacer 2.44|4137896|32|NC_009439|PILER-CR matches to NZ_AP018921 (Pseudonocardia autotrophica strain NBRC 12743 plasmid pPA12743CP, complete sequence) position: , mismatch: 7, identity: 0.781

aggtgtacggtcagcgcgtgctgcggcggtcg	CRISPR spacer
accaggacggtcagcacgtgctgcggcagtgg	Protospacer
*   * *********.***********.** *

68. spacer 2.47|4138081|32|NC_009439|PILER-CR matches to NZ_LN868941 (Nocardia farcinica strain NCTC11134 plasmid 4, complete sequence) position: , mismatch: 7, identity: 0.781

agcggtgacggctacccgaccgtggtggtgga	CRISPR spacer
gccggtgacggctatctgaccgtggtgatcgt	Protospacer
. ************.*.**********.* *

69. spacer 2.47|4138081|32|NC_009439|PILER-CR matches to NZ_CP031419 (Nocardia farcinica strain W6977 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

agcggtgacggctacccgaccgtggtggtgga	CRISPR spacer
gccggtgacggctatctgaccgtggtgatcgt	Protospacer
. ************.*.**********.* *

70. spacer 2.47|4138081|32|NC_009439|PILER-CR matches to JX042578 (Mycobacteriophage ElTiger69, complete genome) position: , mismatch: 7, identity: 0.781

agcggtgacggctacccgaccgtggtggtgga	CRISPR spacer
tgcggtggcggctacccgaccatggtcgacgc	Protospacer
 ******.*************.**** *  *

71. spacer 2.47|4138081|32|NC_009439|PILER-CR matches to MF141539 (Mycobacterium phage MyraDee, complete genome) position: , mismatch: 7, identity: 0.781

agcggtgacggctacccgaccgtggtggtgga	CRISPR spacer
agcggtgacggcgaaccgaccgtgaccgaggt	Protospacer
************ * *********.. * **

72. spacer 2.47|4138081|32|NC_009439|PILER-CR matches to NZ_CP032322 (Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.781

agcggtga-cggctacccgaccgtggtggtgga	CRISPR spacer
-atgctgaccggcttcccgatcgtggtggtggc	Protospacer
 ..* *** ***** *****.***********

73. spacer 2.47|4138081|32|NC_009439|PILER-CR matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 7, identity: 0.781

agcggtga-cggctacccgaccgtggtggtgga	CRISPR spacer
-atgctgaccggcttcccgatcgtggtggtggc	Protospacer
 ..* *** ***** *****.***********

74. spacer 2.47|4138081|32|NC_009439|PILER-CR matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 7, identity: 0.781

agcggtga-cggctacccgaccgtggtggtgga	CRISPR spacer
-atgctgaccggcttcccgatcgtggtggtggc	Protospacer
 ..* *** ***** *****.***********

75. spacer 2.50|4138264|32|NC_009439|PILER-CR matches to MT553337 (Mycobacterium phage DroogsArmy, complete genome) position: , mismatch: 7, identity: 0.781

ggcggttccaaggcatcgaggatgcgtttctg	CRISPR spacer
cgctgttccaaggcatcggggatgccctggtg	Protospacer
 ** **************.****** .*  **

76. spacer 2.50|4138264|32|NC_009439|PILER-CR matches to JF957060 (Mycobacterium phage Timshel, complete genome) position: , mismatch: 7, identity: 0.781

ggcggttccaaggcatcgaggatgcgtttctg	CRISPR spacer
cgctgttccaaggcatcggggatgccctggtg	Protospacer
 ** **************.****** .*  **

77. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NC_010399 (Clavibacter michiganensis subsp. sepedonicus plasmid pCS1, complete sequence) position: , mismatch: 7, identity: 0.781

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
gccttcgccgcgtcgatgctggccgacccgac	Protospacer
*********** ******* ****    .***

78. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NC_013930 (Thioalkalivibrio sp. K90mix plasmid pTK9001, complete sequence) position: , mismatch: 7, identity: 0.781

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
tcgtacgccccctcgatacgggccttgatcat	Protospacer
 * * **** *******.*********** *.

79. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NC_007765 (Rhizobium etli CFN 42 plasmid p42e, complete sequence) position: , mismatch: 7, identity: 0.781

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
gcacgcgccgcctcgatgccggcgttgacggc	Protospacer
** . ************** *** ****.*.*

80. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NC_021908 (Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1d, complete sequence) position: , mismatch: 7, identity: 0.781

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
gcacgcgccgcctcgatgccggcgttgacggc	Protospacer
** . ************** *** ****.*.*

81. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to NZ_CP007797 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p4, complete sequence) position: , mismatch: 7, identity: 0.781

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
gtgatgctgaccgacgacgacgccggcacgca	Protospacer
***.************* *******.*.*  .

82. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to NZ_CP032343 (Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence) position: , mismatch: 7, identity: 0.781

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
gtgatgctgaccgacgacgacgccggcacgca	Protospacer
***.************* *******.*.*  .

83. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to NZ_CP012917 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence) position: , mismatch: 7, identity: 0.781

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
gtgatgctgaccgacgacgacgccggcacgca	Protospacer
***.************* *******.*.*  .

84. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to NC_015595 (Sphingobium chlorophenolicum L-1 plasmid pSPHCH01, complete sequence) position: , mismatch: 7, identity: 0.781

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
ggtgtcatcaccgccgaagacgccgacggcag	Protospacer
*  **  * **** ************** ***

85. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to NZ_CP018225 (Tardibacter chloracetimidivorans strain JJ-A5 plasmid pHSL4, complete sequence) position: , mismatch: 7, identity: 0.781

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
ggtgtcatcaccgccgaagacgccgacggcag	Protospacer
*  **  * **** ************** ***

86. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to NZ_CP013265 (Sphingobium baderi strain DE-13 plasmid pDE1, complete sequence) position: , mismatch: 7, identity: 0.781

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
ggtgtcatcaccgccgaagacgccgacggcag	Protospacer
*  **  * **** ************** ***

87. spacer 2.68|4139365|32|NC_009439|PILER-CR matches to CP040467 (Streptomyces albidoflavus strain UYFA156 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

acccttgtccgcgtcgccctggtcggcgaggt	CRISPR spacer
ccccgccaccgcgtcgccgtggtcggcgaggg	Protospacer
 *** .  ********** ************

88. spacer 2.68|4139365|32|NC_009439|PILER-CR matches to NZ_CP029831 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed7, complete sequence) position: , mismatch: 7, identity: 0.781

acccttgt-ccgcgtcgccctggtcggcgaggt	CRISPR spacer
-cacgggcaccgcatcgccctcgtcggcgaggt	Protospacer
 * *  *. ****.******* ***********

89. spacer 2.68|4139365|32|NC_009439|PILER-CR matches to NZ_CP032325 (Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence) position: , mismatch: 7, identity: 0.781

acccttgtc-cgcgtcgccctggtcggcgaggt	CRISPR spacer
-ccggcgccgcgcgtcggcgtggtcggcgaggt	Protospacer
 **  .*.* ******* * *************

90. spacer 2.68|4139365|32|NC_009439|PILER-CR matches to NZ_CP054622 (Azospirillum oryzae strain KACC 14407 plasmid unnamed7, complete sequence) position: , mismatch: 7, identity: 0.781

acccttgtccgcgtcgccctggtcggcgaggt	CRISPR spacer
acccgcgtccgcgtcgccctggtggtcaatgg	Protospacer
**** .***************** * *.* *

91. spacer 2.68|4139365|32|NC_009439|PILER-CR matches to NZ_CP039651 (Azospirillum sp. TSA2s plasmid p1) position: , mismatch: 7, identity: 0.781

acccttgtccgcgtcgccctggtcggcgaggt	CRISPR spacer
acccgcgtccgcgtcgccctggtggtcaatgg	Protospacer
**** .***************** * *.* *

92. spacer 2.69|4139426|33|NC_009439|PILER-CR matches to NZ_CP017753 (Cupriavidus sp. USMAHM13 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.788

ctggggccgcgcatcgacaagatcgaggctcag---	CRISPR spacer
cgggggccgcgcatcgacgagatcga---ccgggat	Protospacer
* ****************.*******   .*.*

93. spacer 2.74|4139732|32|NC_009439|PILER-CR matches to NZ_CP028969 (Aminobacter sp. MSH1 plasmid pUSP1, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
aaaaagcccggcttctggccgggctttttctc	Protospacer
*************.* ***********...

94. spacer 2.74|4139732|32|NC_009439|PILER-CR matches to NZ_CP026266 (Aminobacter sp. MSH1 plasmid pAM01, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
aaaaagcccggcttctggccgggctttttctc	Protospacer
*************.* ***********...

95. spacer 2.74|4139732|32|NC_009439|PILER-CR matches to NC_008043 (Ruegeria sp. TM1040 megaplasmid, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
caaaagcccggcaccgggccgggctcttaaca	Protospacer
 *********** ************.*.   *

96. spacer 2.74|4139732|32|NC_009439|PILER-CR matches to NZ_CP015231 (Epibacterium mobile F1926 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
caaaagcccggcaccgggccgggctcttacca	Protospacer
 *********** ************.*. . *

97. spacer 2.74|4139732|32|NC_009439|PILER-CR matches to MH576962 (Streptomyces phage Satis, complete genome) position: , mismatch: 7, identity: 0.781

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
gaaaagcccggcacggggccgggcttccgcgt	Protospacer
.*********** * ***********.* .*

98. spacer 2.74|4139732|32|NC_009439|PILER-CR matches to MK620894 (Streptomyces phage Kradal, complete genome) position: , mismatch: 7, identity: 0.781

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
gaaaagcccggcacggggccgggcttccgcgt	Protospacer
.*********** * ***********.* .*

99. spacer 2.74|4139732|32|NC_009439|PILER-CR matches to NC_004999 (Pseudomonas putida NCIB 9816-4 plasmid pDTG1, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
aaaaagcccggcgctgggccgggctctagttg	Protospacer
************ *.**********.*  * .

100. spacer 2.74|4139732|32|NC_009439|PILER-CR matches to NZ_CP018320 (Pseudomonas frederiksbergensis strain AS1 plasmid, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
aaaaagcccggcgctgggccgggctctagttg	Protospacer
************ *.**********.*  * .

101. spacer 2.74|4139732|32|NC_009439|PILER-CR matches to NC_012674 (Pseudomonas fluorescens strain PC20 plasmid pNAH20, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
aaaaagcccggcgctgggccgggctctagttg	Protospacer
************ *.**********.*  * .

102. spacer 2.74|4139732|32|NC_009439|PILER-CR matches to NZ_CP026974 (Achromobacter insolitus strain FDAARGOS_88 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
agaaagcccggctcctgcccgggctggccagc	Protospacer
*.************* * *******  ** *

103. spacer 2.74|4139732|32|NC_009439|PILER-CR matches to NC_014642 (Achromobacter xylosoxidans A8 plasmid pA82, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
agaaagcccggctcctgcccgggctggccagc	Protospacer
*.************* * *******  ** *

104. spacer 3.2|4149247|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to CP013471 (Acetobacter pasteurianus strain Ab3 plasmid ApAb3p3, complete sequence) position: , mismatch: 7, identity: 0.781

gcgctgatcgactgcaacgcgttctactgcag	CRISPR spacer
gggttgattgattgcaacgcgttctactgttc	Protospacer
* *.****.**.*****************.

105. spacer 3.2|4149247|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP015169 (Acetobacter ascendens strain LMG 1591 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

gcgctgatcgactgcaacgcgttctactgcag	CRISPR spacer
gggttgattgattgcaacgcgttctactgttc	Protospacer
* *.****.**.*****************.

106. spacer 3.2|4149247|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to JF412297 (EBPR siphovirus 2, partial sequence) position: , mismatch: 7, identity: 0.781

gcgctgatcgactgcaacgcgttctactgcag	CRISPR spacer
gaactgatcgacggcaacgcgctctatcgcgg	Protospacer
* .********* ********.****..**.*

107. spacer 3.4|4149370|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP049157 (Caballeronia sp. SBC1 plasmid pSBC1_1, complete sequence) position: , mismatch: 7, identity: 0.781

tttatccaggcggcgggggcggtg--ggcagcac	CRISPR spacer
gttatcgaggcggcgggggcggcggcggcggt--	Protospacer
 ***** ***************.*  ***.*.

108. spacer 3.4|4149370|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP049317 (Caballeronia sp. SBC2 plasmid pSBC2-1, complete sequence) position: , mismatch: 7, identity: 0.781

tttatccaggcggcgggggcggtg--ggcagcac	CRISPR spacer
gttatcgaggcggcgggggcggcggcggcggt--	Protospacer
 ***** ***************.*  ***.*.

109. spacer 3.5|4149431|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NC_014310 (Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence) position: , mismatch: 7, identity: 0.781

gcgccggcgccgcagagcctggccggccgaga	CRISPR spacer
gctgcggcgccgcagggcctggccggacgcat	Protospacer
**  ***********.********** ** .

110. spacer 3.5|4149431|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NC_016115 (Streptomyces pratensis ATCC 33331 plasmid pSFLA02, complete sequence) position: , mismatch: 7, identity: 0.781

gcgccg-gcgccgcagagcctggccggccgaga	CRISPR spacer
-tgctgcgcgccgcagagcccggccgtccgatc	Protospacer
 .**.* *************.***** ****

111. spacer 3.5|4149431|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 7, identity: 0.781

gcgccggcgccgcagagcctggcc-ggccgaga	CRISPR spacer
acgccggcggcgcggagcctggcctcggtgag-	Protospacer
.******** ***.**********  * .***

112. spacer 3.5|4149431|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 7, identity: 0.781

gcgccggcgccgcagagcctggcc-ggccgaga	CRISPR spacer
acgccggcggcgcggagcctggcctcggtgag-	Protospacer
.******** ***.**********  * .***

113. spacer 3.11|4149797|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP028969 (Aminobacter sp. MSH1 plasmid pUSP1, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
aaaaagcccggcttctggccgggctttttctc	Protospacer
*************.* ***********...

114. spacer 3.11|4149797|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP026266 (Aminobacter sp. MSH1 plasmid pAM01, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
aaaaagcccggcttctggccgggctttttctc	Protospacer
*************.* ***********...

115. spacer 3.11|4149797|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NC_008043 (Ruegeria sp. TM1040 megaplasmid, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
caaaagcccggcaccgggccgggctcttaaca	Protospacer
 *********** ************.*.   *

116. spacer 3.11|4149797|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP015231 (Epibacterium mobile F1926 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
caaaagcccggcaccgggccgggctcttacca	Protospacer
 *********** ************.*. . *

117. spacer 3.11|4149797|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to MH576962 (Streptomyces phage Satis, complete genome) position: , mismatch: 7, identity: 0.781

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
gaaaagcccggcacggggccgggcttccgcgt	Protospacer
.*********** * ***********.* .*

118. spacer 3.11|4149797|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to MK620894 (Streptomyces phage Kradal, complete genome) position: , mismatch: 7, identity: 0.781

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
gaaaagcccggcacggggccgggcttccgcgt	Protospacer
.*********** * ***********.* .*

119. spacer 3.11|4149797|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NC_004999 (Pseudomonas putida NCIB 9816-4 plasmid pDTG1, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
aaaaagcccggcgctgggccgggctctagttg	Protospacer
************ *.**********.*  * .

120. spacer 3.11|4149797|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP018320 (Pseudomonas frederiksbergensis strain AS1 plasmid, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
aaaaagcccggcgctgggccgggctctagttg	Protospacer
************ *.**********.*  * .

121. spacer 3.11|4149797|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NC_012674 (Pseudomonas fluorescens strain PC20 plasmid pNAH20, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
aaaaagcccggcgctgggccgggctctagttg	Protospacer
************ *.**********.*  * .

122. spacer 3.11|4149797|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP026974 (Achromobacter insolitus strain FDAARGOS_88 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
agaaagcccggctcctgcccgggctggccagc	Protospacer
*.************* * *******  ** *

123. spacer 3.11|4149797|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NC_014642 (Achromobacter xylosoxidans A8 plasmid pA82, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
agaaagcccggctcctgcccgggctggccagc	Protospacer
*.************* * *******  ** *

124. spacer 3.12|4149858|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP028969 (Aminobacter sp. MSH1 plasmid pUSP1, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
aaaaagcccggcttctggccgggctttttctc	Protospacer
*************.* ***********...

125. spacer 3.12|4149858|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP026266 (Aminobacter sp. MSH1 plasmid pAM01, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
aaaaagcccggcttctggccgggctttttctc	Protospacer
*************.* ***********...

126. spacer 3.12|4149858|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NC_008043 (Ruegeria sp. TM1040 megaplasmid, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
caaaagcccggcaccgggccgggctcttaaca	Protospacer
 *********** ************.*.   *

127. spacer 3.12|4149858|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP015231 (Epibacterium mobile F1926 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
caaaagcccggcaccgggccgggctcttacca	Protospacer
 *********** ************.*. . *

128. spacer 3.12|4149858|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to MH576962 (Streptomyces phage Satis, complete genome) position: , mismatch: 7, identity: 0.781

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
gaaaagcccggcacggggccgggcttccgcgt	Protospacer
.*********** * ***********.* .*

129. spacer 3.12|4149858|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to MK620894 (Streptomyces phage Kradal, complete genome) position: , mismatch: 7, identity: 0.781

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
gaaaagcccggcacggggccgggcttccgcgt	Protospacer
.*********** * ***********.* .*

130. spacer 3.12|4149858|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NC_004999 (Pseudomonas putida NCIB 9816-4 plasmid pDTG1, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
aaaaagcccggcgctgggccgggctctagttg	Protospacer
************ *.**********.*  * .

131. spacer 3.12|4149858|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP018320 (Pseudomonas frederiksbergensis strain AS1 plasmid, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
aaaaagcccggcgctgggccgggctctagttg	Protospacer
************ *.**********.*  * .

132. spacer 3.12|4149858|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NC_012674 (Pseudomonas fluorescens strain PC20 plasmid pNAH20, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
aaaaagcccggcgctgggccgggctctagttg	Protospacer
************ *.**********.*  * .

133. spacer 3.12|4149858|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP026974 (Achromobacter insolitus strain FDAARGOS_88 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
agaaagcccggctcctgcccgggctggccagc	Protospacer
*.************* * *******  ** *

134. spacer 3.12|4149858|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NC_014642 (Achromobacter xylosoxidans A8 plasmid pA82, complete sequence) position: , mismatch: 7, identity: 0.781

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
agaaagcccggctcctgcccgggctggccagc	Protospacer
*.************* * *******  ** *

135. spacer 3.13|4149919|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LR134463 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 21, complete sequence) position: , mismatch: 7, identity: 0.781

cgcggcggcgccgacgtcatgcacggccggcc	CRISPR spacer
catggcggcgtcgacgtcatgcacgggccgag	Protospacer
*..*******.*************** * *

136. spacer 3.13|4149919|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NC_011366 (Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG202, complete sequence) position: , mismatch: 7, identity: 0.781

cgcggcggcgccgacgtcatgcacggccggcc--	CRISPR spacer
tatcgcggcgccgacgacatgcacggc--gccgg	Protospacer
... ************ **********  ***

137. spacer 3.13|4149919|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP029831 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed7, complete sequence) position: , mismatch: 7, identity: 0.781

cgcggcggcgccgacgtcatgcacggc--cggcc	CRISPR spacer
tggcgcggcgccgacgagatgcacggcgtcgg--	Protospacer
.*  ************  *********  ***

138. spacer 3.15|4150041|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP020040 (Streptomyces sp. 3211 isolate 3 plasmid p3211-1, complete sequence) position: , mismatch: 7, identity: 0.781

tcctcggtgagggcggcgatcacatcggctgc	CRISPR spacer
tcggcgacgagtgcggcaatcacatcggctga	Protospacer
**  **..*** *****.*************

139. spacer 2.2|4137586|31|NC_009439|CRISPRCasFinder,CRT matches to NC_018532 (Arthrobacter sp. Rue61a plasmid p232, complete sequence) position: , mismatch: 8, identity: 0.742

gtcaggtcgtcgcggttcatccactgcgcga	CRISPR spacer
tagcgttcgtcgcggatcatccgctgcgcgt	Protospacer
    * ********* ******.*******

140. spacer 2.2|4137586|31|NC_009439|CRISPRCasFinder,CRT matches to MN329674 (Mycobacterium phage JoieB, complete genome) position: , mismatch: 8, identity: 0.742

gtcaggtcgtcgcggttcatccactgcgcga	CRISPR spacer
gacagctcgtcgcggttcatccacgagatgc	Protospacer
* *** ****************** . ..*

141. spacer 2.2|4137586|31|NC_009439|CRISPRCasFinder,CRT matches to MK494123 (Mycobacterium phage Blackbeetle, complete genome) position: , mismatch: 8, identity: 0.742

gtcaggtcgtcgcggttcatccactgcgcga	CRISPR spacer
gacagctcgtcgcggttcatccacgagatgc	Protospacer
* *** ****************** . ..*

142. spacer 2.2|4137586|31|NC_009439|CRISPRCasFinder,CRT matches to MN428061 (Mycobacterium phage Corazon, complete genome) position: , mismatch: 8, identity: 0.742

gtcaggtcgtcgcggttcatccactgcgcga	CRISPR spacer
gacagctcgtcgcggttcatccacgagatgc	Protospacer
* *** ****************** . ..*

143. spacer 2.2|4137586|31|NC_009439|CRISPRCasFinder,CRT matches to MG757167 (Mycobacterium phage Tesla, complete genome) position: , mismatch: 8, identity: 0.742

gtcaggtcgtcgcggttcatccactgcgcga	CRISPR spacer
gacagctcgtcgcggttcatccacgagatgc	Protospacer
* *** ****************** . ..*

144. spacer 2.2|4137586|31|NC_009439|CRISPRCasFinder,CRT matches to MH727562 (Mycobacterium phage VasuNzinga, complete genome) position: , mismatch: 8, identity: 0.742

gtcaggtcgtcgcggttcatccactgcgcga	CRISPR spacer
gacagctcgtcgcggttcatccacgagatgc	Protospacer
* *** ****************** . ..*

145. spacer 2.2|4137586|31|NC_009439|CRISPRCasFinder,CRT matches to MK305892 (Mycobacterium phage RedRaider77, complete genome) position: , mismatch: 8, identity: 0.742

gtcaggtcgtcgcggttcatccactgcgcga	CRISPR spacer
gacagctcgtcgcggttcatccacgagatgc	Protospacer
* *** ****************** . ..*

146. spacer 2.2|4137586|31|NC_009439|CRISPRCasFinder,CRT matches to KJ538721 (Mycobacterium phage MosMoris, complete genome) position: , mismatch: 8, identity: 0.742

gtcaggtcgtcgcggttcatccactgcgcga	CRISPR spacer
gacagctcgtcgcggttcatccacgagatgc	Protospacer
* *** ****************** . ..*

147. spacer 2.2|4137586|31|NC_009439|CRISPRCasFinder,CRT matches to JF704100 (Mycobacterium phage Marvin, complete sequence) position: , mismatch: 8, identity: 0.742

gtcaggtcgtcgcggttcatccactgcgcga	CRISPR spacer
gacagctcgtcgcggttcatccacgagatgc	Protospacer
* *** ****************** . ..*

148. spacer 2.2|4137586|31|NC_009439|CRISPRCasFinder,CRT matches to MN428056 (Mycobacterium phage Pringar, complete genome) position: , mismatch: 8, identity: 0.742

gtcaggtcgtcgcggttcatccactgcgcga	CRISPR spacer
gacagctcgtcgcggttcatccacgagatgc	Protospacer
* *** ****************** . ..*

149. spacer 2.2|4137586|31|NC_009439|CRISPRCasFinder,CRT matches to MK279842 (Mycobacterium phage Raela, complete genome) position: , mismatch: 8, identity: 0.742

gtcaggtcgtcgcggttcatccactgcgcga	CRISPR spacer
gacagctcgtcgcggttcatccacgagatgc	Protospacer
* *** ****************** . ..*

150. spacer 2.2|4137586|31|NC_009439|CRISPRCasFinder,CRT matches to MH727553 (Mycobacterium phage LittleLaf, complete genome) position: , mismatch: 8, identity: 0.742

gtcaggtcgtcgcggttcatccactgcgcga	CRISPR spacer
gacagctcgtcgcggttcatccacgagatgc	Protospacer
* *** ****************** . ..*

151. spacer 2.2|4137586|31|NC_009439|CRISPRCasFinder,CRT matches to MK061407 (Mycobacterium phage Beelzebub, complete genome) position: , mismatch: 8, identity: 0.742

gtcaggtcgtcgcggttcatccactgcgcga	CRISPR spacer
gacagctcgtcgcggttcatccacgagatgc	Protospacer
* *** ****************** . ..*

152. spacer 2.2|4137586|31|NC_009439|CRISPRCasFinder,CRT matches to MN329676 (Mycobacterium phage Poise, complete genome) position: , mismatch: 8, identity: 0.742

gtcaggtcgtcgcggttcatccactgcgcga	CRISPR spacer
gacagctcgtcgcggttcatccacgagatgc	Protospacer
* *** ****************** . ..*

153. spacer 2.2|4137586|31|NC_009439|CRISPRCasFinder,CRT matches to KX159477 (Mycobacterium phage Gattaca, complete genome) position: , mismatch: 8, identity: 0.742

gtcaggtcgtcgcggttcatccactgcgcga	CRISPR spacer
gacagctcgtcgcggttcatccacgagatgc	Protospacer
* *** ****************** . ..*

154. spacer 2.2|4137586|31|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP007796 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p3, complete sequence) position: , mismatch: 8, identity: 0.742

gtcaggtcgtcgcggttcatccactgcgcga	CRISPR spacer
ggcaggtcgtcgccgttcagccactccagcc	Protospacer
* *********** ***** ***** *.

155. spacer 2.2|4137586|31|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP033321 (Azospirillum brasilense strain Cd plasmid p3, complete sequence) position: , mismatch: 8, identity: 0.742

gtcaggtcgtcgcggttcatccactgcgcga	CRISPR spacer
ggcaggtcgtcgccgttcagccactccagcc	Protospacer
* *********** ***** ***** *.

156. spacer 2.2|4137586|31|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP033315 (Azospirillum brasilense strain Sp 7 plasmid p3, complete sequence) position: , mismatch: 8, identity: 0.742

gtcaggtcgtcgcggttcatccactgcgcga	CRISPR spacer
ggcaggtcgtcgccgttcagccactccagcc	Protospacer
* *********** ***** ***** *.

157. spacer 2.2|4137586|31|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP032325 (Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence) position: , mismatch: 8, identity: 0.742

gtcaggtcgtcgcggttcatccactgcgcga	CRISPR spacer
ggcaggtcgtcgccgttcagccactccagcc	Protospacer
* *********** ***** ***** *.

158. spacer 2.2|4137586|31|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP022369 (Azospirillum sp. TSH58 plasmid TSH58_p05, complete sequence) position: , mismatch: 8, identity: 0.742

gtcaggtcgtcgcggttcatccactgcgcga	CRISPR spacer
ggcaggtcgtcgccgttcagccactccagcc	Protospacer
* *********** ***** ***** *.

159. spacer 2.2|4137586|31|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP032342 (Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence) position: , mismatch: 8, identity: 0.742

gtcaggtcgtcgcggttcatccactgcgcga	CRISPR spacer
ggcaggtcgtcgccgttcagccactccagcc	Protospacer
* *********** ***** ***** *.

160. spacer 2.2|4137586|31|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP033323 (Azospirillum brasilense strain Cd plasmid p5, complete sequence) position: , mismatch: 8, identity: 0.742

gtcaggtcgtcgcggttcatccactgcgcga	CRISPR spacer
ggcaggtcgtcgccgttcagccactccagcc	Protospacer
* *********** ***** ***** *.

161. spacer 2.3|4137646|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP032322 (Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.75

gcctcaaacgccgcccgctccgcatccatctt	CRISPR spacer
ggccggaacgccgcccgcaccgcgtccatcac	Protospacer
* *. .************ ****.****** .

162. spacer 2.3|4137646|32|NC_009439|CRISPRCasFinder,CRT matches to CP053412 (Salmonella enterica strain 72-4606 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

gcctcaaacgccgcccgctccgcatccatctt	CRISPR spacer
gactcaaacgccgtccgcgccgcatcgagaga	Protospacer
* ***********.**** ******* *

163. spacer 2.7|4137890|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP026091 (Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

aggtgtacggtcagcgcgtgctgcggcggtcg	CRISPR spacer
tgctgtacgggcagcgcctgctgcgggattgg	Protospacer
 * ******* ****** ******** . * *

164. spacer 2.7|4137890|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP026093 (Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

aggtgtacggtcagcgcgtgctgcggcggtcg	CRISPR spacer
tgctgtacgggcagcgcctgctgcgggattgg	Protospacer
 * ******* ****** ******** . * *

165. spacer 2.7|4137890|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP021767 (Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

aggtgtacggtcagcgcgtgctgcggcggtcg	CRISPR spacer
tgctgtacgggcagcgcctgctgcgggattgg	Protospacer
 * ******* ****** ******** . * *

166. spacer 2.10|4138075|32|NC_009439|CRISPRCasFinder,CRT matches to MH051254 (Mycobacterium phage Jabiru, complete genome) position: , mismatch: 8, identity: 0.75

agcggtgacggctacccgaccgtggtggtgga	CRISPR spacer
tgcggtggcggctacccgaccatgatcgacgc	Protospacer
 ******.*************.**.* *  *

167. spacer 2.10|4138075|32|NC_009439|CRISPRCasFinder,CRT matches to MK494091 (Mycobacterium phage Scorpia, complete genome) position: , mismatch: 8, identity: 0.75

agcggtgacggctacccgaccgtggtggtgga	CRISPR spacer
tgcggtggcggctacccgaccatgatcgacgc	Protospacer
 ******.*************.**.* *  *

168. spacer 2.10|4138075|32|NC_009439|CRISPRCasFinder,CRT matches to MH020239 (Mycobacterium phage Naca, complete genome) position: , mismatch: 8, identity: 0.75

agcggtgacggctacccgaccgtggtggtgga	CRISPR spacer
tgcggtggcggctacccgaccatgatcgacgc	Protospacer
 ******.*************.**.* *  *

169. spacer 2.14|4138319|32|NC_009439|CRISPRCasFinder,CRT matches to NC_020062 (Rhizobium tropici CIAT 899 plasmid pRtrCIAT899c, complete sequence) position: , mismatch: 8, identity: 0.75

tcccagt--cctggcggttgatccactcgacggc	CRISPR spacer
--ccggccgcctggcggatcatccactcgacgag	Protospacer
  **.*.  ******** * ************.

170. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP032346 (Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.75

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
gcacgcgccgcctcgatgctggcgttgagcgc	Protospacer
** . ************** *** ****  .*

171. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP017076 (Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence) position: , mismatch: 8, identity: 0.75

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
gtgcgccacgccgcgatgcggcccttgatgac	Protospacer
*. . *  **** ******** **********

172. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP016613 (Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgttcgccgcctcgatgcggcccgtgccttc	Protospacer
 * ****************** ** ** .  *

173. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP050138 (Sphingomonas sp. CL5.1 plasmid pTSSC1, complete sequence) position: , mismatch: 8, identity: 0.75

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
tcgcgcgccgcctcgatccgggcctcgatcag	Protospacer
 * . ************ *******.*** *

174. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP052069 (Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.75

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgttcgccgcctcgatgcggcccgtgccttc	Protospacer
 * ****************** ** ** .  *

175. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP052095 (Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.75

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgttcgccgcctcgatgcggcccgtgccttc	Protospacer
 * ****************** ** ** .  *

176. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP052097 (Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.75

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgttcgccgcctcgatgcggcccgtgccttc	Protospacer
 * ****************** ** ** .  *

177. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP052093 (Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.75

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgttcgccgcctcgatgcggcccgtgccttc	Protospacer
 * ****************** ** ** .  *

178. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP052101 (Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.75

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgttcgccgcctcgatgcggcccgtgccttc	Protospacer
 * ****************** ** ** .  *

179. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP052099 (Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.75

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgttcgccgcctcgatgcggcccgtgccttc	Protospacer
 * ****************** ** ** .  *

180. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP052129 (Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.75

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgttcgccgcctcgatgcggcccgtgccttc	Protospacer
 * ****************** ** ** .  *

181. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP015989 (Sphingobium sp. EP60837 plasmid pEP2, complete sequence) position: , mismatch: 8, identity: 0.75

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
tcgcgcgccgcctcgatccgggcctcgatcag	Protospacer
 * . ************ *******.*** *

182. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP052091 (Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.75

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgttcgccgcctcgatgcggcccgtgccttc	Protospacer
 * ****************** ** ** .  *

183. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_LR134449 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 7, complete sequence) position: , mismatch: 8, identity: 0.75

gccttcg----ccgcctcgatgcgggccttgatgac	CRISPR spacer
----tcgaggcccgcgtcgatgccggccttgatgta	Protospacer
    ***    **** ******* **********

184. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP035514 (Haematobacter massiliensis strain OT1 plasmid pOT1-4, complete sequence) position: , mismatch: 8, identity: 0.75

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
gcctccgccgccgcgatgcgggcgatcagcgc	Protospacer
****.******* **********  * *  .*

185. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_AP022319 (Burkholderia sp. THE68 plasmid BTHE68_p1, complete sequence) position: , mismatch: 8, identity: 0.75

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
gcgcccgccgccgcgatgcaggccttgaggtt	Protospacer
** ..******* ******.******** * .

186. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NC_016626 (Burkholderia sp. YI23 plasmid byi_1p, complete sequence) position: , mismatch: 8, identity: 0.75

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
gcgcccgccgccgcgatgcaggccttgaggtt	Protospacer
** ..******* ******.******** * .

187. spacer 2.18|4138563|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP023152 (Mycobacterium chimaera strain FLAC0070 plasmid pFLAC0070_1, complete sequence) position: , mismatch: 8, identity: 0.75

gcgctcgcgcaggtgacgcacaagcggggtga	CRISPR spacer
ggccagccccaggtcacgcaccagcggggtga	Protospacer
*  *   * ***** ****** **********

188. spacer 2.18|4138563|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_AP012556 (Mycobacterium avium subsp. hominissuis TH135 plasmid pMAH135, complete sequence) position: , mismatch: 8, identity: 0.75

gcgctcgcgcaggtgacgcacaagcggggtga	CRISPR spacer
ggccagccccaggtcacgcaccagcggggtga	Protospacer
*  *   * ***** ****** **********

189. spacer 2.18|4138563|32|NC_009439|CRISPRCasFinder,CRT matches to MN694130 (Marine virus AFVG_250M413, complete genome) position: , mismatch: 8, identity: 0.75

gcgctcgcgcaggtgacgcacaagcggggtga	CRISPR spacer
gccacggagcaggtgacggacaaggggggtgg	Protospacer
**  . * ********** ***** ******.

190. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP032348 (Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence) position: , mismatch: 8, identity: 0.75

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
gtggcgctgaccgacgacgacgccggaacgca	Protospacer
****.************ *******. .*  .

191. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP032324 (Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence) position: , mismatch: 8, identity: 0.75

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
gtggcgctgaccgacgacgacgccggaacgca	Protospacer
****.************ *******. .*  .

192. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP016457 (Sphingobium sp. RAC03 plasmid pBSY17_2, complete sequence) position: , mismatch: 8, identity: 0.75

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
tcggtgctgaccgacgacgacgacgactgcga	Protospacer
 .*************** **** ****  *..

193. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP054620 (Azospirillum oryzae strain KACC 14407 plasmid unnamed5, complete sequence) position: , mismatch: 8, identity: 0.75

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
gacgtgctgaccgacgacgtcgccgacctcgc	Protospacer
*  ************** * ******* .*.

194. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP026242 (Citrobacter freundii complex sp. CFNIH9 plasmid pCFR-eb27, complete sequence) position: , mismatch: 8, identity: 0.75

gtggtgctgaccgacgaagacgccgacgccag--	CRISPR spacer
atcgtgctgaccgaggaacacgccga--tcggct	Protospacer
.* *********** *** *******  .*.*

195. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP009883 (Pantoea sp. PSNIH1 plasmid pPSP-a3e, complete sequence) position: , mismatch: 8, identity: 0.75

gtggtgctgaccgacgaagacgccgacgccag--	CRISPR spacer
atcgtgctgaccgaggaacacgccga--tcggct	Protospacer
.* *********** *** *******  .*.*

196. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP010380 (Enterobacter hormaechei subsp. hormaechei strain 34983 plasmid p34983-328.905kb, complete sequence) position: , mismatch: 8, identity: 0.75

gtggtgctgaccgacgaagacgccgacgccag--	CRISPR spacer
atcgtgctgaccgaggaacacgccga--tcggct	Protospacer
.* *********** *** *******  .*.*

197. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP026171 (Leclercia sp. LSNIH1 plasmid pLEC-1cb1, complete sequence) position: , mismatch: 8, identity: 0.75

gtggtgctgaccgacgaagacgccgacgccag--	CRISPR spacer
atcgtgctgaccgaggaacacgccga--tcggct	Protospacer
.* *********** *** *******  .*.*

198. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP026196 (Enterobacteriaceae bacterium ENNIH1 plasmid pENT-1f0b, complete sequence) position: , mismatch: 8, identity: 0.75

gtggtgctgaccgacgaagacgccgacgccag--	CRISPR spacer
atcgtgctgaccgaggaacacgccga--tcggct	Protospacer
.* *********** *** *******  .*.*

199. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_AP021845 (Azospira sp. I09 plasmid pAZI09, complete sequence) position: , mismatch: 8, identity: 0.75

gtggtgctgaccgacgaagacgccgacgccag--	CRISPR spacer
atcgtgctgaccgaggaacacgccga--tcggct	Protospacer
.* *********** *** *******  .*.*

200. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to CP009869 (Pantoea sp. PSNIH2 plasmid pPSP-75c, complete sequence) position: , mismatch: 8, identity: 0.75

gtggtgctgaccgacgaagacgccgacgccag--	CRISPR spacer
atcgtgctgaccgaggaacacgccga--tcggct	Protospacer
.* *********** *** *******  .*.*

201. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP042479 (Citrobacter freundii strain C50 plasmid pC50_001, complete sequence) position: , mismatch: 8, identity: 0.75

gtggtgctgaccgacgaagacgccgacgccag--	CRISPR spacer
atcgtgctgaccgaggaacacgccga--tcggct	Protospacer
.* *********** *** *******  .*.*

202. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to NC_015727 (Cupriavidus necator N-1 plasmid pBB1, complete sequence) position: , mismatch: 8, identity: 0.75

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
gaggccgtgaccgacgaatacgcctacgccga	Protospacer
* **.  *********** ***** *****..

203. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to NC_009425 (Enterobacter sp. 638 plasmid pENTE01, complete sequence) position: , mismatch: 8, identity: 0.75

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
atgacgctgaccgacaaagccgccgacgttaa	Protospacer
.**..**********.*** ********..*.

204. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 8, identity: 0.75

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
gaggccgtgaccgacgaatacgcctacgccga	Protospacer
* **.  *********** ***** *****..

205. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 8, identity: 0.75

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
gaggccgtgaccgacgaatacgcctacgccga	Protospacer
* **.  *********** ***** *****..

206. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP026208 (Escherichia coli strain ECONIH5 plasmid pECO-109b, complete sequence) position: , mismatch: 8, identity: 0.75

gtggtgctgaccgacgaagacgccgacgccag--	CRISPR spacer
atcgtgctgaccgaggaacacgccga--tcggct	Protospacer
.* *********** *** *******  .*.*

207. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to NC_021910 (Rhizobium etli bv. mimosae str. Mim1 plasmid pRetNIM1c, complete sequence) position: , mismatch: 8, identity: 0.75

gtggtgctgaccgacgaagacgccg-acgccag	CRISPR spacer
taggtgttgcccgacgaagacgccgcatagca-	Protospacer
  ****.** *************** *.. **

208. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP032179 (Citrobacter freundii strain AR_0116 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

gtggtgctgaccgacgaagacgccgacgccag--	CRISPR spacer
atcgtgctgaccgaggaacacgccga--tcggct	Protospacer
.* *********** *** *******  .*.*

209. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP026391 (Leclercia sp. LSNIH3 plasmid pLEC-7c0d, complete sequence) position: , mismatch: 8, identity: 0.75

gtggtgctgaccgacgaagacgccgacgccag--	CRISPR spacer
atcgtgctgaccgaggaacacgccga--tcggct	Protospacer
.* *********** *** *******  .*.*

210. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP029142 (Klebsiella michiganensis strain AR375 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

gtggtgctgaccgacgaagacgccgacgccag--	CRISPR spacer
atcgtgctgaccgaggaacacgccga--tcggct	Protospacer
.* *********** *** *******  .*.*

211. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP031135 (Escherichia coli strain CFSAN064035 plasmid pGMI17-003_1, complete sequence) position: , mismatch: 8, identity: 0.75

gtggtgctgaccgacgaagacgccgacgccag--	CRISPR spacer
atcgtgctgaccgaggaacacgccga--tcggct	Protospacer
.* *********** *** *******  .*.*

212. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP011635 (Klebsiella oxytoca strain CAV1374 plasmid pKPC_CAV1374, complete sequence) position: , mismatch: 8, identity: 0.75

gtggtgctgaccgacgaagacgccgacgccag--	CRISPR spacer
atcgtgctgaccgaggaacacgccga--tcggct	Protospacer
.* *********** *** *******  .*.*

213. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP032344 (Azospirillum brasilense strain MTCC4038 plasmid p5, complete sequence) position: , mismatch: 8, identity: 0.75

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
acgacggtgaccgacgccgacgccgacgccgg	Protospacer
..*..* *********  ************.*

214. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP013115 (Shewanella xiamenensis strain T17 plasmid pSx1, complete sequence) position: , mismatch: 8, identity: 0.75

gtggtgctgaccgacgaagacgccgacgccag--	CRISPR spacer
atcgtgctgaccgaggaacacgccga--tcggct	Protospacer
.* *********** *** *******  .*.*

215. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP033323 (Azospirillum brasilense strain Cd plasmid p5, complete sequence) position: , mismatch: 8, identity: 0.75

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
acgacggtgaccgacgccgacgccgacgccgg	Protospacer
..*..* *********  ************.*

216. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP033317 (Azospirillum brasilense strain Sp 7 plasmid p5, complete sequence) position: , mismatch: 8, identity: 0.75

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
acgacggtgaccgacgccgacgccgacgccgg	Protospacer
..*..* *********  ************.*

217. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP012919 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p5, complete sequence) position: , mismatch: 8, identity: 0.75

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
acgacggtgaccgacgccgacgccgacgccgg	Protospacer
..*..* *********  ************.*

218. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP044111 (Klebsiella michiganensis strain FDAARGOS_647 plasmid unnamed2) position: , mismatch: 8, identity: 0.75

gtggtgctgaccgacgaagacgccgacgccag--	CRISPR spacer
atcgtgctgaccgaggaacacgccga--tcggct	Protospacer
.* *********** *** *******  .*.*

219. spacer 2.22|4138808|32|NC_009439|CRISPRCasFinder,CRT matches to LC425512 (Uncultured phage DNA, contig: NODE34) position: , mismatch: 8, identity: 0.75

aacatca-aggggagggcctgatatggaatgcc	CRISPR spacer
-ctgttatagggcagggcctgacatggaatggc	Protospacer
  ..*.* **** *********.******** *

220. spacer 2.22|4138808|32|NC_009439|CRISPRCasFinder,CRT matches to NC_008562 (Microcystis phage Ma-LMM01 DNA, complete genome) position: , mismatch: 8, identity: 0.75

aacatca-aggggagggcctgatatggaatgcc	CRISPR spacer
-ctgttatagggcagggcctgacatggaatggc	Protospacer
  ..*.* **** *********.******** *

221. spacer 2.25|4138991|32|NC_009439|CRISPRCasFinder,CRT matches to CP054917 (Streptomyces sp. NA02950 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

cttgatgtcagccgtcaccttgttcggggtgc	CRISPR spacer
ggtgatgtcggccgtcaccgtgttcttcgtga	Protospacer
  *******.********* *****   ***

222. spacer 2.31|4139359|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP029777 (Deinococcus actinosclerus strain Deinococcus actinosclerus SJTR plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.75

acccttgtccgcgtcgccctggtcggcgaggt	CRISPR spacer
gagcaggaccgcgtggccctgatcggcgaggt	Protospacer
.  *  * ****** ******.**********

223. spacer 2.31|4139359|32|NC_009439|CRISPRCasFinder,CRT matches to NC_016585 (Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence) position: , mismatch: 8, identity: 0.75

acccttgtccgcgtcgccctggtcggcgaggt	CRISPR spacer
caccggcaccgcatcgccctcgtcggcgaggt	Protospacer
  **    ****.******* ***********

224. spacer 2.31|4139359|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP032325 (Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence) position: , mismatch: 8, identity: 0.75

acccttgtccgcgtcgccctggtcggcgaggt	CRISPR spacer
atcgccgaccgcgtcgccgtggtcgtcgagga	Protospacer
*.* ..* ********** ****** *****

225. spacer 2.31|4139359|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP015038 (Burkholderia cenocepacia strain 895 plasmid pBcp895-1, complete sequence) position: , mismatch: 8, identity: 0.75

acccttgtccgcgtcgccctggtcg---gcgaggt	CRISPR spacer
gtcctcgaccgcgtcgccctggtcgcgtgcaa---	Protospacer
..***.* *****************   **.*

226. spacer 2.31|4139359|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP007130 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 2, complete sequence) position: , mismatch: 8, identity: 0.75

acccttgtccgcgtcgccctggtcggcgaggt	CRISPR spacer
gtcgtcgtccgcgtcgcgcaggtcggcgacga	Protospacer
..* *.*********** * ********* *

227. spacer 2.31|4139359|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP033583 (Streptomyces sp. ADI95-16 plasmid pADI95-16b, complete sequence) position: , mismatch: 8, identity: 0.75

acccttgtccgcgtcgccctggtcggcgaggt	CRISPR spacer
acggctgtctgcgacgccctggtcggcgccga	Protospacer
**  .****.*** **************  *

228. spacer 2.31|4139359|32|NC_009439|CRISPRCasFinder,CRT matches to NC_017791 (Deinococcus gobiensis I-0 plasmid P2, complete sequence) position: , mismatch: 8, identity: 0.75

acccttgtccgcgtcgccctggtcggcgaggt	CRISPR spacer
gccgatcaccgtgtcgcccaggtcggcgagga	Protospacer
.**  *  ***.******* ***********

229. spacer 2.32|4139420|33|NC_009439|CRISPRCasFinder,CRT matches to MN234233 (Corynebacterium phage Colleen, complete genome) position: , mismatch: 8, identity: 0.758

ctggggccgcgcatcgacaagatcgaggctcag	CRISPR spacer
gagcggccgcgcttcgacaagatcgatgctgcc	Protospacer
  * ******** ************* ***

230. spacer 2.32|4139420|33|NC_009439|CRISPRCasFinder,CRT matches to MH271317 (Corynebacterium phage TouchMeNot, complete genome) position: , mismatch: 8, identity: 0.758

ctggggccgcgcatcgacaagatcgaggctcag	CRISPR spacer
gagcggccgcgcttcgacaagatcgatgctgcc	Protospacer
  * ******** ************* ***

231. spacer 2.32|4139420|33|NC_009439|CRISPRCasFinder,CRT matches to MF197383 (Corynebacterium phage Poushou, complete genome) position: , mismatch: 8, identity: 0.758

ctggggccgcgcatcgacaagatcgaggctcag	CRISPR spacer
gagcggccgcgcttcgacaagatcgatgctgcc	Protospacer
  * ******** ************* ***

232. spacer 2.32|4139420|33|NC_009439|CRISPRCasFinder,CRT matches to MF063068 (Pseudomonas phage Noxifer, complete genome) position: , mismatch: 8, identity: 0.758

ctggggccgcgcatcgacaagatcgaggctcag	CRISPR spacer
cacgaggtgcgcatcgacaagatcggtgctcac	Protospacer
*  *.* .*****************. *****

233. spacer 2.33|4139482|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP011544 (Corynebacterium mustelae strain DSM 45274 plasmid phiCmus45274, complete sequence) position: , mismatch: 8, identity: 0.75

gtgacgtacaccgaccggccaacgcgaagcgc	CRISPR spacer
agggtggacaccgcccagccaacgcgaagctc	Protospacer
. *..* ****** **.************* *

234. spacer 2.37|4139726|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP018096 (Chelatococcus daeguensis strain TAD1 plasmid pTAD1, complete sequence) position: , mismatch: 8, identity: 0.75

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
cttcttcccggcaccgcgccgggctttcctga	Protospacer
      ****** *** ***************

235. spacer 2.37|4139726|32|NC_009439|CRISPRCasFinder,CRT matches to MK511040 (Pseudomonas phage CF63, partial genome) position: , mismatch: 8, identity: 0.75

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
aaaaagcccggctcgaggccgggcttcaggtt	Protospacer
************** .**********.

236. spacer 2.37|4139726|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP029987 (Sphingomonas sp. FARSPH plasmid p02, complete sequence) position: , mismatch: 8, identity: 0.75

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
gggatgcccggcttcgtgccgggctttccttt	Protospacer
...* ********.** *************

237. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP016613 (Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

238. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP022775 (Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

239. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP021449 (Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

240. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP026091 (Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

241. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NC_014309 (Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

242. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to CP023013 (Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

243. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP021653 (Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

244. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NC_014310 (Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

245. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP022762 (Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

246. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP049790 (Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

247. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP049794 (Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

248. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP049788 (Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

249. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP022766 (Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

250. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP039340 (Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

251. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP021763 (Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

252. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP026093 (Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

253. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP021767 (Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

254. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP015116 (Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

255. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP016555 (Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

256. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP012940 (Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

257. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP012944 (Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

258. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP012688 (Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

259. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP049792 (Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

260. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP052069 (Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

261. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP016915 (Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

262. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP016905 (Ralstonia solanacearum strain KACC 10709 plasmid unnamed1) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

263. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

264. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP022769 (Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

265. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP023017 (Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

266. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP015851 (Ralstonia solanacearum strain YC40-M plasmid, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

267. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP022773 (Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

268. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP022783 (Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

269. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP022791 (Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

270. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP014703 (Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

271. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP022760 (Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

272. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP022789 (Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

273. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP022795 (Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

274. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP052071 (Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

275. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NC_017575 (Ralstonia solanacearum Po82 megaplasmid, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

276. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP022771 (Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

277. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP022777 (Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

278. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP022799 (Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

279. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP022482 (Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

280. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP009763 (Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

281. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to CP023015 (Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

282. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP022779 (Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

283. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP052075 (Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

284. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP052085 (Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

285. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP052095 (Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

286. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP052105 (Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

287. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP021765 (Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

288. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP052077 (Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

289. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP052087 (Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

290. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP052097 (Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

291. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to CP047139 (Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

292. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP051295 (Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

293. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP052115 (Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

294. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP052127 (Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

295. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to CP047137 (Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

296. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP022764 (Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

297. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP052079 (Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

298. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP052089 (Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

299. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP052093 (Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

300. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP052101 (Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

301. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP052099 (Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

302. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP052107 (Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

303. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP045385 (Ruegeria sp. THAF33 plasmid pTHAF33_a, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga	CRISPR spacer
agcccggtcaggtcgtcgcgcttgatccacagatcca	Protospacer
*.* **************** ** ****** *  * *

304. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP022781 (Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

305. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP052117 (Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

306. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP052125 (Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

307. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP022793 (Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

308. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP022797 (Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

309. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP022785 (Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

310. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP022787 (Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

311. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP022756 (Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

312. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP052129 (Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

313. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP052121 (Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

314. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP052123 (Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

315. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP052131 (Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

316. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to CP011998 (Ralstonia solanacearum strain YC45 plasmid, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

317. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP052073 (Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

318. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP052081 (Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

319. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP052083 (Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

320. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP052109 (Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

321. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP052091 (Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

322. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP052111 (Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

323. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP052103 (Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

324. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP052119 (Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

325. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP052113 (Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

326. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP022758 (Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.784

aacacggtcaggtcgtcgcggttcatccactgcgcga---	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcc---cggcgatca	Protospacer
*.**** * *******************     ****

327. spacer 2.40|4137652|32|NC_009439|PILER-CR matches to NZ_CP032322 (Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.75

gcctcaaacgccgcccgctccgcatccatctt	CRISPR spacer
ggccggaacgccgcccgcaccgcgtccatcac	Protospacer
* *. .************ ****.****** .

328. spacer 2.40|4137652|32|NC_009439|PILER-CR matches to CP053412 (Salmonella enterica strain 72-4606 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

gcctcaaacgccgcccgctccgcatccatctt	CRISPR spacer
gactcaaacgccgtccgcgccgcatcgagaga	Protospacer
* ***********.**** ******* *

329. spacer 2.44|4137896|32|NC_009439|PILER-CR matches to NZ_CP026091 (Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

aggtgtacggtcagcgcgtgctgcggcggtcg	CRISPR spacer
tgctgtacgggcagcgcctgctgcgggattgg	Protospacer
 * ******* ****** ******** . * *

330. spacer 2.44|4137896|32|NC_009439|PILER-CR matches to NZ_CP026093 (Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

aggtgtacggtcagcgcgtgctgcggcggtcg	CRISPR spacer
tgctgtacgggcagcgcctgctgcgggattgg	Protospacer
 * ******* ****** ******** . * *

331. spacer 2.44|4137896|32|NC_009439|PILER-CR matches to NZ_CP021767 (Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

aggtgtacggtcagcgcgtgctgcggcggtcg	CRISPR spacer
tgctgtacgggcagcgcctgctgcgggattgg	Protospacer
 * ******* ****** ******** . * *

332. spacer 2.47|4138081|32|NC_009439|PILER-CR matches to MH051254 (Mycobacterium phage Jabiru, complete genome) position: , mismatch: 8, identity: 0.75

agcggtgacggctacccgaccgtggtggtgga	CRISPR spacer
tgcggtggcggctacccgaccatgatcgacgc	Protospacer
 ******.*************.**.* *  *

333. spacer 2.47|4138081|32|NC_009439|PILER-CR matches to MK494091 (Mycobacterium phage Scorpia, complete genome) position: , mismatch: 8, identity: 0.75

agcggtgacggctacccgaccgtggtggtgga	CRISPR spacer
tgcggtggcggctacccgaccatgatcgacgc	Protospacer
 ******.*************.**.* *  *

334. spacer 2.47|4138081|32|NC_009439|PILER-CR matches to MH020239 (Mycobacterium phage Naca, complete genome) position: , mismatch: 8, identity: 0.75

agcggtgacggctacccgaccgtggtggtgga	CRISPR spacer
tgcggtggcggctacccgaccatgatcgacgc	Protospacer
 ******.*************.**.* *  *

335. spacer 2.51|4138325|32|NC_009439|PILER-CR matches to NC_020062 (Rhizobium tropici CIAT 899 plasmid pRtrCIAT899c, complete sequence) position: , mismatch: 8, identity: 0.75

tcccagt--cctggcggttgatccactcgacggc	CRISPR spacer
--ccggccgcctggcggatcatccactcgacgag	Protospacer
  **.*.  ******** * ************.

336. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NZ_CP032346 (Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.75

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
gcacgcgccgcctcgatgctggcgttgagcgc	Protospacer
** . ************** *** ****  .*

337. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NZ_CP017076 (Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence) position: , mismatch: 8, identity: 0.75

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
gtgcgccacgccgcgatgcggcccttgatgac	Protospacer
*. . *  **** ******** **********

338. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NZ_CP016613 (Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgttcgccgcctcgatgcggcccgtgccttc	Protospacer
 * ****************** ** ** .  *

339. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NZ_CP050138 (Sphingomonas sp. CL5.1 plasmid pTSSC1, complete sequence) position: , mismatch: 8, identity: 0.75

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
tcgcgcgccgcctcgatccgggcctcgatcag	Protospacer
 * . ************ *******.*** *

340. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NZ_CP052069 (Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.75

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgttcgccgcctcgatgcggcccgtgccttc	Protospacer
 * ****************** ** ** .  *

341. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NZ_CP052095 (Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.75

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgttcgccgcctcgatgcggcccgtgccttc	Protospacer
 * ****************** ** ** .  *

342. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NZ_CP052097 (Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.75

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgttcgccgcctcgatgcggcccgtgccttc	Protospacer
 * ****************** ** ** .  *

343. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NZ_CP052093 (Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.75

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgttcgccgcctcgatgcggcccgtgccttc	Protospacer
 * ****************** ** ** .  *

344. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NZ_CP052101 (Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.75

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgttcgccgcctcgatgcggcccgtgccttc	Protospacer
 * ****************** ** ** .  *

345. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NZ_CP052099 (Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.75

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgttcgccgcctcgatgcggcccgtgccttc	Protospacer
 * ****************** ** ** .  *

346. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NZ_CP052129 (Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.75

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgttcgccgcctcgatgcggcccgtgccttc	Protospacer
 * ****************** ** ** .  *

347. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NZ_CP015989 (Sphingobium sp. EP60837 plasmid pEP2, complete sequence) position: , mismatch: 8, identity: 0.75

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
tcgcgcgccgcctcgatccgggcctcgatcag	Protospacer
 * . ************ *******.*** *

348. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NZ_CP052091 (Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.75

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgttcgccgcctcgatgcggcccgtgccttc	Protospacer
 * ****************** ** ** .  *

349. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NZ_LR134449 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 7, complete sequence) position: , mismatch: 8, identity: 0.75

gccttcg----ccgcctcgatgcgggccttgatgac	CRISPR spacer
----tcgaggcccgcgtcgatgccggccttgatgta	Protospacer
    ***    **** ******* **********

350. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NZ_CP035514 (Haematobacter massiliensis strain OT1 plasmid pOT1-4, complete sequence) position: , mismatch: 8, identity: 0.75

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
gcctccgccgccgcgatgcgggcgatcagcgc	Protospacer
****.******* **********  * *  .*

351. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NZ_AP022319 (Burkholderia sp. THE68 plasmid BTHE68_p1, complete sequence) position: , mismatch: 8, identity: 0.75

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
gcgcccgccgccgcgatgcaggccttgaggtt	Protospacer
** ..******* ******.******** * .

352. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NC_016626 (Burkholderia sp. YI23 plasmid byi_1p, complete sequence) position: , mismatch: 8, identity: 0.75

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
gcgcccgccgccgcgatgcaggccttgaggtt	Protospacer
** ..******* ******.******** * .

353. spacer 2.55|4138569|32|NC_009439|PILER-CR matches to NZ_CP023152 (Mycobacterium chimaera strain FLAC0070 plasmid pFLAC0070_1, complete sequence) position: , mismatch: 8, identity: 0.75

gcgctcgcgcaggtgacgcacaagcggggtga	CRISPR spacer
ggccagccccaggtcacgcaccagcggggtga	Protospacer
*  *   * ***** ****** **********

354. spacer 2.55|4138569|32|NC_009439|PILER-CR matches to NZ_AP012556 (Mycobacterium avium subsp. hominissuis TH135 plasmid pMAH135, complete sequence) position: , mismatch: 8, identity: 0.75

gcgctcgcgcaggtgacgcacaagcggggtga	CRISPR spacer
ggccagccccaggtcacgcaccagcggggtga	Protospacer
*  *   * ***** ****** **********

355. spacer 2.55|4138569|32|NC_009439|PILER-CR matches to MN694130 (Marine virus AFVG_250M413, complete genome) position: , mismatch: 8, identity: 0.75

gcgctcgcgcaggtgacgcacaagcggggtga	CRISPR spacer
gccacggagcaggtgacggacaaggggggtgg	Protospacer
**  . * ********** ***** ******.

356. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to NZ_CP032348 (Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence) position: , mismatch: 8, identity: 0.75

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
gtggcgctgaccgacgacgacgccggaacgca	Protospacer
****.************ *******. .*  .

357. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to NZ_CP032324 (Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence) position: , mismatch: 8, identity: 0.75

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
gtggcgctgaccgacgacgacgccggaacgca	Protospacer
****.************ *******. .*  .

358. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to NZ_CP016457 (Sphingobium sp. RAC03 plasmid pBSY17_2, complete sequence) position: , mismatch: 8, identity: 0.75

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
tcggtgctgaccgacgacgacgacgactgcga	Protospacer
 .*************** **** ****  *..

359. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to NZ_CP054620 (Azospirillum oryzae strain KACC 14407 plasmid unnamed5, complete sequence) position: , mismatch: 8, identity: 0.75

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
gacgtgctgaccgacgacgtcgccgacctcgc	Protospacer
*  ************** * ******* .*.

360. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to NZ_CP026242 (Citrobacter freundii complex sp. CFNIH9 plasmid pCFR-eb27, complete sequence) position: , mismatch: 8, identity: 0.75

gtggtgctgaccgacgaagacgccgacgccag--	CRISPR spacer
atcgtgctgaccgaggaacacgccga--tcggct	Protospacer
.* *********** *** *******  .*.*

361. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to NZ_CP009883 (Pantoea sp. PSNIH1 plasmid pPSP-a3e, complete sequence) position: , mismatch: 8, identity: 0.75

gtggtgctgaccgacgaagacgccgacgccag--	CRISPR spacer
atcgtgctgaccgaggaacacgccga--tcggct	Protospacer
.* *********** *** *******  .*.*

362. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to NZ_CP010380 (Enterobacter hormaechei subsp. hormaechei strain 34983 plasmid p34983-328.905kb, complete sequence) position: , mismatch: 8, identity: 0.75

gtggtgctgaccgacgaagacgccgacgccag--	CRISPR spacer
atcgtgctgaccgaggaacacgccga--tcggct	Protospacer
.* *********** *** *******  .*.*

363. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to NZ_CP026171 (Leclercia sp. LSNIH1 plasmid pLEC-1cb1, complete sequence) position: , mismatch: 8, identity: 0.75

gtggtgctgaccgacgaagacgccgacgccag--	CRISPR spacer
atcgtgctgaccgaggaacacgccga--tcggct	Protospacer
.* *********** *** *******  .*.*

364. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to NZ_CP026196 (Enterobacteriaceae bacterium ENNIH1 plasmid pENT-1f0b, complete sequence) position: , mismatch: 8, identity: 0.75

gtggtgctgaccgacgaagacgccgacgccag--	CRISPR spacer
atcgtgctgaccgaggaacacgccga--tcggct	Protospacer
.* *********** *** *******  .*.*

365. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to NZ_AP021845 (Azospira sp. I09 plasmid pAZI09, complete sequence) position: , mismatch: 8, identity: 0.75

gtggtgctgaccgacgaagacgccgacgccag--	CRISPR spacer
atcgtgctgaccgaggaacacgccga--tcggct	Protospacer
.* *********** *** *******  .*.*

366. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to CP009869 (Pantoea sp. PSNIH2 plasmid pPSP-75c, complete sequence) position: , mismatch: 8, identity: 0.75

gtggtgctgaccgacgaagacgccgacgccag--	CRISPR spacer
atcgtgctgaccgaggaacacgccga--tcggct	Protospacer
.* *********** *** *******  .*.*

367. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to NZ_CP042479 (Citrobacter freundii strain C50 plasmid pC50_001, complete sequence) position: , mismatch: 8, identity: 0.75

gtggtgctgaccgacgaagacgccgacgccag--	CRISPR spacer
atcgtgctgaccgaggaacacgccga--tcggct	Protospacer
.* *********** *** *******  .*.*

368. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to NC_015727 (Cupriavidus necator N-1 plasmid pBB1, complete sequence) position: , mismatch: 8, identity: 0.75

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
gaggccgtgaccgacgaatacgcctacgccga	Protospacer
* **.  *********** ***** *****..

369. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to NC_009425 (Enterobacter sp. 638 plasmid pENTE01, complete sequence) position: , mismatch: 8, identity: 0.75

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
atgacgctgaccgacaaagccgccgacgttaa	Protospacer
.**..**********.*** ********..*.

370. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 8, identity: 0.75

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
gaggccgtgaccgacgaatacgcctacgccga	Protospacer
* **.  *********** ***** *****..

371. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 8, identity: 0.75

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
gaggccgtgaccgacgaatacgcctacgccga	Protospacer
* **.  *********** ***** *****..

372. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to NZ_CP026208 (Escherichia coli strain ECONIH5 plasmid pECO-109b, complete sequence) position: , mismatch: 8, identity: 0.75

gtggtgctgaccgacgaagacgccgacgccag--	CRISPR spacer
atcgtgctgaccgaggaacacgccga--tcggct	Protospacer
.* *********** *** *******  .*.*

373. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to NC_021910 (Rhizobium etli bv. mimosae str. Mim1 plasmid pRetNIM1c, complete sequence) position: , mismatch: 8, identity: 0.75

gtggtgctgaccgacgaagacgccg-acgccag	CRISPR spacer
taggtgttgcccgacgaagacgccgcatagca-	Protospacer
  ****.** *************** *.. **

374. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to NZ_CP032179 (Citrobacter freundii strain AR_0116 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

gtggtgctgaccgacgaagacgccgacgccag--	CRISPR spacer
atcgtgctgaccgaggaacacgccga--tcggct	Protospacer
.* *********** *** *******  .*.*

375. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to NZ_CP026391 (Leclercia sp. LSNIH3 plasmid pLEC-7c0d, complete sequence) position: , mismatch: 8, identity: 0.75

gtggtgctgaccgacgaagacgccgacgccag--	CRISPR spacer
atcgtgctgaccgaggaacacgccga--tcggct	Protospacer
.* *********** *** *******  .*.*

376. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to NZ_CP029142 (Klebsiella michiganensis strain AR375 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

gtggtgctgaccgacgaagacgccgacgccag--	CRISPR spacer
atcgtgctgaccgaggaacacgccga--tcggct	Protospacer
.* *********** *** *******  .*.*

377. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to NZ_CP031135 (Escherichia coli strain CFSAN064035 plasmid pGMI17-003_1, complete sequence) position: , mismatch: 8, identity: 0.75

gtggtgctgaccgacgaagacgccgacgccag--	CRISPR spacer
atcgtgctgaccgaggaacacgccga--tcggct	Protospacer
.* *********** *** *******  .*.*

378. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to NZ_CP011635 (Klebsiella oxytoca strain CAV1374 plasmid pKPC_CAV1374, complete sequence) position: , mismatch: 8, identity: 0.75

gtggtgctgaccgacgaagacgccgacgccag--	CRISPR spacer
atcgtgctgaccgaggaacacgccga--tcggct	Protospacer
.* *********** *** *******  .*.*

379. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to NZ_CP032344 (Azospirillum brasilense strain MTCC4038 plasmid p5, complete sequence) position: , mismatch: 8, identity: 0.75

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
acgacggtgaccgacgccgacgccgacgccgg	Protospacer
..*..* *********  ************.*

380. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to NZ_CP013115 (Shewanella xiamenensis strain T17 plasmid pSx1, complete sequence) position: , mismatch: 8, identity: 0.75

gtggtgctgaccgacgaagacgccgacgccag--	CRISPR spacer
atcgtgctgaccgaggaacacgccga--tcggct	Protospacer
.* *********** *** *******  .*.*

381. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to NZ_CP033323 (Azospirillum brasilense strain Cd plasmid p5, complete sequence) position: , mismatch: 8, identity: 0.75

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
acgacggtgaccgacgccgacgccgacgccgg	Protospacer
..*..* *********  ************.*

382. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to NZ_CP033317 (Azospirillum brasilense strain Sp 7 plasmid p5, complete sequence) position: , mismatch: 8, identity: 0.75

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
acgacggtgaccgacgccgacgccgacgccgg	Protospacer
..*..* *********  ************.*

383. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to NZ_CP012919 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p5, complete sequence) position: , mismatch: 8, identity: 0.75

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
acgacggtgaccgacgccgacgccgacgccgg	Protospacer
..*..* *********  ************.*

384. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to NZ_CP044111 (Klebsiella michiganensis strain FDAARGOS_647 plasmid unnamed2) position: , mismatch: 8, identity: 0.75

gtggtgctgaccgacgaagacgccgacgccag--	CRISPR spacer
atcgtgctgaccgaggaacacgccga--tcggct	Protospacer
.* *********** *** *******  .*.*

385. spacer 2.59|4138814|32|NC_009439|PILER-CR matches to LC425512 (Uncultured phage DNA, contig: NODE34) position: , mismatch: 8, identity: 0.75

aacatca-aggggagggcctgatatggaatgcc	CRISPR spacer
-ctgttatagggcagggcctgacatggaatggc	Protospacer
  ..*.* **** *********.******** *

386. spacer 2.59|4138814|32|NC_009439|PILER-CR matches to NC_008562 (Microcystis phage Ma-LMM01 DNA, complete genome) position: , mismatch: 8, identity: 0.75

aacatca-aggggagggcctgatatggaatgcc	CRISPR spacer
-ctgttatagggcagggcctgacatggaatggc	Protospacer
  ..*.* **** *********.******** *

387. spacer 2.62|4138997|32|NC_009439|PILER-CR matches to CP054917 (Streptomyces sp. NA02950 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

cttgatgtcagccgtcaccttgttcggggtgc	CRISPR spacer
ggtgatgtcggccgtcaccgtgttcttcgtga	Protospacer
  *******.********* *****   ***

388. spacer 2.68|4139365|32|NC_009439|PILER-CR matches to NZ_CP029777 (Deinococcus actinosclerus strain Deinococcus actinosclerus SJTR plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.75

acccttgtccgcgtcgccctggtcggcgaggt	CRISPR spacer
gagcaggaccgcgtggccctgatcggcgaggt	Protospacer
.  *  * ****** ******.**********

389. spacer 2.68|4139365|32|NC_009439|PILER-CR matches to NC_016585 (Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence) position: , mismatch: 8, identity: 0.75

acccttgtccgcgtcgccctggtcggcgaggt	CRISPR spacer
caccggcaccgcatcgccctcgtcggcgaggt	Protospacer
  **    ****.******* ***********

390. spacer 2.68|4139365|32|NC_009439|PILER-CR matches to NZ_CP032325 (Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence) position: , mismatch: 8, identity: 0.75

acccttgtccgcgtcgccctggtcggcgaggt	CRISPR spacer
atcgccgaccgcgtcgccgtggtcgtcgagga	Protospacer
*.* ..* ********** ****** *****

391. spacer 2.68|4139365|32|NC_009439|PILER-CR matches to NZ_CP015038 (Burkholderia cenocepacia strain 895 plasmid pBcp895-1, complete sequence) position: , mismatch: 8, identity: 0.75

acccttgtccgcgtcgccctggtcg---gcgaggt	CRISPR spacer
gtcctcgaccgcgtcgccctggtcgcgtgcaa---	Protospacer
..***.* *****************   **.*

392. spacer 2.68|4139365|32|NC_009439|PILER-CR matches to NZ_CP007130 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 2, complete sequence) position: , mismatch: 8, identity: 0.75

acccttgtccgcgtcgccctggtcggcgaggt	CRISPR spacer
gtcgtcgtccgcgtcgcgcaggtcggcgacga	Protospacer
..* *.*********** * ********* *

393. spacer 2.68|4139365|32|NC_009439|PILER-CR matches to NZ_CP033583 (Streptomyces sp. ADI95-16 plasmid pADI95-16b, complete sequence) position: , mismatch: 8, identity: 0.75

acccttgtccgcgtcgccctggtcggcgaggt	CRISPR spacer
acggctgtctgcgacgccctggtcggcgccga	Protospacer
**  .****.*** **************  *

394. spacer 2.68|4139365|32|NC_009439|PILER-CR matches to NC_017791 (Deinococcus gobiensis I-0 plasmid P2, complete sequence) position: , mismatch: 8, identity: 0.75

acccttgtccgcgtcgccctggtcggcgaggt	CRISPR spacer
gccgatcaccgtgtcgcccaggtcggcgagga	Protospacer
.**  *  ***.******* ***********

395. spacer 2.69|4139426|33|NC_009439|PILER-CR matches to MN234233 (Corynebacterium phage Colleen, complete genome) position: , mismatch: 8, identity: 0.758

ctggggccgcgcatcgacaagatcgaggctcag	CRISPR spacer
gagcggccgcgcttcgacaagatcgatgctgcc	Protospacer
  * ******** ************* ***

396. spacer 2.69|4139426|33|NC_009439|PILER-CR matches to MH271317 (Corynebacterium phage TouchMeNot, complete genome) position: , mismatch: 8, identity: 0.758

ctggggccgcgcatcgacaagatcgaggctcag	CRISPR spacer
gagcggccgcgcttcgacaagatcgatgctgcc	Protospacer
  * ******** ************* ***

397. spacer 2.69|4139426|33|NC_009439|PILER-CR matches to MF197383 (Corynebacterium phage Poushou, complete genome) position: , mismatch: 8, identity: 0.758

ctggggccgcgcatcgacaagatcgaggctcag	CRISPR spacer
gagcggccgcgcttcgacaagatcgatgctgcc	Protospacer
  * ******** ************* ***

398. spacer 2.69|4139426|33|NC_009439|PILER-CR matches to MF063068 (Pseudomonas phage Noxifer, complete genome) position: , mismatch: 8, identity: 0.758

ctggggccgcgcatcgacaagatcgaggctcag	CRISPR spacer
cacgaggtgcgcatcgacaagatcggtgctcac	Protospacer
*  *.* .*****************. *****

399. spacer 2.70|4139488|32|NC_009439|PILER-CR matches to NZ_CP011544 (Corynebacterium mustelae strain DSM 45274 plasmid phiCmus45274, complete sequence) position: , mismatch: 8, identity: 0.75

gtgacgtacaccgaccggccaacgcgaagcgc	CRISPR spacer
agggtggacaccgcccagccaacgcgaagctc	Protospacer
. *..* ****** **.************* *

400. spacer 2.74|4139732|32|NC_009439|PILER-CR matches to NZ_CP018096 (Chelatococcus daeguensis strain TAD1 plasmid pTAD1, complete sequence) position: , mismatch: 8, identity: 0.75

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
cttcttcccggcaccgcgccgggctttcctga	Protospacer
      ****** *** ***************

401. spacer 2.74|4139732|32|NC_009439|PILER-CR matches to MK511040 (Pseudomonas phage CF63, partial genome) position: , mismatch: 8, identity: 0.75

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
aaaaagcccggctcgaggccgggcttcaggtt	Protospacer
************** .**********.

402. spacer 2.74|4139732|32|NC_009439|PILER-CR matches to NZ_CP029987 (Sphingomonas sp. FARSPH plasmid p02, complete sequence) position: , mismatch: 8, identity: 0.75

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
gggatgcccggcttcgtgccgggctttccttt	Protospacer
...* ********.** *************

403. spacer 3.2|4149247|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to MT701590 (Klebsiella phage Miami, complete genome) position: , mismatch: 8, identity: 0.75

gcgctgatcgactgcaacgcgttctactgcag	CRISPR spacer
cagccgatcgactgtaacgcgttctatcccat	Protospacer
  **.*********.***********.. **

404. spacer 3.4|4149370|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP015095 (Pelagibaca abyssi strain JLT2014 plasmid pPABY4, complete sequence) position: , mismatch: 8, identity: 0.75

tttatccaggcggcgggggcggtgggcagcac	CRISPR spacer
gcgatcctcgcggcgggggcggtgggcgggat	Protospacer
 . ****  ******************.* *.

405. spacer 3.4|4149370|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NC_011143 (Phenylobacterium zucineum HLK1 plasmid, complete sequence) position: , mismatch: 8, identity: 0.75

tttatccaggcggcgggggcggtgggcagcac	CRISPR spacer
gcgatccaggcggcggaggcggcgggcgacgc	Protospacer
 . *************.*****.****..*.*

406. spacer 3.4|4149370|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NC_017833 (Streptomyces sp. FR1 plasmid pFP4, complete sequence) position: , mismatch: 8, identity: 0.75

tttatccaggcggcgggggcggtgggcagcac	CRISPR spacer
tcccgccaggcgacgggagcggtgggcagagc	Protospacer
*..  *******.****.*********** .*

407. spacer 3.4|4149370|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP030354 (Novosphingobium sp. P6W plasmid pP6W1, complete sequence) position: , mismatch: 8, identity: 0.75

tttatccaggcggcgggggcggtgggcagcac	CRISPR spacer
tcattccaggcggcggcggcggttggcttctc	Protospacer
*.  ************ ****** ***  * *

408. spacer 3.4|4149370|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP032695 (Rhizobium jaguaris strain CCGE525 plasmid pRCCGE525c, complete sequence) position: , mismatch: 8, identity: 0.75

tttatccaggcggcgggggcggtgggcagcac	CRISPR spacer
ttgttccaggcggcgagggcggagggcgcttc	Protospacer
**  ***********.****** ****. . *

409. spacer 3.5|4149431|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NC_011667 (Thauera sp. MZ1T plasmid pTha01, complete sequence) position: , mismatch: 8, identity: 0.75

gcgccggcgccgcagagcctggccggccgaga	CRISPR spacer
gtgccggcaccgcagatcctggccgcgctgca	Protospacer
*.******.******* ********  * . *

410. spacer 3.11|4149797|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP018096 (Chelatococcus daeguensis strain TAD1 plasmid pTAD1, complete sequence) position: , mismatch: 8, identity: 0.75

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
cttcttcccggcaccgcgccgggctttcctga	Protospacer
      ****** *** ***************

411. spacer 3.11|4149797|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to MK511040 (Pseudomonas phage CF63, partial genome) position: , mismatch: 8, identity: 0.75

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
aaaaagcccggctcgaggccgggcttcaggtt	Protospacer
************** .**********.

412. spacer 3.11|4149797|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP029987 (Sphingomonas sp. FARSPH plasmid p02, complete sequence) position: , mismatch: 8, identity: 0.75

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
gggatgcccggcttcgtgccgggctttccttt	Protospacer
...* ********.** *************

413. spacer 3.12|4149858|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP018096 (Chelatococcus daeguensis strain TAD1 plasmid pTAD1, complete sequence) position: , mismatch: 8, identity: 0.75

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
cttcttcccggcaccgcgccgggctttcctga	Protospacer
      ****** *** ***************

414. spacer 3.12|4149858|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to MK511040 (Pseudomonas phage CF63, partial genome) position: , mismatch: 8, identity: 0.75

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
aaaaagcccggctcgaggccgggcttcaggtt	Protospacer
************** .**********.

415. spacer 3.12|4149858|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP029987 (Sphingomonas sp. FARSPH plasmid p02, complete sequence) position: , mismatch: 8, identity: 0.75

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
gggatgcccggcttcgtgccgggctttccttt	Protospacer
...* ********.** *************

416. spacer 3.13|4149919|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP031080 (Paracoccus yeei strain CCUG 32053 plasmid pYEE2, complete sequence) position: , mismatch: 8, identity: 0.75

cgcggcggcgccgacgtcatgcacggccggcc	CRISPR spacer
tatcgcggcgccgacgacatgcacggcgcggc	Protospacer
... ************ **********  * *

417. spacer 3.13|4149919|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

cgcggcggcgccgacgtcatgcacggccggcc	CRISPR spacer
atcggcggcgccgacggcaagcacggtctgta	Protospacer
  ************** ** ******.* *.

418. spacer 3.13|4149919|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NC_023283 (Streptomyces sp. FR1 plasmid pFRL3, complete sequence) position: , mismatch: 8, identity: 0.75

cgcggcggcgccgacgtcatgcacggccggcc	CRISPR spacer
cagttcgtcgccgacgtcctgcacggccgcct	Protospacer
*.   ** ********** ********** *.

419. spacer 3.13|4149919|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP006989 (Rhizobium sp. IE4771 plasmid pRetIE4771c, complete sequence) position: , mismatch: 8, identity: 0.75

cgcggcggcgccgacgtcatgcacgg--ccggcc	CRISPR spacer
tatcgcggcgccgacgacatgcatggcaccgg--	Protospacer
... ************ ******.**  ****

420. spacer 3.13|4149919|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NC_010998 (Rhizobium etli CIAT 652 plasmid pA, complete sequence) position: , mismatch: 8, identity: 0.75

cgcggcggcgccgacgtcatgcacggccggcc--	CRISPR spacer
tatcgcggcgccgacgacatgcatggc--gccgg	Protospacer
... ************ ******.***  ***

421. spacer 3.13|4149919|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP043960 (Streptomyces tendae strain 139 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

cgcggcggcgccgacgtcatgcacggccggcc	CRISPR spacer
tgcgagcttgccgacgtcatgcatggtcggcc	Protospacer
.***.   .**************.**.*****

422. spacer 3.13|4149919|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to MT740747 (Ralstonia phage Simangalove, complete genome) position: , mismatch: 8, identity: 0.75

cgcggcggcgccgacgtcatgcacggccggcc	CRISPR spacer
ggagttgtggccgacggcctgcacggccggcc	Protospacer
 * * .*  ******* * *************

423. spacer 3.13|4149919|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to MT740729 (Ralstonia phage Bakoly, complete genome) position: , mismatch: 8, identity: 0.75

cgcggcggcgccgacgtcatgcacggccggcc	CRISPR spacer
ggagttgtggccgacggcctgcacggccggcc	Protospacer
 * * .*  ******* * *************

424. spacer 3.13|4149919|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to MT740744 (Ralstonia phage Jenny, complete genome) position: , mismatch: 8, identity: 0.75

cgcggcggcgccgacgtcatgcacggccggcc	CRISPR spacer
ggagttgtggccgacggcctgcacggccggcc	Protospacer
 * * .*  ******* * *************

425. spacer 3.13|4149919|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to MT740735 (Ralstonia phage Elie, complete genome) position: , mismatch: 8, identity: 0.75

cgcggcggcgccgacgtcatgcacggccggcc	CRISPR spacer
ggagttgtggccgacggcctgcacggccggcc	Protospacer
 * * .*  ******* * *************

426. spacer 3.13|4149919|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to MT740746 (Ralstonia phage Sarlave, complete genome) position: , mismatch: 8, identity: 0.75

cgcggcggcgccgacgtcatgcacggccggcc	CRISPR spacer
ggagttgtggccgacggcctgcacggccggcc	Protospacer
 * * .*  ******* * *************

427. spacer 3.13|4149919|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to MT740725 (Ralstonia phage Adzire, complete genome) position: , mismatch: 8, identity: 0.75

cgcggcggcgccgacgtcatgcacggccggcc	CRISPR spacer
ggagttgtggccgacggcctgcacggccggcc	Protospacer
 * * .*  ******* * *************

428. spacer 3.15|4150041|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP023408 (Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.75

tcctcggtgagggcggcgatcacatcggctgc	CRISPR spacer
tcctcggtgagcgcgtcgatcactgccgacga	Protospacer
*********** *** *******  * * .*

429. spacer 2.1|4137525|32|NC_009439|CRISPRCasFinder,CRT matches to MH744423 (Mycobacterium phage Saguaro, complete genome) position: , mismatch: 9, identity: 0.719

gggtagccgttgatcttggtccagcgcgggtg	CRISPR spacer
ccgcagctgttgatcttggtcaagcgcagcgt	Protospacer
  *.***.************* *****.*

430. spacer 2.1|4137525|32|NC_009439|CRISPRCasFinder,CRT matches to MK059749 (Mycobacterium phage CRB2, complete genome) position: , mismatch: 9, identity: 0.719

gggtagccgttgatcttggtccagcgcgggtg	CRISPR spacer
ccgcagccgttgatcttggtcaggcgcagcgt	Protospacer
  *.***************** .****.*

431. spacer 2.2|4137586|31|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP025552 (Streptomyces rimosus strain WT5260 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

gtcaggtcgtcgcggttcatccactgcgcga	CRISPR spacer
gcgcggtcggcgcggttcatccacggcagtc	Protospacer
*.  ***** ************** **.

432. spacer 2.3|4137646|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP021653 (Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gcctcaaacgccgcccgctccgcatccatctt	CRISPR spacer
ctttcaaacgccgccagctccacatcctgcgg	Protospacer
 ..************ *****.*****  *

433. spacer 2.3|4137646|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP021767 (Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gcctcaaacgccgcccgctccgcatccatctt	CRISPR spacer
ctttcaaacgccgccagctccacatcctgcgg	Protospacer
 ..************ *****.*****  *

434. spacer 2.3|4137646|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP012688 (Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gcctcaaacgccgcccgctccgcatccatctt	CRISPR spacer
ctttcaaacgccgccagctccacatcctgcgg	Protospacer
 ..************ *****.*****  *

435. spacer 2.3|4137646|32|NC_009439|CRISPRCasFinder,CRT matches to CP047139 (Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gcctcaaacgccgcccgctccgcatccatctt	CRISPR spacer
ctttcaaacgccgccagctccacatcctgcgg	Protospacer
 ..************ *****.*****  *

436. spacer 2.3|4137646|32|NC_009439|CRISPRCasFinder,CRT matches to CP047137 (Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gcctcaaacgccgcccgctccgcatccatctt	CRISPR spacer
ctttcaaacgccgccagctccacatcctgcgg	Protospacer
 ..************ *****.*****  *

437. spacer 2.5|4137768|32|NC_009439|CRISPRCasFinder,CRT matches to KC465901 (Pelagibacter phage HTVC019P, complete genome) position: , mismatch: 9, identity: 0.719

atcgttcacagcaacagcaggttcggttgcca	CRISPR spacer
tctttcttcatcaacagtaggttcggttgcca	Protospacer
 .. *.. ** ******.**************

438. spacer 2.10|4138075|32|NC_009439|CRISPRCasFinder,CRT matches to MN586060 (Mycobacterium phage PetterN, complete genome) position: , mismatch: 9, identity: 0.719

agcggtgacggctacccgaccgtggtggtgga	CRISPR spacer
tgcggtggcggctacccgaccatgatcgactt	Protospacer
 ******.*************.**.* *

439. spacer 2.12|4138197|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_LR536452 (Methylocella tundrae isolate MTUNDRAET4 annotated genome plasmid 3) position: , mismatch: 9, identity: 0.719

ccgcgctctgagcgccgcgagctcttcgccaa	CRISPR spacer
ggccacgacgatcgccgcgagcgcttcgccaa	Protospacer
   *.*  .** ********** *********

440. spacer 2.12|4138197|32|NC_009439|CRISPRCasFinder,CRT matches to MG707188 (Pseudomonas phage TC7, partial genome) position: , mismatch: 9, identity: 0.719

ccgcgctctgagcgccgcgagctcttcgccaa	CRISPR spacer
ccgcgctctgagcgccgctcgctgattcaaga	Protospacer
******************  ***  *.   .*

441. spacer 2.12|4138197|32|NC_009439|CRISPRCasFinder,CRT matches to NC_030931 (Pseudomonas phage phi2, complete genome) position: , mismatch: 9, identity: 0.719

ccgcgctctgagcgccgcgagctcttcgccaa	CRISPR spacer
ccgcgctctgagcgccgctcgctgattcaaga	Protospacer
******************  ***  *.   .*

442. spacer 2.14|4138319|32|NC_009439|CRISPRCasFinder,CRT matches to MT939492 (Xanthomonas phage Xoo-sp14, complete genome) position: , mismatch: 9, identity: 0.719

tcccagt-----cctggcggttgatccactcgacggc	CRISPR spacer
-----gtgttcgcctggcggttgatcgcctcgacgta	Protospacer
     **     **************  *******

443. spacer 2.15|4138380|32|NC_009439|CRISPRCasFinder,CRT matches to LT599585 (Pseudomonas veronii 1YdBTEX2 genome assembly, plasmid: PVE_plasmid) position: , mismatch: 9, identity: 0.719

gctgatttcccgccaaaggaatgtggttgcaa	CRISPR spacer
gtaggcatcccgagaaaggaatgtggttgcgc	Protospacer
*. *.. *****  ****************.

444. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP032346 (Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence) position: , mismatch: 9, identity: 0.719

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
gccttcaccgcctcgatgagggcgaggccgtg	Protospacer
******.*********** ****   * .*

445. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP017148 (Bosea vaviloviae strain Vaf18 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
gcgacgaaggcctcgatgctggccttggtgac	Protospacer
**  . .  ********** *******.****

446. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NC_019849 (Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence) position: , mismatch: 9, identity: 0.719

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgcccgccgcctcgaagccggccttgaatgc	Protospacer
 * ..*********** ** ********  .*

447. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NC_003078 (Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence) position: , mismatch: 9, identity: 0.719

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgcccgccgcctcgaagccggccttgaatgc	Protospacer
 * ..*********** ** ********  .*

448. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP019586 (Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence) position: , mismatch: 9, identity: 0.719

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccacccgccgcctcgaagccggccttgaatgc	Protospacer
 * ..*********** ** ********  .*

449. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NC_017326 (Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence) position: , mismatch: 9, identity: 0.719

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgcccgccgcctcgaagccggccttgaatgc	Protospacer
 * ..*********** ** ********  .*

450. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP021799 (Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.719

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgcccgccgcctcgaagccggccttgaatgc	Protospacer
 * ..*********** ** ********  .*

451. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NC_017323 (Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence) position: , mismatch: 9, identity: 0.719

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgcccgccgcctcgaagccggccttgaatgc	Protospacer
 * ..*********** ** ********  .*

452. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP009146 (Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence) position: , mismatch: 9, identity: 0.719

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgcccgccgcctcgaagccggccttgaatgc	Protospacer
 * ..*********** ** ********  .*

453. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NC_018701 (Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence) position: , mismatch: 9, identity: 0.719

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgcccgccgcctcgaagccggccttgaatgc	Protospacer
 * ..*********** ** ********  .*

454. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP023000 (Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-B, complete sequence) position: , mismatch: 9, identity: 0.719

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgaatgccgcctcgatcggggccttgatcgc	Protospacer
 *   .***********  ********** .*

455. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP021828 (Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.719

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgcccgccgcctcgaagccggccttgaatgc	Protospacer
 * ..*********** ** ********  .*

456. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP021802 (Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.719

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgcccgccgcctcgaagccggccttgaatgc	Protospacer
 * ..*********** ** ********  .*

457. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP032342 (Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence) position: , mismatch: 9, identity: 0.719

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
cccttcgccgccgcgttgcgggcccgcaggta	Protospacer
 *********** ** ********.  * *

458. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP021820 (Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.719

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgcccgccgcctcgaagccggccttgaatgc	Protospacer
 * ..*********** ** ********  .*

459. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP021831 (Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.719

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgcccgccgcctcgaagccggccttgaatgc	Protospacer
 * ..*********** ** ********  .*

460. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP021823 (Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.719

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgcccgccgcctcgaagccggccttgaatgc	Protospacer
 * ..*********** ** ********  .*

461. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP021814 (Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.719

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgcccgccgcctcgaagccggccttgaatgc	Protospacer
 * ..*********** ** ********  .*

462. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP021795 (Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.719

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgcccgccgcctcgaagccggccttgaatgc	Protospacer
 * ..*********** ** ********  .*

463. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP021810 (Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.719

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgcccgccgcctcgaagccggccttgaatgc	Protospacer
 * ..*********** ** ********  .*

464. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP021806 (Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.719

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgcccgccgcctcgaagccggccttgaatgc	Protospacer
 * ..*********** ** ********  .*

465. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP021218 (Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence) position: , mismatch: 9, identity: 0.719

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgcccgccgcctcgaagccggccttgaatgc	Protospacer
 * ..*********** ** ********  .*

466. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP026527 (Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence) position: , mismatch: 9, identity: 0.719

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgcccgccgcctcgaagccggccttgaatgc	Protospacer
 * ..*********** ** ********  .*

467. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP033321 (Azospirillum brasilense strain Cd plasmid p3, complete sequence) position: , mismatch: 9, identity: 0.719

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
cccttcgccgccgcgttgcgggcccgcaggta	Protospacer
 *********** ** ********.  * *

468. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP033315 (Azospirillum brasilense strain Sp 7 plasmid p3, complete sequence) position: , mismatch: 9, identity: 0.719

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
cccttcgccgccgcgttgcgggcccgcaggta	Protospacer
 *********** ** ********.  * *

469. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP019484 (Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence) position: , mismatch: 9, identity: 0.719

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgcccgccgcctcgaagccggccttgaatgc	Protospacer
 * ..*********** ** ********  .*

470. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP019487 (Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence) position: , mismatch: 9, identity: 0.719

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgcccgccgcctcgaagccggccttgaatgc	Protospacer
 * ..*********** ** ********  .*

471. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NC_020560 (Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence) position: , mismatch: 9, identity: 0.719

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgcccgccgcctcgaagccggccttgaatgc	Protospacer
 * ..*********** ** ********  .*

472. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP022775 (Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
tggatgctgaccgacgacgacggcgaccagcg	Protospacer
  *.************* **** ****    *

473. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP015585 (Roseomonas gilardii strain U14-5 plasmid 1, complete sequence) position: , mismatch: 9, identity: 0.719

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
atcgtgctgaccgacgagggcgccgagttcct	Protospacer
.* **************.*.******  .*

474. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to NC_013859 (Azospirillum sp. B510 plasmid pAB510e, complete sequence) position: , mismatch: 9, identity: 0.719

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
gacgtgctgaccgacgatgtcgccgatctcgc	Protospacer
*  ************** * ******. .*.

475. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP032340 (Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence) position: , mismatch: 9, identity: 0.719

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
gacgtgctgaccgacgacgtcgccgatctcgc	Protospacer
*  ************** * ******. .*.

476. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP022764 (Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
tggatgctgaccgacgacgacggcgaccagcg	Protospacer
  *.************* **** ****    *

477. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP012915 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence) position: , mismatch: 9, identity: 0.719

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
gacgtgctgaccgacgacgtcgccgatctcgc	Protospacer
*  ************** * ******. .*.

478. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP022797 (Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
tggatgctgaccgacgacgacggcgaccagcg	Protospacer
  *.************* **** ****    *

479. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP022758 (Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
tggatgctgaccgacgacgacggcgaccagcg	Protospacer
  *.************* **** ****    *

480. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to KX765864 (Salmonella phage ST-374, complete genome) position: , mismatch: 9, identity: 0.719

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
ggaacgctgaacgacgaagacgacgacgacga	Protospacer
* ...***** *********** ***** *..

481. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to KX765862 (Salmonella phage ST-101, complete genome) position: , mismatch: 9, identity: 0.719

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
ggaacgctgaacgacgaagacgacgacgacga	Protospacer
* ...***** *********** ***** *..

482. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to AB916497 (Ralstonia phage RS138 DNA, complete genome) position: , mismatch: 9, identity: 0.719

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
tggatgctgaccgacgacgacggcgaccagcg	Protospacer
  *.************* **** ****    *

483. spacer 2.20|4138685|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP013072 (Sphingobium indicum B90A plasmid pSRL2, complete sequence) position: , mismatch: 9, identity: 0.719

ttgcagcccgccagccgcagcttcgggagggc	CRISPR spacer
atgccgcccgccaggcgcagcttcttgtcgaa	Protospacer
 *** ********* *********  *  *.

484. spacer 2.20|4138685|32|NC_009439|CRISPRCasFinder,CRT matches to NC_008010 (Deinococcus geothermalis DSM 11300 plasmid pDGEO01, complete sequence) position: , mismatch: 9, identity: 0.719

ttgcagcccgccagccgcagcttcgggagggc	CRISPR spacer
ctgcacccggccagccgcagcttcagccgctg	Protospacer
.**** ** ***************.*  *

485. spacer 2.23|4138869|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP020504 (Serratia marcescens strain 95 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.719

ttgctttcattggtgctgcctctttcggttga	CRISPR spacer
ttggtttcatgggtgctgcctctgctgctgct	Protospacer
*** ****** ************ ..* *

486. spacer 2.23|4138869|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP026402 (Escherichia coli strain ECONIH4 plasmid pECO-e618, complete sequence) position: , mismatch: 9, identity: 0.719

ttgctttcattggtgctgcctctttcggttga	CRISPR spacer
ttggtttcatgggtgctgcctctgctgctgct	Protospacer
*** ****** ************ ..* *

487. spacer 2.26|4139052|33|NC_009439|CRISPRCasFinder,CRT matches to NC_008826 (Methylibium petroleiphilum PM1 plasmid RPME01, complete sequence) position: , mismatch: 9, identity: 0.727

-----tttgtggacatggcggccgagctgtggagctgg	CRISPR spacer
agcagtcc-----catggcggccgagccgtggcgctgg	Protospacer
     *..     **************.**** *****

488. spacer 2.26|4139052|33|NC_009439|CRISPRCasFinder,CRT matches to NC_008826 (Methylibium petroleiphilum PM1 plasmid RPME01, complete sequence) position: , mismatch: 9, identity: 0.727

-----tttgtggacatggcggccgagctgtggagctgg	CRISPR spacer
agcagtcc-----catggcggccgagccgtggcgctgg	Protospacer
     *..     **************.**** *****

489. spacer 2.31|4139359|32|NC_009439|CRISPRCasFinder,CRT matches to NC_016624 (Azospirillum lipoferum 4B plasmid AZO_p5, complete sequence) position: , mismatch: 9, identity: 0.719

acccttgtccgcgtcgccctggtcggcgaggt	CRISPR spacer
atcgaccgtcgcctcgccctggtcggcgcggt	Protospacer
*.*  .  .*** *************** ***

490. spacer 2.31|4139359|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP022369 (Azospirillum sp. TSH58 plasmid TSH58_p05, complete sequence) position: , mismatch: 9, identity: 0.719

acccttgtccgcgtcgccctggtcggcgaggt	CRISPR spacer
ccggcggcgcgcgtcggcgtggtcggcgaggt	Protospacer
 *  . *. ******* * *************

491. spacer 2.31|4139359|32|NC_009439|CRISPRCasFinder,CRT matches to NC_012725 (Burkholderia glumae BGR1 plasmid bglu_4p, complete sequence) position: , mismatch: 9, identity: 0.719

acccttgtccgcgtcgccctggtcggcgaggt	CRISPR spacer
cgcgcggaacgcgtcgcactggtcggcggggt	Protospacer
  * . *  ******** **********.***

492. spacer 2.31|4139359|32|NC_009439|CRISPRCasFinder,CRT matches to NC_012720 (Burkholderia glumae BGR1 plasmid bglu_3p, complete sequence) position: , mismatch: 9, identity: 0.719

acccttgtccgcgtcgccctggtcggcgaggt	CRISPR spacer
cgcgcggaacgcgtcgcactggtcggcggggt	Protospacer
  * . *  ******** **********.***

493. spacer 2.31|4139359|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP007796 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p3, complete sequence) position: , mismatch: 9, identity: 0.719

acccttgtccgcgtcgccctggtcggcgaggt	CRISPR spacer
ccggcggcgcgcgtcggcgtggtcggcgaggt	Protospacer
 *  . *. ******* * *************

494. spacer 2.31|4139359|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP035902 (Burkholderia glumae strain 257sh-1 plasmid plas1, complete sequence) position: , mismatch: 9, identity: 0.719

acccttgtccgcgtcgccctggtcggcgaggt	CRISPR spacer
cgcgcggaacgcgtcgcactggtcggcggggt	Protospacer
  * . *  ******** **********.***

495. spacer 2.31|4139359|32|NC_009439|CRISPRCasFinder,CRT matches to NC_023285 (Streptomyces sp. F8 plasmid pFRL5, complete sequence) position: , mismatch: 9, identity: 0.719

acccttgtccgcgtcgccctggtcggcgaggt	CRISPR spacer
caccacgtacgcgtcgcccgggtcggcgacca	Protospacer
  ** .** ********** *********

496. spacer 2.31|4139359|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP029834 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed4, complete sequence) position: , mismatch: 9, identity: 0.719

acccttgtccgcgtcgccctggtcggcgaggt	CRISPR spacer
gtccaccgtcgcctcgccctggtcggcgcggt	Protospacer
..** .  .*** *************** ***

497. spacer 2.31|4139359|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP038636 (Cupriavidus oxalaticus strain X32 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

acccttgtccgcgtcgccctggtcggcgaggt	CRISPR spacer
cacttcacacgcgtcgccctgctctgcgaggt	Protospacer
  *.*... ************ ** *******

498. spacer 2.31|4139359|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP052865 (Burkholderia glumae strain HN1 plasmid pBGHN1-1, complete sequence) position: , mismatch: 9, identity: 0.719

acccttgtccgcgtcgccctggtcggcgaggt	CRISPR spacer
cgcgcggaacgcgtcgcactggtcggcggggt	Protospacer
  * . *  ******** **********.***

499. spacer 2.31|4139359|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP032349 (Azospirillum brasilense strain MTCC4039 plasmid p3, complete sequence) position: , mismatch: 9, identity: 0.719

acccttgtccgcgtcgccctggtcggcgaggt	CRISPR spacer
ccggcggcgcgcgtcggcgtggtcggcgaggt	Protospacer
 *  . *. ******* * *************

500. spacer 2.31|4139359|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP047317 (Burkholderia glumae AU6208 plasmid pwszb, complete sequence) position: , mismatch: 9, identity: 0.719

acccttgtccgcgtcgccctggtcggcgaggt	CRISPR spacer
cgcgcggaacgcgtcgcactggtcggcggggt	Protospacer
  * . *  ******** **********.***

501. spacer 2.33|4139482|32|NC_009439|CRISPRCasFinder,CRT matches to MK016493 (Brevibacterium phage Cantare, complete genome) position: , mismatch: 9, identity: 0.719

gtgacgtacaccgaccggccaacgcgaagcgc	CRISPR spacer
gtgacgtacaccgaccgggaaaccggctacta	Protospacer
******************  ***  *  .*

502. spacer 2.37|4139726|32|NC_009439|CRISPRCasFinder,CRT matches to KT898134 (Aeromonas phage phiARM81mr, complete genome) position: , mismatch: 9, identity: 0.719

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
aaaaagcccggcacagggccgggcggacagtg	Protospacer
************ * *********   *   .

503. spacer 2.37|4139726|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP020399 (Burkholderia multivorans strain FDAARGOS_246 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
gacaagcccggcttcgcgccgggcttgtcgct	Protospacer
.* **********.** ********* .*

504. spacer 2.37|4139726|32|NC_009439|CRISPRCasFinder,CRT matches to NC_016634 (Thermus sp. CCB_US3_UF1 plasmid pTCCB09, complete sequence) position: , mismatch: 9, identity: 0.719

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
aggcatttcggcggcgggccgggctttcctgg	Protospacer
*.. * ..****  *****************.

505. spacer 2.40|4137652|32|NC_009439|PILER-CR matches to NZ_CP021653 (Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gcctcaaacgccgcccgctccgcatccatctt	CRISPR spacer
ctttcaaacgccgccagctccacatcctgcgg	Protospacer
 ..************ *****.*****  *

506. spacer 2.40|4137652|32|NC_009439|PILER-CR matches to NZ_CP021767 (Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gcctcaaacgccgcccgctccgcatccatctt	CRISPR spacer
ctttcaaacgccgccagctccacatcctgcgg	Protospacer
 ..************ *****.*****  *

507. spacer 2.40|4137652|32|NC_009439|PILER-CR matches to NZ_CP012688 (Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gcctcaaacgccgcccgctccgcatccatctt	CRISPR spacer
ctttcaaacgccgccagctccacatcctgcgg	Protospacer
 ..************ *****.*****  *

508. spacer 2.40|4137652|32|NC_009439|PILER-CR matches to CP047139 (Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gcctcaaacgccgcccgctccgcatccatctt	CRISPR spacer
ctttcaaacgccgccagctccacatcctgcgg	Protospacer
 ..************ *****.*****  *

509. spacer 2.40|4137652|32|NC_009439|PILER-CR matches to CP047137 (Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gcctcaaacgccgcccgctccgcatccatctt	CRISPR spacer
ctttcaaacgccgccagctccacatcctgcgg	Protospacer
 ..************ *****.*****  *

510. spacer 2.42|4137774|32|NC_009439|PILER-CR matches to KC465901 (Pelagibacter phage HTVC019P, complete genome) position: , mismatch: 9, identity: 0.719

atcgttcacagcaacagcaggttcggttgcca	CRISPR spacer
tctttcttcatcaacagtaggttcggttgcca	Protospacer
 .. *.. ** ******.**************

511. spacer 2.47|4138081|32|NC_009439|PILER-CR matches to MN586060 (Mycobacterium phage PetterN, complete genome) position: , mismatch: 9, identity: 0.719

agcggtgacggctacccgaccgtggtggtgga	CRISPR spacer
tgcggtggcggctacccgaccatgatcgactt	Protospacer
 ******.*************.**.* *

512. spacer 2.49|4138203|32|NC_009439|PILER-CR matches to NZ_LR536452 (Methylocella tundrae isolate MTUNDRAET4 annotated genome plasmid 3) position: , mismatch: 9, identity: 0.719

ccgcgctctgagcgccgcgagctcttcgccaa	CRISPR spacer
ggccacgacgatcgccgcgagcgcttcgccaa	Protospacer
   *.*  .** ********** *********

513. spacer 2.49|4138203|32|NC_009439|PILER-CR matches to MG707188 (Pseudomonas phage TC7, partial genome) position: , mismatch: 9, identity: 0.719

ccgcgctctgagcgccgcgagctcttcgccaa	CRISPR spacer
ccgcgctctgagcgccgctcgctgattcaaga	Protospacer
******************  ***  *.   .*

514. spacer 2.49|4138203|32|NC_009439|PILER-CR matches to NC_030931 (Pseudomonas phage phi2, complete genome) position: , mismatch: 9, identity: 0.719

ccgcgctctgagcgccgcgagctcttcgccaa	CRISPR spacer
ccgcgctctgagcgccgctcgctgattcaaga	Protospacer
******************  ***  *.   .*

515. spacer 2.51|4138325|32|NC_009439|PILER-CR matches to MT939492 (Xanthomonas phage Xoo-sp14, complete genome) position: , mismatch: 9, identity: 0.719

tcccagt-----cctggcggttgatccactcgacggc	CRISPR spacer
-----gtgttcgcctggcggttgatcgcctcgacgta	Protospacer
     **     **************  *******

516. spacer 2.52|4138386|32|NC_009439|PILER-CR matches to LT599585 (Pseudomonas veronii 1YdBTEX2 genome assembly, plasmid: PVE_plasmid) position: , mismatch: 9, identity: 0.719

gctgatttcccgccaaaggaatgtggttgcaa	CRISPR spacer
gtaggcatcccgagaaaggaatgtggttgcgc	Protospacer
*. *.. *****  ****************.

517. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NZ_CP032346 (Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence) position: , mismatch: 9, identity: 0.719

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
gccttcaccgcctcgatgagggcgaggccgtg	Protospacer
******.*********** ****   * .*

518. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NZ_CP017148 (Bosea vaviloviae strain Vaf18 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
gcgacgaaggcctcgatgctggccttggtgac	Protospacer
**  . .  ********** *******.****

519. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NC_019849 (Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence) position: , mismatch: 9, identity: 0.719

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgcccgccgcctcgaagccggccttgaatgc	Protospacer
 * ..*********** ** ********  .*

520. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NC_003078 (Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence) position: , mismatch: 9, identity: 0.719

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgcccgccgcctcgaagccggccttgaatgc	Protospacer
 * ..*********** ** ********  .*

521. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NZ_CP019586 (Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence) position: , mismatch: 9, identity: 0.719

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccacccgccgcctcgaagccggccttgaatgc	Protospacer
 * ..*********** ** ********  .*

522. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NC_017326 (Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence) position: , mismatch: 9, identity: 0.719

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgcccgccgcctcgaagccggccttgaatgc	Protospacer
 * ..*********** ** ********  .*

523. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NZ_CP021799 (Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.719

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgcccgccgcctcgaagccggccttgaatgc	Protospacer
 * ..*********** ** ********  .*

524. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NC_017323 (Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence) position: , mismatch: 9, identity: 0.719

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgcccgccgcctcgaagccggccttgaatgc	Protospacer
 * ..*********** ** ********  .*

525. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NZ_CP009146 (Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence) position: , mismatch: 9, identity: 0.719

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgcccgccgcctcgaagccggccttgaatgc	Protospacer
 * ..*********** ** ********  .*

526. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NC_018701 (Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence) position: , mismatch: 9, identity: 0.719

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgcccgccgcctcgaagccggccttgaatgc	Protospacer
 * ..*********** ** ********  .*

527. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NZ_CP023000 (Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-B, complete sequence) position: , mismatch: 9, identity: 0.719

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgaatgccgcctcgatcggggccttgatcgc	Protospacer
 *   .***********  ********** .*

528. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NZ_CP021828 (Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.719

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgcccgccgcctcgaagccggccttgaatgc	Protospacer
 * ..*********** ** ********  .*

529. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NZ_CP021802 (Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.719

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgcccgccgcctcgaagccggccttgaatgc	Protospacer
 * ..*********** ** ********  .*

530. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NZ_CP032342 (Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence) position: , mismatch: 9, identity: 0.719

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
cccttcgccgccgcgttgcgggcccgcaggta	Protospacer
 *********** ** ********.  * *

531. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NZ_CP021820 (Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.719

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgcccgccgcctcgaagccggccttgaatgc	Protospacer
 * ..*********** ** ********  .*

532. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NZ_CP021831 (Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.719

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgcccgccgcctcgaagccggccttgaatgc	Protospacer
 * ..*********** ** ********  .*

533. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NZ_CP021823 (Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.719

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgcccgccgcctcgaagccggccttgaatgc	Protospacer
 * ..*********** ** ********  .*

534. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NZ_CP021814 (Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.719

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgcccgccgcctcgaagccggccttgaatgc	Protospacer
 * ..*********** ** ********  .*

535. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NZ_CP021795 (Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.719

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgcccgccgcctcgaagccggccttgaatgc	Protospacer
 * ..*********** ** ********  .*

536. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NZ_CP021810 (Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.719

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgcccgccgcctcgaagccggccttgaatgc	Protospacer
 * ..*********** ** ********  .*

537. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NZ_CP021806 (Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.719

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgcccgccgcctcgaagccggccttgaatgc	Protospacer
 * ..*********** ** ********  .*

538. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NZ_CP021218 (Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence) position: , mismatch: 9, identity: 0.719

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgcccgccgcctcgaagccggccttgaatgc	Protospacer
 * ..*********** ** ********  .*

539. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NZ_CP026527 (Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence) position: , mismatch: 9, identity: 0.719

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgcccgccgcctcgaagccggccttgaatgc	Protospacer
 * ..*********** ** ********  .*

540. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NZ_CP033321 (Azospirillum brasilense strain Cd plasmid p3, complete sequence) position: , mismatch: 9, identity: 0.719

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
cccttcgccgccgcgttgcgggcccgcaggta	Protospacer
 *********** ** ********.  * *

541. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NZ_CP033315 (Azospirillum brasilense strain Sp 7 plasmid p3, complete sequence) position: , mismatch: 9, identity: 0.719

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
cccttcgccgccgcgttgcgggcccgcaggta	Protospacer
 *********** ** ********.  * *

542. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NZ_CP019484 (Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence) position: , mismatch: 9, identity: 0.719

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgcccgccgcctcgaagccggccttgaatgc	Protospacer
 * ..*********** ** ********  .*

543. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NZ_CP019487 (Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence) position: , mismatch: 9, identity: 0.719

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgcccgccgcctcgaagccggccttgaatgc	Protospacer
 * ..*********** ** ********  .*

544. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NC_020560 (Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence) position: , mismatch: 9, identity: 0.719

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgcccgccgcctcgaagccggccttgaatgc	Protospacer
 * ..*********** ** ********  .*

545. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to NZ_CP022775 (Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
tggatgctgaccgacgacgacggcgaccagcg	Protospacer
  *.************* **** ****    *

546. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to NZ_CP015585 (Roseomonas gilardii strain U14-5 plasmid 1, complete sequence) position: , mismatch: 9, identity: 0.719

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
atcgtgctgaccgacgagggcgccgagttcct	Protospacer
.* **************.*.******  .*

547. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to NC_013859 (Azospirillum sp. B510 plasmid pAB510e, complete sequence) position: , mismatch: 9, identity: 0.719

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
gacgtgctgaccgacgatgtcgccgatctcgc	Protospacer
*  ************** * ******. .*.

548. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to NZ_CP032340 (Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence) position: , mismatch: 9, identity: 0.719

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
gacgtgctgaccgacgacgtcgccgatctcgc	Protospacer
*  ************** * ******. .*.

549. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to NZ_CP022764 (Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
tggatgctgaccgacgacgacggcgaccagcg	Protospacer
  *.************* **** ****    *

550. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to NZ_CP012915 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence) position: , mismatch: 9, identity: 0.719

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
gacgtgctgaccgacgacgtcgccgatctcgc	Protospacer
*  ************** * ******. .*.

551. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to NZ_CP022797 (Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
tggatgctgaccgacgacgacggcgaccagcg	Protospacer
  *.************* **** ****    *

552. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to NZ_CP022758 (Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
tggatgctgaccgacgacgacggcgaccagcg	Protospacer
  *.************* **** ****    *

553. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to KX765864 (Salmonella phage ST-374, complete genome) position: , mismatch: 9, identity: 0.719

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
ggaacgctgaacgacgaagacgacgacgacga	Protospacer
* ...***** *********** ***** *..

554. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to KX765862 (Salmonella phage ST-101, complete genome) position: , mismatch: 9, identity: 0.719

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
ggaacgctgaacgacgaagacgacgacgacga	Protospacer
* ...***** *********** ***** *..

555. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to AB916497 (Ralstonia phage RS138 DNA, complete genome) position: , mismatch: 9, identity: 0.719

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
tggatgctgaccgacgacgacggcgaccagcg	Protospacer
  *.************* **** ****    *

556. spacer 2.57|4138691|32|NC_009439|PILER-CR matches to NZ_CP013072 (Sphingobium indicum B90A plasmid pSRL2, complete sequence) position: , mismatch: 9, identity: 0.719

ttgcagcccgccagccgcagcttcgggagggc	CRISPR spacer
atgccgcccgccaggcgcagcttcttgtcgaa	Protospacer
 *** ********* *********  *  *.

557. spacer 2.57|4138691|32|NC_009439|PILER-CR matches to NC_008010 (Deinococcus geothermalis DSM 11300 plasmid pDGEO01, complete sequence) position: , mismatch: 9, identity: 0.719

ttgcagcccgccagccgcagcttcgggagggc	CRISPR spacer
ctgcacccggccagccgcagcttcagccgctg	Protospacer
.**** ** ***************.*  *

558. spacer 2.60|4138875|32|NC_009439|PILER-CR matches to NZ_CP020504 (Serratia marcescens strain 95 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.719

ttgctttcattggtgctgcctctttcggttga	CRISPR spacer
ttggtttcatgggtgctgcctctgctgctgct	Protospacer
*** ****** ************ ..* *

559. spacer 2.60|4138875|32|NC_009439|PILER-CR matches to NZ_CP026402 (Escherichia coli strain ECONIH4 plasmid pECO-e618, complete sequence) position: , mismatch: 9, identity: 0.719

ttgctttcattggtgctgcctctttcggttga	CRISPR spacer
ttggtttcatgggtgctgcctctgctgctgct	Protospacer
*** ****** ************ ..* *

560. spacer 2.63|4139058|33|NC_009439|PILER-CR matches to NC_008826 (Methylibium petroleiphilum PM1 plasmid RPME01, complete sequence) position: , mismatch: 9, identity: 0.727

-----tttgtggacatggcggccgagctgtggagctgg	CRISPR spacer
agcagtcc-----catggcggccgagccgtggcgctgg	Protospacer
     *..     **************.**** *****

561. spacer 2.63|4139058|33|NC_009439|PILER-CR matches to NC_008826 (Methylibium petroleiphilum PM1 plasmid RPME01, complete sequence) position: , mismatch: 9, identity: 0.727

-----tttgtggacatggcggccgagctgtggagctgg	CRISPR spacer
agcagtcc-----catggcggccgagccgtggcgctgg	Protospacer
     *..     **************.**** *****

562. spacer 2.68|4139365|32|NC_009439|PILER-CR matches to NC_016624 (Azospirillum lipoferum 4B plasmid AZO_p5, complete sequence) position: , mismatch: 9, identity: 0.719

acccttgtccgcgtcgccctggtcggcgaggt	CRISPR spacer
atcgaccgtcgcctcgccctggtcggcgcggt	Protospacer
*.*  .  .*** *************** ***

563. spacer 2.68|4139365|32|NC_009439|PILER-CR matches to NZ_CP022369 (Azospirillum sp. TSH58 plasmid TSH58_p05, complete sequence) position: , mismatch: 9, identity: 0.719

acccttgtccgcgtcgccctggtcggcgaggt	CRISPR spacer
ccggcggcgcgcgtcggcgtggtcggcgaggt	Protospacer
 *  . *. ******* * *************

564. spacer 2.68|4139365|32|NC_009439|PILER-CR matches to NC_012725 (Burkholderia glumae BGR1 plasmid bglu_4p, complete sequence) position: , mismatch: 9, identity: 0.719

acccttgtccgcgtcgccctggtcggcgaggt	CRISPR spacer
cgcgcggaacgcgtcgcactggtcggcggggt	Protospacer
  * . *  ******** **********.***

565. spacer 2.68|4139365|32|NC_009439|PILER-CR matches to NC_012720 (Burkholderia glumae BGR1 plasmid bglu_3p, complete sequence) position: , mismatch: 9, identity: 0.719

acccttgtccgcgtcgccctggtcggcgaggt	CRISPR spacer
cgcgcggaacgcgtcgcactggtcggcggggt	Protospacer
  * . *  ******** **********.***

566. spacer 2.68|4139365|32|NC_009439|PILER-CR matches to NZ_CP007796 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p3, complete sequence) position: , mismatch: 9, identity: 0.719

acccttgtccgcgtcgccctggtcggcgaggt	CRISPR spacer
ccggcggcgcgcgtcggcgtggtcggcgaggt	Protospacer
 *  . *. ******* * *************

567. spacer 2.68|4139365|32|NC_009439|PILER-CR matches to NZ_CP035902 (Burkholderia glumae strain 257sh-1 plasmid plas1, complete sequence) position: , mismatch: 9, identity: 0.719

acccttgtccgcgtcgccctggtcggcgaggt	CRISPR spacer
cgcgcggaacgcgtcgcactggtcggcggggt	Protospacer
  * . *  ******** **********.***

568. spacer 2.68|4139365|32|NC_009439|PILER-CR matches to NC_023285 (Streptomyces sp. F8 plasmid pFRL5, complete sequence) position: , mismatch: 9, identity: 0.719

acccttgtccgcgtcgccctggtcggcgaggt	CRISPR spacer
caccacgtacgcgtcgcccgggtcggcgacca	Protospacer
  ** .** ********** *********

569. spacer 2.68|4139365|32|NC_009439|PILER-CR matches to NZ_CP029834 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed4, complete sequence) position: , mismatch: 9, identity: 0.719

acccttgtccgcgtcgccctggtcggcgaggt	CRISPR spacer
gtccaccgtcgcctcgccctggtcggcgcggt	Protospacer
..** .  .*** *************** ***

570. spacer 2.68|4139365|32|NC_009439|PILER-CR matches to NZ_CP038636 (Cupriavidus oxalaticus strain X32 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

acccttgtccgcgtcgccctggtcggcgaggt	CRISPR spacer
cacttcacacgcgtcgccctgctctgcgaggt	Protospacer
  *.*... ************ ** *******

571. spacer 2.68|4139365|32|NC_009439|PILER-CR matches to NZ_CP052865 (Burkholderia glumae strain HN1 plasmid pBGHN1-1, complete sequence) position: , mismatch: 9, identity: 0.719

acccttgtccgcgtcgccctggtcggcgaggt	CRISPR spacer
cgcgcggaacgcgtcgcactggtcggcggggt	Protospacer
  * . *  ******** **********.***

572. spacer 2.68|4139365|32|NC_009439|PILER-CR matches to NZ_CP032349 (Azospirillum brasilense strain MTCC4039 plasmid p3, complete sequence) position: , mismatch: 9, identity: 0.719

acccttgtccgcgtcgccctggtcggcgaggt	CRISPR spacer
ccggcggcgcgcgtcggcgtggtcggcgaggt	Protospacer
 *  . *. ******* * *************

573. spacer 2.68|4139365|32|NC_009439|PILER-CR matches to NZ_CP047317 (Burkholderia glumae AU6208 plasmid pwszb, complete sequence) position: , mismatch: 9, identity: 0.719

acccttgtccgcgtcgccctggtcggcgaggt	CRISPR spacer
cgcgcggaacgcgtcgcactggtcggcggggt	Protospacer
  * . *  ******** **********.***

574. spacer 2.70|4139488|32|NC_009439|PILER-CR matches to MK016493 (Brevibacterium phage Cantare, complete genome) position: , mismatch: 9, identity: 0.719

gtgacgtacaccgaccggccaacgcgaagcgc	CRISPR spacer
gtgacgtacaccgaccgggaaaccggctacta	Protospacer
******************  ***  *  .*

575. spacer 2.74|4139732|32|NC_009439|PILER-CR matches to KT898134 (Aeromonas phage phiARM81mr, complete genome) position: , mismatch: 9, identity: 0.719

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
aaaaagcccggcacagggccgggcggacagtg	Protospacer
************ * *********   *   .

576. spacer 2.74|4139732|32|NC_009439|PILER-CR matches to NZ_CP020399 (Burkholderia multivorans strain FDAARGOS_246 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
gacaagcccggcttcgcgccgggcttgtcgct	Protospacer
.* **********.** ********* .*

577. spacer 2.74|4139732|32|NC_009439|PILER-CR matches to NC_016634 (Thermus sp. CCB_US3_UF1 plasmid pTCCB09, complete sequence) position: , mismatch: 9, identity: 0.719

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
aggcatttcggcggcgggccgggctttcctgg	Protospacer
*.. * ..****  *****************.

578. spacer 3.1|4149186|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP006990 (Rhizobium sp. IE4771 plasmid pRetIE4771d, complete sequence) position: , mismatch: 9, identity: 0.719

atctattgcggcatgttcgccggtatcggctt	CRISPR spacer
tcccgccgcggcattttcgacggtatcggcat	Protospacer
 .*....******* **** ********** *

579. spacer 3.1|4149186|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP007798 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p5, complete sequence) position: , mismatch: 9, identity: 0.719

atctattgcggcatgttcgccggtatcggctt	CRISPR spacer
aattcgggcggcatgctcgccggtctcggcgg	Protospacer
* .*   ********.******** *****

580. spacer 3.1|4149186|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP021127 (Rhizobium sp. Kim5 plasmid pRetKim5c, complete sequence) position: , mismatch: 9, identity: 0.719

atctattgcggcatgttcgccggtatcggctt	CRISPR spacer
tcccgccgcggcattttcgacggtatcggcat	Protospacer
 .*....******* **** ********** *

581. spacer 3.1|4149186|32|NC_009439|CRISPRCasFinder,CRT matches to CP007644 (Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803c, complete sequence) position: , mismatch: 9, identity: 0.719

atctattgcggcatgttcgccggtatcggctt	CRISPR spacer
tcccgccgcggcattttcgacggtatcggcat	Protospacer
 .*....******* **** ********** *

582. spacer 3.1|4149186|32|NC_009439|CRISPRCasFinder,CRT matches to MG592505 (Vibrio phage 1.134.O._10N.222.52.B8, partial genome) position: , mismatch: 9, identity: 0.719

atctattgcggcatgttcgccggtatcggctt	CRISPR spacer
gcctattgcggaatgttcgccagtacccattg	Protospacer
..********* *********.***.* ..*

583. spacer 3.1|4149186|32|NC_009439|CRISPRCasFinder,CRT matches to MG592457 (Vibrio phage 1.082.O._10N.261.49.E4, partial genome) position: , mismatch: 9, identity: 0.719

atctattgcggcatgttcgccggtatcggctt	CRISPR spacer
gcctattgcggaatgttcgccagtacccattg	Protospacer
..********* *********.***.* ..*

584. spacer 3.1|4149186|32|NC_009439|CRISPRCasFinder,CRT matches to MG592543 (Vibrio phage 1.176.O._10N.261.55.F5, partial genome) position: , mismatch: 9, identity: 0.719

atctattgcggcatgttcgccggtatcggctt	CRISPR spacer
gcctattgcggaatgttcgccagtacccattg	Protospacer
..********* *********.***.* ..*

585. spacer 3.4|4149370|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 9, identity: 0.719

tttatccaggcggcgggggcggtgggcagcac	CRISPR spacer
gcggaccgggcgccgggggcggtgggcagggc	Protospacer
 . . **.**** **************** .*

586. spacer 3.4|4149370|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP022363 (Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence) position: , mismatch: 9, identity: 0.719

tttatcca---ggcggcgggggcggtgggcagcac	CRISPR spacer
---gggcgggcggcggcgggggcggtgcgcggcac	Protospacer
   .  *.   **************** **.****

587. spacer 3.4|4149370|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP029833 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.719

tttatccaggcggcgggggcggtgggcagcac	CRISPR spacer
ccgtagcaggcggcggcggcggtgcgcagcgc	Protospacer
..    ********** ******* *****.*

588. spacer 3.4|4149370|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to KX557283 (Gordonia phage Remus, complete genome) position: , mismatch: 9, identity: 0.719

tttatccaggcggcgggggcggtgggcagcac	CRISPR spacer
agcccgcaggcggcggtggcggtggccagcgc	Protospacer
  . . ********** ******** ****.*

589. spacer 3.4|4149370|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NC_041886 (Gordonia phage Strosahl, complete genome) position: , mismatch: 9, identity: 0.719

tttatccaggcggcgggggcggtgggcagcac	CRISPR spacer
agcccgcaggcggcggtggcggtggccagcgc	Protospacer
  . . ********** ******** ****.*

590. spacer 3.4|4149370|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to LR606151 (Rhizobium sp. Q54 genome assembly, plasmid: 8) position: , mismatch: 9, identity: 0.719

tttatccaggcggcgggggcggtgggcagcac	CRISPR spacer
gtgcgcagggcggcccgggcggtgggcagcag	Protospacer
 *   * .******  ***************

591. spacer 3.4|4149370|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP020372 (Candidatus Thiodictyon syntrophicum strain Cad16T plasmid pTs485, complete sequence) position: , mismatch: 9, identity: 0.719

tttatccaggcggcgggggcggtgggcagcac	CRISPR spacer
ggcgacctcgcggcgggggaggtgggcggcac	Protospacer
  .. **  ********** *******.****

592. spacer 3.4|4149370|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP015040 (Rhodovulum sp. P5 plasmid pRGUI01, complete sequence) position: , mismatch: 9, identity: 0.719

tttatccaggcggcgggggcggtgggcagcac	CRISPR spacer
tgggacgccgcggcgcgggcggcgggcagcac	Protospacer
*  . *   ****** ******.*********

593. spacer 3.4|4149370|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP034186 (Deinococcus sp. S14-83 strain S14-83T plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

tttatccaggcggcgggggcggtgggcagcac	CRISPR spacer
gcttgccgggcggcgcgggcggtgggcaagcc	Protospacer
 .*  **.******* ************.  *

594. spacer 3.4|4149370|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to MH651183 (Mycobacterium phage Nivrat, complete genome) position: , mismatch: 9, identity: 0.719

tttatccaggcggcgggggcggtgggcagcac	CRISPR spacer
tgggtgtcggcggcggcggcggcgggcagcag	Protospacer
*  .* . ******** *****.********

595. spacer 3.4|4149370|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to MH834617 (Mycobacterium phage Lizziana, complete genome) position: , mismatch: 9, identity: 0.719

tttatccaggcggcgggggcggtgggcagcac	CRISPR spacer
tgggtgtcggcggcggcggcggcgggcagcag	Protospacer
*  .* . ******** *****.********

596. spacer 3.4|4149370|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to MH399771 (Mycobacterium phage ByChance, complete genome) position: , mismatch: 9, identity: 0.719

tttatccaggcggcgggggcggtgggcagcac	CRISPR spacer
tgggtgtcggcggcggcggcggcgggcagcag	Protospacer
*  .* . ******** *****.********

597. spacer 3.5|4149431|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP041223 (Porphyrobacter sp. YT40 plasmid pYT40, complete sequence) position: , mismatch: 9, identity: 0.719

gcgccggcgccgcagagcctggccggccgaga	CRISPR spacer
ccgcaggcgccgcagggcctggccgacgcgat	Protospacer
 *** **********.*********.*  ..

598. spacer 3.5|4149431|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NC_018022 (Mycolicibacterium chubuense NBB4 plasmid pMYCCH.01, complete sequence) position: , mismatch: 9, identity: 0.719

gcgccggcgccgcagagcctggccggccgaga	CRISPR spacer
ccgccggcgccgcagagcgcggccaccgcgta	Protospacer
 ***************** .****. *  . *

599. spacer 3.5|4149431|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP010861 (Marinovum algicola DG 898 plasmid pMaD6, complete sequence) position: , mismatch: 9, identity: 0.719

gcgccggcgccgcagagcctggccggccgaga	CRISPR spacer
agagcgcggccgcagagccgggcctgccgagg	Protospacer
. . **  *********** **** ******.

600. spacer 3.7|4149553|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP019603 (Croceicoccus marinus strain E4A9 plasmid pCME4A9I, complete sequence) position: , mismatch: 9, identity: 0.719

atcgtcggcggcgctgacgtgtacgtgtcgga	CRISPR spacer
ggcaacggcggcgcagacgtgttcgtgttcca	Protospacer
. *. ********* ******* *****.  *

601. spacer 3.11|4149797|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to KT898134 (Aeromonas phage phiARM81mr, complete genome) position: , mismatch: 9, identity: 0.719

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
aaaaagcccggcacagggccgggcggacagtg	Protospacer
************ * *********   *   .

602. spacer 3.11|4149797|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP020399 (Burkholderia multivorans strain FDAARGOS_246 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
gacaagcccggcttcgcgccgggcttgtcgct	Protospacer
.* **********.** ********* .*

603. spacer 3.11|4149797|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NC_016634 (Thermus sp. CCB_US3_UF1 plasmid pTCCB09, complete sequence) position: , mismatch: 9, identity: 0.719

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
aggcatttcggcggcgggccgggctttcctgg	Protospacer
*.. * ..****  *****************.

604. spacer 3.12|4149858|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to KT898134 (Aeromonas phage phiARM81mr, complete genome) position: , mismatch: 9, identity: 0.719

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
aaaaagcccggcacagggccgggcggacagtg	Protospacer
************ * *********   *   .

605. spacer 3.12|4149858|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP020399 (Burkholderia multivorans strain FDAARGOS_246 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
gacaagcccggcttcgcgccgggcttgtcgct	Protospacer
.* **********.** ********* .*

606. spacer 3.12|4149858|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NC_016634 (Thermus sp. CCB_US3_UF1 plasmid pTCCB09, complete sequence) position: , mismatch: 9, identity: 0.719

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
aggcatttcggcggcgggccgggctttcctgg	Protospacer
*.. * ..****  *****************.

607. spacer 3.13|4149919|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP024424 (Paracoccus yeei strain TT13 plasmid pTT13-2, complete sequence) position: , mismatch: 9, identity: 0.719

cgcggcggcgccgacgtcatgcacggccggcc	CRISPR spacer
tatcgcggcgccgacgacatgcacggcgcggg	Protospacer
... ************ **********  *

608. spacer 3.13|4149919|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP020440 (Paracoccus yeei strain FDAARGOS_252 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

cgcggcggcgccgacgtcatgcacggccggcc	CRISPR spacer
tatcgcggcgccgacgacatgcacggcgcggg	Protospacer
... ************ **********  *

609. spacer 3.13|4149919|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP044082 (Paracoccus yeei strain FDAARGOS_643 plasmid unnamed4, complete sequence) position: , mismatch: 9, identity: 0.719

cgcggcggcgccgacgtcatgcacggccggcc	CRISPR spacer
tatcgcggcgccgacgacatgcacggcgcggg	Protospacer
... ************ **********  *

610. spacer 3.13|4149919|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 9, identity: 0.719

cgcg-gcggcgccgacgtcatgcacggccggcc	CRISPR spacer
-gtgcgcggcgccaacgtcatgcgcggctactg	Protospacer
 *.* ********.*********.****.. .

611. spacer 3.13|4149919|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to CP007642 (Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803a, complete sequence) position: , mismatch: 9, identity: 0.719

cgcggcggcgccgacgtcatgcacgg--ccggcc	CRISPR spacer
tatcgcggcgccgacgacatgcatggcactgg--	Protospacer
... ************ ******.**  *.**

612. spacer 3.15|4150041|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP015738 (Shinella sp. HZN7 plasmid pShin-02, complete sequence) position: , mismatch: 9, identity: 0.719

tcctcggtgagggcggcgatcacatcggctgc	CRISPR spacer
cgggcatcgagcgcggcgatcacatcggccgc	Protospacer
.   *. .*** *****************.**

613. spacer 2.1|4137525|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP015882 (Ensifer adhaerens strain Casida A plasmid pCasidaAB, complete sequence) position: , mismatch: 10, identity: 0.688

gggtagccgttgatcttggtccagcgcgggtg	CRISPR spacer
accttgccgttgctcttgttccagcgcgcaaa	Protospacer
.  * ******* ***** ********* . .

614. spacer 2.1|4137525|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP030264 (Ensifer adhaerens strain Corn53 plasmid AB, complete sequence) position: , mismatch: 10, identity: 0.688

gggtagccgttgatcttggtccagcgcgggtg	CRISPR spacer
accttgccgttgctcttgttccagcgcgcaaa	Protospacer
.  * ******* ***** ********* . .

615. spacer 2.3|4137646|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP025613 (Niveispirillum cyanobacteriorum strain TH16 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.688

gcctcaaacgccgcccgctccgcatccatctt	CRISPR spacer
ttctcaaacgccgcctgcgccgcatcggcagc	Protospacer
 .*************.** ******* ..  .

616. spacer 2.5|4137768|32|NC_009439|CRISPRCasFinder,CRT matches to MK504443 (Lactobacillus phage 521B, complete genome) position: , mismatch: 10, identity: 0.688

atcgttcacagcaacagcaggttcggttgcca	CRISPR spacer
atcgtttacagcaacagaaggttctaactttc	Protospacer
******.********** ****** . . ..

617. spacer 2.7|4137890|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP045095 (Streptomyces sp. GY16 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.688

aggtgtacggtcagcgcgtgctgcggcggtcg	CRISPR spacer
gcggcgacggtcagcgcgtgcagccgcggggc	Protospacer
. *   *************** ** ****

618. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP039697 (Novosphingobium sp. ABRDHK2 plasmid pABRDHK22, complete sequence) position: , mismatch: 10, identity: 0.688

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
gatgattccgccacgatgcgggccttgctgct	Protospacer
* .  . ***** ************** ** .

619. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NC_015727 (Cupriavidus necator N-1 plasmid pBB1, complete sequence) position: , mismatch: 10, identity: 0.688

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ttggtcgccgcctcgatgccggcattgcccgc	Protospacer
 .  *************** *** *** . .*

620. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP044079 (Paracoccus yeei strain FDAARGOS_643 plasmid unnamed2, complete sequence) position: , mismatch: 10, identity: 0.688

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
gcctgcgccgcttcgatgcgggcgcgcgcatc	Protospacer
**** ******.*********** .  ... *

621. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP031079 (Paracoccus yeei strain CCUG 32053 plasmid pYEE1, complete sequence) position: , mismatch: 10, identity: 0.688

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
gcctgcgccgcttcgatgcgggcgcgcgcatc	Protospacer
**** ******.*********** .  ... *

622. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to KY555147 (Caulobacter phage Ccr34, complete genome) position: , mismatch: 10, identity: 0.688

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgccggccgccttgacgcgggccttgatcga	Protospacer
 * .. *******.**.************ .

623. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to KY555145 (Caulobacter phage Ccr29, complete genome) position: , mismatch: 10, identity: 0.688

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgccggccgccttgacgcgggccttgatcga	Protospacer
 * .. *******.**.************ .

624. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to KY555143 (Caulobacter phage Ccr2, complete genome) position: , mismatch: 10, identity: 0.688

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgccggccgccttgacgcgggccttgatcga	Protospacer
 * .. *******.**.************ .

625. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NC_019410 (Caulobacter phage CcrKarma, complete genome) position: , mismatch: 10, identity: 0.688

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgccggccgccttgacgcgggccttgatcga	Protospacer
 * .. *******.**.************ .

626. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to KY555146 (Caulobacter phage Ccr32, complete genome) position: , mismatch: 10, identity: 0.688

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgccggccgccttgacgcgggccttgatcga	Protospacer
 * .. *******.**.************ .

627. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NC_019407 (Caulobacter phage CcrMagneto, complete genome) position: , mismatch: 10, identity: 0.688

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgccggccgccttgacgcgggccttgatcga	Protospacer
 * .. *******.**.************ .

628. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to KY555144 (Caulobacter phage Ccr5, complete genome) position: , mismatch: 10, identity: 0.688

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgccggccgccttgacgcgggccttgatcga	Protospacer
 * .. *******.**.************ .

629. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to JX163858 (Caulobacter phage phiCbK, complete genome) position: , mismatch: 10, identity: 0.688

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgccggccgccttgacgcgggccttgatcga	Protospacer
 * .. *******.**.************ .

630. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to KY555142 (Caulobacter phage Ccr10, complete genome) position: , mismatch: 10, identity: 0.688

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgccggccgccttgacgcgggccttgatcga	Protospacer
 * .. *******.**.************ .

631. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NC_019411 (Caulobacter phage CcrSwift, complete genome) position: , mismatch: 10, identity: 0.688

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgccggccgccttgacgcgggccttgatcga	Protospacer
 * .. *******.**.************ .

632. spacer 2.18|4138563|32|NC_009439|CRISPRCasFinder,CRT matches to MN183283 (Arthrobacter phage BossLady, complete genome) position: , mismatch: 10, identity: 0.688

gcgctcgcgcaggtgacgcacaagcggggtga	CRISPR spacer
catctcgcgcagctggcgcacaagcgcgcgcg	Protospacer
   ********* **.********** *   .

633. spacer 2.18|4138563|32|NC_009439|CRISPRCasFinder,CRT matches to MF189176 (Arthrobacter phage Jordan, complete genome) position: , mismatch: 10, identity: 0.688

gcgctcgcgcaggtgacgcacaagcggggtga	CRISPR spacer
catctcgcgcagctggcgcacaagcgcgcgcg	Protospacer
   ********* **.********** *   .

634. spacer 2.18|4138563|32|NC_009439|CRISPRCasFinder,CRT matches to MF189178 (Arthrobacter phage Shade, complete genome) position: , mismatch: 10, identity: 0.688

gcgctcgcgcaggtgacgcacaagcggggtga	CRISPR spacer
catctcgcgcagctggcgcacaagcgcgcgcg	Protospacer
   ********* **.********** *   .

635. spacer 2.18|4138563|32|NC_009439|CRISPRCasFinder,CRT matches to KU160668 (Arthrobacter phage TaeYoung, complete genome) position: , mismatch: 10, identity: 0.688

gcgctcgcgcaggtgacgcacaagcggggtga	CRISPR spacer
catctcgcgcagctggcgcacaagcgcgcgcg	Protospacer
   ********* **.********** *   .

636. spacer 2.18|4138563|32|NC_009439|CRISPRCasFinder,CRT matches to MT889388 (Arthrobacter phage Pippa, complete genome) position: , mismatch: 10, identity: 0.688

gcgctcgcgcaggtgacgcacaagcggggtga	CRISPR spacer
catctcgcgcagctggcgcacaagcgcgcgcg	Protospacer
   ********* **.********** *   .

637. spacer 2.18|4138563|32|NC_009439|CRISPRCasFinder,CRT matches to MT114161 (Arthrobacter phage JKerns, complete genome) position: , mismatch: 10, identity: 0.688

gcgctcgcgcaggtgacgcacaagcggggtga	CRISPR spacer
catctcgcgcagctggcgcacaagcgcgcgcg	Protospacer
   ********* **.********** *   .

638. spacer 2.18|4138563|32|NC_009439|CRISPRCasFinder,CRT matches to NC_041933 (Arthrobacter phage Sonny, complete genome) position: , mismatch: 10, identity: 0.688

gcgctcgcgcaggtgacgcacaagcggggtga	CRISPR spacer
catctcgcgcagctggcgcacaagcgcgcgcg	Protospacer
   ********* **.********** *   .

639. spacer 2.18|4138563|32|NC_009439|CRISPRCasFinder,CRT matches to MK919479 (Arthrobacter phage Grekaycon, complete genome) position: , mismatch: 10, identity: 0.688

gcgctcgcgcaggtgacgcacaagcggggtga	CRISPR spacer
catctcgcgcagctggcgcacaagcgcgcgcg	Protospacer
   ********* **.********** *   .

640. spacer 2.18|4138563|32|NC_009439|CRISPRCasFinder,CRT matches to NC_049468 (Arthrobacter phage Zartrosa, complete genome) position: , mismatch: 10, identity: 0.688

gcgctcgcgcaggtgacgcacaagcggggtga	CRISPR spacer
catctcgcgcagctggcgcacaagcgcgcgcg	Protospacer
   ********* **.********** *   .

641. spacer 2.18|4138563|32|NC_009439|CRISPRCasFinder,CRT matches to KU160656 (Arthrobacter phage Martha, complete genome) position: , mismatch: 10, identity: 0.688

gcgctcgcgcaggtgacgcacaagcggggtga	CRISPR spacer
catctcgcgcagctggcgcacaagcgcgcgcg	Protospacer
   ********* **.********** *   .

642. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_AP014579 (Burkholderia sp. RPE67 plasmid p1, complete sequence) position: , mismatch: 10, identity: 0.688

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
atcactctgaacgacgaacacgccgacgcgcc	Protospacer
.* .. **** ******* **********

643. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to NC_016626 (Burkholderia sp. YI23 plasmid byi_1p, complete sequence) position: , mismatch: 10, identity: 0.688

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
atcactctgaacgacgaacacgccgacgcgcc	Protospacer
.* .. **** ******* **********

644. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP045385 (Ruegeria sp. THAF33 plasmid pTHAF33_a, complete sequence) position: , mismatch: 10, identity: 0.688

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
tcgaacatgagcgacgaagaggccgacgccgc	Protospacer
 .*.   *** ********* *********.

645. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to MF377441 (Arthrobacter phage Timinator, complete genome) position: , mismatch: 10, identity: 0.688

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
acgtgcctgaccgacgacgatgccgacgcgct	Protospacer
..*   *********** **.********

646. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to MT310895 (Arthrobacter phage StevieBAY, complete genome) position: , mismatch: 10, identity: 0.688

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
acgtgcctgaccgacgacgatgccgacgcgct	Protospacer
..*   *********** **.********

647. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to KC139667 (Salmonella phage FSL SP-099 hypothetical proteins, exonuclease RdgC, hypothetical proteins, putative DNA adenine methylase, hypothetical proteins, NinC protein, nucleoside phosphosulphate reductase, hypothetical proteins, lysis protein A, lysis protein B, hypothetical proteins, and tail fiber protein genes, complete cds; and hypothetical protein gene, partial cds) position: , mismatch: 10, identity: 0.688

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
ggaacgctgaacgacgaagacgacgacgaggt	Protospacer
* ...***** *********** *****  .

648. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to KP162168 (Paracoccus phage vB_PmaS-R3, complete genome) position: , mismatch: 10, identity: 0.688

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
gacaacatgaccgaagaagacgccgaagccgt	Protospacer
*  .   ******* *********** ***.

649. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to NC_021780 (Salmonella phage FSL SP-088, complete genome) position: , mismatch: 10, identity: 0.688

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
ggaacgctgaacgacgaagacgacgacgaggt	Protospacer
* ...***** *********** *****  .

650. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to KC139515 (Salmonella phage FSL SP-124, complete genome) position: , mismatch: 10, identity: 0.688

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
ggaacgctgaacgacgaagacgacgacgaggt	Protospacer
* ...***** *********** *****  .

651. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to NC_025442 (Salmonella phage Chi, complete genome) position: , mismatch: 10, identity: 0.688

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
ggaacgctgaacgacgaagacgacgacgaggt	Protospacer
* ...***** *********** *****  .

652. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to JN871591 (Salmonella phage SPN19, complete genome) position: , mismatch: 10, identity: 0.688

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
ggaacgctgaacgacgaagacgacgacgaggt	Protospacer
* ...***** *********** *****  .

653. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to MN871450 (UNVERIFIED: Serratia phage KpYy_1_41, complete genome) position: , mismatch: 10, identity: 0.688

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
ggaacgctgaacgacgaagacgacgacgaggt	Protospacer
* ...***** *********** *****  .

654. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to JX094499 (Enterobacteria phage Chi, complete genome) position: , mismatch: 10, identity: 0.688

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
ggaacgctgaacgacgaagacgacgacgaggt	Protospacer
* ...***** *********** *****  .

655. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to KU647629 (Arthrobacter phage BarretLemon, complete genome) position: , mismatch: 10, identity: 0.688

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
acgagcctgaccgacgacgatgccgacgcgct	Protospacer
..*.  *********** **.********

656. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to KX452700 (UNVERIFIED: Enterobacter phage KPN7 genomic sequence) position: , mismatch: 10, identity: 0.688

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
ggaacgctgaacgacgaagacgacgacgaggt	Protospacer
* ...***** *********** *****  .

657. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to KR296691 (Salmonella phage 37, complete genome) position: , mismatch: 10, identity: 0.688

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
ggaacgctgaacgacgaagacgacgacgaggt	Protospacer
* ...***** *********** *****  .

658. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to LR026998 (unidentified phage genome assembly, chromosome: 1) position: , mismatch: 10, identity: 0.688

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
ggaacgctgaacgacgaagacgacgacgaggt	Protospacer
* ...***** *********** *****  .

659. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to NC_031930 (Salmonella phage 118970_sal1, complete genome) position: , mismatch: 10, identity: 0.688

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
ggaacgctgaacgacgaagacgacgacgaggt	Protospacer
* ...***** *********** *****  .

660. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to MK286578 (Salmonella phage Season12, complete genome) position: , mismatch: 10, identity: 0.688

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
ggaacgctgaacgacgaagacgacgacgaggt	Protospacer
* ...***** *********** *****  .

661. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to NC_026608 (Paracoccus phage vB_PmaS_IMEP1, complete genome) position: , mismatch: 10, identity: 0.688

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
gacaacatgaccgaagaagacgccgaagccgt	Protospacer
*  .   ******* *********** ***.

662. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to KR296689 (Salmonella phage 35, complete genome) position: , mismatch: 10, identity: 0.688

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
ggaacgctgaacgacgaagacgacgacgaggt	Protospacer
* ...***** *********** *****  .

663. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to NC_048727 (Salmonella phage Siskin, complete genome) position: , mismatch: 10, identity: 0.688

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
ggaacgctgaacgacgaagacgacgacgaggt	Protospacer
* ...***** *********** *****  .

664. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to NC_048666 (Salmonella phage YSD1 strain YSD1_PHAGE genome assembly) position: , mismatch: 10, identity: 0.688

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
ggaacgctgaacgacgaagacgacgacgaggt	Protospacer
* ...***** *********** *****  .

665. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to KX452699 (UNVERIFIED: Salmonella phage KPN6 genomic sequence) position: , mismatch: 10, identity: 0.688

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
ggaacgctgaacgacgaagacgacgacgaggt	Protospacer
* ...***** *********** *****  .

666. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to KC139585 (Salmonella phage FSL SP-019 hypothetical protein gene, partial cds; hypothetical protein genes, complete cds; and hypothetical protein gene, partial cds) position: , mismatch: 10, identity: 0.688

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
ggaacgctgaacgacgaagacgacgacgaggt	Protospacer
* ...***** *********** *****  .

667. spacer 2.19|4138624|32|NC_009439|CRISPRCasFinder,CRT matches to MH825703 (Arthrobacter phage LeeroyJ, complete genome) position: , mismatch: 10, identity: 0.688

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
acgtgcctgaccgacgacgatgccgacgcgct	Protospacer
..*   *********** **.********

668. spacer 2.20|4138685|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP054609 (Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.688

ttgcagcccgccagccgcagcttcgggagggc	CRISPR spacer
ggttcgtccgccagcagcagcttcgggcggtg	Protospacer
   . *.******** *********** **

669. spacer 2.31|4139359|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP014519 (Sinomonas atrocyanea strain KCTC 3377 plasmid pSA01, complete sequence) position: , mismatch: 10, identity: 0.688

acccttgtccgcgtcgccctggtcggcgaggt	CRISPR spacer
gatgggttccgcgtcgccctcgtcgtcgagga	Protospacer
. .    ************* **** *****

670. spacer 2.31|4139359|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP016082 (Streptomyces sp. SAT1 plasmid unnamed2, complete sequence) position: , mismatch: 10, identity: 0.688

acccttgtccgcgtcgccctggtcggcgaggt	CRISPR spacer
ggcgcgttccgcgtcgccgtggtccgcgagcc	Protospacer
. * .  *********** ***** ***** .

671. spacer 2.31|4139359|32|NC_009439|CRISPRCasFinder,CRT matches to CP054927 (Streptomyces fulvissimus strain NA06532 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.688

acccttgtccgcgtcgccctggtcggcgaggt	CRISPR spacer
cacgacgtcggcctcgccctggtcggcgatcc	Protospacer
  *  .*** ** ****************  .

672. spacer 2.31|4139359|32|NC_009439|CRISPRCasFinder,CRT matches to NC_006910 (Micromonospora rosaria strain SCC2095 plasmid pMR2, complete sequence) position: , mismatch: 10, identity: 0.688

acccttgtccgcgtcgccctggtcggcgaggt	CRISPR spacer
gtagacgggcgcgtcgccctggtcgacggggt	Protospacer
..   .*  ****************.**.***

673. spacer 2.32|4139420|33|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP017941 (Phyllobacterium zundukense strain Tri-48 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.697

ctggggccgcgcatcgacaagatcgaggctcag	CRISPR spacer
gcgatgccgcgcatcgacgagttcgaggccacc	Protospacer
 .*. *************.** *******.

674. spacer 2.32|4139420|33|NC_009439|CRISPRCasFinder,CRT matches to NC_007766 (Rhizobium etli CFN 42 plasmid p42f, complete sequence) position: , mismatch: 10, identity: 0.697

ctggggccgcgcatcgacaagatcgaggctcag	CRISPR spacer
gcgatgccgcgcatcgacgagttcgaggccact	Protospacer
 .*. *************.** *******.

675. spacer 2.32|4139420|33|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP006990 (Rhizobium sp. IE4771 plasmid pRetIE4771d, complete sequence) position: , mismatch: 10, identity: 0.697

ctggggccgcgcatcgacaagatcgaggctcag	CRISPR spacer
gcgatgccgcgcatcgacgagttcgaggccact	Protospacer
 .*. *************.** *******.

676. spacer 2.32|4139420|33|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP020911 (Rhizobium etli strain NXC12 plasmid pRetNXC12e, complete sequence) position: , mismatch: 10, identity: 0.697

ctggggccgcgcatcgacaagatcgaggctcag	CRISPR spacer
gcgatgccgcgcatcgacgagttcgaggccact	Protospacer
 .*. *************.** *******.

677. spacer 2.32|4139420|33|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP054022 (Rhizobium sp. JKLM12A2 plasmid pPR12A201, complete sequence) position: , mismatch: 10, identity: 0.697

ctggggccgcgcatcgacaagatcgaggctcag	CRISPR spacer
gcgatgccgcgcatcgacgagttcgaggccacc	Protospacer
 .*. *************.** *******.

678. spacer 2.32|4139420|33|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP054032 (Rhizobium sp. JKLM13E plasmid pPR13E01, complete sequence) position: , mismatch: 10, identity: 0.697

ctggggccgcgcatcgacaagatcgaggctcag	CRISPR spacer
gcgatgccgcgcatcgacgagttcgaggccacc	Protospacer
 .*. *************.** *******.

679. spacer 2.32|4139420|33|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP050092 (Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b6, complete sequence) position: , mismatch: 10, identity: 0.697

ctggggccgcgcatcgacaagatcgaggctcag	CRISPR spacer
gcgatgccgcgcatcgacgagttcgaggccacc	Protospacer
 .*. *************.** *******.

680. spacer 2.32|4139420|33|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP050081 (Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b5, complete sequence) position: , mismatch: 10, identity: 0.697

ctggggccgcgcatcgacaagatcgaggctcag	CRISPR spacer
gcgatgccgcgcatcgacgagttcgaggccacc	Protospacer
 .*. *************.** *******.

681. spacer 2.32|4139420|33|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP049731 (Rhizobium leguminosarum strain A1 plasmid pRL12, complete sequence) position: , mismatch: 10, identity: 0.697

ctggggccgcgcatcgacaagatcgaggctcag	CRISPR spacer
gcgatgccgcgcatcgacgagttcgaggccacc	Protospacer
 .*. *************.** *******.

682. spacer 2.32|4139420|33|NC_009439|CRISPRCasFinder,CRT matches to NC_021911 (Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1f, complete sequence) position: , mismatch: 10, identity: 0.697

ctggggccgcgcatcgacaagatcgaggctcag	CRISPR spacer
gcgatgccgcgcatcgacgagttcgaggccact	Protospacer
 .*. *************.** *******.

683. spacer 2.32|4139420|33|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP053206 (Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1D, complete sequence) position: , mismatch: 10, identity: 0.697

ctggggccgcgcatcgacaagatcgaggctcag	CRISPR spacer
gcgatgccgcgcatcgacgagttcgaggccacc	Protospacer
 .*. *************.** *******.

684. spacer 2.37|4139726|32|NC_009439|CRISPRCasFinder,CRT matches to CP042641 (Escherichia coli strain NCYU-24-74 plasmid pNCYU-24-74-3, complete sequence) position: , mismatch: 10, identity: 0.688

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
gtgcagcccggctccttgccgggctttttttt	Protospacer
. . ***********  **********..*

685. spacer 2.37|4139726|32|NC_009439|CRISPRCasFinder,CRT matches to NC_008538 (Arthrobacter sp. FB24 plasmid 2, complete sequence) position: , mismatch: 10, identity: 0.688

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
cgaaagaccggatccgggccgggctgaacgac	Protospacer
 .**** **** *************   * .

686. spacer 2.37|4139726|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP018229 (Rhizobium leguminosarum strain Vaf-108 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.688

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
gcatggcgcggctccgcgccgggctttcgatg	Protospacer
. * .** ******** ***********   .

687. spacer 2.39|4137586|37|NC_009439|PILER-CR matches to NZ_CP026308 (Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.73

aacacggtcaggtcgtcgcggttcatccactgcgcga	CRISPR spacer
agcacgctgaggtcgtcgcggttcatcccggcgacca	Protospacer
*.**** * *******************     .* *

688. spacer 2.40|4137652|32|NC_009439|PILER-CR matches to NZ_CP025613 (Niveispirillum cyanobacteriorum strain TH16 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.688

gcctcaaacgccgcccgctccgcatccatctt	CRISPR spacer
ttctcaaacgccgcctgcgccgcatcggcagc	Protospacer
 .*************.** ******* ..  .

689. spacer 2.42|4137774|32|NC_009439|PILER-CR matches to MK504443 (Lactobacillus phage 521B, complete genome) position: , mismatch: 10, identity: 0.688

atcgttcacagcaacagcaggttcggttgcca	CRISPR spacer
atcgtttacagcaacagaaggttctaactttc	Protospacer
******.********** ****** . . ..

690. spacer 2.44|4137896|32|NC_009439|PILER-CR matches to NZ_CP045095 (Streptomyces sp. GY16 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.688

aggtgtacggtcagcgcgtgctgcggcggtcg	CRISPR spacer
gcggcgacggtcagcgcgtgcagccgcggggc	Protospacer
. *   *************** ** ****

691. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NZ_CP039697 (Novosphingobium sp. ABRDHK2 plasmid pABRDHK22, complete sequence) position: , mismatch: 10, identity: 0.688

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
gatgattccgccacgatgcgggccttgctgct	Protospacer
* .  . ***** ************** ** .

692. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NC_015727 (Cupriavidus necator N-1 plasmid pBB1, complete sequence) position: , mismatch: 10, identity: 0.688

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ttggtcgccgcctcgatgccggcattgcccgc	Protospacer
 .  *************** *** *** . .*

693. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NZ_CP044079 (Paracoccus yeei strain FDAARGOS_643 plasmid unnamed2, complete sequence) position: , mismatch: 10, identity: 0.688

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
gcctgcgccgcttcgatgcgggcgcgcgcatc	Protospacer
**** ******.*********** .  ... *

694. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NZ_CP031079 (Paracoccus yeei strain CCUG 32053 plasmid pYEE1, complete sequence) position: , mismatch: 10, identity: 0.688

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
gcctgcgccgcttcgatgcgggcgcgcgcatc	Protospacer
**** ******.*********** .  ... *

695. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to KY555147 (Caulobacter phage Ccr34, complete genome) position: , mismatch: 10, identity: 0.688

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgccggccgccttgacgcgggccttgatcga	Protospacer
 * .. *******.**.************ .

696. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to KY555145 (Caulobacter phage Ccr29, complete genome) position: , mismatch: 10, identity: 0.688

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgccggccgccttgacgcgggccttgatcga	Protospacer
 * .. *******.**.************ .

697. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to KY555143 (Caulobacter phage Ccr2, complete genome) position: , mismatch: 10, identity: 0.688

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgccggccgccttgacgcgggccttgatcga	Protospacer
 * .. *******.**.************ .

698. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NC_019410 (Caulobacter phage CcrKarma, complete genome) position: , mismatch: 10, identity: 0.688

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgccggccgccttgacgcgggccttgatcga	Protospacer
 * .. *******.**.************ .

699. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to KY555146 (Caulobacter phage Ccr32, complete genome) position: , mismatch: 10, identity: 0.688

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgccggccgccttgacgcgggccttgatcga	Protospacer
 * .. *******.**.************ .

700. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NC_019407 (Caulobacter phage CcrMagneto, complete genome) position: , mismatch: 10, identity: 0.688

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgccggccgccttgacgcgggccttgatcga	Protospacer
 * .. *******.**.************ .

701. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to KY555144 (Caulobacter phage Ccr5, complete genome) position: , mismatch: 10, identity: 0.688

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgccggccgccttgacgcgggccttgatcga	Protospacer
 * .. *******.**.************ .

702. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to JX163858 (Caulobacter phage phiCbK, complete genome) position: , mismatch: 10, identity: 0.688

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgccggccgccttgacgcgggccttgatcga	Protospacer
 * .. *******.**.************ .

703. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to KY555142 (Caulobacter phage Ccr10, complete genome) position: , mismatch: 10, identity: 0.688

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgccggccgccttgacgcgggccttgatcga	Protospacer
 * .. *******.**.************ .

704. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NC_019411 (Caulobacter phage CcrSwift, complete genome) position: , mismatch: 10, identity: 0.688

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
ccgccggccgccttgacgcgggccttgatcga	Protospacer
 * .. *******.**.************ .

705. spacer 2.55|4138569|32|NC_009439|PILER-CR matches to MN183283 (Arthrobacter phage BossLady, complete genome) position: , mismatch: 10, identity: 0.688

gcgctcgcgcaggtgacgcacaagcggggtga	CRISPR spacer
catctcgcgcagctggcgcacaagcgcgcgcg	Protospacer
   ********* **.********** *   .

706. spacer 2.55|4138569|32|NC_009439|PILER-CR matches to MF189176 (Arthrobacter phage Jordan, complete genome) position: , mismatch: 10, identity: 0.688

gcgctcgcgcaggtgacgcacaagcggggtga	CRISPR spacer
catctcgcgcagctggcgcacaagcgcgcgcg	Protospacer
   ********* **.********** *   .

707. spacer 2.55|4138569|32|NC_009439|PILER-CR matches to MF189178 (Arthrobacter phage Shade, complete genome) position: , mismatch: 10, identity: 0.688

gcgctcgcgcaggtgacgcacaagcggggtga	CRISPR spacer
catctcgcgcagctggcgcacaagcgcgcgcg	Protospacer
   ********* **.********** *   .

708. spacer 2.55|4138569|32|NC_009439|PILER-CR matches to KU160668 (Arthrobacter phage TaeYoung, complete genome) position: , mismatch: 10, identity: 0.688

gcgctcgcgcaggtgacgcacaagcggggtga	CRISPR spacer
catctcgcgcagctggcgcacaagcgcgcgcg	Protospacer
   ********* **.********** *   .

709. spacer 2.55|4138569|32|NC_009439|PILER-CR matches to MT889388 (Arthrobacter phage Pippa, complete genome) position: , mismatch: 10, identity: 0.688

gcgctcgcgcaggtgacgcacaagcggggtga	CRISPR spacer
catctcgcgcagctggcgcacaagcgcgcgcg	Protospacer
   ********* **.********** *   .

710. spacer 2.55|4138569|32|NC_009439|PILER-CR matches to MT114161 (Arthrobacter phage JKerns, complete genome) position: , mismatch: 10, identity: 0.688

gcgctcgcgcaggtgacgcacaagcggggtga	CRISPR spacer
catctcgcgcagctggcgcacaagcgcgcgcg	Protospacer
   ********* **.********** *   .

711. spacer 2.55|4138569|32|NC_009439|PILER-CR matches to NC_041933 (Arthrobacter phage Sonny, complete genome) position: , mismatch: 10, identity: 0.688

gcgctcgcgcaggtgacgcacaagcggggtga	CRISPR spacer
catctcgcgcagctggcgcacaagcgcgcgcg	Protospacer
   ********* **.********** *   .

712. spacer 2.55|4138569|32|NC_009439|PILER-CR matches to MK919479 (Arthrobacter phage Grekaycon, complete genome) position: , mismatch: 10, identity: 0.688

gcgctcgcgcaggtgacgcacaagcggggtga	CRISPR spacer
catctcgcgcagctggcgcacaagcgcgcgcg	Protospacer
   ********* **.********** *   .

713. spacer 2.55|4138569|32|NC_009439|PILER-CR matches to NC_049468 (Arthrobacter phage Zartrosa, complete genome) position: , mismatch: 10, identity: 0.688

gcgctcgcgcaggtgacgcacaagcggggtga	CRISPR spacer
catctcgcgcagctggcgcacaagcgcgcgcg	Protospacer
   ********* **.********** *   .

714. spacer 2.55|4138569|32|NC_009439|PILER-CR matches to KU160656 (Arthrobacter phage Martha, complete genome) position: , mismatch: 10, identity: 0.688

gcgctcgcgcaggtgacgcacaagcggggtga	CRISPR spacer
catctcgcgcagctggcgcacaagcgcgcgcg	Protospacer
   ********* **.********** *   .

715. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to NZ_AP014579 (Burkholderia sp. RPE67 plasmid p1, complete sequence) position: , mismatch: 10, identity: 0.688

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
atcactctgaacgacgaacacgccgacgcgcc	Protospacer
.* .. **** ******* **********

716. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to NC_016626 (Burkholderia sp. YI23 plasmid byi_1p, complete sequence) position: , mismatch: 10, identity: 0.688

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
atcactctgaacgacgaacacgccgacgcgcc	Protospacer
.* .. **** ******* **********

717. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to NZ_CP045385 (Ruegeria sp. THAF33 plasmid pTHAF33_a, complete sequence) position: , mismatch: 10, identity: 0.688

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
tcgaacatgagcgacgaagaggccgacgccgc	Protospacer
 .*.   *** ********* *********.

718. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to MF377441 (Arthrobacter phage Timinator, complete genome) position: , mismatch: 10, identity: 0.688

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
acgtgcctgaccgacgacgatgccgacgcgct	Protospacer
..*   *********** **.********

719. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to MT310895 (Arthrobacter phage StevieBAY, complete genome) position: , mismatch: 10, identity: 0.688

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
acgtgcctgaccgacgacgatgccgacgcgct	Protospacer
..*   *********** **.********

720. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to KC139667 (Salmonella phage FSL SP-099 hypothetical proteins, exonuclease RdgC, hypothetical proteins, putative DNA adenine methylase, hypothetical proteins, NinC protein, nucleoside phosphosulphate reductase, hypothetical proteins, lysis protein A, lysis protein B, hypothetical proteins, and tail fiber protein genes, complete cds; and hypothetical protein gene, partial cds) position: , mismatch: 10, identity: 0.688

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
ggaacgctgaacgacgaagacgacgacgaggt	Protospacer
* ...***** *********** *****  .

721. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to KP162168 (Paracoccus phage vB_PmaS-R3, complete genome) position: , mismatch: 10, identity: 0.688

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
gacaacatgaccgaagaagacgccgaagccgt	Protospacer
*  .   ******* *********** ***.

722. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to NC_021780 (Salmonella phage FSL SP-088, complete genome) position: , mismatch: 10, identity: 0.688

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
ggaacgctgaacgacgaagacgacgacgaggt	Protospacer
* ...***** *********** *****  .

723. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to KC139515 (Salmonella phage FSL SP-124, complete genome) position: , mismatch: 10, identity: 0.688

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
ggaacgctgaacgacgaagacgacgacgaggt	Protospacer
* ...***** *********** *****  .

724. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to NC_025442 (Salmonella phage Chi, complete genome) position: , mismatch: 10, identity: 0.688

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
ggaacgctgaacgacgaagacgacgacgaggt	Protospacer
* ...***** *********** *****  .

725. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to JN871591 (Salmonella phage SPN19, complete genome) position: , mismatch: 10, identity: 0.688

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
ggaacgctgaacgacgaagacgacgacgaggt	Protospacer
* ...***** *********** *****  .

726. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to MN871450 (UNVERIFIED: Serratia phage KpYy_1_41, complete genome) position: , mismatch: 10, identity: 0.688

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
ggaacgctgaacgacgaagacgacgacgaggt	Protospacer
* ...***** *********** *****  .

727. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to JX094499 (Enterobacteria phage Chi, complete genome) position: , mismatch: 10, identity: 0.688

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
ggaacgctgaacgacgaagacgacgacgaggt	Protospacer
* ...***** *********** *****  .

728. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to KU647629 (Arthrobacter phage BarretLemon, complete genome) position: , mismatch: 10, identity: 0.688

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
acgagcctgaccgacgacgatgccgacgcgct	Protospacer
..*.  *********** **.********

729. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to KX452700 (UNVERIFIED: Enterobacter phage KPN7 genomic sequence) position: , mismatch: 10, identity: 0.688

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
ggaacgctgaacgacgaagacgacgacgaggt	Protospacer
* ...***** *********** *****  .

730. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to KR296691 (Salmonella phage 37, complete genome) position: , mismatch: 10, identity: 0.688

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
ggaacgctgaacgacgaagacgacgacgaggt	Protospacer
* ...***** *********** *****  .

731. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to LR026998 (unidentified phage genome assembly, chromosome: 1) position: , mismatch: 10, identity: 0.688

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
ggaacgctgaacgacgaagacgacgacgaggt	Protospacer
* ...***** *********** *****  .

732. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to NC_031930 (Salmonella phage 118970_sal1, complete genome) position: , mismatch: 10, identity: 0.688

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
ggaacgctgaacgacgaagacgacgacgaggt	Protospacer
* ...***** *********** *****  .

733. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to MK286578 (Salmonella phage Season12, complete genome) position: , mismatch: 10, identity: 0.688

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
ggaacgctgaacgacgaagacgacgacgaggt	Protospacer
* ...***** *********** *****  .

734. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to NC_026608 (Paracoccus phage vB_PmaS_IMEP1, complete genome) position: , mismatch: 10, identity: 0.688

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
gacaacatgaccgaagaagacgccgaagccgt	Protospacer
*  .   ******* *********** ***.

735. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to KR296689 (Salmonella phage 35, complete genome) position: , mismatch: 10, identity: 0.688

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
ggaacgctgaacgacgaagacgacgacgaggt	Protospacer
* ...***** *********** *****  .

736. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to NC_048727 (Salmonella phage Siskin, complete genome) position: , mismatch: 10, identity: 0.688

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
ggaacgctgaacgacgaagacgacgacgaggt	Protospacer
* ...***** *********** *****  .

737. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to NC_048666 (Salmonella phage YSD1 strain YSD1_PHAGE genome assembly) position: , mismatch: 10, identity: 0.688

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
ggaacgctgaacgacgaagacgacgacgaggt	Protospacer
* ...***** *********** *****  .

738. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to KX452699 (UNVERIFIED: Salmonella phage KPN6 genomic sequence) position: , mismatch: 10, identity: 0.688

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
ggaacgctgaacgacgaagacgacgacgaggt	Protospacer
* ...***** *********** *****  .

739. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to KC139585 (Salmonella phage FSL SP-019 hypothetical protein gene, partial cds; hypothetical protein genes, complete cds; and hypothetical protein gene, partial cds) position: , mismatch: 10, identity: 0.688

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
ggaacgctgaacgacgaagacgacgacgaggt	Protospacer
* ...***** *********** *****  .

740. spacer 2.56|4138630|32|NC_009439|PILER-CR matches to MH825703 (Arthrobacter phage LeeroyJ, complete genome) position: , mismatch: 10, identity: 0.688

gtggtgctgaccgacgaagacgccgacgccag	CRISPR spacer
acgtgcctgaccgacgacgatgccgacgcgct	Protospacer
..*   *********** **.********

741. spacer 2.57|4138691|32|NC_009439|PILER-CR matches to NZ_CP054609 (Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.688

ttgcagcccgccagccgcagcttcgggagggc	CRISPR spacer
ggttcgtccgccagcagcagcttcgggcggtg	Protospacer
   . *.******** *********** **

742. spacer 2.68|4139365|32|NC_009439|PILER-CR matches to NZ_CP014519 (Sinomonas atrocyanea strain KCTC 3377 plasmid pSA01, complete sequence) position: , mismatch: 10, identity: 0.688

acccttgtccgcgtcgccctggtcggcgaggt	CRISPR spacer
gatgggttccgcgtcgccctcgtcgtcgagga	Protospacer
. .    ************* **** *****

743. spacer 2.68|4139365|32|NC_009439|PILER-CR matches to NZ_CP016082 (Streptomyces sp. SAT1 plasmid unnamed2, complete sequence) position: , mismatch: 10, identity: 0.688

acccttgtccgcgtcgccctggtcggcgaggt	CRISPR spacer
ggcgcgttccgcgtcgccgtggtccgcgagcc	Protospacer
. * .  *********** ***** ***** .

744. spacer 2.68|4139365|32|NC_009439|PILER-CR matches to CP054927 (Streptomyces fulvissimus strain NA06532 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.688

acccttgtccgcgtcgccctggtcggcgaggt	CRISPR spacer
cacgacgtcggcctcgccctggtcggcgatcc	Protospacer
  *  .*** ** ****************  .

745. spacer 2.68|4139365|32|NC_009439|PILER-CR matches to NC_006910 (Micromonospora rosaria strain SCC2095 plasmid pMR2, complete sequence) position: , mismatch: 10, identity: 0.688

acccttgtccgcgtcgccctggtcggcgaggt	CRISPR spacer
gtagacgggcgcgtcgccctggtcgacggggt	Protospacer
..   .*  ****************.**.***

746. spacer 2.69|4139426|33|NC_009439|PILER-CR matches to NZ_CP017941 (Phyllobacterium zundukense strain Tri-48 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.697

ctggggccgcgcatcgacaagatcgaggctcag	CRISPR spacer
gcgatgccgcgcatcgacgagttcgaggccacc	Protospacer
 .*. *************.** *******.

747. spacer 2.69|4139426|33|NC_009439|PILER-CR matches to NC_007766 (Rhizobium etli CFN 42 plasmid p42f, complete sequence) position: , mismatch: 10, identity: 0.697

ctggggccgcgcatcgacaagatcgaggctcag	CRISPR spacer
gcgatgccgcgcatcgacgagttcgaggccact	Protospacer
 .*. *************.** *******.

748. spacer 2.69|4139426|33|NC_009439|PILER-CR matches to NZ_CP006990 (Rhizobium sp. IE4771 plasmid pRetIE4771d, complete sequence) position: , mismatch: 10, identity: 0.697

ctggggccgcgcatcgacaagatcgaggctcag	CRISPR spacer
gcgatgccgcgcatcgacgagttcgaggccact	Protospacer
 .*. *************.** *******.

749. spacer 2.69|4139426|33|NC_009439|PILER-CR matches to NZ_CP020911 (Rhizobium etli strain NXC12 plasmid pRetNXC12e, complete sequence) position: , mismatch: 10, identity: 0.697

ctggggccgcgcatcgacaagatcgaggctcag	CRISPR spacer
gcgatgccgcgcatcgacgagttcgaggccact	Protospacer
 .*. *************.** *******.

750. spacer 2.69|4139426|33|NC_009439|PILER-CR matches to NZ_CP054022 (Rhizobium sp. JKLM12A2 plasmid pPR12A201, complete sequence) position: , mismatch: 10, identity: 0.697

ctggggccgcgcatcgacaagatcgaggctcag	CRISPR spacer
gcgatgccgcgcatcgacgagttcgaggccacc	Protospacer
 .*. *************.** *******.

751. spacer 2.69|4139426|33|NC_009439|PILER-CR matches to NZ_CP054032 (Rhizobium sp. JKLM13E plasmid pPR13E01, complete sequence) position: , mismatch: 10, identity: 0.697

ctggggccgcgcatcgacaagatcgaggctcag	CRISPR spacer
gcgatgccgcgcatcgacgagttcgaggccacc	Protospacer
 .*. *************.** *******.

752. spacer 2.69|4139426|33|NC_009439|PILER-CR matches to NZ_CP050092 (Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b6, complete sequence) position: , mismatch: 10, identity: 0.697

ctggggccgcgcatcgacaagatcgaggctcag	CRISPR spacer
gcgatgccgcgcatcgacgagttcgaggccacc	Protospacer
 .*. *************.** *******.

753. spacer 2.69|4139426|33|NC_009439|PILER-CR matches to NZ_CP050081 (Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b5, complete sequence) position: , mismatch: 10, identity: 0.697

ctggggccgcgcatcgacaagatcgaggctcag	CRISPR spacer
gcgatgccgcgcatcgacgagttcgaggccacc	Protospacer
 .*. *************.** *******.

754. spacer 2.69|4139426|33|NC_009439|PILER-CR matches to NZ_CP049731 (Rhizobium leguminosarum strain A1 plasmid pRL12, complete sequence) position: , mismatch: 10, identity: 0.697

ctggggccgcgcatcgacaagatcgaggctcag	CRISPR spacer
gcgatgccgcgcatcgacgagttcgaggccacc	Protospacer
 .*. *************.** *******.

755. spacer 2.69|4139426|33|NC_009439|PILER-CR matches to NC_021911 (Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1f, complete sequence) position: , mismatch: 10, identity: 0.697

ctggggccgcgcatcgacaagatcgaggctcag	CRISPR spacer
gcgatgccgcgcatcgacgagttcgaggccact	Protospacer
 .*. *************.** *******.

756. spacer 2.69|4139426|33|NC_009439|PILER-CR matches to NZ_CP053206 (Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1D, complete sequence) position: , mismatch: 10, identity: 0.697

ctggggccgcgcatcgacaagatcgaggctcag	CRISPR spacer
gcgatgccgcgcatcgacgagttcgaggccacc	Protospacer
 .*. *************.** *******.

757. spacer 2.74|4139732|32|NC_009439|PILER-CR matches to CP042641 (Escherichia coli strain NCYU-24-74 plasmid pNCYU-24-74-3, complete sequence) position: , mismatch: 10, identity: 0.688

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
gtgcagcccggctccttgccgggctttttttt	Protospacer
. . ***********  **********..*

758. spacer 2.74|4139732|32|NC_009439|PILER-CR matches to NC_008538 (Arthrobacter sp. FB24 plasmid 2, complete sequence) position: , mismatch: 10, identity: 0.688

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
cgaaagaccggatccgggccgggctgaacgac	Protospacer
 .**** **** *************   * .

759. spacer 2.74|4139732|32|NC_009439|PILER-CR matches to NZ_CP018229 (Rhizobium leguminosarum strain Vaf-108 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.688

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
gcatggcgcggctccgcgccgggctttcgatg	Protospacer
. * .** ******** ***********   .

760. spacer 3.1|4149186|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP032327 (Azospirillum brasilense strain MTCC4035 plasmid p6, complete sequence) position: , mismatch: 10, identity: 0.688

atctattgcggcatgttcgccggtatcggctt	CRISPR spacer
aatccgggcggcatgctcgccggtctcggcgg	Protospacer
* ..   ********.******** *****

761. spacer 3.1|4149186|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP023408 (Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence) position: , mismatch: 10, identity: 0.688

atctattgcggcatgttcgccggtatcggctt	CRISPR spacer
cgcgtcggcggcatgtccgccggtaacggccg	Protospacer
  *  . *********.******** ****.

762. spacer 3.4|4149370|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 10, identity: 0.688

tttatccaggcggcgggggcggtgggcagcac	CRISPR spacer
aacgcccaggcggccggggcggtggacaacgg	Protospacer
  ...********* **********.**.*.

763. spacer 3.4|4149370|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP032054 (Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence) position: , mismatch: 10, identity: 0.688

tttatccaggcggcgggggcggtgggcagcac	CRISPR spacer
aacgcccaggcggccggggcggtggacaacgg	Protospacer
  ...********* **********.**.*.

764. spacer 3.4|4149370|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP016560 (Streptomyces clavuligerus strain F613-1 plasmid pSCL4, complete sequence) position: , mismatch: 10, identity: 0.688

tttatccaggcggcgggggcggtgggcagcac	CRISPR spacer
aacgcccaggcggccggggcggtggacaacgg	Protospacer
  ...********* **********.**.*.

765. spacer 3.4|4149370|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP034185 (Deinococcus sp. S14-83 strain S14-83T plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.688

tttatccaggcggcgggggcggtgggcagcac	CRISPR spacer
gacgccatcgcggcggtggcggtgggcggcac	Protospacer
  ...*   ******* **********.****

766. spacer 3.5|4149431|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP015092 (Pelagibaca abyssi strain JLT2014 plasmid pPABY3, complete sequence) position: , mismatch: 10, identity: 0.688

gcgccggcgccgcagagcctggccggccgaga	CRISPR spacer
agagcacggccgcagagccgggcctgccgagg	Protospacer
. . *.  *********** **** ******.

767. spacer 3.11|4149797|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to CP042641 (Escherichia coli strain NCYU-24-74 plasmid pNCYU-24-74-3, complete sequence) position: , mismatch: 10, identity: 0.688

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
gtgcagcccggctccttgccgggctttttttt	Protospacer
. . ***********  **********..*

768. spacer 3.11|4149797|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NC_008538 (Arthrobacter sp. FB24 plasmid 2, complete sequence) position: , mismatch: 10, identity: 0.688

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
cgaaagaccggatccgggccgggctgaacgac	Protospacer
 .**** **** *************   * .

769. spacer 3.11|4149797|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP018229 (Rhizobium leguminosarum strain Vaf-108 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.688

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
gcatggcgcggctccgcgccgggctttcgatg	Protospacer
. * .** ******** ***********   .

770. spacer 3.12|4149858|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to CP042641 (Escherichia coli strain NCYU-24-74 plasmid pNCYU-24-74-3, complete sequence) position: , mismatch: 10, identity: 0.688

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
gtgcagcccggctccttgccgggctttttttt	Protospacer
. . ***********  **********..*

771. spacer 3.12|4149858|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NC_008538 (Arthrobacter sp. FB24 plasmid 2, complete sequence) position: , mismatch: 10, identity: 0.688

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
cgaaagaccggatccgggccgggctgaacgac	Protospacer
 .**** **** *************   * .

772. spacer 3.12|4149858|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP018229 (Rhizobium leguminosarum strain Vaf-108 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.688

aaaaagcccggctccgggccgggctttcctga	CRISPR spacer
gcatggcgcggctccgcgccgggctttcgatg	Protospacer
. * .** ******** ***********   .

773. spacer 3.13|4149919|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP012185 (Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence) position: , mismatch: 10, identity: 0.688

cgcggcggcgccgacgtcatgcacggccggcc	CRISPR spacer
tatcgcggtgccgacgtcgtgcacggcgaccg	Protospacer
... ****.*********.******** . *

774. spacer 3.13|4149919|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP040821 (Paraoceanicella profunda strain D4M1 plasmid pD4M1C, complete sequence) position: , mismatch: 10, identity: 0.688

cgcggcggcgccgacgtcatgcacggccggcc	CRISPR spacer
gccggcggcgcccacgtcatgcccgttcacga	Protospacer
  ********** ********* ** .*.

775. spacer 3.13|4149919|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP012182 (Pseudonocardia sp. EC080610-09 plasmid pBCI2-1, complete sequence) position: , mismatch: 10, identity: 0.688

cgcggcggcgccgacgtcatgcacggccggcc	CRISPR spacer
tatcgcggtgccgacgtcgtgcacggcgaccg	Protospacer
... ****.*********.******** . *

776. spacer 3.15|4150041|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP021355 (Rhodococcus sp. S2-17 plasmid pRB98, complete sequence) position: , mismatch: 10, identity: 0.688

tcctcggtgagggcggcgatcacatcggctgc	CRISPR spacer
ggggcggtgaggtcggcgatctcatcgaccca	Protospacer
    ******** ******** *****.*.

777. spacer 3.15|4150041|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to MH697582 (Mycobacterium phage Ejimix, complete genome) position: , mismatch: 10, identity: 0.688

tcctcg-----gtgagggcggcgatcacatcggctgc	CRISPR spacer
-----gggagcgtgaggccagcgatcacatcggcgag	Protospacer
     *     ****** *.************** .

778. spacer 3.15|4150041|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to MK967402 (Mycobacterium phage NihilNomen, complete genome) position: , mismatch: 10, identity: 0.688

tcctcg-----gtgagggcggcgatcacatcggctgc	CRISPR spacer
-----gggagcgtgaggccagcgatcacatcggcgag	Protospacer
     *     ****** *.************** .

779. spacer 3.15|4150041|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to MH697583 (Mycobacterium phage EricMillard, complete genome) position: , mismatch: 10, identity: 0.688

tcctcg-----gtgagggcggcgatcacatcggctgc	CRISPR spacer
-----gggagcgtgaggccagcgatcacatcggcgag	Protospacer
     *     ****** *.************** .

780. spacer 3.15|4150041|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to MH727551 (Mycobacterium phage Kalah2, complete genome) position: , mismatch: 10, identity: 0.688

tcctcg-----gtgagggcggcgatcacatcggctgc	CRISPR spacer
-----gggagcgtgaggccagcgatcacatcggcgag	Protospacer
     *     ****** *.************** .

781. spacer 3.15|4150041|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to MF919504 (Mycobacterium phage DmpstrDiver, complete genome) position: , mismatch: 10, identity: 0.688

tcctcg-----gtgagggcggcgatcacatcggctgc	CRISPR spacer
-----gggagcgtgaggccagcgatcacatcggcgag	Protospacer
     *     ****** *.************** .

782. spacer 3.15|4150041|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to MH399772 (Mycobacterium phage Constella, complete genome) position: , mismatch: 10, identity: 0.688

tcctcg-----gtgagggcggcgatcacatcggctgc	CRISPR spacer
-----gggagcgtgaggccagcgatcacatcggcgag	Protospacer
     *     ****** *.************** .

783. spacer 3.15|4150041|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to MH077579 (Mycobacterium phage Halley, complete genome) position: , mismatch: 10, identity: 0.688

tcctcg-----gtgagggcggcgatcacatcggctgc	CRISPR spacer
-----gggagcgtgaggccagcgatcacatcggcgag	Protospacer
     *     ****** *.************** .

784. spacer 3.15|4150041|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to JF937090 (Mycobacterium virus BAKA, complete genome) position: , mismatch: 10, identity: 0.688

tcctcg-----gtgagggcggcgatcacatcggctgc	CRISPR spacer
-----gggagcgtgaggccagcgatcacatcggcgag	Protospacer
     *     ****** *.************** .

785. spacer 3.15|4150041|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to MH669017 (Mycobacterium phage Zelink, complete genome) position: , mismatch: 10, identity: 0.688

tcctcg-----gtgagggcggcgatcacatcggctgc	CRISPR spacer
-----gggagcgtgaggccagcgatcacatcggcgag	Protospacer
     *     ****** *.************** .

786. spacer 3.15|4150041|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to MK524521 (Mycobacterium phage Schatzie, complete genome) position: , mismatch: 10, identity: 0.688

tcctcg-----gtgagggcggcgatcacatcggctgc	CRISPR spacer
-----gggagcgtgaggccagcgatcacatcggcgag	Protospacer
     *     ****** *.************** .

787. spacer 3.15|4150041|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to MK524516 (Mycobacterium phage Bobby, complete genome) position: , mismatch: 10, identity: 0.688

tcctcg-----gtgagggcggcgatcacatcggctgc	CRISPR spacer
-----gggagcgtgaggccagcgatcacatcggcgag	Protospacer
     *     ****** *.************** .

788. spacer 3.15|4150041|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to MN062701 (Mycobacterium phage Dallas, complete genome) position: , mismatch: 10, identity: 0.688

tcctcg-----gtgagggcggcgatcacatcggctgc	CRISPR spacer
-----gggagcgtgaggccagcgatcacatcggcgag	Protospacer
     *     ****** *.************** .

789. spacer 3.15|4150041|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NC_041844 (Mycobacterium phage Optimus, complete genome) position: , mismatch: 10, identity: 0.688

tcctcg-----gtgagggcggcgatcacatcggctgc	CRISPR spacer
-----gggagcgtgaggccagcgatcacatcggcgag	Protospacer
     *     ****** *.************** .

790. spacer 3.15|4150041|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to MK524527 (Mycobacterium phage ThreeRngTarjay, complete genome) position: , mismatch: 10, identity: 0.688

tcctcg-----gtgagggcggcgatcacatcggctgc	CRISPR spacer
-----gggagcgtgaggccagcgatcacatcggcgag	Protospacer
     *     ****** *.************** .

791. spacer 3.15|4150041|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to MK279849 (Mycobacterium phage Duke13, complete genome) position: , mismatch: 10, identity: 0.688

tcctcg-----gtgagggcggcgatcacatcggctgc	CRISPR spacer
-----gggagcgtgaggccagcgatcacatcggcgag	Protospacer
     *     ****** *.************** .

792. spacer 3.15|4150041|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to MN183286 (Mycobacteriophage Yeet, complete genome) position: , mismatch: 10, identity: 0.688

tcctcg-----gtgagggcggcgatcacatcggctgc	CRISPR spacer
-----gggagcgtgaggccagcgatcacatcggcgag	Protospacer
     *     ****** *.************** .

793. spacer 3.15|4150041|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to MK524529 (Mycobacterium phage Phoebus, complete genome) position: , mismatch: 10, identity: 0.688

tcctcg-----gtgagggcggcgatcacatcggctgc	CRISPR spacer
-----gggagcgtgaggccagcgatcacatcggcgag	Protospacer
     *     ****** *.************** .

794. spacer 3.15|4150041|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to JN201525 (Mycobacterium phage Thibault, complete genome) position: , mismatch: 10, identity: 0.688

tcctcg-----gtgagggcggcgatcacatcggctgc	CRISPR spacer
-----gggagcgtgaggccagcgatcacatcggcgag	Protospacer
     *     ****** *.************** .

795. spacer 3.15|4150041|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to MF919512 (Mycobacterium phage Klein, complete genome) position: , mismatch: 10, identity: 0.688

tcctcg-----gtgagggcggcgatcacatcggctgc	CRISPR spacer
-----gggagcgtgaggccagcgatcacatcggcgag	Protospacer
     *     ****** *.************** .

796. spacer 3.15|4150041|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NC_026584 (Mycobacterium phage Minerva, complete genome) position: , mismatch: 10, identity: 0.688

tcctcg-----gtgagggcggcgatcacatcggctgc	CRISPR spacer
-----gggagcgtgaggccagcgatcacatcggcgag	Protospacer
     *     ****** *.************** .

797. spacer 3.15|4150041|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to KF114875 (Mycobacterium phage Redno2, complete genome) position: , mismatch: 10, identity: 0.688

tcctcg-----gtgagggcggcgatcacatcggctgc	CRISPR spacer
-----gggagcgtgaggccagcgatcacatcggcgag	Protospacer
     *     ****** *.************** .

798. spacer 3.15|4150041|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to NC_022067 (Mycobacterium phage Wanda, complete genome) position: , mismatch: 10, identity: 0.688

tcctcg-----gtgagggcggcgatcacatcggctgc	CRISPR spacer
-----gggagcgtgaggccagcgatcacatcggcgag	Protospacer
     *     ****** *.************** .

799. spacer 3.15|4150041|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to MK524504 (Mycobacterium phage Hughesyang, complete genome) position: , mismatch: 10, identity: 0.688

tcctcg-----gtgagggcggcgatcacatcggctgc	CRISPR spacer
-----gggagcgtgaggccagcgatcacatcggcgag	Protospacer
     *     ****** *.************** .

800. spacer 3.15|4150041|32|NC_009439|CRISPRCasFinder,CRT,PILER-CR matches to MK967379 (Mycobacterium phage HokkenD, complete genome) position: , mismatch: 10, identity: 0.688

tcctcg-----gtgagggcggcgatcacatcggctgc	CRISPR spacer
-----gggagcgtgaggccagcgatcacatcggcgag	Protospacer
     *     ****** *.************** .

801. spacer 2.3|4137646|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP036407 (Komagataeibacter saccharivorans strain JH1 plasmid p92689, complete sequence) position: , mismatch: 11, identity: 0.656

gcctcaaacgccgcccgctccgcatccatctt	CRISPR spacer
atgctgaacgccgcccgcgcggcatccatacg	Protospacer
.. ...************ * ******** .

802. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_KX169264 (Pseudomonas aeruginosa strain D5170990 plasmid pD5170990, complete sequence) position: , mismatch: 11, identity: 0.656

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
tggcccgccgcgtcgatgcgggcctggacccg	Protospacer
   ..****** ************* **.

803. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_KP975076 (Pseudomonas aeruginosa strain MRSN17623 plasmid pMRVIM0713, complete sequence) position: , mismatch: 11, identity: 0.656

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
tggcccgccgcgtcgatgcgggcctggacccg	Protospacer
   ..****** ************* **.

804. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to MN336501 (Pseudomonas aeruginosa strain 164130 plasmid p4130-KPC, complete sequence) position: , mismatch: 11, identity: 0.656

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
tggcccgccgcgtcgatgcgggcctggacccg	Protospacer
   ..****** ************* **.

805. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP014066 (Achromobacter xylosoxidans strain FDAARGOS_162 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.656

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
tggcccgccgcgtcgatgcgggcctggacccg	Protospacer
   ..****** ************* **.

806. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NC_009739 (Pseudomonas aeruginosa plasmid pMATVIM-7, complete sequence) position: , mismatch: 11, identity: 0.656

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
tggcccgccgcgtcgatgcgggcctggacccg	Protospacer
   ..****** ************* **.

807. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_MK423762 (Achromobacter ruhlandii strain 138R plasmid p138R, complete sequence) position: , mismatch: 11, identity: 0.656

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
tggcccgccgcgtcgatgcgggcctggacccg	Protospacer
   ..****** ************* **.

808. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP033834 (Pseudomonas aeruginosa strain FDAARGOS_570 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.656

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
tggcccgccgcgtcgatgcgggcctggacccg	Protospacer
   ..****** ************* **.

809. spacer 2.16|4138441|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_AP013064 (Serratia marcescens SM39 plasmid pSMC1, complete sequence) position: , mismatch: 11, identity: 0.656

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
tggcccgccgcgtcgatgcgggcctggacccg	Protospacer
   ..****** ************* **.

810. spacer 2.28|4139176|32|NC_009439|CRISPRCasFinder,CRT matches to NZ_AP017899 (Sphingopyxis sp. FD7 plasmid pSFD01, complete sequence) position: , mismatch: 11, identity: 0.656

agcattcgaagatttttcccgcacggtgcgga	CRISPR spacer
caggttcgaagccttttcccgcacggttacac	Protospacer
 . .******* .**************   .

811. spacer 2.32|4139420|33|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP050098 (Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b4, complete sequence) position: , mismatch: 11, identity: 0.667

ctggggccgcgcatcgacaagatcgaggctcag	CRISPR spacer
gcaatgccgcgcatcgacgagttcgaggccacc	Protospacer
 ... *************.** *******.

812. spacer 2.32|4139420|33|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP053440 (Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eF, complete sequence) position: , mismatch: 11, identity: 0.667

ctggggccgcgcatcgacaagatcgaggctcag	CRISPR spacer
gcaatgccgcgcatcgacgagttcgaggccacc	Protospacer
 ... *************.** *******.

813. spacer 2.32|4139420|33|NC_009439|CRISPRCasFinder,CRT matches to NC_012848 (Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132501, complete sequence) position: , mismatch: 11, identity: 0.667

ctggggccgcgcatcgacaagatcgaggctcag	CRISPR spacer
gcaatgccgcgcatcgacgagttcgaggccacc	Protospacer
 ... *************.** *******.

814. spacer 2.32|4139420|33|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP024310 (Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3c, complete sequence) position: , mismatch: 11, identity: 0.667

ctggggccgcgcatcgacaagatcgaggctcag	CRISPR spacer
gccatgccgcgcatcgacgagttcgaggcaacc	Protospacer
 . . *************.** *******

815. spacer 2.32|4139420|33|NC_009439|CRISPRCasFinder,CRT matches to NZ_CP023064 (Sinorhizobium sp. CCBAU 05631 plasmid pSS05631b, complete sequence) position: , mismatch: 11, identity: 0.667

ctggggccgcgcatcgacaagatcgaggctcag	CRISPR spacer
gccatgccgcgcatcgacgagttcgaggcaacc	Protospacer
 . . *************.** *******

816. spacer 2.40|4137652|32|NC_009439|PILER-CR matches to NZ_CP036407 (Komagataeibacter saccharivorans strain JH1 plasmid p92689, complete sequence) position: , mismatch: 11, identity: 0.656

gcctcaaacgccgcccgctccgcatccatctt	CRISPR spacer
atgctgaacgccgcccgcgcggcatccatacg	Protospacer
.. ...************ * ******** .

817. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NZ_KX169264 (Pseudomonas aeruginosa strain D5170990 plasmid pD5170990, complete sequence) position: , mismatch: 11, identity: 0.656

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
tggcccgccgcgtcgatgcgggcctggacccg	Protospacer
   ..****** ************* **.

818. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NZ_KP975076 (Pseudomonas aeruginosa strain MRSN17623 plasmid pMRVIM0713, complete sequence) position: , mismatch: 11, identity: 0.656

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
tggcccgccgcgtcgatgcgggcctggacccg	Protospacer
   ..****** ************* **.

819. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to MN336501 (Pseudomonas aeruginosa strain 164130 plasmid p4130-KPC, complete sequence) position: , mismatch: 11, identity: 0.656

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
tggcccgccgcgtcgatgcgggcctggacccg	Protospacer
   ..****** ************* **.

820. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NZ_CP014066 (Achromobacter xylosoxidans strain FDAARGOS_162 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.656

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
tggcccgccgcgtcgatgcgggcctggacccg	Protospacer
   ..****** ************* **.

821. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NC_009739 (Pseudomonas aeruginosa plasmid pMATVIM-7, complete sequence) position: , mismatch: 11, identity: 0.656

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
tggcccgccgcgtcgatgcgggcctggacccg	Protospacer
   ..****** ************* **.

822. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NZ_MK423762 (Achromobacter ruhlandii strain 138R plasmid p138R, complete sequence) position: , mismatch: 11, identity: 0.656

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
tggcccgccgcgtcgatgcgggcctggacccg	Protospacer
   ..****** ************* **.

823. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NZ_CP033834 (Pseudomonas aeruginosa strain FDAARGOS_570 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.656

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
tggcccgccgcgtcgatgcgggcctggacccg	Protospacer
   ..****** ************* **.

824. spacer 2.53|4138447|32|NC_009439|PILER-CR matches to NZ_AP013064 (Serratia marcescens SM39 plasmid pSMC1, complete sequence) position: , mismatch: 11, identity: 0.656

gccttcgccgcctcgatgcgggccttgatgac	CRISPR spacer
tggcccgccgcgtcgatgcgggcctggacccg	Protospacer
   ..****** ************* **.

825. spacer 2.65|4139182|32|NC_009439|PILER-CR matches to NZ_AP017899 (Sphingopyxis sp. FD7 plasmid pSFD01, complete sequence) position: , mismatch: 11, identity: 0.656

agcattcgaagatttttcccgcacggtgcgga	CRISPR spacer
caggttcgaagccttttcccgcacggttacac	Protospacer
 . .******* .**************   .

826. spacer 2.69|4139426|33|NC_009439|PILER-CR matches to NZ_CP050098 (Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b4, complete sequence) position: , mismatch: 11, identity: 0.667

ctggggccgcgcatcgacaagatcgaggctcag	CRISPR spacer
gcaatgccgcgcatcgacgagttcgaggccacc	Protospacer
 ... *************.** *******.

827. spacer 2.69|4139426|33|NC_009439|PILER-CR matches to NZ_CP053440 (Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eF, complete sequence) position: , mismatch: 11, identity: 0.667

ctggggccgcgcatcgacaagatcgaggctcag	CRISPR spacer
gcaatgccgcgcatcgacgagttcgaggccacc	Protospacer
 ... *************.** *******.

828. spacer 2.69|4139426|33|NC_009439|PILER-CR matches to NC_012848 (Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132501, complete sequence) position: , mismatch: 11, identity: 0.667

ctggggccgcgcatcgacaagatcgaggctcag	CRISPR spacer
gcaatgccgcgcatcgacgagttcgaggccacc	Protospacer
 ... *************.** *******.

829. spacer 2.69|4139426|33|NC_009439|PILER-CR matches to NZ_CP024310 (Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3c, complete sequence) position: , mismatch: 11, identity: 0.667

ctggggccgcgcatcgacaagatcgaggctcag	CRISPR spacer
gccatgccgcgcatcgacgagttcgaggcaacc	Protospacer
 . . *************.** *******

830. spacer 2.69|4139426|33|NC_009439|PILER-CR matches to NZ_CP023064 (Sinorhizobium sp. CCBAU 05631 plasmid pSS05631b, complete sequence) position: , mismatch: 11, identity: 0.667

ctggggccgcgcatcgacaagatcgaggctcag	CRISPR spacer
gccatgccgcgcatcgacgagttcgaggcaacc	Protospacer
 . . *************.** *******

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

50549 : 100293

Synechococcus_phage(16.67%)

tRNA,plate,holin

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011920402.1\|50549_51494_-\|tRNA	methionyl-tRNA formyltransferase	NA	NA	NA	NA
WP_003242326.1\|51546_52053_-	peptide deformylase	E3SLL2	Synechococcus_phage	2.5e-18	40.7
WP_011920403.1\|52206_53244_+	LysM peptidoglycan-binding domain-containing protein	NA	NA	NA	NA
WP_011920404.1\|53330_54437_+	DNA-protecting protein DprA	S6BFL3	Thermus_phage	7.7e-28	36.9
WP_011920405.1\|54503_55061_+	threonylcarbamoyl-AMP synthase	A0A291ATS8	Pandoravirus	1.3e-12	36.6
WP_011920406.1\|55172_56150_-	NADPH:quinone reductase	NA	NA	NA	NA
WP_011920407.1\|56294_57209_+	oxygen-dependent coproporphyrinogen oxidase	NA	NA	NA	NA
WP_011920408.1\|57316_58138_+	shikimate dehydrogenase	NA	NA	NA	NA
WP_041772772.1\|58341_59913_-	SulP family inorganic anion transporter	NA	NA	NA	NA
WP_003242278.1\|60028_60949_-\|holin	choline ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_011920410.1\|60992_62501_-\|holin	choline-sulfatase	NA	NA	NA	NA
WP_003242276.1\|62615_63569_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_011920411.1\|63684_64587_+	D-alanyl-D-alanine endopeptidase	NA	NA	NA	NA
WP_011920412.1\|64683_65592_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_011920413.1\|65801_66605_+	2,5-didehydrogluconate reductase DkgB	A0A1V0SDE7	Indivirus	3.3e-36	35.1
WP_011920414.1\|66676_67420_-	SDR family oxidoreductase	A0A0N9R355	Chrysochromulina_ericina_virus	5.1e-07	26.5
WP_011920415.1\|67575_68385_-	tryptophan synthase subunit alpha	NA	NA	NA	NA
WP_041772773.1\|68381_69608_-	tryptophan synthase subunit beta	NA	NA	NA	NA
WP_080518485.1\|69722_70400_+	DUF3592 domain-containing protein	NA	NA	NA	NA
WP_011920418.1\|70404_71316_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_011920419.1\|71369_71609_+	hypothetical protein	NA	NA	NA	NA
WP_003242036.1\|71707_71923_+	dodecin domain-containing protein	NA	NA	NA	NA
WP_011920420.1\|71891_72869_-	NAD-dependent epimerase/dehydratase family protein	NA	NA	NA	NA
WP_011920421.1\|73152_73734_+	hypothetical protein	NA	NA	NA	NA
WP_003242043.1\|73971_75201_-	spore maturation protein	NA	NA	NA	NA
WP_003242046.1\|75365_75827_-	inhibitor of vertebrate lysozyme family protein	NA	NA	NA	NA
WP_003242048.1\|75837_76002_-	DUF1328 domain-containing protein	NA	NA	NA	NA
WP_041772774.1\|76021_76222_-	hypothetical protein	NA	NA	NA	NA
WP_003242052.1\|76570_76972_+	acyl-CoA thioesterase	NA	NA	NA	NA
WP_003242055.1\|77047_77680_-	response regulator transcription factor	NA	NA	NA	NA
WP_011920423.1\|77720_79070_-	cache domain-containing protein	NA	NA	NA	NA
WP_003242058.1\|79639_80740_-	TRAP transporter substrate-binding protein	NA	NA	NA	NA
WP_011920424.1\|80924_81467_+	TRAP transporter small permease subunit	NA	NA	NA	NA
WP_003242060.1\|81459_82836_+	TRAP transporter large permease subunit	NA	NA	NA	NA
WP_011920425.1\|82940_83843_+	D-hexose-6-phosphate mutarotase	NA	NA	NA	NA
WP_011920426.1\|84278_85841_+	type VI secretion system protein TssA	NA	NA	NA	NA
WP_003242063.1\|85895_86402_+	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_003242064.1\|86427_87906_+	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_011920427.1\|87912_88341_+\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_011920428.1\|88330_89776_+	PAAR domain-containing protein	NA	NA	NA	NA
WP_011920429.1\|89768_90155_+	hypothetical protein	NA	NA	NA	NA
WP_003242068.1\|90185_91976_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_003242069.1\|91939_92947_+\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_011920430.1\|92958_95559_+	type VI secretion system ATPase TssH	H6X3M6	Enterobacteria_phage	8.0e-92	30.8
WP_041772775.1\|95569_97078_+	sigma-54-dependent Fis family transcriptional regulator	NA	NA	NA	NA
WP_011920432.1\|97125_97260_+	hypothetical protein	NA	NA	NA	NA
WP_011920433.1\|97280_98477_+	type VI secretion system-associated FHA domain protein TagH	NA	NA	NA	NA
WP_003242077.1\|98482_98965_+	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_011920434.1\|98961_100293_+\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA

DBSCAN-SWA_2

2624550 : 2631673

uncultured_Caudovirales_phage(85.71%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003240629.1\|2624550_2625219_+	Bax inhibitor-1/YccA family protein	A0A2H4JFM9	uncultured_Caudovirales_phage	4.4e-95	83.9
WP_012018703.1\|2625354_2625747_+	sulfurtransferase complex subunit TusD	A0A2H4JA39	uncultured_Caudovirales_phage	3.0e-51	76.7
WP_012018704.1\|2625747_2626107_+	sulfurtransferase complex subunit TusC	A0A2H4J8C0	uncultured_Caudovirales_phage	2.3e-34	63.3
WP_012018705.1\|2626106_2626406_+	sulfurtransferase complex subunit TusB	A0A2H4JG28	uncultured_Caudovirales_phage	3.2e-29	64.6
WP_003240638.1\|2626402_2626738_+	TusE/DsrC/DsvC family sulfur relay protein	A0A2H4J8B6	uncultured_Caudovirales_phage	3.0e-44	78.4
WP_012018706.1\|2626734_2627730_+	glycosyl transferase family protein	A0A2H4JBY5	uncultured_Caudovirales_phage	1.7e-146	77.9
WP_012018707.1\|2627804_2628803_+	glutathione S-transferase family protein	NA	NA	NA	NA
WP_012018708.1\|2628847_2630236_-	uroporphyrinogen-III C-methyltransferase	NA	NA	NA	NA
WP_012018709.1\|2630392_2631673_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	3.9e-100	55.1

DBSCAN-SWA_3

4313864 : 4355421

Pseudomonas_phage(34.78%)

tRNA,capsid,portal,protease,head,tail,terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012019787.1\|4313864_4315064_-\|tRNA	tyrosine--tRNA ligase	NA	NA	NA	NA
WP_004373463.1\|4315246_4316674_+	peptidoglycan DD-metalloendopeptidase family protein	A8ATH6	Listeria_phage	4.2e-18	45.6
WP_012019788.1\|4316677_4317769_+	anhydro-N-acetylmuramic acid kinase	NA	NA	NA	NA
WP_004373465.1\|4317818_4318169_-	iron-sulfur cluster insertion protein ErpA	A0A2H4N7M3	Lake_Baikal_phage	7.9e-27	52.3
WP_004373467.1\|4318242_4318653_-	polymer-forming cytoskeletal protein	NA	NA	NA	NA
WP_012019790.1\|4319381_4320416_-	N-acetyl-gamma-glutamyl-phosphate reductase	NA	NA	NA	NA
WP_004373474.1\|4320552_4320981_+	protoporphyrinogen oxidase HemJ	NA	NA	NA	NA
WP_012019791.1\|4320991_4321954_+	nitronate monooxygenase	NA	NA	NA	NA
WP_012019792.1\|4321950_4323213_+	DSD1 family PLP-dependent enzyme	NA	NA	NA	NA
WP_012019793.1\|4323313_4324270_+	DUF805 domain-containing protein	NA	NA	NA	NA
WP_012019794.1\|4324279_4325068_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_012019795.1\|4325075_4326557_-	AAA family ATPase	U5XGM6	Phormidium_phage	2.2e-70	35.5
WP_012019796.1\|4326678_4327512_+	formylglycine-generating enzyme family protein	A0A075BSL8	Microcystis_phage	1.8e-32	36.5
WP_004373481.1\|4327579_4328227_+	2-polyprenyl-3-methyl-6-methoxy-1,4-benzoquinone monooxygenase	NA	NA	NA	NA
WP_004373482.1\|4328276_4328699_-	OsmC family protein	NA	NA	NA	NA
WP_004373483.1\|4328932_4329577_+	cAMP-activated global transcriptional regulator CRP	NA	NA	NA	NA
WP_004373484.1\|4329622_4330462_-	indole-3-glycerol phosphate synthase TrpC	A0A0P0IR83	Acinetobacter_phage	1.9e-71	55.9
WP_012019797.1\|4330458_4331505_-	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	1.9e-108	57.7
WP_012019798.1\|4331501_4332098_-	aminodeoxychorismate/anthranilate synthase component II	A0A0P0IKJ1	Acinetobacter_phage	3.5e-75	64.7
WP_012019799.1\|4332451_4332961_+	hypothetical protein	NA	NA	NA	NA
WP_012019800.1\|4332977_4333673_+	SOS response-associated peptidase	NA	NA	NA	NA
WP_012019801.1\|4333680_4333947_-	hypothetical protein	NA	NA	NA	NA
WP_012019802.1\|4334161_4334632_-	hypothetical protein	A0A0U4JX95	Pseudomonas_phage	6.2e-19	51.0
WP_012019803.1\|4334628_4335075_-	hypothetical protein	A0A2R3UAM8	Myoviridae_environmental_samples	8.2e-37	59.6
WP_041772973.1\|4335167_4335389_+	carbon storage regulator	NA	NA	NA	NA
WP_041772974.1\|4335385_4335805_-	hypothetical protein	NA	NA	NA	NA
WP_012019805.1\|4335810_4336779_-	hypothetical protein	A0A1J0GUW3	Halomonas_phage	8.0e-13	43.0
WP_012019806.1\|4336778_4337297_-	hypothetical protein	A0A191SAU8	Nostoc_phage	2.7e-23	44.2
WP_012019807.1\|4337302_4337809_-	hypothetical protein	A0A0H4ITE0	Stenotrophomonas_phage	4.6e-12	35.5
WP_012019808.1\|4337798_4338371_-	hypothetical protein	NA	NA	NA	NA
WP_012019809.1\|4338407_4339322_-	hypothetical protein	NA	NA	NA	NA
WP_012019810.1\|4339321_4340938_-	hypothetical protein	NA	NA	NA	NA
WP_012019811.1\|4340934_4341384_-	hypothetical protein	NA	NA	NA	NA
WP_049767439.1\|4341386_4343105_-	hypothetical protein	A0A1W6JTA3	Pseudomonas_phage	4.9e-130	45.0
WP_012019813.1\|4343111_4343615_-	hypothetical protein	A0A0U4IIK1	Pseudomonas_phage	2.8e-33	44.5
WP_012019814.1\|4343653_4345669_-	hypothetical protein	A0A0U3TH20	Pseudomonas_phage	1.1e-59	32.4
WP_012019815.1\|4345668_4345818_-	hypothetical protein	NA	NA	NA	NA
WP_012019816.1\|4345844_4346207_-	hypothetical protein	A0A0U4KLC4	Pseudomonas_phage	3.2e-15	43.0
WP_012019817.1\|4346730_4347516_-	hypothetical protein	A0A0U4ISK2	Pseudomonas_phage	1.0e-111	77.8
WP_012019818.1\|4347539_4347986_-	hypothetical protein	A0A0U4IBQ1	Pseudomonas_phage	3.3e-38	57.7
WP_012019819.1\|4347989_4348577_-	hypothetical protein	A0A0U4J906	Pseudomonas_phage	1.1e-52	58.5
WP_012019820.1\|4348573_4349125_-	hypothetical protein	NA	NA	NA	NA
WP_012019821.1\|4349127_4349658_-\|head,tail	phage head-tail connector protein	NA	NA	NA	NA
WP_041772976.1\|4349659_4349869_-	hypothetical protein	NA	NA	NA	NA
WP_012019822.1\|4349924_4351166_-\|capsid	phage major capsid protein	C7BGH0	Burkholderia_phage	2.9e-84	44.3
WP_041772977.1\|4351236_4351947_-\|protease	Clp protease ClpP	C7BGG9	Burkholderia_phage	1.2e-50	53.3
WP_157045663.1\|4351906_4353199_-\|portal	phage portal protein	Q6DMU2	Streptococcus_phage	1.6e-56	35.2
WP_012019825.1\|4353209_4354916_-\|terminase	terminase large subunit	Q8W631	Enterobacteria_phage	1.5e-86	36.0
WP_012019826.1\|4354899_4355421_-\|terminase	P27 family phage terminase small subunit	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_009439

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection