CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	1 crisprs	c2c9_V-U4,cas14j,cas3,cas8e,cse2gr11,cas7,cas5,cas6e,cas1,cas2,csa3	0	74	2	0
NC_009467	Acidiphilium cryptum JF-5 plasmid pACRY01, complete sequence	1 crisprs	csa3	2	2	2	2
NC_009472	Acidiphilium cryptum JF-5 plasmid pACRY06, complete sequence	0 crisprs	NA	0	0	0	0
NC_009474	Acidiphilium cryptum JF-5 plasmid pACRY08, complete sequence	0 crisprs	NA	0	0	0	0
NC_009470	Acidiphilium cryptum JF-5 plasmid pACRY04, complete sequence	1 crisprs	NA	0	8	1	0
NC_009484	Acidiphilium cryptum JF-5, complete genome	2 crisprs	csa3,cas3,cas2,cas1,cas6e,cas5,cas7,cse2gr11,cas8e,DEDDh	3	17	3	0
NC_009471	Acidiphilium cryptum JF-5 plasmid pACRY05, complete sequence	0 crisprs	NA	0	0	0	0
NC_009473	Acidiphilium cryptum JF-5 plasmid pACRY07, complete sequence	0 crisprs	NA	0	0	0	0
NC_009469	Acidiphilium cryptum JF-5 plasmid pACRY03, complete sequence	0 crisprs	NA	0	0	1	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_009470_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_009470_1

25677-25888

Orphan

I-E

Consensus_repeat	Method
CCGTTCCCCGCGCACGCGGGGATGAACCGC	PILER-CR
CCGTTCCCCGCGCACGCGGGGATG	CRISPRCasFinder
CCGTTCCCCGCGCACGCGGGGATGAACCG	CRT

3 spacers

The CRISPR arrays of NC_009470_1

>merge|NC_009470|1|25677-25888|PILER-CR,CRISPRCasFinder,CRT
CCGTTCCCCGCGCACGCGGGGATGAACCGCGCCTCGGCCAGTATGTGATCGCGGCGATCGTCCGTTCCCCGCGCACGCGGGGATGAACCGCTGAACATCATAGACTTTCACCGTCACCGAAACCGTTCCCCGCGCACGCGGGGATGAACCGAAAGACGCCGGCAATTCAGCCGCCGCTCATTGCCGTTCCCCGCGTACGCGGGGATGCACTG

>NC_009470|1|1|25677-25828|PILER-CR
CCGTTCCCCGCGCACGCGGGGATGAACCGC	GCCTCGGCCAGTATGTGATCGCGGCGATCGT
CCGTTCCCCGCGCACGCGGGGATGAACCGC	TGAACATCATAGACTTTCACCGTCACCGAAA
CCGTTCCCCGCGCACGCGGGGATGAACCGA

>NC_009470|1|1|25677-25883|CRISPRCasFinder
CCGTTCCCCGCGCACGCGGGGATG	AACCGCGCCTCGGCCAGTATGTGATCGCGGCGATCGT
CCGTTCCCCGCGCACGCGGGGATG	AACCGCTGAACATCATAGACTTTCACCGTCACCGAAA
CCGTTCCCCGCGCACGCGGGGATG	AACCGAAAGACGCCGGCAATTCAGCCGCCGCTCATTG
CCGTTCCCCGCGTACGCGGGGATG

>NC_009470|1|1|25677-25888|CRT
CCGTTCCCCGCGCACGCGGGGATGAACCG	CGCCTCGGCCAGTATGTGATCGCGGCGATCGT
CCGTTCCCCGCGCACGCGGGGATGAACCG	CTGAACATCATAGACTTTCACCGTCACCGAAA
CCGTTCCCCGCGCACGCGGGGATGAACCG	AAAGACGCCGGCAATTCAGCCGCCGCTCATTG
CCGTTCCCCGCGTACGCGGGGATGCACTG

Protein	Signature genes	Signature genes Name	Protein_function
NC_009470.1\|WP_011930835.1\|22935_23262_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|237030
NC_009470.1\|WP_043508985.1\|32779_34042_-\|DNA-(cytosine-5-)-methyltransferase	unknown	unknown	gnl\|CDD\|236696
NC_009470.1\|WP_011930839.1\|26564_27131_-\|hypothetical-protein	unknown	unknown	unknown
NC_009470.1\|WP_011930844.1\|32322_32787_-\|DNA-mismatch-endonuclease-Vsr	unknown	unknown	gnl\|CDD\|226250
NC_009470.1\|WP_011930843.1\|31097_32336_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|370247
NC_009470.1\|WP_155856332.1\|22381_22942_+\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|163057
NC_009470.1\|WP_011930840.1\|27153_28509_-\|replication-protein-C	unknown	unknown	gnl\|CDD\|367494
NC_009470.1\|WP_011930828.1\|12940_13237_+\|hypothetical-protein	unknown	unknown	unknown
NC_009470.1\|WP_011930832.1\|19768_20977_-\|IS256-family-transposase	unknown	unknown	gnl\|CDD\|307151
NC_009470.1\|WP_011930829.1\|13257_13974_+\|MgtC/SapB-family-protein	unknown	unknown	gnl\|CDD\|224204
NC_009470.1\|WP_155856331.1\|16678_19699_-\|Tn3-family-transposase	unknown	unknown	gnl\|CDD\|376561
NC_009470.1\|WP_011930838.1\|25912_26179_-\|hypothetical-protein	unknown	unknown	unknown
NC_009470.1\|WP_081432852.1\|29990_30350_+\|hypothetical-protein	unknown	unknown	unknown
NC_009470.1\|WP_011930830.1\|14026_16660_+\|Tn3-family-transposase	unknown	unknown	gnl\|CDD\|376561
NC_009470.1\|WP_011930833.1\|21119_21713_-\|recombinase-family-protein	unknown	unknown	gnl\|CDD\|239737
NC_009470.1\|WP_011930841.1\|29310_29994_+\|ParA-family-protein	unknown	unknown	gnl\|CDD\|349760
NC_009470.1\|WP_011930842.1\|30433_31087_+\|hypothetical-protein	unknown	unknown	unknown
NC_009470.1\|WP_081432851.1\|28696_28906_-\|ribbon-helix-helix-protein,-CopG-family	unknown	unknown	gnl\|CDD\|223932
NC_009470.1\|WP_155856334.1\|24703_25129_-\|hypothetical-protein	unknown	unknown	unknown
NC_009470.1\|WP_155856333.1\|23392_24100_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NC_009470.1\|WP_011930835.1\|22935_23262_+\|hypothetical-protein	gnl\|CDD\|237030	PRK12270, kgd, multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine pyrophosphate-binding subunit/dihydrolipoyllysine-residue succinyltransferase subunit.	0.00134091
NC_009470.1\|WP_011930844.1\|32322_32787_-\|DNA-mismatch-endonuclease-Vsr	gnl\|CDD\|226250	COG3727, Vsr, DNA G:T-mismatch repair endonuclease [DNA replication, recombination, and repair].	1.23603e-51
NC_009470.1\|WP_155856332.1\|22381_22942_+\|AAA-family-ATPase	gnl\|CDD\|163057	TIGR02881, Stage_V_sporulation_protein_K, stage V sporulation protein K. Members of this protein family are the stage V sporulation protein K (SpoVK), a close homolog of the Rubisco expression protein CbbX (TIGR02880) and a members of the ATPase family associated with various cellular activities (pfam00004). Members are strictly limited to bacterial endospore-forming species, but are not universal in this group and are missing from the Clostridium group. [Cellular processes, Sporulation and germination].	9.00226e-53
NC_009470.1\|WP_011930832.1\|19768_20977_-\|IS256-family-transposase	gnl\|CDD\|307151	pfam00872, Transposase_mut, Transposase, Mutator family.	3.19734e-141
NC_009470.1\|WP_011930843.1\|31097_32336_-\|hypothetical-protein	gnl\|CDD\|370247	pfam09019, EcoRII-C, EcoRII C terminal. The C-terminal catalytic domain of the Restriction Endonuclease EcoRII has a restriction endonuclease-like fold with a central five-stranded mixed beta-sheet surrounded on both sides by alpha-helices. It cleaves DNA specifically at single 5' CCWGG sites.	2.312e-92
NC_009470.1\|WP_081432851.1\|28696_28906_-\|ribbon-helix-helix-protein,-CopG-family	gnl\|CDD\|223932	COG0864, NikR, Predicted transcriptional regulators containing the CopG/Arc/MetJ DNA-binding domain and a metal-binding domain [Transcription].	0.00388419
NC_009470.1\|WP_011930830.1\|14026_16660_+\|Tn3-family-transposase	gnl\|CDD\|376561	pfam01526, DDE_Tnp_Tn3, Tn3 transposase DDE domain. This family includes transposases of Tn3, Tn21, Tn1721, Tn2501, Tn3926 transposons from E-coli. The specific binding of the Tn3 transposase to DNA has been demonstrated. Sequence analysis has suggested that the invariant triad of Asp689, Asp765, Glu895 (numbering as in Tn3) may correspond to the D-D-35-E motif previously implicated in the catalysis of numerous transposases.	1.42091e-132
NC_009470.1\|WP_011930833.1\|21119_21713_-\|recombinase-family-protein	gnl\|CDD\|239737	cd03768, SR_ResInv, Serine Recombinase (SR) family, Resolvase and Invertase subfamily, catalytic domain; members contain a C-terminal DNA binding domain. Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and the enzyme. They are functionally versatile and include resolvases, invertases, integrases, and transposases. Resolvases and invertases affect resolution or inversion and comprise a major phylogenic group. Resolvases (e.g. Tn3, gamma-delta, and Tn5044) normally recombine two sites in direct repeat causing deletion of the DNA between the sites. Invertases (e.g. Gin and Hin) recombine sites in inverted repeat to invert the DNA between the sites. Cointegrate resolution with gamma-delta resolvase requires the formation of a synaptosome of three resolvase dimers bound to each of two res sites on the DNA. Also included in this subfamily are some putative integrases including a sequence from bacteriophage phi-FC1.	2.14859e-53
NC_009470.1\|WP_011930829.1\|13257_13974_+\|MgtC/SapB-family-protein	gnl\|CDD\|224204	COG1285, SapB, Uncharacterized membrane protein [Function unknown].	1.28915e-49
NC_009470.1\|WP_011930841.1\|29310_29994_+\|ParA-family-protein	gnl\|CDD\|349760	cd02042, ParAB_family, partition proteins ParAB family. ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation. ParB binds to DNA sequences adjacent to the origin of replication and localizes to opposite cell poles shortly following the initiation of DNA replication. ParB regulates the ParA ATPase activity by promoting nucleotide exchange in a fashion reminiscent of the exchange factors of eukaryotic G proteins. ADP-bound ParA binds single-stranded DNA, whereas the ATP-bound form dissociates ParB from its DNA binding sites. Increasing the fraction of ParA-ADP in the cell inhibits cell division, suggesting that this simple nucleotide switch may regulate cytokinesis. ParA shares sequence similarity to a conserved and widespread family of ATPases which includes the repA protein of the repABC operon in Rhizobium etli symbiotic plasmid. This operon is involved in the plasmid replication and partition.	8.69848e-19
NC_009470.1\|WP_043508985.1\|32779_34042_-\|DNA-(cytosine-5-)-methyltransferase	gnl\|CDD\|236696	PRK10458, PRK10458, DNA cytosine methylase; Provisional.	6.28999e-164
NC_009470.1\|WP_011930840.1\|27153_28509_-\|replication-protein-C	gnl\|CDD\|367494	pfam03428, RP-C, Replication protein C N-terminal domain. Replication protein C is involved in the early stages of viral DNA replication.	1.66893e-69
NC_009470.1\|WP_155856331.1\|16678_19699_-\|Tn3-family-transposase	gnl\|CDD\|376561	pfam01526, DDE_Tnp_Tn3, Tn3 transposase DDE domain. This family includes transposases of Tn3, Tn21, Tn1721, Tn2501, Tn3926 transposons from E-coli. The specific binding of the Tn3 transposase to DNA has been demonstrated. Sequence analysis has suggested that the invariant triad of Asp689, Asp765, Glu895 (numbering as in Tn3) may correspond to the D-D-35-E motif previously implicated in the catalysis of numerous transposases.	2.78361e-176

>NC_009470.1|WP_155856334.1|24703_25129_-|hypothetical-protein
MQAGAPPAADFGMQPRQARFHLVPAPRPLLAAGEGTTKAAQFGQCCPQGADRIDFGTVRSDNGGFQAEIEAHRPHRHQPWGVCRGWHFVGQVDEPAPVFPGERNCLAVFPWRKIAVALKPERPAQRLALIQAAVPHLEIDR
>NC_009470.1|WP_155856333.1|23392_24100_+|hypothetical-protein
MQLYLGQYPHGQFAGQAKAALAALNSRPAAFPAPTAKAAASSATSKPSKPAPSPTVSKPANLKPGWLVEVRATHQQATSSGQTWLPDPVALSLKPQPGPVFNIATLAQGIPAAGTLPAIAGSAKWLVRKAGQWGIGTDIKWHNTGPCTATVTVQGNRIIKSTTNQVSYAPGSGDTSFSAALSLTPGVYNVAWTLVCQPTSSYLPGKDATLSLLVAPPQGALAAPTTGEFVYQPNK
>NC_009470.1|WP_011930835.1|22935_23262_+|hypothetical-protein
MLNPEFRDHLRAVHRALWRQDNSYRLAILAAPVLLVLAVIHALPGGKNASPPTPSGPPVSSSHSSASNIPPPAAKPAAAAVPLKIKPGAPLPATQPASAGGYHSPFNQ
>NC_009470.1|WP_155856332.1|22381_22942_+|AAA-family-ATPase
MAHNRCYGHYIGHTAPKVKNKVAEAMDGILFIDEAYTLSGGKGGHDFGQEAIDTLLKEMEDKRDRLVIIVAGYPAEMRAFINSNPGLASRFAKTIEFQPYSPPELIEIFKGMLRKEDLHLAPDWPEAELTGWFSSRLTDPQFGNARTVRTIVERIREAQSLRLAQNGAGDLQTVTAEDVQEALASC
>NC_009470.1|WP_011930833.1|21119_21713_-|recombinase-family-protein
MLIGYMRVSTDNDRQVLDLQRDALLGAGVDERHLFDDRAAGSRRDRPGLAAALAYLKSGDCLVVWKLDRLGRSLPHLLETVNSLRARGVGFRSLTEQMDTTTPQGEFLFHVFGALAQFERSLIQERVQAGLAAARRRGRRGGRPMAIDAEKLAAVIAALDAGATKASVCRTFGISRSTLVDSLARIGLMSALVVEIV
>NC_009470.1|WP_011930832.1|19768_20977_-|IS256-family-transposase
MTDDRLPLAELLAKAGDGDFLRSVAEAVVQLLMEADVEGLIGAGRHERTGERTTYRNGYRDRSLDTRLGNLQLRIPKLRQGSYFPPFLEPRKTSEKALVAVIQEAWVGGVSTRRVDDLVQAMGLSGIGKSTVSKLCKDIDERVNAFLERPLTGDWPYLWLDATYLKQREGGRIVSVAAIIAVAANTEGKREIVGLHIGPSEAETFWAAFLKSLVRRGLRQVKLVISDAHEGLKSAIRRVMGASWQRCRVHWMRNALAYVGKGQQSMVSAALRQAFIQPDRAGASQTLRHTADQFRAKWPKLAAFIDDSEVDVLAHMDFPVQHRVKIHSTNPIERLNKEVKRRADVVGIFPNEAAIIRLVGAVLLEQNDEWQTQNRYMQTEPMAELTPPAIDVFPPQIATAAE
>NC_009470.1|WP_155856331.1|16678_19699_-|Tn3-family-transposase
MPSTGRREGPVGHRRILTGEQIAQLFDPLTDRRGIIRHYTLSAADLAMIRRGRGDHHRLGLALMLCYLRYPGRPLHAGEIPDPALVSFVATQIDVLPDSLGAYLRVDQNRRRHSAALQDRLGLRPWGPRVAADLADWLLAHALEADRLVDLAALVLEECRGRGILLPPPARLERLCIEVRYRARREIERRLTAGLSADQRRRLDALTERRLDTSQSWLAWLRQIPESAKPASMLGVIERLEHIRAIDIDPARGHRINQSRLAQLVREAGRTTVQHVAGYERRRRHAVLTAIDLDLSARLTDQAITLFERLIGAMFRKAEGRHARAFQAEGRAINEKVRLYARIGAALMAARAGQGDPFAAIDKVIPWDRFCSTVMEAETLVRSEDFDPYEVLSEHYAGIRRWAPAFLATFEFQGVPAAASLMRAIAMLRAMNSAGASTLPKSAPTAFVRPRWARHVLTAHGIDRRYYELCVLAELRQRLAAGDVWVTGSRQYRAFEERLISRETLQVLQKASGIPVAIETDFDRFIETRRTWLDARLAEVDARARGGLLPDVTIEKGVLRITPIEKSTPPEAEALAAKLYATLPRIRITDLLTEVAGWTGFLDCFTHLRTGEAAADPRVLMAGLLADGLNLGLTRMAEACSIASLGQLAWTADWHIRDETYALALRRLVEHQSREPLAALFGSGTASSSDGQFFRAGGSGRDASRINAHYGPEPGLKFYTHLSDRYAPFHTRVIAATASEALHVLDGLLDHHGDAPPRQHRHHTDGGGVSDHVFALCALLGYVFAPRIPDLKDRRLYSFARPAAYPTLAPMIAGRINVDLIRAHWPDLLRIATSIRTGTVSASVILRQLAAYPRQNAVAAALRELGRLERTLFTLDWLEDPGLRRESSHELNKGEARNSLARAVFIHRLGEIRDRTFENQTHRASGLNLLVTAIILWNTRYLAQAIQALRQVEDVPGTLLRHLSPIGWEHVNLTGDYIWSANQKSTENHAGLRPLRPIPDTTTHAA
>NC_009470.1|WP_011930830.1|14026_16660_+|Tn3-family-transposase
MAQRRLLTDEERHVLLGVPTDPDGLVRHYTFTRSDRNFLLTRRGKANQLGFAVQLALLRHPGTTLSYIAGSVAALVAWLATQLEIPQSAFETYQRRPQTMTDHAQILATTLGLRLPNKGDFASMIDAASLAAWGTDRGPMIVKGVIADLRARKIILPTTGVIERVAIAGRARARKRTADALVQGVSPDQITRLDPLLIVDRDLGMTPFGWLKDMPTSPKPDNIRGLIERLRMVRRFAISPDVARQVHEDRFRQLVREGRITDAHQVARYATHRRRAIMVAVLIDLESRLIDGVLDMSDKLIGGMFARARKSKERHYVASTRDVGRLMHLFSATIEALATAHESGRDGFSVVDETVGWTKLQRVRSEVRAFAEFTEEDPLIRASDRYATLRKFAPDIIEALAFKTARSDSPLLAAIRLLKDLNETGQRHIPADAPMPFRKEWAKLVQGGDRPNRRLYETAVFATLRGKLQSGDVWVERSSNYRRFDSYLIAPEAVPSIATELGLPATADIWIAARGRDLDQRLKRFARRLARGDLEGVEWRDDRLHISPVKALTPPAADTLASEITALLPYARITEILHEVNRQTGFAAAFTNLRTGEHCDNENALLAAILADATNLGLTRMAAASQGVTRDQLIWVADAYIRPETYKAALGRIIDAHHRLPVAALWGAGTTSSSDGQFFRSGKRGETAGDINARYGADPGLGFYTHVSDQHAPYNVRVMSATSHEAPYVLDGLLHHGTSLKIDTHYVDTGGASDHVFALCSMLGIRFCPRLRDFPDRKLASIEPVTAYKNLQPLLGRRIRTDVIREHWSDIVRLVASLKAGAVAPSTMLKKLAAYQRQNQLDLALQEIGRIERTLFMLDWLESSDLARSNGSPRAVA
>NC_009470.1|WP_011930829.1|13257_13974_+|MgtC/SapB-family-protein
MTDLSQPFPVPFLTTVGDFAVAFVLGTLIGAERQWRQRSAGLRTTVLVALGAAAFADLGVRLAGPAGSTRVVAYIVSGIGFLGAGVILKEGANIRGINTAGTLWCSAAVGAFCGCGYSAEATLLTVFILAGNTLLRPLVNYINRRPIDARATEAQYAIHALCDPADVSDVRDLLFSELEAAHYPIREIATLSDSEELVELAATLVPTNAKPDELDAVVAALEKAGPIKTATWTVSTTA
>NC_009470.1|WP_011930828.1|12940_13237_+|hypothetical-protein
MKQDNSFPASETRRAKGVSRIPVSRAARASQRDLDRAAHDRSADIAAIARAEGWLTPLVPIERVALRPWQQTVFWGLRLYIGVMLIIMGWGFLHVAGG
>NC_009470.1|WP_011930838.1|25912_26179_-|hypothetical-protein
MMASNPDENAERLYLREQIARFDQMHERIWRMREESWPRIDALLAQAARDRAAIHRNDTNWPAIIAAGGAVLSGISAILAVLVAAHLI
>NC_009470.1|WP_011930839.1|26564_27131_-|hypothetical-protein
MALEADYLEALGLLGRVCEEYRRETGSPAYLVGGAAVALWTGGAFHSADFDLIVAAEERFHEILLQRGFCPEDRAGKLKVGYYHPDYPQFGWQLVTGPMFDGRADRMRVAQFQIDAGSAVVLPAIEDLIADRLGQYAGGKPPDESRLNQARVLFEMADRIDSAYLKKRVEEEGGDISLLNGLNSELEP
>NC_009470.1|WP_011930840.1|27153_28509_-|replication-protein-C
METESPGFGQNTKTNQRSGGLRRLSLAMIATDRTAEGFTGLSDGAGGPGAVLAAFKAAAPYLGLPPRVVHAVDWLFRFTQRQDWEPGARPVVWPSATVQQADLDLGVSQTKALNRLLVELGLVVMRDSPNGKRYGRRDRSGRIIEAYGFDLSPLGVRLEEFRAVAEKGRAEREAVRQLRRRVTIARKAIEQIAETAVEVGLEPGGFVREAEEARRLCWRLGKEERSTVLVFGVTRLEDRHGELRQRLESLIAERRGSAQKDVETDPKGPENRPHQYRYKSNADPEQDTVSGIEKSSPAPVMSVAPTGSPGLRDGSSGPQTGRGGQKPALQDDGTVLRITPDELVRLAPRLRPYLGRSSPAWPDVVEAADWLRHDLGVSKPLWGEACLAMGREQAAIALAIVSARPAGHFRSTPGGYFHGMVARARAGELNLGKTIWGMRSKRDTHGWDQPQ
>NC_009470.1|WP_081432851.1|28696_28906_-|ribbon-helix-helix-protein,-CopG-family
MPAGVDAVLGKHRAYRRRLAAGGQHQLVVALPKDLVAVVDEIKESQGLRNRSQALLQLIERGIQATQKT
>NC_009470.1|WP_011930841.1|29310_29994_+|ParA-family-protein
MPTVVFASPKGGAGKSTSAVILATELAAAGAEITIIDADPNKPVARWSRLPGKPASLRVIDDVSEKTIIRVIDTEAERAAFVIVDLEGTASRMVPYAMSRADLVLIPTRGSVLDAVEAVAAIREVKQQEEAFRLHIPAAVLFTNTSAAIRPRTLSAIETEFAENGVNVLKTRLHEREAYRALFSFGGTLEALDPANVRNIPAAIENAQAFAREVVDLLRQNREEVAA
>NC_009470.1|WP_081432852.1|29990_30350_+|hypothetical-protein
MSQRSSIFHNPHPPLDVSDFKPAGGKQHRPAPAAIDEISSKGRFQSREPEPAIPGQSIDSPPSTRRQPMTYRTGRNKVFSVKTDPATADEFYAIAQKNGWKAAETFEKAVAALRRELTS
>NC_009470.1|WP_011930842.1|30433_31087_+|hypothetical-protein
MGVQLYLLDRRPTTLVVGGTSHKIGTLRRFWKVTELNNARMTEIGAAQGRIRQKAAPVAVMLNDVMEAALEMEPGRSLPAHIVLGWDADRVSVTDQDWEYLPVLGYAVRNPETGIYVLHETGEGEGGLLRPVTRDRAIHRGLITTDDQLVRHGQPRITTCHSVTPLIETYAEADCLLADGRSTRILTSVTSGRLPDPAWYAGKRPADVKAYPIDRAA
>NC_009470.1|WP_011930843.1|31097_32336_-|hypothetical-protein
MALTDLVGWMDEYGVPGAVWFAKRLAANDTLATGAHGAGPYIPKEFLFSVFPDLNHPEEENPDCWFDLYIDSHADRRRIRAIWYNNRLRGGTRNEARLTNFGGGRSALLDPDSTGALAVFAFLPHGPGRQMECHVWVCDQGAEADLLEERIGPVEPKAPVVWQPGEIARDLFMHTDAGPGSCRLLPGEIPPAWLTRFPTGEEIIRETVKRRQRNGLEPDRLLMRRRECEFEIFLSVEEAVYLPRIRQGFSAIGDFLSLAQTILQSRKTRSGTSLELHVREIMTEEGLLADTSFTYRPVIENGKRPDFLFPSKAAYDNPAFPAERLRMLAAKTTCKDRWRQVLNEADRIATKHLLTLQEGVSEGQFREMSEAGVRLVVPAELHRSYPASVRPHLVTFENFIGDVRPLSAIQGP
>NC_009470.1|WP_011930844.1|32322_32787_-|DNA-mismatch-endonuclease-Vsr
MPDIVDRQTRSRMMAGIRSANTRPERMIRSALHVRGFRYRLHPRALPGRPDIVLPRYRAAIFVHGCFWHGHDCGLFRLPGTRPEFWAEKIRRNRQRDAAVMNELVATGWRVLTIWECAIRRRRGMVPEPVIDEAVSWLRSGDGNLEIRGNNGAD
>NC_009470.1|WP_043508985.1|32779_34042_-|DNA-(cytosine-5-)-methyltransferase
MTEFSILRQKAGLSVVEAAEALGYHERHVYRWENGKGKPPRQAVLDCLRARQPGGHKPVADTSAFTFIDLFAGIGGLRRGFEAIGGRCVFTSEWDKYSQATYAANYPYDDHTISGDITKIGEKDIPEHDVLLAGFPCQPFSIAGVSKKNALKRPHGFACEAQGTLFFELARIIKHHRPKVFLLENVKNLVNHDRGTTFRIIRDVLENQLDYRIDFRVIDAKSWVPQHRERIFIAGFRDRNAEFTFKTLDIPDPASGPRLASILHPEDGTEKPDGHFTEGPLATVTERYTLTDHLWNYLQNYAEKHRRAGNGFGFGLCGPEDVARTLSARYYKDGSEILIRQNGKRPRRLTPRECARLMGFDRPGEADFKIPVSDTQAYKQFGNAVAVPVVAAVARHMKQWILEAVEGDENHHATGLQESA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_009470_1	1.1\|25707\|31\|NC_009470\|PILER-CR	25707-25737	31	NC_009470	Acidiphilium cryptum JF-5 plasmid pACRY04, complete sequence	25707-25737	0	1.0
NC_009470_1	1.2\|25768\|31\|NC_009470\|PILER-CR	25768-25798	31	NC_009470	Acidiphilium cryptum JF-5 plasmid pACRY04, complete sequence	25768-25798	0	1.0
NC_009470_1	1.3\|25701\|37\|NC_009470\|CRISPRCasFinder	25701-25737	37	NC_009470	Acidiphilium cryptum JF-5 plasmid pACRY04, complete sequence	25701-25737	0	1.0
NC_009470_1	1.4\|25762\|37\|NC_009470\|CRISPRCasFinder	25762-25798	37	NC_009470	Acidiphilium cryptum JF-5 plasmid pACRY04, complete sequence	25762-25798	0	1.0
NC_009470_1	1.5\|25823\|37\|NC_009470\|CRISPRCasFinder	25823-25859	37	NC_009470	Acidiphilium cryptum JF-5 plasmid pACRY04, complete sequence	25823-25859	0	1.0
NC_009470_1	1.6\|25706\|32\|NC_009470\|CRT	25706-25737	32	NC_009470	Acidiphilium cryptum JF-5 plasmid pACRY04, complete sequence	25706-25737	0	1.0
NC_009470_1	1.7\|25767\|32\|NC_009470\|CRT	25767-25798	32	NC_009470	Acidiphilium cryptum JF-5 plasmid pACRY04, complete sequence	25767-25798	0	1.0
NC_009470_1	1.8\|25828\|32\|NC_009470\|CRT	25828-25859	32	NC_009470	Acidiphilium cryptum JF-5 plasmid pACRY04, complete sequence	25828-25859	0	1.0
NC_009470_1	1.1\|25707\|31\|NC_009470\|PILER-CR	25707-25737	31	NZ_LT985249	Escherichia coli strain 195 plasmid RCS46_p, complete sequence	214490-214520	7	0.774
NC_009470_1	1.1\|25707\|31\|NC_009470\|PILER-CR	25707-25737	31	CP006583	Mesorhizobium huakuii 7653R plasmid pMHb, complete sequence	53243-53273	8	0.742
NC_009470_1	1.6\|25706\|32\|NC_009470\|CRT	25706-25737	32	NZ_LT985249	Escherichia coli strain 195 plasmid RCS46_p, complete sequence	214489-214520	8	0.75
NC_009470_1	1.8\|25828\|32\|NC_009470\|CRT	25828-25859	32	NZ_CP006990	Rhizobium sp. IE4771 plasmid pRetIE4771d, complete sequence	575656-575687	8	0.75
NC_009470_1	1.8\|25828\|32\|NC_009470\|CRT	25828-25859	32	NZ_CP020952	Rhizobium sp. CIAT894 plasmid pRheCIAT894e, complete sequence	690712-690743	8	0.75
NC_009470_1	1.8\|25828\|32\|NC_009470\|CRT	25828-25859	32	NZ_CP021127	Rhizobium sp. Kim5 plasmid pRetKim5c, complete sequence	525270-525301	8	0.75
NC_009470_1	1.6\|25706\|32\|NC_009470\|CRT	25706-25737	32	CP006583	Mesorhizobium huakuii 7653R plasmid pMHb, complete sequence	53242-53273	9	0.719
NC_009470_1	1.8\|25828\|32\|NC_009470\|CRT	25828-25859	32	NZ_CP021819	Sinorhizobium meliloti strain M162 plasmid psymA, complete sequence	849970-850001	9	0.719
NC_009470_1	1.8\|25828\|32\|NC_009470\|CRT	25828-25859	32	NZ_CP021813	Sinorhizobium meliloti strain M270 plasmid psymA, complete sequence	924843-924874	9	0.719

1. spacer 1.1|25707|31|NC_009470|PILER-CR matches to NC_009470 (Acidiphilium cryptum JF-5 plasmid pACRY04, complete sequence) position: , mismatch: 0, identity: 1.0

gcctcggccagtatgtgatcgcggcgatcgt	CRISPR spacer
gcctcggccagtatgtgatcgcggcgatcgt	Protospacer
*******************************

2. spacer 1.2|25768|31|NC_009470|PILER-CR matches to NC_009470 (Acidiphilium cryptum JF-5 plasmid pACRY04, complete sequence) position: , mismatch: 0, identity: 1.0

tgaacatcatagactttcaccgtcaccgaaa	CRISPR spacer
tgaacatcatagactttcaccgtcaccgaaa	Protospacer
*******************************

3. spacer 1.3|25701|37|NC_009470|CRISPRCasFinder matches to NC_009470 (Acidiphilium cryptum JF-5 plasmid pACRY04, complete sequence) position: , mismatch: 0, identity: 1.0

aaccgcgcctcggccagtatgtgatcgcggcgatcgt	CRISPR spacer
aaccgcgcctcggccagtatgtgatcgcggcgatcgt	Protospacer
*************************************

4. spacer 1.4|25762|37|NC_009470|CRISPRCasFinder matches to NC_009470 (Acidiphilium cryptum JF-5 plasmid pACRY04, complete sequence) position: , mismatch: 0, identity: 1.0

aaccgctgaacatcatagactttcaccgtcaccgaaa	CRISPR spacer
aaccgctgaacatcatagactttcaccgtcaccgaaa	Protospacer
*************************************

5. spacer 1.5|25823|37|NC_009470|CRISPRCasFinder matches to NC_009470 (Acidiphilium cryptum JF-5 plasmid pACRY04, complete sequence) position: , mismatch: 0, identity: 1.0

aaccgaaagacgccggcaattcagccgccgctcattg	CRISPR spacer
aaccgaaagacgccggcaattcagccgccgctcattg	Protospacer
*************************************

6. spacer 1.6|25706|32|NC_009470|CRT matches to NC_009470 (Acidiphilium cryptum JF-5 plasmid pACRY04, complete sequence) position: , mismatch: 0, identity: 1.0

cgcctcggccagtatgtgatcgcggcgatcgt	CRISPR spacer
cgcctcggccagtatgtgatcgcggcgatcgt	Protospacer
********************************

7. spacer 1.7|25767|32|NC_009470|CRT matches to NC_009470 (Acidiphilium cryptum JF-5 plasmid pACRY04, complete sequence) position: , mismatch: 0, identity: 1.0

ctgaacatcatagactttcaccgtcaccgaaa	CRISPR spacer
ctgaacatcatagactttcaccgtcaccgaaa	Protospacer
********************************

8. spacer 1.8|25828|32|NC_009470|CRT matches to NC_009470 (Acidiphilium cryptum JF-5 plasmid pACRY04, complete sequence) position: , mismatch: 0, identity: 1.0

aaagacgccggcaattcagccgccgctcattg	CRISPR spacer
aaagacgccggcaattcagccgccgctcattg	Protospacer
********************************

9. spacer 1.1|25707|31|NC_009470|PILER-CR matches to NZ_LT985249 (Escherichia coli strain 195 plasmid RCS46_p, complete sequence) position: , mismatch: 7, identity: 0.774

gcctcggccagtatgtgatcgcggcgatcgt	CRISPR spacer
ccatcggcccgtatgtgatcccggcgattaa	Protospacer
 * ****** ********** *******..

10. spacer 1.1|25707|31|NC_009470|PILER-CR matches to CP006583 (Mesorhizobium huakuii 7653R plasmid pMHb, complete sequence) position: , mismatch: 8, identity: 0.742

gcctcggccagtatgtgatcgcggcgatcgt	CRISPR spacer
ccatcggccaggatgtgttcgcggcgtgctc	Protospacer
 * ******** ***** ********  * .

11. spacer 1.6|25706|32|NC_009470|CRT matches to NZ_LT985249 (Escherichia coli strain 195 plasmid RCS46_p, complete sequence) position: , mismatch: 8, identity: 0.75

cgcctcggccagtatgtgatcgcggcgatcgt	CRISPR spacer
gccatcggcccgtatgtgatcccggcgattaa	Protospacer
  * ****** ********** *******..

12. spacer 1.8|25828|32|NC_009470|CRT matches to NZ_CP006990 (Rhizobium sp. IE4771 plasmid pRetIE4771d, complete sequence) position: , mismatch: 8, identity: 0.75

aaagacgccggcaattcagccgccgctcattg	CRISPR spacer
tgagacgcgggcaattcagctgccgggcaacg	Protospacer
 .****** ***********.****  ** .*

13. spacer 1.8|25828|32|NC_009470|CRT matches to NZ_CP020952 (Rhizobium sp. CIAT894 plasmid pRheCIAT894e, complete sequence) position: , mismatch: 8, identity: 0.75

aaagacgccggcaattcagccgccgctcattg	CRISPR spacer
tgagacgcgggcaattcagctgccgggcaacg	Protospacer
 .****** ***********.****  ** .*

14. spacer 1.8|25828|32|NC_009470|CRT matches to NZ_CP021127 (Rhizobium sp. Kim5 plasmid pRetKim5c, complete sequence) position: , mismatch: 8, identity: 0.75

aaagacgccggcaattcagccgccgctcattg	CRISPR spacer
tgagacgcgggcaattcagctgccgggcaacg	Protospacer
 .****** ***********.****  ** .*

15. spacer 1.6|25706|32|NC_009470|CRT matches to CP006583 (Mesorhizobium huakuii 7653R plasmid pMHb, complete sequence) position: , mismatch: 9, identity: 0.719

cgcctcggccagtatgtgatcgcggcgatcgt	CRISPR spacer
gccatcggccaggatgtgttcgcggcgtgctc	Protospacer
  * ******** ***** ********  * .

16. spacer 1.8|25828|32|NC_009470|CRT matches to NZ_CP021819 (Sinorhizobium meliloti strain M162 plasmid psymA, complete sequence) position: , mismatch: 9, identity: 0.719

aaagacgccggcaattcagccgccgctcattg	CRISPR spacer
ttcgctgccggcaattcagccgccgggcatac	Protospacer
   * .*******************  ***

17. spacer 1.8|25828|32|NC_009470|CRT matches to NZ_CP021813 (Sinorhizobium meliloti strain M270 plasmid psymA, complete sequence) position: , mismatch: 9, identity: 0.719

aaagacgccggcaattcagccgccgctcattg	CRISPR spacer
ttcgctgccggcaattcagccgccgggcatac	Protospacer
   * .*******************  ***

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

13257 : 22942

Salmonella_phage(33.33%)

transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011930829.1\|13257_13974_+	MgtC/SapB family protein	G3MA03	Bacillus_virus	1.6e-10	45.9
WP_011930830.1\|14026_16660_+\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	1.3e-169	37.6
WP_155856331.1\|16678_19699_-\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	2.4e-244	46.4
WP_011930832.1\|19768_20977_-\|transposase	IS256 family transposase	A0A220NQR7	Corynebacterium_phage	2.3e-94	47.0
WP_011930833.1\|21119_21713_-	recombinase family protein	A0A0A7NPV4	Enterobacteria_phage	9.5e-41	51.4
WP_155856332.1\|22381_22942_+	AAA family ATPase	V5UQM2	Mycobacterium_phage	1.1e-22	43.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NC_009468

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_009468_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_009468_1

35116-37523

TypeI-E

I-E

Consensus_repeat	Method
GTGTTCCCCGCAGGCGCGGGGATGAACC	PILER-CR
GTGTTCCCCGCAGGCGCGGGGATGAACCG	CRISPRCasFinder
GTGTTCCCCGCAGGCGCGGGGATGAACCG	CRT

39 spacers

cas2,cas1,cas6e,cas5,cas7,cse2gr11,cas8e,cas3,c2c9_V-U4

The CRISPR arrays of NC_009468_1

>merge|NC_009468|1|35116-37523|PILER-CR,CRISPRCasFinder,CRT
GTGTTCCCCGCAGGCGCGGGGATGAACCGCCGCCTGGGAGGATATGGAGCGCTGGATTGATGTGTTCCCCGCAGGCGCGGGGATGAACCGGCGGCGGCGCAATACTACGCAGCGGTGAAAGCGTGTTCCCCGCAGGCGCGGGGATGAACCGCGAAAATGGCGTTCTGGGAGGCGCTGACGAATGTGTTCCCCGCAGGCGCGGGGATGAACCGATGTGGTGGCAAGTGACGGGCCGAGTCTGGAAGTGTTCCCCGCAGGCGCGGGGATGAACCGATGCGCAAGGCGCGCAAGCGCAAGGGCAACAGGTGTTCCCCGCAGGCGCGGGGATGAACCGGTCATTGATCTGTCGCCAGTGGCCGTCGTCCGGTGTTCCCCGCAGGCGCGGGGATGAACCGCTTCGCGCCCTGATCGACATGCAGCGCGAGGTGTGTTCCCCGCAGGCGCGGGGATGAACCGATCTCCTTGTCTATCTAAAAACTAGCACAGAGGTGTTCCCCGCAGGCGCGGGGATGAACCGTTTTTTGAACAGCCGGAATTGATTGAACAGTTGTGTTCCCCGCAGGCGCGGGGATGAACCGCGAATGAGGAATTCGCCGCGTTCTATACGCTCGTGTTCCCCGCAGGCGCGGGGATGAACCGTGTCGCAATCCGGAGTCGGCTCGCTCCGCCATGTGTTCCCCGCAGGCGCGGGGATGAACCGGGGTATACGTGCTACCGGCGGGGGCTGGAGTAGTGTTCCCCGCAGGCGCGGGGATGAACCGTGGCCGATGCTCGCGCAGAAAGTGGGCGTGTGGTGTTCCCCGCAGGCGCGGGGATGAACCGCCGTCAAATCGATGGAGCCCGGTCACTGTTGTGTGTTCCCCGCAGGCGCGGGGATGAACCGTAAAGCGCGGCGTCCCCCCGCGCCGCAAAAGCGTGTTCCCCGCAGGCGCGGGGATGAACCGGAGCGCAAGCACCTGGCGTCGGAGATTTGGGCGTGTTCCCCGCAGGCGCGGGGATGAACCGGGTGGAAGATGGTTTGTCATTCGCAGAGCCCAGTGTTCCCCGCAGGCGCGGGGATGAACCGCCGGAAGGGACGGGCTCGCATGCCACGGGCACGTGTTCCCCGCAGGCGCGGGGATGAACCGGCAGAGGCAGCAGAGAGGCGATGCACCGAATTGTGTTCCCCGCAGGCGCGGGGATGAACCGGATATCGTTGCCAGACGGCGCACGCTCGCAATGTGTTCCCCGCAGGCGCGGGGATGAACCGACAGACCAGAGGAGGCAAGAGAGCGCGACAGGGTGTTCCCCGCAGGCGCGGGGATGAACCGATCGTCGATCTAACGACACCGCCAACGATGTTGTGTTCCCCGCAGGCGCGGGGATGAACCGGGCGCCAACGGTTGCGTCTTGTTTCTCGTCTAGTGTTCCCCGCAGGCGCGGGGATGAACCGGCGGACCCGCTATTACTGACCTGGCTCGATCGGTGTTCCCCGCAGGCGCGGGGATGAACCGCGACGCCGGACGCTCGCGAAATCGCCTTTGTGGTGTTCTCCGCAGGCGCGGGGATGAACCGACGCCGGTTCGCGGGCGCACAGTGCTTGTGCAGTGTTCCCCGCAGGCGCGGGGATGAACCGCTCGCCGGGCTGTGGAAGAAAGCCGGCCCCTGGTGTTCCCCGCAGGCGCGGGGATGAACCGTCGTGCAGATCGTGGTTGACAATCCAGGCAGCGTGTTCCCCGCAGGCGCGGGGATGAACCGCCGTTCGTCTGGATCGTAGATCGCGAAATGACGTGTTCCCCGCAGGCGCGGGGATGAACCGGATTGTCAGGTAATCGCCGAGCGTCTGATAAAGTGTTCCCCGCAGGCGCGGGGATGAACCGGCGCTTCGAGCGCCGCCGGGCCACAAGGTTGTGTGTTCCCCGCAGGCGCGGGGATGAACCGGTGCGGTTCTGCACCGGGCCGAACGTGGCCGCGTGGTCCCCGCAGGCGCGGGGATGAACCGTCAGCGTATCGCTCGCGGCGGCAACGTGGGTAGTGTTCCCCGCAGGCGCGGGGATGAACCGTTTACGTTGTATTGGGTGCGGCGAGACGGGCAGTGTTCCCCGCAGGCGCGGGGATGAACCGTCCTGGGTGAGCGAGACGGGCACACTCACGGGGTGTTCCCCGCAGGCGCGGGGATGAACCATCCGGCATCGTTTCCGCGCCGGCATTCACGCCGTGTTCCCCGCAGGCGCGGGGATGAACCGCCTGACACCGGCGACACGGCCCTCAGCCGCTCGTGTTCCCCGCAGGCGCGGGGATGAACCGAACGTGACAACGCCCGTCGCCTGCGCGGTGAGGCGTTCCCCGCAGGCGCGGGGATGAACCGACGCGGGGGCTTCGATAGGCTTGGTAAGCTTCGTGTTCCCCGCAGGCGCGGGGATGAACCG

>NC_009468|1|1|35116-37278|PILER-CR
GTGTTCCCCGCAGGCGCGGGGATGAACC	GCCGCCTGGGAGGATATGGAGCGCTGGATTGAT
GTGTTCCCCGCAGGCGCGGGGATGAACC	GGCGGCGGCGCAATACTACGCAGCGGTGAAAGC
GTGTTCCCCGCAGGCGCGGGGATGAACC	GCGAAAATGGCGTTCTGGGAGGCGCTGACGAAT
GTGTTCCCCGCAGGCGCGGGGATGAACC	GATGTGGTGGCAAGTGACGGGCCGAGTCTGGAA
GTGTTCCCCGCAGGCGCGGGGATGAACC	GATGCGCAAGGCGCGCAAGCGCAAGGGCAACAG
GTGTTCCCCGCAGGCGCGGGGATGAACC	GGTCATTGATCTGTCGCCAGTGGCCGTCGTCCG
GTGTTCCCCGCAGGCGCGGGGATGAACC	GCTTCGCGCCCTGATCGACATGCAGCGCGAGGT
GTGTTCCCCGCAGGCGCGGGGATGAACC	GATCTCCTTGTCTATCTAAAAACTAGCACAGAG
GTGTTCCCCGCAGGCGCGGGGATGAACC	GTTTTTTGAACAGCCGGAATTGATTGAACAGTT
GTGTTCCCCGCAGGCGCGGGGATGAACC	GCGAATGAGGAATTCGCCGCGTTCTATACGCTC
GTGTTCCCCGCAGGCGCGGGGATGAACC	GTGTCGCAATCCGGAGTCGGCTCGCTCCGCCAT
GTGTTCCCCGCAGGCGCGGGGATGAACC	GGGGTATACGTGCTACCGGCGGGGGCTGGAGTA
GTGTTCCCCGCAGGCGCGGGGATGAACC	GTGGCCGATGCTCGCGCAGAAAGTGGGCGTGTG
GTGTTCCCCGCAGGCGCGGGGATGAACC	GCCGTCAAATCGATGGAGCCCGGTCACTGTTGT
GTGTTCCCCGCAGGCGCGGGGATGAACC	GTAAAGCGCGGCGTCCCCCCGCGCCGCAAAAGC
GTGTTCCCCGCAGGCGCGGGGATGAACC	GGAGCGCAAGCACCTGGCGTCGGAGATTTGGGC
GTGTTCCCCGCAGGCGCGGGGATGAACC	GGGTGGAAGATGGTTTGTCATTCGCAGAGCCCA
GTGTTCCCCGCAGGCGCGGGGATGAACC	GCCGGAAGGGACGGGCTCGCATGCCACGGGCAC
GTGTTCCCCGCAGGCGCGGGGATGAACC	GGCAGAGGCAGCAGAGAGGCGATGCACCGAATT
GTGTTCCCCGCAGGCGCGGGGATGAACC	GGATATCGTTGCCAGACGGCGCACGCTCGCAAT
GTGTTCCCCGCAGGCGCGGGGATGAACC	GACAGACCAGAGGAGGCAAGAGAGCGCGACAGG
GTGTTCCCCGCAGGCGCGGGGATGAACC	GATCGTCGATCTAACGACACCGCCAACGATGTT
GTGTTCCCCGCAGGCGCGGGGATGAACC	GGGCGCCAACGGTTGCGTCTTGTTTCTCGTCTA
GTGTTCCCCGCAGGCGCGGGGATGAACC	GGCGGACCCGCTATTACTGACCTGGCTCGATCG
GTGTTCCCCGCAGGCGCGGGGATGAACC	GCGACGCCGGACGCTCGCGAAATCGCCTTTGTG
GTGTTCTCCGCAGGCGCGGGGATGAACC	GACGCCGGTTCGCGGGCGCACAGTGCTTGTGCA
GTGTTCCCCGCAGGCGCGGGGATGAACC	GCTCGCCGGGCTGTGGAAGAAAGCCGGCCCCTG
GTGTTCCCCGCAGGCGCGGGGATGAACC	GTCGTGCAGATCGTGGTTGACAATCCAGGCAGC
GTGTTCCCCGCAGGCGCGGGGATGAACC	GCCGTTCGTCTGGATCGTAGATCGCGAAATGAC
GTGTTCCCCGCAGGCGCGGGGATGAACC	GGATTGTCAGGTAATCGCCGAGCGTCTGATAAA
GTGTTCCCCGCAGGCGCGGGGATGAACC	GGCGCTTCGAGCGCCGCCGGGCCACAAGGTTGT
GTGTTCCCCGCAGGCGCGGGGATGAACC	GGTGCGGTTCTGCACCGGGCCGAACGTGGCCGC
GTGGTCCCCGCAGGCGCGGGGATGAACC	GTCAGCGTATCGCTCGCGGCGGCAACGTGGGTA
GTGTTCCCCGCAGGCGCGGGGATGAACC	GTTTACGTTGTATTGGGTGCGGCGAGACGGGCA
GTGTTCCCCGCAGGCGCGGGGATGAACC	GTCCTGGGTGAGCGAGACGGGCACACTCACGGG
GTGTTCCCCGCAGGCGCGGGGATGAACC

>NC_009468|1|1|35116-37523|CRISPRCasFinder
GTGTTCCCCGCAGGCGCGGGGATGAACCG	CCGCCTGGGAGGATATGGAGCGCTGGATTGAT
GTGTTCCCCGCAGGCGCGGGGATGAACCG	GCGGCGGCGCAATACTACGCAGCGGTGAAAGC
GTGTTCCCCGCAGGCGCGGGGATGAACCG	CGAAAATGGCGTTCTGGGAGGCGCTGACGAAT
GTGTTCCCCGCAGGCGCGGGGATGAACCG	ATGTGGTGGCAAGTGACGGGCCGAGTCTGGAA
GTGTTCCCCGCAGGCGCGGGGATGAACCG	ATGCGCAAGGCGCGCAAGCGCAAGGGCAACAG
GTGTTCCCCGCAGGCGCGGGGATGAACCG	GTCATTGATCTGTCGCCAGTGGCCGTCGTCCG
GTGTTCCCCGCAGGCGCGGGGATGAACCG	CTTCGCGCCCTGATCGACATGCAGCGCGAGGT
GTGTTCCCCGCAGGCGCGGGGATGAACCG	ATCTCCTTGTCTATCTAAAAACTAGCACAGAG
GTGTTCCCCGCAGGCGCGGGGATGAACCG	TTTTTTGAACAGCCGGAATTGATTGAACAGTT
GTGTTCCCCGCAGGCGCGGGGATGAACCG	CGAATGAGGAATTCGCCGCGTTCTATACGCTC
GTGTTCCCCGCAGGCGCGGGGATGAACCG	TGTCGCAATCCGGAGTCGGCTCGCTCCGCCAT
GTGTTCCCCGCAGGCGCGGGGATGAACCG	GGGTATACGTGCTACCGGCGGGGGCTGGAGTA
GTGTTCCCCGCAGGCGCGGGGATGAACCG	TGGCCGATGCTCGCGCAGAAAGTGGGCGTGTG
GTGTTCCCCGCAGGCGCGGGGATGAACCG	CCGTCAAATCGATGGAGCCCGGTCACTGTTGT
GTGTTCCCCGCAGGCGCGGGGATGAACCG	TAAAGCGCGGCGTCCCCCCGCGCCGCAAAAGC
GTGTTCCCCGCAGGCGCGGGGATGAACCG	GAGCGCAAGCACCTGGCGTCGGAGATTTGGGC
GTGTTCCCCGCAGGCGCGGGGATGAACCG	GGTGGAAGATGGTTTGTCATTCGCAGAGCCCA
GTGTTCCCCGCAGGCGCGGGGATGAACCG	CCGGAAGGGACGGGCTCGCATGCCACGGGCAC
GTGTTCCCCGCAGGCGCGGGGATGAACCG	GCAGAGGCAGCAGAGAGGCGATGCACCGAATT
GTGTTCCCCGCAGGCGCGGGGATGAACCG	GATATCGTTGCCAGACGGCGCACGCTCGCAAT
GTGTTCCCCGCAGGCGCGGGGATGAACCG	ACAGACCAGAGGAGGCAAGAGAGCGCGACAGG
GTGTTCCCCGCAGGCGCGGGGATGAACCG	ATCGTCGATCTAACGACACCGCCAACGATGTT
GTGTTCCCCGCAGGCGCGGGGATGAACCG	GGCGCCAACGGTTGCGTCTTGTTTCTCGTCTA
GTGTTCCCCGCAGGCGCGGGGATGAACCG	GCGGACCCGCTATTACTGACCTGGCTCGATCG
GTGTTCCCCGCAGGCGCGGGGATGAACCG	CGACGCCGGACGCTCGCGAAATCGCCTTTGTG
GTGTTCTCCGCAGGCGCGGGGATGAACCG	ACGCCGGTTCGCGGGCGCACAGTGCTTGTGCA
GTGTTCCCCGCAGGCGCGGGGATGAACCG	CTCGCCGGGCTGTGGAAGAAAGCCGGCCCCTG
GTGTTCCCCGCAGGCGCGGGGATGAACCG	TCGTGCAGATCGTGGTTGACAATCCAGGCAGC
GTGTTCCCCGCAGGCGCGGGGATGAACCG	CCGTTCGTCTGGATCGTAGATCGCGAAATGAC
GTGTTCCCCGCAGGCGCGGGGATGAACCG	GATTGTCAGGTAATCGCCGAGCGTCTGATAAA
GTGTTCCCCGCAGGCGCGGGGATGAACCG	GCGCTTCGAGCGCCGCCGGGCCACAAGGTTGT
GTGTTCCCCGCAGGCGCGGGGATGAACCG	GTGCGGTTCTGCACCGGGCCGAACGTGGCCGC
GTGGTCCCCGCAGGCGCGGGGATGAACCG	TCAGCGTATCGCTCGCGGCGGCAACGTGGGTA
GTGTTCCCCGCAGGCGCGGGGATGAACCG	TTTACGTTGTATTGGGTGCGGCGAGACGGGCA
GTGTTCCCCGCAGGCGCGGGGATGAACCG	TCCTGGGTGAGCGAGACGGGCACACTCACGGG
GTGTTCCCCGCAGGCGCGGGGATGAACCA	TCCGGCATCGTTTCCGCGCCGGCATTCACGCC
GTGTTCCCCGCAGGCGCGGGGATGAACCG	CCTGACACCGGCGACACGGCCCTCAGCCGCTC
GTGTTCCCCGCAGGCGCGGGGATGAACCG	AACGTGACAACGCCCGTCGCCTGCGCGGTGAG
GCGTTCCCCGCAGGCGCGGGGATGAACCG	ACGCGGGGGCTTCGATAGGCTTGGTAAGCTTC
GTGTTCCCCGCAGGCGCGGGGATGAACCG

>NC_009468|1|1|35116-37523|CRT
GTGTTCCCCGCAGGCGCGGGGATGAACCG	CCGCCTGGGAGGATATGGAGCGCTGGATTGAT
GTGTTCCCCGCAGGCGCGGGGATGAACCG	GCGGCGGCGCAATACTACGCAGCGGTGAAAGC
GTGTTCCCCGCAGGCGCGGGGATGAACCG	CGAAAATGGCGTTCTGGGAGGCGCTGACGAAT
GTGTTCCCCGCAGGCGCGGGGATGAACCG	ATGTGGTGGCAAGTGACGGGCCGAGTCTGGAA
GTGTTCCCCGCAGGCGCGGGGATGAACCG	ATGCGCAAGGCGCGCAAGCGCAAGGGCAACAG
GTGTTCCCCGCAGGCGCGGGGATGAACCG	GTCATTGATCTGTCGCCAGTGGCCGTCGTCCG
GTGTTCCCCGCAGGCGCGGGGATGAACCG	CTTCGCGCCCTGATCGACATGCAGCGCGAGGT
GTGTTCCCCGCAGGCGCGGGGATGAACCG	ATCTCCTTGTCTATCTAAAAACTAGCACAGAG
GTGTTCCCCGCAGGCGCGGGGATGAACCG	TTTTTTGAACAGCCGGAATTGATTGAACAGTT
GTGTTCCCCGCAGGCGCGGGGATGAACCG	CGAATGAGGAATTCGCCGCGTTCTATACGCTC
GTGTTCCCCGCAGGCGCGGGGATGAACCG	TGTCGCAATCCGGAGTCGGCTCGCTCCGCCAT
GTGTTCCCCGCAGGCGCGGGGATGAACCG	GGGTATACGTGCTACCGGCGGGGGCTGGAGTA
GTGTTCCCCGCAGGCGCGGGGATGAACCG	TGGCCGATGCTCGCGCAGAAAGTGGGCGTGTG
GTGTTCCCCGCAGGCGCGGGGATGAACCG	CCGTCAAATCGATGGAGCCCGGTCACTGTTGT
GTGTTCCCCGCAGGCGCGGGGATGAACCG	TAAAGCGCGGCGTCCCCCCGCGCCGCAAAAGC
GTGTTCCCCGCAGGCGCGGGGATGAACCG	GAGCGCAAGCACCTGGCGTCGGAGATTTGGGC
GTGTTCCCCGCAGGCGCGGGGATGAACCG	GGTGGAAGATGGTTTGTCATTCGCAGAGCCCA
GTGTTCCCCGCAGGCGCGGGGATGAACCG	CCGGAAGGGACGGGCTCGCATGCCACGGGCAC
GTGTTCCCCGCAGGCGCGGGGATGAACCG	GCAGAGGCAGCAGAGAGGCGATGCACCGAATT
GTGTTCCCCGCAGGCGCGGGGATGAACCG	GATATCGTTGCCAGACGGCGCACGCTCGCAAT
GTGTTCCCCGCAGGCGCGGGGATGAACCG	ACAGACCAGAGGAGGCAAGAGAGCGCGACAGG
GTGTTCCCCGCAGGCGCGGGGATGAACCG	ATCGTCGATCTAACGACACCGCCAACGATGTT
GTGTTCCCCGCAGGCGCGGGGATGAACCG	GGCGCCAACGGTTGCGTCTTGTTTCTCGTCTA
GTGTTCCCCGCAGGCGCGGGGATGAACCG	GCGGACCCGCTATTACTGACCTGGCTCGATCG
GTGTTCCCCGCAGGCGCGGGGATGAACCG	CGACGCCGGACGCTCGCGAAATCGCCTTTGTG
GTGTTCTCCGCAGGCGCGGGGATGAACCG	ACGCCGGTTCGCGGGCGCACAGTGCTTGTGCA
GTGTTCCCCGCAGGCGCGGGGATGAACCG	CTCGCCGGGCTGTGGAAGAAAGCCGGCCCCTG
GTGTTCCCCGCAGGCGCGGGGATGAACCG	TCGTGCAGATCGTGGTTGACAATCCAGGCAGC
GTGTTCCCCGCAGGCGCGGGGATGAACCG	CCGTTCGTCTGGATCGTAGATCGCGAAATGAC
GTGTTCCCCGCAGGCGCGGGGATGAACCG	GATTGTCAGGTAATCGCCGAGCGTCTGATAAA
GTGTTCCCCGCAGGCGCGGGGATGAACCG	GCGCTTCGAGCGCCGCCGGGCCACAAGGTTGT
GTGTTCCCCGCAGGCGCGGGGATGAACCG	GTGCGGTTCTGCACCGGGCCGAACGTGGCCGC
GTGGTCCCCGCAGGCGCGGGGATGAACCG	TCAGCGTATCGCTCGCGGCGGCAACGTGGGTA
GTGTTCCCCGCAGGCGCGGGGATGAACCG	TTTACGTTGTATTGGGTGCGGCGAGACGGGCA
GTGTTCCCCGCAGGCGCGGGGATGAACCG	TCCTGGGTGAGCGAGACGGGCACACTCACGGG
GTGTTCCCCGCAGGCGCGGGGATGAACCA	TCCGGCATCGTTTCCGCGCCGGCATTCACGCC
GTGTTCCCCGCAGGCGCGGGGATGAACCG	CCTGACACCGGCGACACGGCCCTCAGCCGCTC
GTGTTCCCCGCAGGCGCGGGGATGAACCG	AACGTGACAACGCCCGTCGCCTGCGCGGTGAG
GCGTTCCCCGCAGGCGCGGGGATGAACCG	ACGCGGGGGCTTCGATAGGCTTGGTAAGCTTC
GTGTTCCCCGCAGGCGCGGGGATGAACCG

Protein	Signature genes	Signature genes Name	Protein_function
NC_009468.1\|WP_081432825.1\|44446_45445_+\|Holliday-junction-branch-migration-DNA-helicase-RuvB	unknown	unknown	gnl\|CDD\|234619
NC_009468.1\|WP_011930725.1\|29132_30722_+\|type-I-E-CRISPR-associated-protein-Cse1/CasA	cas8e	cd09729_cas8e_CAS-I-E	gnl\|CDD\|187860
NC_009468.1\|WP_011930721.1\|33126_33804_+\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	cas6e	cd09727_cas6e_CAS-I-E	gnl\|CDD\|215025
NC_009468.1\|WP_011930728.1\|25325_25595_-\|hypothetical-protein	unknown	unknown	unknown
NC_009468.1\|WP_011930716.1\|42243_43443_+\|IS200/IS605-family-element-transposase-accessory-protein-TnpB	c2c9_V-U4	-	gnl\|CDD\|223747
NC_009468.1\|WP_011930724.1\|30718_31258_+\|type-I-E-CRISPR-associated-protein-Cse2/CasB	cse2gr11	cd09731_cse2gr11_CAS-I-E	gnl\|CDD\|187862
NC_009468.1\|WP_011930726.1\|26163_28842_+\|CRISPR-associated-helicase/endonuclease-Cas3	cas3	cd09639_cas3_CAS-I	gnl\|CDD\|182031
NC_009468.1\|WP_011930718.1\|41007_41421_-\|hypothetical-protein	unknown	unknown	unknown
NC_009468.1\|WP_043508878.1\|41620_42250_+\|IS607-family-transposase	unknown	unknown	gnl\|CDD\|239738
NC_009468.1\|WP_043508880.1\|43496_43679_+\|hypothetical-protein	unknown	unknown	unknown
NC_009468.1\|WP_011930723.1\|31257_32370_+\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	cas7	pfam09344_cas7_CAS-I-E	gnl\|CDD\|378153
NC_009468.1\|WP_043508875.1\|25766_26090_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|237030
NC_009468.1\|WP_011930715.1\|43829_44450_+\|Holliday-junction-branch-migration-protein-RuvA	unknown	unknown	gnl\|CDD\|234645
NC_009468.1\|WP_081432824.1\|34739_35066_+\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	cas2	pfam09707_cas2_CAS-I-E	gnl\|CDD\|236930
NC_009468.1\|WP_081432839.1\|46164_46320_+\|DUF2384-domain-containing-protein	unknown	unknown	gnl\|CDD\|378249
NC_009468.1\|WP_011930719.1\|40186_41011_-\|hypothetical-protein	unknown	unknown	unknown
NC_009468.1\|WP_011930722.1\|32371_33121_+\|type-I-E-CRISPR-associated-protein-Cas5/CasD	cas5	cd09645_cas5_CAS-I-E	gnl\|CDD\|273842
NC_009468.1\|WP_011930713.1\|45444_45996_+\|hypothetical-protein	unknown	unknown	unknown
NC_009468.1\|WP_007424557.1\|33796_34759_+\|type-I-E-CRISPR-associated-endonuclease-Cas1	cas1	cd09719_cas1_CAS-I-E	gnl\|CDD\|274693
NC_009468.1\|WP_011930720.1\|38111_40184_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|376986

Protein	Function_ID	Function_description	E-value
NC_009468.1\|WP_081432825.1\|44446_45445_+\|Holliday-junction-branch-migration-DNA-helicase-RuvB	gnl\|CDD\|234619	PRK00080, ruvB, Holliday junction branch migration DNA helicase RuvB.	0
NC_009468.1\|WP_011930725.1\|29132_30722_+\|type-I-E-CRISPR-associated-protein-Cse1/CasA	gnl\|CDD\|187860	cd09729, Cse1_I-E, CRISPR/Cas system-associated protein Cse1. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Large proteins, some contain Zn-finger domain; subunit of the Cascade complex; signature gene for I-E subtype; also known as Cse1/CasA/YgcL family.	5.42568e-127
NC_009468.1\|WP_011930721.1\|33126_33804_+\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	gnl\|CDD\|215025	smart01101, CRISPR_assoc, This domain forms an anti-parallel beta strand structure with flanking alpha helical regions.	5.47615e-67
NC_009468.1\|WP_011930716.1\|42243_43443_+\|IS200/IS605-family-element-transposase-accessory-protein-TnpB	gnl\|CDD\|223747	COG0675, COG0675, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	1.13947e-52
NC_009468.1\|WP_011930724.1\|30718_31258_+\|type-I-E-CRISPR-associated-protein-Cse2/CasB	gnl\|CDD\|187862	cd09731, Cse2_I-E, CRISPR/Cas system-associated protein Cse2. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Small alpha-helical protein; also known as Cse2/CasB/YgcK family; specific gene for I-E subtype;.	1.59549e-18
NC_009468.1\|WP_011930726.1\|26163_28842_+\|CRISPR-associated-helicase/endonuclease-Cas3	gnl\|CDD\|182031	PRK09694, PRK09694, CRISPR-associated helicase/endonuclease Cas3.	3.23117e-121
NC_009468.1\|WP_043508878.1\|41620_42250_+\|IS607-family-transposase	gnl\|CDD\|239738	cd03769, SR_IS607_transposase_like, Serine Recombinase (SR) family, IS607-like transposase subfamily, catalytic domain; members contain a DNA binding domain with homology to MerR/SoxR located N-terminal to the catalytic domain. Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and the enzyme. They are functionally versatile and include resolvases, invertases, integrases, and transposases. This subfamily is composed of proteins that catalyze the transposition of insertion sequence (IS) elements such as IS607 from Helicobacter and IS1535 from Mycobacterium, and similar proteins from other bacteria and several archaeal species. IS elements are DNA segments that move to new sites in prokaryotic and eukaryotic genomes causing insertion mutations and gene rearrangements.	1.24511e-72
NC_009468.1\|WP_011930723.1\|31257_32370_+\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	gnl\|CDD\|378153	pfam09344, Cas_CT1975, CT1975-like protein. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family is represented by CT1975 of Chlorobium tepidum.	2.20815e-114
NC_009468.1\|WP_043508875.1\|25766_26090_+\|hypothetical-protein	gnl\|CDD\|237030	PRK12270, kgd, multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine pyrophosphate-binding subunit/dihydrolipoyllysine-residue succinyltransferase subunit.	0.00860427
NC_009468.1\|WP_011930715.1\|43829_44450_+\|Holliday-junction-branch-migration-protein-RuvA	gnl\|CDD\|234645	PRK00116, ruvA, Holliday junction branch migration protein RuvA.	2.29924e-42
NC_009468.1\|WP_081432824.1\|34739_35066_+\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	gnl\|CDD\|236930	PRK11558, PRK11558, putative ssRNA endonuclease; Provisional.	1.06128e-51
NC_009468.1\|WP_081432839.1\|46164_46320_+\|DUF2384-domain-containing-protein	gnl\|CDD\|378249	pfam09722, DUF2384, Protein of unknown function (DUF2384). Proteins in this family are found almost exclusively in the Proteobacteria, but also in Gloeobacter violaceus PCC 7421, a cyanobacterium. The function is unknown.	1.01362e-09
NC_009468.1\|WP_011930722.1\|32371_33121_+\|type-I-E-CRISPR-associated-protein-Cas5/CasD	gnl\|CDD\|273842	TIGR01868, hypothetical_protein, CRISPR-associated protein Cas5/CasD, subtype I-E/ECOLI. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family is part of the ECOLI subtype CRISPR/Cas locus, and now characterized as part of the CASCADE complex of that system. It shares a small N-terminal homology region with members of several other CRISPR/Cas subtypes, and we view the families that share this region as being Cas5.	1.38582e-34
NC_009468.1\|WP_007424557.1\|33796_34759_+\|type-I-E-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|274693	TIGR03638, cas1_ECOLI, CRISPR-associated endonuclease Cas1, subtype I-E/ECOLI. The CRISPR-associated protein Cas1 is virtually universal to CRISPR systems. CRISPR, an acronym for Clustered Regularly Interspaced Short Palindromic Repeats, is prokaryotic immunity system for foreign DNA, mostly from phage. CRISPR systems belong to different subtypes, distinguished by both nature of the repeats, the makeup of the cohort of associated Cas proteins, and by molecular phylogeny within the more universal Cas proteins such as this one. This model is of type EXCEPTION and provides more specific information than the EQUIVALOG model TIGR00287. It describes the Cas1 protein particular to the ECOLI subtype of CRISPR/Cas system.	3.36109e-135
NC_009468.1\|WP_011930720.1\|38111_40184_-\|hypothetical-protein	gnl\|CDD\|376986	pfam03090, Replicase, Replicase family. This is a family of bacterial plasmid DNA replication initiator proteins. pfam01051 is a similar family. These RepA proteins exist as monomers and dimers in equilibrium: monomers bind directly to repeated DNA sequences and thus activate replication; dimers repress repA transcription by binding an inversely repeated DNA operator. Dimer dissociation can occur spontaneously or be mediated by Hsp70 chaperones.	2.22453e-08

>NC_009468.1|WP_081432824.1|34739_35066_+|type-I-E-CRISPR-associated-endoribonuclease-Cas2
MLVIVVENAPPRLRGRLGVWLLEVRAGVYVGNYGRKVREMLWEQVRGAIGDGNGIIAWTSPSDAGFEFDTCGKNRRVPVDLDGFCLVAFTEEAETAPPLHTGEPRHRR
>NC_009468.1|WP_007424557.1|33796_34759_+|type-I-E-CRISPR-associated-endonuclease-Cas1
MSDQAPGLPPPRPIPIRERSSILFLERGQLDVIDGSFVVVDQRGIRTVIPVGGITCLMLEPGTRVSHAAVCLAARAGTLLIWVGEAGVRLYAAGQPGGARSDRLLYQARLALDDEARLRVVRRMYSIRFQEEPPQRRSVDQLRGIEGVRVRELYKLMAQRHGVSWAGRRYDPQNWGGADLVNRCLSAATAALYGISEAAILAAGYAPAIGFLHSGKPQSFVYDIADLFKFETVVPEAFKVVAAVQSGRGQIDGMAIGEPVGAVRRRCRDAFRRTNVLARIIPAIEDVLAAGGLAVPEAPEEAMPVAIPPPEPTGDAGHRG
>NC_009468.1|WP_011930721.1|33126_33804_+|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE
MWLSKARLNHDQKAVAALASVLVPEDGSARVAATHHLVWSLFAGDADRKRDFLWREERPGHFLILSPDRPGDGGGLCTVESKEFTPALSAGDRLGFSLRANAVVSRGEPGSGRGKRHDVVMDVLRHHPKGERASHRLGLVTEAGAAWLVRQGERHGFVIEGQPACDGYEAIRVLRGRGEKPLTFSQIDFAGVLSVTDPARFIAAIGHGFGRARAFGCGLMLIRRV
>NC_009468.1|WP_011930722.1|32371_33121_+|type-I-E-CRISPR-associated-protein-Cas5/CasD
MKRFLTFTLFAPIASFGAIAVGERRESWSRPARSAVLGLVGACLGIEREDAEEQAALERDFGFALLCGTSGGPLADFHTLQVGRPARGQTFRTRAEELNSNTVDTILTRRDYRVSAWHLAALWVRSVVDPRWALEDLADAMKQPAFTPYLGRRACPLGLPLAPQIIDADSPASALDRRWASGPEAEFRPSLAGTIQDLFVARDRWVGDEGANNLLRSEERRDAPISRTLWQFGLRTEVIEAFSPTENRS
>NC_009468.1|WP_011930723.1|31257_32370_+|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC
MTQFLQVHLLTFFPPSNMNRDDTGRPKTAMVGGAMRLRLSSQALKRAWRTSTIFSEALKGYMGERTQRLGEEILKTLQAEGVSEVQALAVARAVAGQFGKLNEDETPARIQQLAFISPDERKAAFDLARRYAAGELPLPEKAKGKRGKANKTEGEEEVEAPEILLLRESDTAADIALFGRMLADKPAFNREAAAQVAHAITTHRISVDDDYYTAVDDLKRPSEDAGAGFIGETGFGSGVFYTYMSINIDLLIRNLGGGDQARDLAATAIAALVEAAATTAPSGKQNSFAAHGRAGYILAERGKAQPRTLAGAFAKPVEGGDIMDASIGRLEEFREAIDKAYGPTADATKVMRVGGEGSLADIIVFAREGV
>NC_009468.1|WP_011930724.1|30718_31258_+|type-I-E-CRISPR-associated-protein-Cse2/CasB
MIRYRSAAHDWWRDLVPRAGYPGDRAAVAKLRRASTISEAITEEASIALFRRVGATSAEDLPRVALAAAILARVSKEPDGPNAPRSVARVLGPQKTDDVSTAILSPLRFKRLLAVDEPEEQLIAFRRMVAIARGSLPVRDLADALLDWSETRRRRWVFDYWNASEIASTPTTDTPEEPV
>NC_009468.1|WP_011930725.1|29132_30722_+|type-I-E-CRISPR-associated-protein-Cse1/CasA
MFNLLTNPWLPIVRQDGTKSVIAPRGITEDISANPVIAVDWPRADFRLATMELLAGLIATACPPADEDDWLDAWEAPPSPEKLDGALAPLSHAFSFDGPGPRFMQDLADLDADEEPVENLLIEVAGNSGPLVHPGRTKRMGRPAAAISLYTLQSWSPSGGRGNRTGLRGGGPMVTMVAPGRHRSLWHHIWANVPLGRKPEPVDFPRIFPWLSPTITSVNDEVVTPDDVAHPLQVWWGMPRRIRLSFVQLPSPAPCDLTGALDSSVVTGWRQRPHGPQYVGWGTRHPLTPTYQNKAGEEILSVHPNPGGVGYRNWIGLVLRSPDGLRRPAPIVSTWRNDRYRGTEEAKGARLIAGGYDTDNMKARGFMETEVPLVLASSKEVQERLDALATSLVRASERASYQLRKAVQQALYHPGAKVKATAHGIALLGDRVWLETESAFFSALHRAMSLDDTAPERVAWQARLRGLALRIFDDTVPIDPLDRNNVRQVRARFFLGLGLSGYGKDGQSFFQILEMPLPAQEKKSKGKAS
>NC_009468.1|WP_011930726.1|26163_28842_+|CRISPR-associated-helicase/endonuclease-Cas3
MLLPNSWQNVLAFWGKSYTREDKLFAYPIVAHSLDVAAAGSHLPMPLKEFDKRTVYFLLSLHDIGKFSRPFQAQESDLWPSRVLGPWPGRVAGPRHDALTAALLEVFADEGLLDPVFPLGRRGSGWHPSKRSGLIRTIAGHHGRPIDVPDHLEPAVCRQCLDAAREFVQAMLDLFQPSPLPPPQSRRASARMQWQIAGFLTLADWIGSNEIWFPRDGTHSDLDPHDYFREVALPRAAQAGADAGLTPSKARTFTGFSALFPKVDTPSPAQSWAETVPLPEGAVLAIIEDLTGSGKTEAALTLASRIMASGEAKGIFFALPSMATANSMFQRLTDTYLRLFEKGSRPSIALTHGKAGLDPRFRALISASPSSASEPREGEAIPSEAECAAWLAEDRRRSLFADVGIGTIDQALLAVLPVRHAPLRLHGLQGKVLVVDEVHAFDSYMDRELQALLEFHAALGGSAILLSATLPLRMRQSLTDAFRRGAGQEAPRQVTSMHYPLATMVGSEAHTEYSLGVRAGLPRSVTITRVGTEAEALSRVVDAARLGAAVVWIRNSVDDALEAAAAVRMQNIDPIVFHARFAHCDRQSIELEVLRRFGKESVGQARAGVLIATQVVEQSLDLDFDLLVTDLAPVDSLIQRAGRLWRHNRGTRVVGRPEMVVLSPEPSMDADAGWLDPLLPRTNNVYRNPALLWRGARALFAKSDLVTPGDMRPLIEAADNVADTPPGLKMAADGAWAKHLSHRAFAAGAVLDFDEGYTLQSGAWDRETRTPTRLEEREQATLRLARVKDGKVVPYAGLAGDLRQAWTLSEVRVQRYRIAACPPPAGYSEAANEARSQWGRWERESPHMLLAILEVTKQEGQLMLKGEKPDGHPVSAIYDAVDGLRLLPASAG
>NC_009468.1|WP_043508875.1|25766_26090_+|hypothetical-protein
MQKSIQTDDIPNIRLQVDTSIATLRKLDDLRCRLGLSTYAEVIAAALKHEYAALEARRRLASAPTPPPPSSFSKRAAPEPVVPAAPRPQVQARPAPQRVLALGGRER
>NC_009468.1|WP_011930728.1|25325_25595_-|hypothetical-protein
MSDERPPLSPTEKIRDQLREALAAVNGLELEHSFGKLLDALHEAAVNGVQLTEAHNQIIGLIRRRVETTWPETVFGYRGELEAPPDDEV
>NC_009468.1|WP_011930720.1|38111_40184_-|hypothetical-protein
MVKSAVVQIARPAPARRRSGLRLRMLGRTIANEYFYRGGSAARRGPTGADVASRRISPDEWHDYTLAISCARRAMSKLKRDAIMASRRHDRPDDDDLVEMIEKRRHLRAEVKKRIGAGLVLEPDISCGAFVDGVKLRGFRSSLDPILKLFVSKLCKGRYTRRGSRLPSISSSRDKASIFPCPSKALALDDEYVTFNPMMRGVFRVDLDRDFASTEECQEKIRELRLPAPNIITGVSTSGGKLRRPHVYFVVKHSVCFTGNGRNGAKALFKLIGTILTERLAPLGADRFATNTLRGKNPLCERLTTAVVYSEPYSLGFDPHGCESLADLLDLGQYRGKFSNFGAAEDMLLRDGRRGSNAVFRTVGRLCARLVHEFHPESPRRSARYRANLVGTDHALEDFEDAVLRGAQQYFEDCEQLRRQCAKSARYFFTRYDARIASANRRRGAMAAEPEYLAALSKREKQQAGGRYAALKCKEATLIRLAVAAEEIGHLAEDIGVSELARASGVSRMTIYRHRHELERGRYLLAEMRENGAAQGDHTIHAGPTSDCNIQCLDKRDTGKSGSLEEMGTPGAEHPEGVTQSRRQFIKRRGSRFMGSKSGKVRVHALNPVFILEIPGGSGAKRPRIVRIRDDVDELAYEAAVEPTIRFIDDFGRERMGNEPVIYAHNGAVAWKNPDFADRRNLNSANRRSS
>NC_009468.1|WP_011930719.1|40186_41011_-|hypothetical-protein
MIDGQEHDVAAEIRIPLIEGAFFAARDRLASELATSGFDPHVAAAGANQIGEAILESPTQNEDAAWLIAAMAPAGIARRLAGTDARNTRAALIRDGIAPDIARAVVQIAPVSPRGPQAALRQLTRVADAMRVGMDAVVEAMRGRLVDSLAARGIVPKVAREISAALPKAAMRADLHLSEAIANQAAYVLETHPKLGAMSAVHGVIAYRRLGESAAMNQLIHDLRYAPAVAAAPEPMPAGVMEAIELSQRAVDANLANANRVYVEALDDSPKPGS
>NC_009468.1|WP_011930718.1|41007_41421_-|hypothetical-protein
MSARARKTGGLLLGILRVEGAPAQTRYELFPDEQGLIRWRRAMLRRNWREWVAPAIDSAIAEGQLHDVRLLISDPEMLTDRQVDEVSLLYKIAVTFEAIPNMTVLRDEPVAVRDQLSLFGDESEAVEADPLMAGPSP
>NC_009468.1|WP_043508878.1|41620_42250_+|IS607-family-transposase
MNGLVGIGEAARMLGVSITTLRRWEAAGKLVADHTAGGHRRYDIAKLRPDLFHAEDEADRRTIAYARVSSHDQKDDLERQKQVLELYCARQGWKFEIVADLGSGMNYRKKGLKKLLGAIIDGSVGRLVIAHKDRLLRFGADLVFAICEAKNVEVVILNQGEDTTFEEDLAKDVLEIITVFSARLYGSRSHKNQKLLDGVKRAVEESAAC
>NC_009468.1|WP_011930716.1|42243_43443_+|IS200/IS605-family-element-transposase-accessory-protein-TnpB
MLIAHRIALDPTNAQRTYFARASGTARFAWNWALAEWQRQFTARKDDPSLPAPSDASLRRRLNGLKREEFPWMFDVTKCAAQEAIIDLGSAFRNFFEKRGRYPRFKKKGVSDSFCAANEAGTFRTDGEKIKLPVVGWVRLHEALRFTGKLKRVTVSREADRWYASIMVETNDIKPVVQPLPAVGVDLGVTTLATLSRGEAIPGPKAHKALLQRLRRASRALTRKRKGSSNRRKAKAKLARLHARISAIRKDATHKATTMLAKTYRRIGIEALNVRGMARNRHLARSIMDGGFFEFRRQLEYKAKFYGAAVVVADRWFPSSKTCSCCGSVKAELALSQRLFHCDECGYEAGRDHNAARNLENMAASFAVSACGEDRSDAVRKPRVKRASMKQEPDSKLAA
>NC_009468.1|WP_043508880.1|43496_43679_+|hypothetical-protein
MDAETAEIAGSEAAESISENLADDPEDSLEVSTILDDLKIEVWEGALQARPEAEPEFTFT
>NC_009468.1|WP_011930715.1|43829_44450_+|Holliday-junction-branch-migration-protein-RuvA
MITQLTGIPRRIGDQECVIDVHGVGYGVHVPSATLDMIEGEAGPVTILIQTRMSDSEISLYGFATPADLQTFRKLVGVQGVGPATALNLLSQLAPEELWRAIREADQKALTAVKGIGPAAAKRLISELESHAAKLAAEMPAPAARLDLGLSADQLAQSLQRLGHAPSAARAAAQFALNGAKPGDTEQELVARALQAAAGMTTGAAA
>NC_009468.1|WP_081432825.1|44446_45445_+|Holliday-junction-branch-migration-DNA-helicase-RuvB
MSSTIERTPVRTPVALEDDDMSPALRPQGLADFVGQADTMRNLATFIRAALIRGVSLDHVLLNGPPGLGKTTIAQIIAHEMNCNLKTIIGPAVQRAADLAAVLTTMQPNEVLFIDEIHRVQPAAAEILYGAMEDFTLDILIGEGPQARSVRIDLPRFTLIGATTRSGSLPAPLRDRFGIHLGLEFYSPEDLVRIVTRSAGMLGIGMMPEGAMEIARRSRGTPRIANRLLRRVHDFAVVAGVVAITDTIADMALSSLAVDRRGLDKLDRRYIDWIDTVHGGGPVGIDTLATGLGEARETIEDVIEPFLVASGIITRTSRGRVLTPKAYEVEAR
>NC_009468.1|WP_011930713.1|45444_45996_+|hypothetical-protein
MQHRRDQRLMGTVDQLAPLFTTTVQNDIFLIGIDMGDPAHPAGAAILFSGDDEFYGQISDAMPASALSDLAVVFHAADKRIATMMRSSGRRALPREMPDGIASQDLKASPGLVAHRPPFAIIRGANEASGTVLVHLLIQAAGTAEWRTALRVSSGWLGRLAGLAEEASRYPGQALVAQHHSPF
>NC_009468.1|WP_081432839.1|46164_46320_+|DUF2384-domain-containing-protein
MDAIAGGDERSARDWIAAPNSALGARPIDLLASVQGLVDVVAYLDARRASI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_009468_1	1.1\|35144\|33\|NC_009468\|PILER-CR	35144-35176	33	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	35144-35176	0	1.0
NC_009468_1	1.2\|35205\|33\|NC_009468\|PILER-CR	35205-35237	33	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	35205-35237	0	1.0
NC_009468_1	1.3\|35266\|33\|NC_009468\|PILER-CR	35266-35298	33	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	35266-35298	0	1.0
NC_009468_1	1.4\|35327\|33\|NC_009468\|PILER-CR	35327-35359	33	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	35327-35359	0	1.0
NC_009468_1	1.5\|35388\|33\|NC_009468\|PILER-CR	35388-35420	33	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	35388-35420	0	1.0
NC_009468_1	1.6\|35449\|33\|NC_009468\|PILER-CR	35449-35481	33	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	35449-35481	0	1.0
NC_009468_1	1.7\|35510\|33\|NC_009468\|PILER-CR	35510-35542	33	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	35510-35542	0	1.0
NC_009468_1	1.8\|35571\|33\|NC_009468\|PILER-CR	35571-35603	33	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	35571-35603	0	1.0
NC_009468_1	1.9\|35632\|33\|NC_009468\|PILER-CR	35632-35664	33	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	35632-35664	0	1.0
NC_009468_1	1.10\|35693\|33\|NC_009468\|PILER-CR	35693-35725	33	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	35693-35725	0	1.0
NC_009468_1	1.11\|35754\|33\|NC_009468\|PILER-CR	35754-35786	33	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	35754-35786	0	1.0
NC_009468_1	1.12\|35815\|33\|NC_009468\|PILER-CR	35815-35847	33	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	35815-35847	0	1.0
NC_009468_1	1.13\|35876\|33\|NC_009468\|PILER-CR	35876-35908	33	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	35876-35908	0	1.0
NC_009468_1	1.14\|35937\|33\|NC_009468\|PILER-CR	35937-35969	33	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	35937-35969	0	1.0
NC_009468_1	1.15\|35998\|33\|NC_009468\|PILER-CR	35998-36030	33	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	35998-36030	0	1.0
NC_009468_1	1.16\|36059\|33\|NC_009468\|PILER-CR	36059-36091	33	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	36059-36091	0	1.0
NC_009468_1	1.17\|36120\|33\|NC_009468\|PILER-CR	36120-36152	33	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	36120-36152	0	1.0
NC_009468_1	1.18\|36181\|33\|NC_009468\|PILER-CR	36181-36213	33	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	36181-36213	0	1.0
NC_009468_1	1.19\|36242\|33\|NC_009468\|PILER-CR	36242-36274	33	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	36242-36274	0	1.0
NC_009468_1	1.20\|36303\|33\|NC_009468\|PILER-CR	36303-36335	33	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	36303-36335	0	1.0
NC_009468_1	1.21\|36364\|33\|NC_009468\|PILER-CR	36364-36396	33	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	36364-36396	0	1.0
NC_009468_1	1.22\|36425\|33\|NC_009468\|PILER-CR	36425-36457	33	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	36425-36457	0	1.0
NC_009468_1	1.23\|36486\|33\|NC_009468\|PILER-CR	36486-36518	33	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	36486-36518	0	1.0
NC_009468_1	1.24\|36547\|33\|NC_009468\|PILER-CR	36547-36579	33	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	36547-36579	0	1.0
NC_009468_1	1.25\|36608\|33\|NC_009468\|PILER-CR	36608-36640	33	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	36608-36640	0	1.0
NC_009468_1	1.26\|36669\|33\|NC_009468\|PILER-CR	36669-36701	33	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	36669-36701	0	1.0
NC_009468_1	1.27\|36730\|33\|NC_009468\|PILER-CR	36730-36762	33	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	36730-36762	0	1.0
NC_009468_1	1.28\|36791\|33\|NC_009468\|PILER-CR	36791-36823	33	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	36791-36823	0	1.0
NC_009468_1	1.29\|36852\|33\|NC_009468\|PILER-CR	36852-36884	33	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	36852-36884	0	1.0
NC_009468_1	1.30\|36913\|33\|NC_009468\|PILER-CR	36913-36945	33	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	36913-36945	0	1.0
NC_009468_1	1.31\|36974\|33\|NC_009468\|PILER-CR	36974-37006	33	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	36974-37006	0	1.0
NC_009468_1	1.32\|37035\|33\|NC_009468\|PILER-CR	37035-37067	33	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	37035-37067	0	1.0
NC_009468_1	1.33\|37096\|33\|NC_009468\|PILER-CR	37096-37128	33	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	37096-37128	0	1.0
NC_009468_1	1.34\|37157\|33\|NC_009468\|PILER-CR	37157-37189	33	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	37157-37189	0	1.0
NC_009468_1	1.35\|37218\|33\|NC_009468\|PILER-CR	37218-37250	33	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	37218-37250	0	1.0
NC_009468_1	1.36\|35145\|32\|NC_009468\|CRISPRCasFinder,CRT	35145-35176	32	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	35145-35176	0	1.0
NC_009468_1	1.37\|35206\|32\|NC_009468\|CRISPRCasFinder,CRT	35206-35237	32	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	35206-35237	0	1.0
NC_009468_1	1.38\|35267\|32\|NC_009468\|CRISPRCasFinder,CRT	35267-35298	32	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	35267-35298	0	1.0
NC_009468_1	1.39\|35328\|32\|NC_009468\|CRISPRCasFinder,CRT	35328-35359	32	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	35328-35359	0	1.0
NC_009468_1	1.40\|35389\|32\|NC_009468\|CRISPRCasFinder,CRT	35389-35420	32	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	35389-35420	0	1.0
NC_009468_1	1.41\|35450\|32\|NC_009468\|CRISPRCasFinder,CRT	35450-35481	32	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	35450-35481	0	1.0
NC_009468_1	1.42\|35511\|32\|NC_009468\|CRISPRCasFinder,CRT	35511-35542	32	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	35511-35542	0	1.0
NC_009468_1	1.43\|35572\|32\|NC_009468\|CRISPRCasFinder,CRT	35572-35603	32	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	35572-35603	0	1.0
NC_009468_1	1.44\|35633\|32\|NC_009468\|CRISPRCasFinder,CRT	35633-35664	32	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	35633-35664	0	1.0
NC_009468_1	1.45\|35694\|32\|NC_009468\|CRISPRCasFinder,CRT	35694-35725	32	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	35694-35725	0	1.0
NC_009468_1	1.46\|35755\|32\|NC_009468\|CRISPRCasFinder,CRT	35755-35786	32	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	35755-35786	0	1.0
NC_009468_1	1.47\|35816\|32\|NC_009468\|CRISPRCasFinder,CRT	35816-35847	32	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	35816-35847	0	1.0
NC_009468_1	1.48\|35877\|32\|NC_009468\|CRISPRCasFinder,CRT	35877-35908	32	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	35877-35908	0	1.0
NC_009468_1	1.49\|35938\|32\|NC_009468\|CRISPRCasFinder,CRT	35938-35969	32	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	35938-35969	0	1.0
NC_009468_1	1.50\|35999\|32\|NC_009468\|CRISPRCasFinder,CRT	35999-36030	32	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	35999-36030	0	1.0
NC_009468_1	1.51\|36060\|32\|NC_009468\|CRISPRCasFinder,CRT	36060-36091	32	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	36060-36091	0	1.0
NC_009468_1	1.52\|36121\|32\|NC_009468\|CRISPRCasFinder,CRT	36121-36152	32	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	36121-36152	0	1.0
NC_009468_1	1.53\|36182\|32\|NC_009468\|CRISPRCasFinder,CRT	36182-36213	32	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	36182-36213	0	1.0
NC_009468_1	1.54\|36243\|32\|NC_009468\|CRISPRCasFinder,CRT	36243-36274	32	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	36243-36274	0	1.0
NC_009468_1	1.55\|36304\|32\|NC_009468\|CRISPRCasFinder,CRT	36304-36335	32	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	36304-36335	0	1.0
NC_009468_1	1.56\|36365\|32\|NC_009468\|CRISPRCasFinder,CRT	36365-36396	32	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	36365-36396	0	1.0
NC_009468_1	1.57\|36426\|32\|NC_009468\|CRISPRCasFinder,CRT	36426-36457	32	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	36426-36457	0	1.0
NC_009468_1	1.58\|36487\|32\|NC_009468\|CRISPRCasFinder,CRT	36487-36518	32	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	36487-36518	0	1.0
NC_009468_1	1.59\|36548\|32\|NC_009468\|CRISPRCasFinder,CRT	36548-36579	32	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	36548-36579	0	1.0
NC_009468_1	1.60\|36609\|32\|NC_009468\|CRISPRCasFinder,CRT	36609-36640	32	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	36609-36640	0	1.0
NC_009468_1	1.61\|36670\|32\|NC_009468\|CRISPRCasFinder,CRT	36670-36701	32	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	36670-36701	0	1.0
NC_009468_1	1.62\|36731\|32\|NC_009468\|CRISPRCasFinder,CRT	36731-36762	32	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	36731-36762	0	1.0
NC_009468_1	1.63\|36792\|32\|NC_009468\|CRISPRCasFinder,CRT	36792-36823	32	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	36792-36823	0	1.0
NC_009468_1	1.64\|36853\|32\|NC_009468\|CRISPRCasFinder,CRT	36853-36884	32	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	36853-36884	0	1.0
NC_009468_1	1.65\|36914\|32\|NC_009468\|CRISPRCasFinder,CRT	36914-36945	32	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	36914-36945	0	1.0
NC_009468_1	1.66\|36975\|32\|NC_009468\|CRISPRCasFinder,CRT	36975-37006	32	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	36975-37006	0	1.0
NC_009468_1	1.67\|37036\|32\|NC_009468\|CRISPRCasFinder,CRT	37036-37067	32	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	37036-37067	0	1.0
NC_009468_1	1.68\|37097\|32\|NC_009468\|CRISPRCasFinder,CRT	37097-37128	32	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	37097-37128	0	1.0
NC_009468_1	1.69\|37158\|32\|NC_009468\|CRISPRCasFinder,CRT	37158-37189	32	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	37158-37189	0	1.0
NC_009468_1	1.70\|37219\|32\|NC_009468\|CRISPRCasFinder,CRT	37219-37250	32	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	37219-37250	0	1.0
NC_009468_1	1.71\|37280\|32\|NC_009468\|CRISPRCasFinder,CRT	37280-37311	32	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	37280-37311	0	1.0
NC_009468_1	1.72\|37341\|32\|NC_009468\|CRISPRCasFinder,CRT	37341-37372	32	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	37341-37372	0	1.0
NC_009468_1	1.73\|37402\|32\|NC_009468\|CRISPRCasFinder,CRT	37402-37433	32	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	37402-37433	0	1.0
NC_009468_1	1.74\|37463\|32\|NC_009468\|CRISPRCasFinder,CRT	37463-37494	32	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	37463-37494	0	1.0
NC_009468_1	1.36\|35145\|32\|NC_009468\|CRISPRCasFinder,CRT	35145-35176	32	NZ_CP015246	Escherichia coli O91 str. RM7190 plasmid pRM7190-2, complete sequence	42859-42890	6	0.812
NC_009468_1	1.36\|35145\|32\|NC_009468\|CRISPRCasFinder,CRT	35145-35176	32	NZ_CP031907	Escherichia coli O91:H21 strain FWSEC0008 plasmid unnamed17, complete sequence	22669-22700	6	0.812
NC_009468_1	1.36\|35145\|32\|NC_009468\|CRISPRCasFinder,CRT	35145-35176	32	CP042949	Escherichia coli strain ATCC 51435 plasmid pB2F1, complete sequence	73720-73751	6	0.812
NC_009468_1	1.36\|35145\|32\|NC_009468\|CRISPRCasFinder,CRT	35145-35176	32	NZ_CP028431	Escherichia coli strain RM9131 plasmid pRM9131-2, complete sequence	1818-1849	6	0.812
NC_009468_1	1.36\|35145\|32\|NC_009468\|CRISPRCasFinder,CRT	35145-35176	32	NZ_CP028118	Escherichia coli O111 str. RM9322 plasmid pRM9322-1, complete sequence	31724-31755	6	0.812
NC_009468_1	1.36\|35145\|32\|NC_009468\|CRISPRCasFinder,CRT	35145-35176	32	NZ_CP021341	Escherichia coli strain 95NR1 plasmid p95NR1B, complete sequence	69764-69795	6	0.812
NC_009468_1	1.36\|35145\|32\|NC_009468\|CRISPRCasFinder,CRT	35145-35176	32	NZ_CP021337	Escherichia coli strain 95JB1 plasmid p95JB1B, complete sequence	71044-71075	6	0.812
NC_009468_1	1.36\|35145\|32\|NC_009468\|CRISPRCasFinder,CRT	35145-35176	32	NZ_CP029691	Escherichia coli strain SD134209 plasmid pSD134209-2, complete sequence	1818-1849	6	0.812
NC_009468_1	1.36\|35145\|32\|NC_009468\|CRISPRCasFinder,CRT	35145-35176	32	NZ_CP027463	Escherichia coli isolate 07-4299 plasmid unnamed	56811-56842	6	0.812
NC_009468_1	1.36\|35145\|32\|NC_009468\|CRISPRCasFinder,CRT	35145-35176	32	NZ_CP027767	Escherichia coli strain 2013C-3342 plasmid unnamed, complete sequence	26554-26585	6	0.812
NC_009468_1	1.36\|35145\|32\|NC_009468\|CRISPRCasFinder,CRT	35145-35176	32	NZ_AP018805	Escherichia coli strain E2863 plasmid pE2863-3, complete sequence	61353-61384	6	0.812
NC_009468_1	1.36\|35145\|32\|NC_009468\|CRISPRCasFinder,CRT	35145-35176	32	NZ_CP027311	Escherichia coli strain 2014C-4135 plasmid unnamed, complete sequence	44743-44774	6	0.812
NC_009468_1	1.36\|35145\|32\|NC_009468\|CRISPRCasFinder,CRT	35145-35176	32	NZ_CP027576	Escherichia coli strain 2013C-4081 plasmid unnamed3, complete sequence	48545-48576	6	0.812
NC_009468_1	1.36\|35145\|32\|NC_009468\|CRISPRCasFinder,CRT	35145-35176	32	NZ_CP027458	Escherichia coli strain 88-3493 plasmid unnamed, complete sequence	76065-76096	6	0.812
NC_009468_1	1.36\|35145\|32\|NC_009468\|CRISPRCasFinder,CRT	35145-35176	32	NZ_CP027553	Escherichia coli strain 2015C-4498 plasmid unnamed, complete sequence	47850-47881	6	0.812
NC_009468_1	1.36\|35145\|32\|NC_009468\|CRISPRCasFinder,CRT	35145-35176	32	NZ_CP027367	Escherichia coli strain 89-3156 plasmid unnamed, complete sequence	52973-53004	6	0.812
NC_009468_1	1.36\|35145\|32\|NC_009468\|CRISPRCasFinder,CRT	35145-35176	32	NZ_CP028434	Escherichia coli strain RM9975 plasmid pRM9975-2, complete sequence	1818-1849	6	0.812
NC_009468_1	1.36\|35145\|32\|NC_009468\|CRISPRCasFinder,CRT	35145-35176	32	NZ_AP019763	Escherichia coli O111:H- strain 110512 plasmid pO111-110512_2, complete sequence	61388-61419	6	0.812
NC_009468_1	1.36\|35145\|32\|NC_009468\|CRISPRCasFinder,CRT	35145-35176	32	NZ_CP024291	Escherichia coli O178:H19 strain 2012C-4431 plasmid unnamed2, complete sequence	61056-61087	6	0.812
NC_009468_1	1.36\|35145\|32\|NC_009468\|CRISPRCasFinder,CRT	35145-35176	32	NZ_CP023164	Escherichia coli O22:H8 strain RM10809-3 plasmid pRM10809-3, complete sequence	41364-41395	6	0.812
NC_009468_1	1.36\|35145\|32\|NC_009468\|CRISPRCasFinder,CRT	35145-35176	32	NZ_AP018800	Escherichia coli strain E2855 plasmid pE2855-4, complete sequence	62610-62641	6	0.812
NC_009468_1	1.36\|35145\|32\|NC_009468\|CRISPRCasFinder,CRT	35145-35176	32	NC_013366	Escherichia coli O111:H- str. 11128 plasmid pO111_3, complete sequence	15407-15438	6	0.812
NC_009468_1	1.42\|35511\|32\|NC_009468\|CRISPRCasFinder,CRT	35511-35542	32	NZ_CP010729	Phaeobacter inhibens strain P88 plasmid pP88_d, complete sequence	39282-39313	6	0.812
NC_009468_1	1.67\|37036\|32\|NC_009468\|CRISPRCasFinder,CRT	37036-37067	32	CP054927	Streptomyces fulvissimus strain NA06532 plasmid unnamed1, complete sequence	45136-45167	6	0.812
NC_009468_1	1.5\|35388\|33\|NC_009468\|PILER-CR	35388-35420	33	NZ_CP039644	Azospirillum sp. TSA2s plasmid p2, complete sequence	95416-95448	7	0.788
NC_009468_1	1.32\|37035\|33\|NC_009468\|PILER-CR	37035-37067	33	CP054927	Streptomyces fulvissimus strain NA06532 plasmid unnamed1, complete sequence	45135-45167	7	0.788
NC_009468_1	1.40\|35389\|32\|NC_009468\|CRISPRCasFinder,CRT	35389-35420	32	NZ_CP007735	Klebsiella pneumoniae subsp. pneumoniae KPNIH27 plasmid pKPN-a41, complete sequence	43466-43497	7	0.781
NC_009468_1	1.40\|35389\|32\|NC_009468\|CRISPRCasFinder,CRT	35389-35420	32	CP032292	UNVERIFIED_ORG: Enterobacter cloacae strain AR_0073 plasmid unnamed1, complete sequence	52958-52989	7	0.781
NC_009468_1	1.40\|35389\|32\|NC_009468\|CRISPRCasFinder,CRT	35389-35420	32	NZ_CP039644	Azospirillum sp. TSA2s plasmid p2, complete sequence	95416-95447	7	0.781
NC_009468_1	1.42\|35511\|32\|NC_009468\|CRISPRCasFinder,CRT	35511-35542	32	NZ_CP005192	Sphingobium sp. MI1205 plasmid pMI3, complete sequence	32165-32196	7	0.781
NC_009468_1	1.42\|35511\|32\|NC_009468\|CRISPRCasFinder,CRT	35511-35542	32	NZ_CP005193	Sphingobium sp. MI1205 plasmid pMI4, complete sequence	17230-17261	7	0.781
NC_009468_1	1.42\|35511\|32\|NC_009468\|CRISPRCasFinder,CRT	35511-35542	32	NC_020563	Sphingomonas sp. MM-1 plasmid pISP4, complete sequence	32094-32125	7	0.781
NC_009468_1	1.42\|35511\|32\|NC_009468\|CRISPRCasFinder,CRT	35511-35542	32	NZ_CP005087	Sphingobium sp. TKS plasmid pTK3, complete sequence	28018-28049	7	0.781
NC_009468_1	1.42\|35511\|32\|NC_009468\|CRISPRCasFinder,CRT	35511-35542	32	NC_020562	Sphingomonas sp. MM-1 plasmid pISP1, complete sequence	160547-160578	7	0.781
NC_009468_1	1.64\|36853\|32\|NC_009468\|CRISPRCasFinder,CRT	36853-36884	32	NZ_AP022333	Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49a, complete sequence	12425-12456	7	0.781
NC_009468_1	1.67\|37036\|32\|NC_009468\|CRISPRCasFinder,CRT	37036-37067	32	NZ_CP007130	Gemmatirosa kalamazoonesis strain KBS708 plasmid 2, complete sequence	986541-986572	7	0.781
NC_009468_1	1.73\|37402\|32\|NC_009468\|CRISPRCasFinder,CRT	37402-37433	32	CP031731	Stenotrophomonas rhizophila strain GA1 plasmid unnamed2, complete sequence	36914-36945	7	0.781
NC_009468_1	1.5\|35388\|33\|NC_009468\|PILER-CR	35388-35420	33	NZ_CP007735	Klebsiella pneumoniae subsp. pneumoniae KPNIH27 plasmid pKPN-a41, complete sequence	43465-43497	8	0.758
NC_009468_1	1.5\|35388\|33\|NC_009468\|PILER-CR	35388-35420	33	NZ_CP010598	Phaeobacter inhibens strain P10 plasmid pP10_c, complete sequence	21604-21636	8	0.758
NC_009468_1	1.5\|35388\|33\|NC_009468\|PILER-CR	35388-35420	33	NC_018288	Phaeobacter inhibens DSM 17395 plasmid pPGA1_65, complete sequence	44736-44768	8	0.758
NC_009468_1	1.5\|35388\|33\|NC_009468\|PILER-CR	35388-35420	33	NZ_CP016368	Phaeobacter porticola strain P97 plasmid pP97_d, complete sequence	21415-21447	8	0.758
NC_009468_1	1.5\|35388\|33\|NC_009468\|PILER-CR	35388-35420	33	CP032292	UNVERIFIED_ORG: Enterobacter cloacae strain AR_0073 plasmid unnamed1, complete sequence	52957-52989	8	0.758
NC_009468_1	1.7\|35510\|33\|NC_009468\|PILER-CR	35510-35542	33	NZ_CP005192	Sphingobium sp. MI1205 plasmid pMI3, complete sequence	32165-32197	8	0.758
NC_009468_1	1.7\|35510\|33\|NC_009468\|PILER-CR	35510-35542	33	NZ_CP005087	Sphingobium sp. TKS plasmid pTK3, complete sequence	28018-28050	8	0.758
NC_009468_1	1.7\|35510\|33\|NC_009468\|PILER-CR	35510-35542	33	NC_020562	Sphingomonas sp. MM-1 plasmid pISP1, complete sequence	160547-160579	8	0.758
NC_009468_1	1.7\|35510\|33\|NC_009468\|PILER-CR	35510-35542	33	MN813686	Mycobacterium phage BirdsNest, complete genome	44774-44806	8	0.758
NC_009468_1	1.7\|35510\|33\|NC_009468\|PILER-CR	35510-35542	33	NZ_CP005193	Sphingobium sp. MI1205 plasmid pMI4, complete sequence	17229-17261	8	0.758
NC_009468_1	1.7\|35510\|33\|NC_009468\|PILER-CR	35510-35542	33	NC_020563	Sphingomonas sp. MM-1 plasmid pISP4, complete sequence	32093-32125	8	0.758
NC_009468_1	1.10\|35693\|33\|NC_009468\|PILER-CR	35693-35725	33	NZ_AP014579	Burkholderia sp. RPE67 plasmid p1, complete sequence	228796-228828	8	0.758
NC_009468_1	1.10\|35693\|33\|NC_009468\|PILER-CR	35693-35725	33	NC_016626	Burkholderia sp. YI23 plasmid byi_1p, complete sequence	23353-23385	8	0.758
NC_009468_1	1.29\|36852\|33\|NC_009468\|PILER-CR	36852-36884	33	NZ_AP022333	Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49a, complete sequence	12424-12456	8	0.758
NC_009468_1	1.32\|37035\|33\|NC_009468\|PILER-CR	37035-37067	33	NZ_CP016083	Streptomyces sp. SAT1 plasmid unnamed3, complete sequence	643959-643991	8	0.758
NC_009468_1	1.32\|37035\|33\|NC_009468\|PILER-CR	37035-37067	33	NZ_CP015737	Shinella sp. HZN7 plasmid pShin-01, complete sequence	176101-176133	8	0.758
NC_009468_1	1.40\|35389\|32\|NC_009468\|CRISPRCasFinder,CRT	35389-35420	32	NZ_CP010598	Phaeobacter inhibens strain P10 plasmid pP10_c, complete sequence	21605-21636	8	0.75
NC_009468_1	1.40\|35389\|32\|NC_009468\|CRISPRCasFinder,CRT	35389-35420	32	NC_018288	Phaeobacter inhibens DSM 17395 plasmid pPGA1_65, complete sequence	44736-44767	8	0.75
NC_009468_1	1.40\|35389\|32\|NC_009468\|CRISPRCasFinder,CRT	35389-35420	32	NZ_CP016368	Phaeobacter porticola strain P97 plasmid pP97_d, complete sequence	21416-21447	8	0.75
NC_009468_1	1.42\|35511\|32\|NC_009468\|CRISPRCasFinder,CRT	35511-35542	32	MN813686	Mycobacterium phage BirdsNest, complete genome	44774-44805	8	0.75
NC_009468_1	1.42\|35511\|32\|NC_009468\|CRISPRCasFinder,CRT	35511-35542	32	NC_022049	Paracoccus aminophilus JCM 7686 plasmid pAMI4, complete sequence	211552-211583	8	0.75
NC_009468_1	1.44\|35633\|32\|NC_009468\|CRISPRCasFinder,CRT	35633-35664	32	NZ_CP032695	Rhizobium jaguaris strain CCGE525 plasmid pRCCGE525c, complete sequence	983184-983215	8	0.75
NC_009468_1	1.45\|35694\|32\|NC_009468\|CRISPRCasFinder,CRT	35694-35725	32	NZ_CP007516	Rubrobacter radiotolerans strain RSPS-4 plasmid 2, complete sequence	58306-58337	8	0.75
NC_009468_1	1.45\|35694\|32\|NC_009468\|CRISPRCasFinder,CRT	35694-35725	32	NZ_AP014579	Burkholderia sp. RPE67 plasmid p1, complete sequence	228796-228827	8	0.75
NC_009468_1	1.45\|35694\|32\|NC_009468\|CRISPRCasFinder,CRT	35694-35725	32	NC_016626	Burkholderia sp. YI23 plasmid byi_1p, complete sequence	23353-23384	8	0.75
NC_009468_1	1.46\|35755\|32\|NC_009468\|CRISPRCasFinder,CRT	35755-35786	32	KM389229	UNVERIFIED: Pseudomonas phage F_TK1718sp/PAK clone contig00001 genomic sequence	15951-15982	8	0.75
NC_009468_1	1.55\|36304\|32\|NC_009468\|CRISPRCasFinder,CRT	36304-36335	32	NZ_CP006991	Rhizobium sp. IE4771 plasmid pRetIE4771e, complete sequence	430619-430650	8	0.75
NC_009468_1	1.55\|36304\|32\|NC_009468\|CRISPRCasFinder,CRT	36304-36335	32	NZ_CP021128	Rhizobium sp. Kim5 plasmid pRetKim5d, complete sequence	380673-380704	8	0.75
NC_009468_1	1.55\|36304\|32\|NC_009468\|CRISPRCasFinder,CRT	36304-36335	32	CP007645	Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803d, complete sequence	437207-437238	8	0.75
NC_009468_1	1.67\|37036\|32\|NC_009468\|CRISPRCasFinder,CRT	37036-37067	32	NZ_CP049157	Caballeronia sp. SBC1 plasmid pSBC1_1, complete sequence	728111-728142	8	0.75
NC_009468_1	1.67\|37036\|32\|NC_009468\|CRISPRCasFinder,CRT	37036-37067	32	NZ_CP049317	Caballeronia sp. SBC2 plasmid pSBC2-1, complete sequence	912935-912966	8	0.75
NC_009468_1	1.67\|37036\|32\|NC_009468\|CRISPRCasFinder,CRT	37036-37067	32	NZ_CP038636	Cupriavidus oxalaticus strain X32 plasmid unnamed1, complete sequence	591988-592019	8	0.75
NC_009468_1	1.67\|37036\|32\|NC_009468\|CRISPRCasFinder,CRT	37036-37067	32	NZ_CP016083	Streptomyces sp. SAT1 plasmid unnamed3, complete sequence	643959-643990	8	0.75
NC_009468_1	1.67\|37036\|32\|NC_009468\|CRISPRCasFinder,CRT	37036-37067	32	NZ_CP015737	Shinella sp. HZN7 plasmid pShin-01, complete sequence	176102-176133	8	0.75
NC_009468_1	1.67\|37036\|32\|NC_009468\|CRISPRCasFinder,CRT	37036-37067	32	MT270409	Phaeobacter phage MD18, complete genome	69047-69078	8	0.75
NC_009468_1	1.71\|37280\|32\|NC_009468\|CRISPRCasFinder,CRT	37280-37311	32	NC_019849	Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence	1398013-1398044	8	0.75
NC_009468_1	1.71\|37280\|32\|NC_009468\|CRISPRCasFinder,CRT	37280-37311	32	NC_003078	Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence	348544-348575	8	0.75
NC_009468_1	1.71\|37280\|32\|NC_009468\|CRISPRCasFinder,CRT	37280-37311	32	NZ_CP019586	Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence	350257-350288	8	0.75
NC_009468_1	1.71\|37280\|32\|NC_009468\|CRISPRCasFinder,CRT	37280-37311	32	NC_017326	Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence	1358779-1358810	8	0.75
NC_009468_1	1.71\|37280\|32\|NC_009468\|CRISPRCasFinder,CRT	37280-37311	32	NZ_CP021799	Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence	416081-416112	8	0.75
NC_009468_1	1.71\|37280\|32\|NC_009468\|CRISPRCasFinder,CRT	37280-37311	32	NC_017323	Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence	949639-949670	8	0.75
NC_009468_1	1.71\|37280\|32\|NC_009468\|CRISPRCasFinder,CRT	37280-37311	32	NZ_CP009146	Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence	1320742-1320773	8	0.75
NC_009468_1	1.71\|37280\|32\|NC_009468\|CRISPRCasFinder,CRT	37280-37311	32	NC_018701	Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence	1378237-1378268	8	0.75
NC_009468_1	1.71\|37280\|32\|NC_009468\|CRISPRCasFinder,CRT	37280-37311	32	NZ_CP021828	Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence	1600462-1600493	8	0.75
NC_009468_1	1.71\|37280\|32\|NC_009468\|CRISPRCasFinder,CRT	37280-37311	32	NZ_CP021802	Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence	1989938-1989969	8	0.75
NC_009468_1	1.71\|37280\|32\|NC_009468\|CRISPRCasFinder,CRT	37280-37311	32	NZ_CP021820	Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence	55167-55198	8	0.75
NC_009468_1	1.71\|37280\|32\|NC_009468\|CRISPRCasFinder,CRT	37280-37311	32	NZ_CP021831	Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence	1566119-1566150	8	0.75
NC_009468_1	1.71\|37280\|32\|NC_009468\|CRISPRCasFinder,CRT	37280-37311	32	NZ_CP021823	Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence	31442-31473	8	0.75
NC_009468_1	1.71\|37280\|32\|NC_009468\|CRISPRCasFinder,CRT	37280-37311	32	NZ_CP021814	Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence	1286355-1286386	8	0.75
NC_009468_1	1.71\|37280\|32\|NC_009468\|CRISPRCasFinder,CRT	37280-37311	32	NZ_CP021795	Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence	1249611-1249642	8	0.75
NC_009468_1	1.71\|37280\|32\|NC_009468\|CRISPRCasFinder,CRT	37280-37311	32	NZ_CP021810	Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence	502134-502165	8	0.75
NC_009468_1	1.71\|37280\|32\|NC_009468\|CRISPRCasFinder,CRT	37280-37311	32	NZ_CP021806	Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence	1302349-1302380	8	0.75
NC_009468_1	1.71\|37280\|32\|NC_009468\|CRISPRCasFinder,CRT	37280-37311	32	NZ_CP021218	Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence	1554779-1554810	8	0.75
NC_009468_1	1.71\|37280\|32\|NC_009468\|CRISPRCasFinder,CRT	37280-37311	32	NZ_CP026527	Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence	1386643-1386674	8	0.75
NC_009468_1	1.71\|37280\|32\|NC_009468\|CRISPRCasFinder,CRT	37280-37311	32	NZ_CP019484	Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence	558267-558298	8	0.75
NC_009468_1	1.71\|37280\|32\|NC_009468\|CRISPRCasFinder,CRT	37280-37311	32	NZ_CP019487	Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence	345808-345839	8	0.75
NC_009468_1	1.71\|37280\|32\|NC_009468\|CRISPRCasFinder,CRT	37280-37311	32	NC_020560	Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence	348544-348575	8	0.75
NC_009468_1	1.72\|37341\|32\|NC_009468\|CRISPRCasFinder,CRT	37341-37372	32	NZ_CP054621	Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence	166339-166370	8	0.75
NC_009468_1	1.73\|37402\|32\|NC_009468\|CRISPRCasFinder,CRT	37402-37433	32	NZ_CP018231	Rhizobium leguminosarum strain Vaf-108 plasmid unnamed3	260318-260349	8	0.75
NC_009468_1	1.7\|35510\|33\|NC_009468\|PILER-CR	35510-35542	33	NC_022049	Paracoccus aminophilus JCM 7686 plasmid pAMI4, complete sequence	211551-211583	9	0.727
NC_009468_1	1.7\|35510\|33\|NC_009468\|PILER-CR	35510-35542	33	NZ_CP044082	Paracoccus yeei strain FDAARGOS_643 plasmid unnamed4, complete sequence	44494-44526	9	0.727
NC_009468_1	1.7\|35510\|33\|NC_009468\|PILER-CR	35510-35542	33	NZ_CP031080	Paracoccus yeei strain CCUG 32053 plasmid pYEE2, complete sequence	209749-209781	9	0.727
NC_009468_1	1.9\|35632\|33\|NC_009468\|PILER-CR	35632-35664	33	NZ_CP032695	Rhizobium jaguaris strain CCGE525 plasmid pRCCGE525c, complete sequence	983184-983216	9	0.727
NC_009468_1	1.10\|35693\|33\|NC_009468\|PILER-CR	35693-35725	33	NZ_CP007516	Rubrobacter radiotolerans strain RSPS-4 plasmid 2, complete sequence	58306-58338	9	0.727
NC_009468_1	1.11\|35754\|33\|NC_009468\|PILER-CR	35754-35786	33	KM389229	UNVERIFIED: Pseudomonas phage F_TK1718sp/PAK clone contig00001 genomic sequence	15950-15982	9	0.727
NC_009468_1	1.20\|36303\|33\|NC_009468\|PILER-CR	36303-36335	33	NZ_CP006991	Rhizobium sp. IE4771 plasmid pRetIE4771e, complete sequence	430619-430651	9	0.727
NC_009468_1	1.20\|36303\|33\|NC_009468\|PILER-CR	36303-36335	33	NZ_CP021128	Rhizobium sp. Kim5 plasmid pRetKim5d, complete sequence	380673-380705	9	0.727
NC_009468_1	1.20\|36303\|33\|NC_009468\|PILER-CR	36303-36335	33	CP007645	Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803d, complete sequence	437207-437239	9	0.727
NC_009468_1	1.32\|37035\|33\|NC_009468\|PILER-CR	37035-37067	33	NZ_CP049317	Caballeronia sp. SBC2 plasmid pSBC2-1, complete sequence	912935-912967	9	0.727
NC_009468_1	1.32\|37035\|33\|NC_009468\|PILER-CR	37035-37067	33	NZ_CP049157	Caballeronia sp. SBC1 plasmid pSBC1_1, complete sequence	728110-728142	9	0.727
NC_009468_1	1.32\|37035\|33\|NC_009468\|PILER-CR	37035-37067	33	NZ_CP038636	Cupriavidus oxalaticus strain X32 plasmid unnamed1, complete sequence	591988-592020	9	0.727
NC_009468_1	1.40\|35389\|32\|NC_009468\|CRISPRCasFinder,CRT	35389-35420	32	NZ_AP014705	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence	394062-394093	9	0.719
NC_009468_1	1.40\|35389\|32\|NC_009468\|CRISPRCasFinder,CRT	35389-35420	32	MN586020	Microbacterium phage Megan, complete genome	15368-15399	9	0.719
NC_009468_1	1.42\|35511\|32\|NC_009468\|CRISPRCasFinder,CRT	35511-35542	32	NZ_GU811235	Sphingobium chungbukense strain DJ77 plasmid pSY3, complete sequence	14705-14736	9	0.719
NC_009468_1	1.42\|35511\|32\|NC_009468\|CRISPRCasFinder,CRT	35511-35542	32	NZ_CP044082	Paracoccus yeei strain FDAARGOS_643 plasmid unnamed4, complete sequence	44495-44526	9	0.719
NC_009468_1	1.42\|35511\|32\|NC_009468\|CRISPRCasFinder,CRT	35511-35542	32	NZ_CP031080	Paracoccus yeei strain CCUG 32053 plasmid pYEE2, complete sequence	209750-209781	9	0.719
NC_009468_1	1.42\|35511\|32\|NC_009468\|CRISPRCasFinder,CRT	35511-35542	32	NZ_LN907828	Erwinia gerundensis isolate E_g_EM595 plasmid pEM01, complete sequence	133159-133190	9	0.719
NC_009468_1	1.42\|35511\|32\|NC_009468\|CRISPRCasFinder,CRT	35511-35542	32	NC_010625	Paraburkholderia phymatum STM815 plasmid pBPHY01, complete sequence	1855915-1855946	9	0.719
NC_009468_1	1.42\|35511\|32\|NC_009468\|CRISPRCasFinder,CRT	35511-35542	32	NZ_AP022849	Bosea sp. ANAM02 plasmid pANAM02, complete sequence	541100-541131	9	0.719
NC_009468_1	1.42\|35511\|32\|NC_009468\|CRISPRCasFinder,CRT	35511-35542	32	NZ_CP016619	Microvirga ossetica strain V5/3m plasmid unnamed2, complete sequence	784812-784843	9	0.719
NC_009468_1	1.42\|35511\|32\|NC_009468\|CRISPRCasFinder,CRT	35511-35542	32	NZ_CP032349	Azospirillum brasilense strain MTCC4039 plasmid p3, complete sequence	382588-382619	9	0.719
NC_009468_1	1.46\|35755\|32\|NC_009468\|CRISPRCasFinder,CRT	35755-35786	32	NZ_CP050104	Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b2, complete sequence	672556-672587	9	0.719
NC_009468_1	1.46\|35755\|32\|NC_009468\|CRISPRCasFinder,CRT	35755-35786	32	NZ_CP025013	Rhizobium leguminosarum strain Norway plasmid pRLN1, complete sequence	408419-408450	9	0.719
NC_009468_1	1.46\|35755\|32\|NC_009468\|CRISPRCasFinder,CRT	35755-35786	32	NZ_CP025507	Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvA, complete sequence	373167-373198	9	0.719
NC_009468_1	1.46\|35755\|32\|NC_009468\|CRISPRCasFinder,CRT	35755-35786	32	NZ_CP050109	Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b2, complete sequence	672556-672587	9	0.719
NC_009468_1	1.54\|36243\|32\|NC_009468\|CRISPRCasFinder,CRT	36243-36274	32	NZ_CP047177	Rathayibacter sp. VKM Ac-2759 plasmid unnamed1, complete sequence	36086-36117	9	0.719
NC_009468_1	1.60\|36609\|32\|NC_009468\|CRISPRCasFinder,CRT	36609-36640	32	NZ_CP013486	Vibrio alginolyticus strain ATCC 33787 plasmid pMBL128, complete sequence	4229-4260	9	0.719
NC_009468_1	1.67\|37036\|32\|NC_009468\|CRISPRCasFinder,CRT	37036-37067	32	MG641885	Salmonella phage PMBT28, complete genome	11924-11955	9	0.719
NC_009468_1	1.68\|37097\|32\|NC_009468\|CRISPRCasFinder,CRT	37097-37128	32	NZ_CP051517	Paraburkholderia aromaticivorans strain AR20-38 plasmid unnamed1	10390-10421	9	0.719
NC_009468_1	1.68\|37097\|32\|NC_009468\|CRISPRCasFinder,CRT	37097-37128	32	NZ_CP026527	Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence	783914-783945	9	0.719
NC_009468_1	1.68\|37097\|32\|NC_009468\|CRISPRCasFinder,CRT	37097-37128	32	NZ_CP041223	Porphyrobacter sp. YT40 plasmid pYT40, complete sequence	139418-139449	9	0.719
NC_009468_1	1.68\|37097\|32\|NC_009468\|CRISPRCasFinder,CRT	37097-37128	32	MK310144	Mycobacterium phage CicholasNage, complete genome	26643-26674	9	0.719
NC_009468_1	1.71\|37280\|32\|NC_009468\|CRISPRCasFinder,CRT	37280-37311	32	KX388536	Agrobacterium tumefaciens strain Chry5 plasmid pTiChry5, complete sequence	81946-81977	9	0.719
NC_009468_1	1.71\|37280\|32\|NC_009468\|CRISPRCasFinder,CRT	37280-37311	32	NZ_KY000032	Agrobacterium fabrum strain CFBP2788 plasmid pTi_CFBP2788, complete sequence	64723-64754	9	0.719
NC_009468_1	1.71\|37280\|32\|NC_009468\|CRISPRCasFinder,CRT	37280-37311	32	NZ_KY000032	Agrobacterium fabrum strain CFBP2788 plasmid pTi_CFBP2788, complete sequence	79868-79899	9	0.719
NC_009468_1	1.71\|37280\|32\|NC_009468\|CRISPRCasFinder,CRT	37280-37311	32	NZ_CP039902	Agrobacterium tumefaciens strain CFBP5877 plasmid pTiCFBP5877, complete sequence	33873-33904	9	0.719
NC_009468_1	1.71\|37280\|32\|NC_009468\|CRISPRCasFinder,CRT	37280-37311	32	NZ_CP039893	Agrobacterium tumefaciens strain CFBP5499 plasmid pTiCFBP5499, complete sequence	218697-218728	9	0.719
NC_009468_1	1.71\|37280\|32\|NC_009468\|CRISPRCasFinder,CRT	37280-37311	32	NZ_KY000025	Agrobacterium genomosp. 6 strain AR125 plasmid pTi_AR125, complete sequence	207168-207199	9	0.719
NC_009468_1	1.71\|37280\|32\|NC_009468\|CRISPRCasFinder,CRT	37280-37311	32	NZ_KY000074	Agrobacterium larrymoorei strain CFBP5481 plasmid pTi_CFBP5481, complete sequence	95803-95834	9	0.719
NC_009468_1	1.71\|37280\|32\|NC_009468\|CRISPRCasFinder,CRT	37280-37311	32	NZ_KY000029	Agrobacterium genomosp. 6 strain CFBP5499 plasmid pTi_CFBP5499, complete sequence	207168-207199	9	0.719
NC_009468_1	1.71\|37280\|32\|NC_009468\|CRISPRCasFinder,CRT	37280-37311	32	CP047390	Agrobacterium sp. CGMCC 11546 plasmid pB	48493-48524	9	0.719
NC_009468_1	1.7\|35510\|33\|NC_009468\|PILER-CR	35510-35542	33	NZ_GU811235	Sphingobium chungbukense strain DJ77 plasmid pSY3, complete sequence	14704-14736	10	0.697
NC_009468_1	1.36\|35145\|32\|NC_009468\|CRISPRCasFinder,CRT	35145-35176	32	NZ_CP022416	Sulfitobacter pseudonitzschiae strain SMR1 plasmid pSMR1-1, complete sequence	292835-292866	10	0.688
NC_009468_1	1.40\|35389\|32\|NC_009468\|CRISPRCasFinder,CRT	35389-35420	32	NZ_CP020740	[Pseudomonas] mesoacidophila strain ATCC 31433 plasmid pATCC31433, complete sequence	101530-101561	10	0.688
NC_009468_1	1.40\|35389\|32\|NC_009468\|CRISPRCasFinder,CRT	35389-35420	32	NZ_CP010860	Marinovum algicola DG 898 plasmid pMaD5, complete sequence	98252-98283	10	0.688
NC_009468_1	1.42\|35511\|32\|NC_009468\|CRISPRCasFinder,CRT	35511-35542	32	NZ_AP018668	Sphingobium amiense strain DSM 16289 plasmid pSAMIE_5, complete sequence	5251-5282	10	0.688
NC_009468_1	1.42\|35511\|32\|NC_009468\|CRISPRCasFinder,CRT	35511-35542	32	NZ_CP018096	Chelatococcus daeguensis strain TAD1 plasmid pTAD1, complete sequence	368303-368334	10	0.688
NC_009468_1	1.42\|35511\|32\|NC_009468\|CRISPRCasFinder,CRT	35511-35542	32	NZ_CP012399	Chelatococcus sp. CO-6 plasmid pCO-6, complete sequence	51729-51760	10	0.688
NC_009468_1	1.42\|35511\|32\|NC_009468\|CRISPRCasFinder,CRT	35511-35542	32	MN478374	Bacteriophage Phobos, complete genome	29674-29705	10	0.688
NC_009468_1	1.47\|35816\|32\|NC_009468\|CRISPRCasFinder,CRT	35816-35847	32	KU728633	Mycobacterium phage Bipper, complete genome	70372-70403	10	0.688
NC_009468_1	1.47\|35816\|32\|NC_009468\|CRISPRCasFinder,CRT	35816-35847	32	MK977701	Mycobacterium phage Cracklewink, complete genome	69524-69555	10	0.688
NC_009468_1	1.48\|35877\|32\|NC_009468\|CRISPRCasFinder,CRT	35877-35908	32	NZ_CP013426	Burkholderia sp. MSMB0856 plasmid pMSMB0856, complete sequence	139730-139761	10	0.688
NC_009468_1	1.50\|35999\|32\|NC_009468\|CRISPRCasFinder,CRT	35999-36030	32	NZ_CP015041	Rhodovulum sp. P5 plasmid pRGUI02, complete sequence	53357-53388	10	0.688
NC_009468_1	1.50\|35999\|32\|NC_009468\|CRISPRCasFinder,CRT	35999-36030	32	AP017627	Pleomorphomonas sp. SM30 plasmid pSM30-1 DNA, complete genome	94219-94250	10	0.688
NC_009468_1	1.60\|36609\|32\|NC_009468\|CRISPRCasFinder,CRT	36609-36640	32	NZ_CP015420	Rhodovulum sulfidophilum DSM 1374 plasmid unnamed2, complete sequence	10232-10263	10	0.688
NC_009468_1	1.60\|36609\|32\|NC_009468\|CRISPRCasFinder,CRT	36609-36640	32	NZ_AP014801	Rhodovulum sulfidophilum plasmid Plasmid1 DNA, complete genome, strain: DSM 2351	76054-76085	10	0.688
NC_009468_1	1.68\|37097\|32\|NC_009468\|CRISPRCasFinder,CRT	37097-37128	32	NC_020548	Azoarcus sp. KH32C plasmid pAZKH, complete sequence	409121-409152	10	0.688
NC_009468_1	1.68\|37097\|32\|NC_009468\|CRISPRCasFinder,CRT	37097-37128	32	NZ_CP032695	Rhizobium jaguaris strain CCGE525 plasmid pRCCGE525c, complete sequence	139017-139048	10	0.688
NC_009468_1	1.68\|37097\|32\|NC_009468\|CRISPRCasFinder,CRT	37097-37128	32	MH593834	Siphoviridae sp. isolate ctbe1, complete genome	57283-57314	10	0.688
NC_009468_1	1.69\|37158\|32\|NC_009468\|CRISPRCasFinder,CRT	37158-37189	32	NZ_LN614828	Legionella fallonii LLAP-10 plasmid II, complete sequence	233595-233626	10	0.688
NC_009468_1	1.72\|37341\|32\|NC_009468\|CRISPRCasFinder,CRT	37341-37372	32	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	1209657-1209688	10	0.688
NC_009468_1	1.65\|36914\|32\|NC_009468\|CRISPRCasFinder,CRT	36914-36945	32	NZ_CP022305	Thalassococcus sp. S3 plasmid pS3B, complete sequence	26156-26187	11	0.656

1. spacer 1.1|35144|33|NC_009468|PILER-CR matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

gccgcctgggaggatatggagcgctggattgat	CRISPR spacer
gccgcctgggaggatatggagcgctggattgat	Protospacer
*********************************

2. spacer 1.2|35205|33|NC_009468|PILER-CR matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

ggcggcggcgcaatactacgcagcggtgaaagc	CRISPR spacer
ggcggcggcgcaatactacgcagcggtgaaagc	Protospacer
*********************************

3. spacer 1.3|35266|33|NC_009468|PILER-CR matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

gcgaaaatggcgttctgggaggcgctgacgaat	CRISPR spacer
gcgaaaatggcgttctgggaggcgctgacgaat	Protospacer
*********************************

4. spacer 1.4|35327|33|NC_009468|PILER-CR matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

gatgtggtggcaagtgacgggccgagtctggaa	CRISPR spacer
gatgtggtggcaagtgacgggccgagtctggaa	Protospacer
*********************************

5. spacer 1.5|35388|33|NC_009468|PILER-CR matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

gatgcgcaaggcgcgcaagcgcaagggcaacag	CRISPR spacer
gatgcgcaaggcgcgcaagcgcaagggcaacag	Protospacer
*********************************

6. spacer 1.6|35449|33|NC_009468|PILER-CR matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

ggtcattgatctgtcgccagtggccgtcgtccg	CRISPR spacer
ggtcattgatctgtcgccagtggccgtcgtccg	Protospacer
*********************************

7. spacer 1.7|35510|33|NC_009468|PILER-CR matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

gcttcgcgccctgatcgacatgcagcgcgaggt	CRISPR spacer
gcttcgcgccctgatcgacatgcagcgcgaggt	Protospacer
*********************************

8. spacer 1.8|35571|33|NC_009468|PILER-CR matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

gatctccttgtctatctaaaaactagcacagag	CRISPR spacer
gatctccttgtctatctaaaaactagcacagag	Protospacer
*********************************

9. spacer 1.9|35632|33|NC_009468|PILER-CR matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

gttttttgaacagccggaattgattgaacagtt	CRISPR spacer
gttttttgaacagccggaattgattgaacagtt	Protospacer
*********************************

10. spacer 1.10|35693|33|NC_009468|PILER-CR matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

gcgaatgaggaattcgccgcgttctatacgctc	CRISPR spacer
gcgaatgaggaattcgccgcgttctatacgctc	Protospacer
*********************************

11. spacer 1.11|35754|33|NC_009468|PILER-CR matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

gtgtcgcaatccggagtcggctcgctccgccat	CRISPR spacer
gtgtcgcaatccggagtcggctcgctccgccat	Protospacer
*********************************

12. spacer 1.12|35815|33|NC_009468|PILER-CR matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

ggggtatacgtgctaccggcgggggctggagta	CRISPR spacer
ggggtatacgtgctaccggcgggggctggagta	Protospacer
*********************************

13. spacer 1.13|35876|33|NC_009468|PILER-CR matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

gtggccgatgctcgcgcagaaagtgggcgtgtg	CRISPR spacer
gtggccgatgctcgcgcagaaagtgggcgtgtg	Protospacer
*********************************

14. spacer 1.14|35937|33|NC_009468|PILER-CR matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

gccgtcaaatcgatggagcccggtcactgttgt	CRISPR spacer
gccgtcaaatcgatggagcccggtcactgttgt	Protospacer
*********************************

15. spacer 1.15|35998|33|NC_009468|PILER-CR matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

gtaaagcgcggcgtccccccgcgccgcaaaagc	CRISPR spacer
gtaaagcgcggcgtccccccgcgccgcaaaagc	Protospacer
*********************************

16. spacer 1.16|36059|33|NC_009468|PILER-CR matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

ggagcgcaagcacctggcgtcggagatttgggc	CRISPR spacer
ggagcgcaagcacctggcgtcggagatttgggc	Protospacer
*********************************

17. spacer 1.17|36120|33|NC_009468|PILER-CR matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

gggtggaagatggtttgtcattcgcagagccca	CRISPR spacer
gggtggaagatggtttgtcattcgcagagccca	Protospacer
*********************************

18. spacer 1.18|36181|33|NC_009468|PILER-CR matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

gccggaagggacgggctcgcatgccacgggcac	CRISPR spacer
gccggaagggacgggctcgcatgccacgggcac	Protospacer
*********************************

19. spacer 1.19|36242|33|NC_009468|PILER-CR matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

ggcagaggcagcagagaggcgatgcaccgaatt	CRISPR spacer
ggcagaggcagcagagaggcgatgcaccgaatt	Protospacer
*********************************

20. spacer 1.20|36303|33|NC_009468|PILER-CR matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

ggatatcgttgccagacggcgcacgctcgcaat	CRISPR spacer
ggatatcgttgccagacggcgcacgctcgcaat	Protospacer
*********************************

21. spacer 1.21|36364|33|NC_009468|PILER-CR matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

gacagaccagaggaggcaagagagcgcgacagg	CRISPR spacer
gacagaccagaggaggcaagagagcgcgacagg	Protospacer
*********************************

22. spacer 1.22|36425|33|NC_009468|PILER-CR matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

gatcgtcgatctaacgacaccgccaacgatgtt	CRISPR spacer
gatcgtcgatctaacgacaccgccaacgatgtt	Protospacer
*********************************

23. spacer 1.23|36486|33|NC_009468|PILER-CR matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

gggcgccaacggttgcgtcttgtttctcgtcta	CRISPR spacer
gggcgccaacggttgcgtcttgtttctcgtcta	Protospacer
*********************************

24. spacer 1.24|36547|33|NC_009468|PILER-CR matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

ggcggacccgctattactgacctggctcgatcg	CRISPR spacer
ggcggacccgctattactgacctggctcgatcg	Protospacer
*********************************

25. spacer 1.25|36608|33|NC_009468|PILER-CR matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

gcgacgccggacgctcgcgaaatcgcctttgtg	CRISPR spacer
gcgacgccggacgctcgcgaaatcgcctttgtg	Protospacer
*********************************

26. spacer 1.26|36669|33|NC_009468|PILER-CR matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

gacgccggttcgcgggcgcacagtgcttgtgca	CRISPR spacer
gacgccggttcgcgggcgcacagtgcttgtgca	Protospacer
*********************************

27. spacer 1.27|36730|33|NC_009468|PILER-CR matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

gctcgccgggctgtggaagaaagccggcccctg	CRISPR spacer
gctcgccgggctgtggaagaaagccggcccctg	Protospacer
*********************************

28. spacer 1.28|36791|33|NC_009468|PILER-CR matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

gtcgtgcagatcgtggttgacaatccaggcagc	CRISPR spacer
gtcgtgcagatcgtggttgacaatccaggcagc	Protospacer
*********************************

29. spacer 1.29|36852|33|NC_009468|PILER-CR matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

gccgttcgtctggatcgtagatcgcgaaatgac	CRISPR spacer
gccgttcgtctggatcgtagatcgcgaaatgac	Protospacer
*********************************

30. spacer 1.30|36913|33|NC_009468|PILER-CR matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgtcaggtaatcgccgagcgtctgataaa	CRISPR spacer
ggattgtcaggtaatcgccgagcgtctgataaa	Protospacer
*********************************

31. spacer 1.31|36974|33|NC_009468|PILER-CR matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

ggcgcttcgagcgccgccgggccacaaggttgt	CRISPR spacer
ggcgcttcgagcgccgccgggccacaaggttgt	Protospacer
*********************************

32. spacer 1.32|37035|33|NC_009468|PILER-CR matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

ggtgcggttctgcaccgggccgaacgtggccgc	CRISPR spacer
ggtgcggttctgcaccgggccgaacgtggccgc	Protospacer
*********************************

33. spacer 1.33|37096|33|NC_009468|PILER-CR matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

gtcagcgtatcgctcgcggcggcaacgtgggta	CRISPR spacer
gtcagcgtatcgctcgcggcggcaacgtgggta	Protospacer
*********************************

34. spacer 1.34|37157|33|NC_009468|PILER-CR matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

gtttacgttgtattgggtgcggcgagacgggca	CRISPR spacer
gtttacgttgtattgggtgcggcgagacgggca	Protospacer
*********************************

35. spacer 1.35|37218|33|NC_009468|PILER-CR matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

gtcctgggtgagcgagacgggcacactcacggg	CRISPR spacer
gtcctgggtgagcgagacgggcacactcacggg	Protospacer
*********************************

36. spacer 1.36|35145|32|NC_009468|CRISPRCasFinder,CRT matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

ccgcctgggaggatatggagcgctggattgat	CRISPR spacer
ccgcctgggaggatatggagcgctggattgat	Protospacer
********************************

37. spacer 1.37|35206|32|NC_009468|CRISPRCasFinder,CRT matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

gcggcggcgcaatactacgcagcggtgaaagc	CRISPR spacer
gcggcggcgcaatactacgcagcggtgaaagc	Protospacer
********************************

38. spacer 1.38|35267|32|NC_009468|CRISPRCasFinder,CRT matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

cgaaaatggcgttctgggaggcgctgacgaat	CRISPR spacer
cgaaaatggcgttctgggaggcgctgacgaat	Protospacer
********************************

39. spacer 1.39|35328|32|NC_009468|CRISPRCasFinder,CRT matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

atgtggtggcaagtgacgggccgagtctggaa	CRISPR spacer
atgtggtggcaagtgacgggccgagtctggaa	Protospacer
********************************

40. spacer 1.40|35389|32|NC_009468|CRISPRCasFinder,CRT matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

atgcgcaaggcgcgcaagcgcaagggcaacag	CRISPR spacer
atgcgcaaggcgcgcaagcgcaagggcaacag	Protospacer
********************************

41. spacer 1.41|35450|32|NC_009468|CRISPRCasFinder,CRT matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

gtcattgatctgtcgccagtggccgtcgtccg	CRISPR spacer
gtcattgatctgtcgccagtggccgtcgtccg	Protospacer
********************************

42. spacer 1.42|35511|32|NC_009468|CRISPRCasFinder,CRT matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

cttcgcgccctgatcgacatgcagcgcgaggt	CRISPR spacer
cttcgcgccctgatcgacatgcagcgcgaggt	Protospacer
********************************

43. spacer 1.43|35572|32|NC_009468|CRISPRCasFinder,CRT matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

atctccttgtctatctaaaaactagcacagag	CRISPR spacer
atctccttgtctatctaaaaactagcacagag	Protospacer
********************************

44. spacer 1.44|35633|32|NC_009468|CRISPRCasFinder,CRT matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

ttttttgaacagccggaattgattgaacagtt	CRISPR spacer
ttttttgaacagccggaattgattgaacagtt	Protospacer
********************************

45. spacer 1.45|35694|32|NC_009468|CRISPRCasFinder,CRT matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

cgaatgaggaattcgccgcgttctatacgctc	CRISPR spacer
cgaatgaggaattcgccgcgttctatacgctc	Protospacer
********************************

46. spacer 1.46|35755|32|NC_009468|CRISPRCasFinder,CRT matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

tgtcgcaatccggagtcggctcgctccgccat	CRISPR spacer
tgtcgcaatccggagtcggctcgctccgccat	Protospacer
********************************

47. spacer 1.47|35816|32|NC_009468|CRISPRCasFinder,CRT matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

gggtatacgtgctaccggcgggggctggagta	CRISPR spacer
gggtatacgtgctaccggcgggggctggagta	Protospacer
********************************

48. spacer 1.48|35877|32|NC_009468|CRISPRCasFinder,CRT matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

tggccgatgctcgcgcagaaagtgggcgtgtg	CRISPR spacer
tggccgatgctcgcgcagaaagtgggcgtgtg	Protospacer
********************************

49. spacer 1.49|35938|32|NC_009468|CRISPRCasFinder,CRT matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

ccgtcaaatcgatggagcccggtcactgttgt	CRISPR spacer
ccgtcaaatcgatggagcccggtcactgttgt	Protospacer
********************************

50. spacer 1.50|35999|32|NC_009468|CRISPRCasFinder,CRT matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

taaagcgcggcgtccccccgcgccgcaaaagc	CRISPR spacer
taaagcgcggcgtccccccgcgccgcaaaagc	Protospacer
********************************

51. spacer 1.51|36060|32|NC_009468|CRISPRCasFinder,CRT matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

gagcgcaagcacctggcgtcggagatttgggc	CRISPR spacer
gagcgcaagcacctggcgtcggagatttgggc	Protospacer
********************************

52. spacer 1.52|36121|32|NC_009468|CRISPRCasFinder,CRT matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

ggtggaagatggtttgtcattcgcagagccca	CRISPR spacer
ggtggaagatggtttgtcattcgcagagccca	Protospacer
********************************

53. spacer 1.53|36182|32|NC_009468|CRISPRCasFinder,CRT matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

ccggaagggacgggctcgcatgccacgggcac	CRISPR spacer
ccggaagggacgggctcgcatgccacgggcac	Protospacer
********************************

54. spacer 1.54|36243|32|NC_009468|CRISPRCasFinder,CRT matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

gcagaggcagcagagaggcgatgcaccgaatt	CRISPR spacer
gcagaggcagcagagaggcgatgcaccgaatt	Protospacer
********************************

55. spacer 1.55|36304|32|NC_009468|CRISPRCasFinder,CRT matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

gatatcgttgccagacggcgcacgctcgcaat	CRISPR spacer
gatatcgttgccagacggcgcacgctcgcaat	Protospacer
********************************

56. spacer 1.56|36365|32|NC_009468|CRISPRCasFinder,CRT matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

acagaccagaggaggcaagagagcgcgacagg	CRISPR spacer
acagaccagaggaggcaagagagcgcgacagg	Protospacer
********************************

57. spacer 1.57|36426|32|NC_009468|CRISPRCasFinder,CRT matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

atcgtcgatctaacgacaccgccaacgatgtt	CRISPR spacer
atcgtcgatctaacgacaccgccaacgatgtt	Protospacer
********************************

58. spacer 1.58|36487|32|NC_009468|CRISPRCasFinder,CRT matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

ggcgccaacggttgcgtcttgtttctcgtcta	CRISPR spacer
ggcgccaacggttgcgtcttgtttctcgtcta	Protospacer
********************************

59. spacer 1.59|36548|32|NC_009468|CRISPRCasFinder,CRT matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

gcggacccgctattactgacctggctcgatcg	CRISPR spacer
gcggacccgctattactgacctggctcgatcg	Protospacer
********************************

60. spacer 1.60|36609|32|NC_009468|CRISPRCasFinder,CRT matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

cgacgccggacgctcgcgaaatcgcctttgtg	CRISPR spacer
cgacgccggacgctcgcgaaatcgcctttgtg	Protospacer
********************************

61. spacer 1.61|36670|32|NC_009468|CRISPRCasFinder,CRT matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

acgccggttcgcgggcgcacagtgcttgtgca	CRISPR spacer
acgccggttcgcgggcgcacagtgcttgtgca	Protospacer
********************************

62. spacer 1.62|36731|32|NC_009468|CRISPRCasFinder,CRT matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

ctcgccgggctgtggaagaaagccggcccctg	CRISPR spacer
ctcgccgggctgtggaagaaagccggcccctg	Protospacer
********************************

63. spacer 1.63|36792|32|NC_009468|CRISPRCasFinder,CRT matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

tcgtgcagatcgtggttgacaatccaggcagc	CRISPR spacer
tcgtgcagatcgtggttgacaatccaggcagc	Protospacer
********************************

64. spacer 1.64|36853|32|NC_009468|CRISPRCasFinder,CRT matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

ccgttcgtctggatcgtagatcgcgaaatgac	CRISPR spacer
ccgttcgtctggatcgtagatcgcgaaatgac	Protospacer
********************************

65. spacer 1.65|36914|32|NC_009468|CRISPRCasFinder,CRT matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

gattgtcaggtaatcgccgagcgtctgataaa	CRISPR spacer
gattgtcaggtaatcgccgagcgtctgataaa	Protospacer
********************************

66. spacer 1.66|36975|32|NC_009468|CRISPRCasFinder,CRT matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

gcgcttcgagcgccgccgggccacaaggttgt	CRISPR spacer
gcgcttcgagcgccgccgggccacaaggttgt	Protospacer
********************************

67. spacer 1.67|37036|32|NC_009468|CRISPRCasFinder,CRT matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcggttctgcaccgggccgaacgtggccgc	CRISPR spacer
gtgcggttctgcaccgggccgaacgtggccgc	Protospacer
********************************

68. spacer 1.68|37097|32|NC_009468|CRISPRCasFinder,CRT matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

tcagcgtatcgctcgcggcggcaacgtgggta	CRISPR spacer
tcagcgtatcgctcgcggcggcaacgtgggta	Protospacer
********************************

69. spacer 1.69|37158|32|NC_009468|CRISPRCasFinder,CRT matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

tttacgttgtattgggtgcggcgagacgggca	CRISPR spacer
tttacgttgtattgggtgcggcgagacgggca	Protospacer
********************************

70. spacer 1.70|37219|32|NC_009468|CRISPRCasFinder,CRT matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

tcctgggtgagcgagacgggcacactcacggg	CRISPR spacer
tcctgggtgagcgagacgggcacactcacggg	Protospacer
********************************

71. spacer 1.71|37280|32|NC_009468|CRISPRCasFinder,CRT matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

tccggcatcgtttccgcgccggcattcacgcc	CRISPR spacer
tccggcatcgtttccgcgccggcattcacgcc	Protospacer
********************************

72. spacer 1.72|37341|32|NC_009468|CRISPRCasFinder,CRT matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

cctgacaccggcgacacggccctcagccgctc	CRISPR spacer
cctgacaccggcgacacggccctcagccgctc	Protospacer
********************************

73. spacer 1.73|37402|32|NC_009468|CRISPRCasFinder,CRT matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

aacgtgacaacgcccgtcgcctgcgcggtgag	CRISPR spacer
aacgtgacaacgcccgtcgcctgcgcggtgag	Protospacer
********************************

74. spacer 1.74|37463|32|NC_009468|CRISPRCasFinder,CRT matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

acgcgggggcttcgataggcttggtaagcttc	CRISPR spacer
acgcgggggcttcgataggcttggtaagcttc	Protospacer
********************************

75. spacer 1.36|35145|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP015246 (Escherichia coli O91 str. RM7190 plasmid pRM7190-2, complete sequence) position: , mismatch: 6, identity: 0.812

ccgcctgggaggatatggagcgctgg-attgat	CRISPR spacer
tggcctggcaggataaggagcgctgacattga-	Protospacer
. ****** ****** *********. *****

76. spacer 1.36|35145|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP031907 (Escherichia coli O91:H21 strain FWSEC0008 plasmid unnamed17, complete sequence) position: , mismatch: 6, identity: 0.812

ccgcctgggaggatatggagcgctgg-attgat	CRISPR spacer
tggcctggcaggataaggagcgctgacattga-	Protospacer
. ****** ****** *********. *****

77. spacer 1.36|35145|32|NC_009468|CRISPRCasFinder,CRT matches to CP042949 (Escherichia coli strain ATCC 51435 plasmid pB2F1, complete sequence) position: , mismatch: 6, identity: 0.812

ccgcctgggaggatatggagcgctgg-attgat	CRISPR spacer
tggcctggcaggataaggagcgctgacattga-	Protospacer
. ****** ****** *********. *****

78. spacer 1.36|35145|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP028431 (Escherichia coli strain RM9131 plasmid pRM9131-2, complete sequence) position: , mismatch: 6, identity: 0.812

ccgcctgggaggatatggagcgctgg-attgat	CRISPR spacer
tggcctggcaggataaggagcgctgacattga-	Protospacer
. ****** ****** *********. *****

79. spacer 1.36|35145|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP028118 (Escherichia coli O111 str. RM9322 plasmid pRM9322-1, complete sequence) position: , mismatch: 6, identity: 0.812

ccgcctgggaggatatggagcgctgg-attgat	CRISPR spacer
tggcctggcaggataaggagcgctgacattga-	Protospacer
. ****** ****** *********. *****

80. spacer 1.36|35145|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP021341 (Escherichia coli strain 95NR1 plasmid p95NR1B, complete sequence) position: , mismatch: 6, identity: 0.812

ccgcctgggaggatatggagcgctgg-attgat	CRISPR spacer
tggcctggcaggataaggagcgctgacattga-	Protospacer
. ****** ****** *********. *****

81. spacer 1.36|35145|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP021337 (Escherichia coli strain 95JB1 plasmid p95JB1B, complete sequence) position: , mismatch: 6, identity: 0.812

ccgcctgggaggatatggagcgctgg-attgat	CRISPR spacer
tggcctggcaggataaggagcgctgacattga-	Protospacer
. ****** ****** *********. *****

82. spacer 1.36|35145|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP029691 (Escherichia coli strain SD134209 plasmid pSD134209-2, complete sequence) position: , mismatch: 6, identity: 0.812

ccgcctgggaggatatggagcgctgg-attgat	CRISPR spacer
tggcctggcaggataaggagcgctgacattga-	Protospacer
. ****** ****** *********. *****

83. spacer 1.36|35145|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP027463 (Escherichia coli isolate 07-4299 plasmid unnamed) position: , mismatch: 6, identity: 0.812

ccgcctgggaggatatggagcgctgg-attgat	CRISPR spacer
tggcctggcaggataaggagcgctgacattga-	Protospacer
. ****** ****** *********. *****

84. spacer 1.36|35145|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP027767 (Escherichia coli strain 2013C-3342 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

ccgcctgggaggatatggagcgctgg-attgat	CRISPR spacer
tggcctggcaggataaggagcgctgacattga-	Protospacer
. ****** ****** *********. *****

85. spacer 1.36|35145|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_AP018805 (Escherichia coli strain E2863 plasmid pE2863-3, complete sequence) position: , mismatch: 6, identity: 0.812

ccgcctgggaggatatggagcgctgg-attgat	CRISPR spacer
tggcctggcaggataaggagcgctgacattga-	Protospacer
. ****** ****** *********. *****

86. spacer 1.36|35145|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP027311 (Escherichia coli strain 2014C-4135 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

ccgcctgggaggatatggagcgctgg-attgat	CRISPR spacer
tggcctggcaggataaggagcgctgacattga-	Protospacer
. ****** ****** *********. *****

87. spacer 1.36|35145|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP027576 (Escherichia coli strain 2013C-4081 plasmid unnamed3, complete sequence) position: , mismatch: 6, identity: 0.812

ccgcctgggaggatatggagcgctgg-attgat	CRISPR spacer
tggcctggcaggataaggagcgctgacattga-	Protospacer
. ****** ****** *********. *****

88. spacer 1.36|35145|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP027458 (Escherichia coli strain 88-3493 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

ccgcctgggaggatatggagcgctgg-attgat	CRISPR spacer
tggcctggcaggataaggagcgctgacattga-	Protospacer
. ****** ****** *********. *****

89. spacer 1.36|35145|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP027553 (Escherichia coli strain 2015C-4498 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

ccgcctgggaggatatggagcgctgg-attgat	CRISPR spacer
tggcctggcaggataaggagcgctgacattga-	Protospacer
. ****** ****** *********. *****

90. spacer 1.36|35145|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP027367 (Escherichia coli strain 89-3156 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

ccgcctgggaggatatggagcgctgg-attgat	CRISPR spacer
tggcctggcaggataaggagcgctgacattga-	Protospacer
. ****** ****** *********. *****

91. spacer 1.36|35145|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP028434 (Escherichia coli strain RM9975 plasmid pRM9975-2, complete sequence) position: , mismatch: 6, identity: 0.812

ccgcctgggaggatatggagcgctgg-attgat	CRISPR spacer
tggcctggcaggataaggagcgctgacattga-	Protospacer
. ****** ****** *********. *****

92. spacer 1.36|35145|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_AP019763 (Escherichia coli O111:H- strain 110512 plasmid pO111-110512_2, complete sequence) position: , mismatch: 6, identity: 0.812

ccgcctgggaggatatggagcgctgg-attgat	CRISPR spacer
tggcctggcaggataaggagcgctgacattga-	Protospacer
. ****** ****** *********. *****

93. spacer 1.36|35145|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP024291 (Escherichia coli O178:H19 strain 2012C-4431 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.812

ccgcctgggaggatatggagcgctgg-attgat	CRISPR spacer
tggcctggcaggataaggagcgctgacattga-	Protospacer
. ****** ****** *********. *****

94. spacer 1.36|35145|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP023164 (Escherichia coli O22:H8 strain RM10809-3 plasmid pRM10809-3, complete sequence) position: , mismatch: 6, identity: 0.812

ccgcctgggaggatatggagcgctgg-attgat	CRISPR spacer
tggcctggcaggataaggagcgctgacattga-	Protospacer
. ****** ****** *********. *****

95. spacer 1.36|35145|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_AP018800 (Escherichia coli strain E2855 plasmid pE2855-4, complete sequence) position: , mismatch: 6, identity: 0.812

ccgcctgggaggatatggagcgctgg-attgat	CRISPR spacer
tggcctggcaggataaggagcgctgacattga-	Protospacer
. ****** ****** *********. *****

96. spacer 1.36|35145|32|NC_009468|CRISPRCasFinder,CRT matches to NC_013366 (Escherichia coli O111:H- str. 11128 plasmid pO111_3, complete sequence) position: , mismatch: 6, identity: 0.812

ccgcctgggaggatatggagcgctgg-attgat	CRISPR spacer
tggcctggcaggataaggagcgctgacattga-	Protospacer
. ****** ****** *********. *****

97. spacer 1.42|35511|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP010729 (Phaeobacter inhibens strain P88 plasmid pP88_d, complete sequence) position: , mismatch: 6, identity: 0.812

cttcgcgccctgatcgacatgcagcgcgaggt-	CRISPR spacer
tttcgcggcctgatcgacatgcag-gcgcgcct	Protospacer
.****** **************** *** * .

98. spacer 1.67|37036|32|NC_009468|CRISPRCasFinder,CRT matches to CP054927 (Streptomyces fulvissimus strain NA06532 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.812

gtgcggttctgcaccgggccgaacgtggccgc	CRISPR spacer
aagcccgtctgcaccgcgccgaacgtggccgc	Protospacer
. **   ********* ***************

99. spacer 1.5|35388|33|NC_009468|PILER-CR matches to NZ_CP039644 (Azospirillum sp. TSA2s plasmid p2, complete sequence) position: , mismatch: 7, identity: 0.788

gatgcgcaaggcgcgcaagcgcaagggcaacag--	CRISPR spacer
gctgagcaaggcgcgcaagcgcgagg--agctggt	Protospacer
* ** *****************.***  *.* *

100. spacer 1.32|37035|33|NC_009468|PILER-CR matches to CP054927 (Streptomyces fulvissimus strain NA06532 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.788

ggtgcggttctgcaccgggccgaacgtggccgc	CRISPR spacer
caagcccgtctgcaccgcgccgaacgtggccgc	Protospacer
 . **   ********* ***************

101. spacer 1.40|35389|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP007735 (Klebsiella pneumoniae subsp. pneumoniae KPNIH27 plasmid pKPN-a41, complete sequence) position: , mismatch: 7, identity: 0.781

atgcgcaaggcgcgcaagcgcaagggcaacag	CRISPR spacer
aagttcaaggcgcgcaagcagaagggcaagat	Protospacer
* *. **************. ******** *

102. spacer 1.40|35389|32|NC_009468|CRISPRCasFinder,CRT matches to CP032292 (UNVERIFIED_ORG: Enterobacter cloacae strain AR_0073 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

atgcgcaaggcgcgcaagcgcaagggcaacag	CRISPR spacer
aagttcaaggcgcgcaagcagaagggcaagat	Protospacer
* *. **************. ******** *

103. spacer 1.40|35389|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP039644 (Azospirillum sp. TSA2s plasmid p2, complete sequence) position: , mismatch: 7, identity: 0.781

atgcgcaaggcgcgcaagcgcaagggcaacag--	CRISPR spacer
ctgagcaaggcgcgcaagcgcgagg--agctggt	Protospacer
 ** *****************.***  *.* *

104. spacer 1.42|35511|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP005192 (Sphingobium sp. MI1205 plasmid pMI3, complete sequence) position: , mismatch: 7, identity: 0.781

cttcgcgccctgatcgacatgcagcgcgaggt	CRISPR spacer
gaacacgccctgttcgacatgctgcgcgagga	Protospacer
   *.******* ********* ********

105. spacer 1.42|35511|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP005193 (Sphingobium sp. MI1205 plasmid pMI4, complete sequence) position: , mismatch: 7, identity: 0.781

cttcgcgccctgatcgacatgcagcgcgaggt	CRISPR spacer
gaacacgccctgttcgacatgctgcgcgagga	Protospacer
   *.******* ********* ********

106. spacer 1.42|35511|32|NC_009468|CRISPRCasFinder,CRT matches to NC_020563 (Sphingomonas sp. MM-1 plasmid pISP4, complete sequence) position: , mismatch: 7, identity: 0.781

cttcgcgccctgatcgacatgcagcgcgaggt	CRISPR spacer
gaacacgccctgttcgacatgctgcgcgagga	Protospacer
   *.******* ********* ********

107. spacer 1.42|35511|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP005087 (Sphingobium sp. TKS plasmid pTK3, complete sequence) position: , mismatch: 7, identity: 0.781

cttcgcgccctgatcgacatgcagcgcgaggt	CRISPR spacer
gaacacgccctgttcgacatgctgcgcgagga	Protospacer
   *.******* ********* ********

108. spacer 1.42|35511|32|NC_009468|CRISPRCasFinder,CRT matches to NC_020562 (Sphingomonas sp. MM-1 plasmid pISP1, complete sequence) position: , mismatch: 7, identity: 0.781

cttcgcgccctgatcgacatgcagcgcgaggt	CRISPR spacer
gaacacgccctgttcgacatgctgcgcgagga	Protospacer
   *.******* ********* ********

109. spacer 1.64|36853|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_AP022333 (Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49a, complete sequence) position: , mismatch: 7, identity: 0.781

ccgttcgtctggatcgtagatcgcgaaatgac	CRISPR spacer
ccgttcgtctgggtcgtcgatcgcgtcgcgcc	Protospacer
************.**** *******  ..* *

110. spacer 1.67|37036|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP007130 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 2, complete sequence) position: , mismatch: 7, identity: 0.781

gtgcggt-tctgcaccgggccgaacgtggccgc	CRISPR spacer
-tgccgcgtctgcagcgagccgaacgtggccca	Protospacer
 *** *. ****** **.*************

111. spacer 1.73|37402|32|NC_009468|CRISPRCasFinder,CRT matches to CP031731 (Stenotrophomonas rhizophila strain GA1 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.781

aacgtgacaacgcccgtcgcctgcgcggtgag	CRISPR spacer
aacgagccaacgcccgtcgcctgcttcgcgat	Protospacer
**** * ***************** . *.**

112. spacer 1.5|35388|33|NC_009468|PILER-CR matches to NZ_CP007735 (Klebsiella pneumoniae subsp. pneumoniae KPNIH27 plasmid pKPN-a41, complete sequence) position: , mismatch: 8, identity: 0.758

gatgcgcaaggcgcgcaagcgcaagggcaacag	CRISPR spacer
caagttcaaggcgcgcaagcagaagggcaagat	Protospacer
 * *. **************. ******** *

113. spacer 1.5|35388|33|NC_009468|PILER-CR matches to NZ_CP010598 (Phaeobacter inhibens strain P10 plasmid pP10_c, complete sequence) position: , mismatch: 8, identity: 0.758

gatgcgcaaggcgcgcaagcgcaagggcaacag	CRISPR spacer
gatccgcaaggcgcgcaagggcaaccgcggcgc	Protospacer
*** *************** ****  **..*.

114. spacer 1.5|35388|33|NC_009468|PILER-CR matches to NC_018288 (Phaeobacter inhibens DSM 17395 plasmid pPGA1_65, complete sequence) position: , mismatch: 8, identity: 0.758

gatgcgcaaggcgcgcaagcgcaagggcaacag	CRISPR spacer
gatccgcaaggcgcgcaagggcaaccgcggcgc	Protospacer
*** *************** ****  **..*.

115. spacer 1.5|35388|33|NC_009468|PILER-CR matches to NZ_CP016368 (Phaeobacter porticola strain P97 plasmid pP97_d, complete sequence) position: , mismatch: 8, identity: 0.758

gatgcgcaaggcgcgcaagcgcaagggcaacag	CRISPR spacer
gatccgcaaggcgcgcaagggcaaccgcggcgc	Protospacer
*** *************** ****  **..*.

116. spacer 1.5|35388|33|NC_009468|PILER-CR matches to CP032292 (UNVERIFIED_ORG: Enterobacter cloacae strain AR_0073 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.758

gatgcgcaaggcgcgcaagcgcaagggcaacag	CRISPR spacer
caagttcaaggcgcgcaagcagaagggcaagat	Protospacer
 * *. **************. ******** *

117. spacer 1.7|35510|33|NC_009468|PILER-CR matches to NZ_CP005192 (Sphingobium sp. MI1205 plasmid pMI3, complete sequence) position: , mismatch: 8, identity: 0.758

gcttcgcgccctgatcgacatgcagcgcgaggt	CRISPR spacer
cgaacacgccctgttcgacatgctgcgcgagga	Protospacer
    *.******* ********* ********

118. spacer 1.7|35510|33|NC_009468|PILER-CR matches to NZ_CP005087 (Sphingobium sp. TKS plasmid pTK3, complete sequence) position: , mismatch: 8, identity: 0.758

gcttcgcgccctgatcgacatgcagcgcgaggt	CRISPR spacer
cgaacacgccctgttcgacatgctgcgcgagga	Protospacer
    *.******* ********* ********

119. spacer 1.7|35510|33|NC_009468|PILER-CR matches to NC_020562 (Sphingomonas sp. MM-1 plasmid pISP1, complete sequence) position: , mismatch: 8, identity: 0.758

gcttcgcgccctgatcgacatgcagcgcgaggt	CRISPR spacer
cgaacacgccctgttcgacatgctgcgcgagga	Protospacer
    *.******* ********* ********

120. spacer 1.7|35510|33|NC_009468|PILER-CR matches to MN813686 (Mycobacterium phage BirdsNest, complete genome) position: , mismatch: 8, identity: 0.758

gcttcgcgccctgatcgacatgcagcgcgaggt	CRISPR spacer
ggcgcgcgtcctgatcgacatgcaccgcgacca	Protospacer
* . ****.*************** *****

121. spacer 1.7|35510|33|NC_009468|PILER-CR matches to NZ_CP005193 (Sphingobium sp. MI1205 plasmid pMI4, complete sequence) position: , mismatch: 8, identity: 0.758

gcttcgcgccctgatcgacatgcagcgcgaggt	CRISPR spacer
cgaacacgccctgttcgacatgctgcgcgagga	Protospacer
    *.******* ********* ********

122. spacer 1.7|35510|33|NC_009468|PILER-CR matches to NC_020563 (Sphingomonas sp. MM-1 plasmid pISP4, complete sequence) position: , mismatch: 8, identity: 0.758

gcttcgcgccctgatcgacatgcagcgcgaggt	CRISPR spacer
cgaacacgccctgttcgacatgctgcgcgagga	Protospacer
    *.******* ********* ********

123. spacer 1.10|35693|33|NC_009468|PILER-CR matches to NZ_AP014579 (Burkholderia sp. RPE67 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.758

gcgaatgaggaattcgccgcgttctatacgctc	CRISPR spacer
gcgaatccggaattcgccgcgttccgcacgtgg	Protospacer
******  ****************...***.

124. spacer 1.10|35693|33|NC_009468|PILER-CR matches to NC_016626 (Burkholderia sp. YI23 plasmid byi_1p, complete sequence) position: , mismatch: 8, identity: 0.758

gcgaatgaggaattcgccgcgttctatacgctc	CRISPR spacer
gcgaatccggaattcgccgcgttccgcacgtgg	Protospacer
******  ****************...***.

125. spacer 1.29|36852|33|NC_009468|PILER-CR matches to NZ_AP022333 (Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49a, complete sequence) position: , mismatch: 8, identity: 0.758

gccgttcgtctggatcgtagatcgcgaaatgac	CRISPR spacer
tccgttcgtctgggtcgtcgatcgcgtcgcgcc	Protospacer
 ************.**** *******  ..* *

126. spacer 1.32|37035|33|NC_009468|PILER-CR matches to NZ_CP016083 (Streptomyces sp. SAT1 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.758

ggtgcggttctgcaccgggccgaacg--tggccgc	CRISPR spacer
ggtgcgggtcggcaccgggccgaagagctggtt--	Protospacer
******* ** ************* .  ***..

127. spacer 1.32|37035|33|NC_009468|PILER-CR matches to NZ_CP015737 (Shinella sp. HZN7 plasmid pShin-01, complete sequence) position: , mismatch: 8, identity: 0.758

ggtgcggttctgcaccgggccgaacgtggccgc	CRISPR spacer
ggtgcggttctggaccggcccgaagggctacgg	Protospacer
************ ***** ***** *    **

128. spacer 1.40|35389|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP010598 (Phaeobacter inhibens strain P10 plasmid pP10_c, complete sequence) position: , mismatch: 8, identity: 0.75

atgcgcaaggcgcgcaagcgcaagggcaacag	CRISPR spacer
atccgcaaggcgcgcaagggcaaccgcggcgc	Protospacer
** *************** ****  **..*.

129. spacer 1.40|35389|32|NC_009468|CRISPRCasFinder,CRT matches to NC_018288 (Phaeobacter inhibens DSM 17395 plasmid pPGA1_65, complete sequence) position: , mismatch: 8, identity: 0.75

atgcgcaaggcgcgcaagcgcaagggcaacag	CRISPR spacer
atccgcaaggcgcgcaagggcaaccgcggcgc	Protospacer
** *************** ****  **..*.

130. spacer 1.40|35389|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP016368 (Phaeobacter porticola strain P97 plasmid pP97_d, complete sequence) position: , mismatch: 8, identity: 0.75

atgcgcaaggcgcgcaagcgcaagggcaacag	CRISPR spacer
atccgcaaggcgcgcaagggcaaccgcggcgc	Protospacer
** *************** ****  **..*.

131. spacer 1.42|35511|32|NC_009468|CRISPRCasFinder,CRT matches to MN813686 (Mycobacterium phage BirdsNest, complete genome) position: , mismatch: 8, identity: 0.75

cttcgcgccctgatcgacatgcagcgcgaggt	CRISPR spacer
gcgcgcgtcctgatcgacatgcaccgcgacca	Protospacer
 . ****.*************** *****

132. spacer 1.42|35511|32|NC_009468|CRISPRCasFinder,CRT matches to NC_022049 (Paracoccus aminophilus JCM 7686 plasmid pAMI4, complete sequence) position: , mismatch: 8, identity: 0.75

cttcgcgccctgatcgacatgcagcgcgaggt	CRISPR spacer
gcgcgcgccctgatcggcaagcagcgcggtgc	Protospacer
 . *************.** ********. *.

133. spacer 1.44|35633|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP032695 (Rhizobium jaguaris strain CCGE525 plasmid pRCCGE525c, complete sequence) position: , mismatch: 8, identity: 0.75

ttttttgaacagccggaattgattgaacagtt	CRISPR spacer
ctccaggatcagccggaactgattgaacagct	Protospacer
.*..  ** *********.***********.*

134. spacer 1.45|35694|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP007516 (Rubrobacter radiotolerans strain RSPS-4 plasmid 2, complete sequence) position: , mismatch: 8, identity: 0.75

cgaatgaggaattcgccgcgttctatacgctc	CRISPR spacer
tatgcgtggaattcgccgcgctctataagctc	Protospacer
.. ..* *************.****** ****

135. spacer 1.45|35694|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_AP014579 (Burkholderia sp. RPE67 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.75

cgaatgaggaattcgccgcgttctatacgctc	CRISPR spacer
cgaatccggaattcgccgcgttccgcacgtgg	Protospacer
*****  ****************...***.

136. spacer 1.45|35694|32|NC_009468|CRISPRCasFinder,CRT matches to NC_016626 (Burkholderia sp. YI23 plasmid byi_1p, complete sequence) position: , mismatch: 8, identity: 0.75

cgaatgaggaattcgccgcgttctatacgctc	CRISPR spacer
cgaatccggaattcgccgcgttccgcacgtgg	Protospacer
*****  ****************...***.

137. spacer 1.46|35755|32|NC_009468|CRISPRCasFinder,CRT matches to KM389229 (UNVERIFIED: Pseudomonas phage F_TK1718sp/PAK clone contig00001 genomic sequence) position: , mismatch: 8, identity: 0.75

tgtcgcaatccggagtcggctcgctccgccat	CRISPR spacer
cctgcccttccggagacggctccctccgccat	Protospacer
. *  *  ******* ****** *********

138. spacer 1.55|36304|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP006991 (Rhizobium sp. IE4771 plasmid pRetIE4771e, complete sequence) position: , mismatch: 8, identity: 0.75

gatatcgttgccagacggcgcacgctcgcaat	CRISPR spacer
gacgacgttgcccgagggcgcacgctcgccgg	Protospacer
**.. ******* ** ************* .

139. spacer 1.55|36304|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP021128 (Rhizobium sp. Kim5 plasmid pRetKim5d, complete sequence) position: , mismatch: 8, identity: 0.75

gatatcgttgccagacggcgcacgctcgcaat	CRISPR spacer
gacgacgttgcccgagggcgcacgctcgccgg	Protospacer
**.. ******* ** ************* .

140. spacer 1.55|36304|32|NC_009468|CRISPRCasFinder,CRT matches to CP007645 (Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803d, complete sequence) position: , mismatch: 8, identity: 0.75

gatatcgttgccagacggcgcacgctcgcaat	CRISPR spacer
gacgacgttgcccgagggcgcacgctcgccgg	Protospacer
**.. ******* ** ************* .

141. spacer 1.67|37036|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP049157 (Caballeronia sp. SBC1 plasmid pSBC1_1, complete sequence) position: , mismatch: 8, identity: 0.75

gtgcggttctgcaccgggccgaacgtggccgc	CRISPR spacer
ttcgatttccgcaccgggccgaacctggccgt	Protospacer
 *  . ***.************** ******.

142. spacer 1.67|37036|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP049317 (Caballeronia sp. SBC2 plasmid pSBC2-1, complete sequence) position: , mismatch: 8, identity: 0.75

gtgcggttctgcaccgggccgaacgtggccgc	CRISPR spacer
ttcgatttccgcaccgggccgaacctggccgt	Protospacer
 *  . ***.************** ******.

143. spacer 1.67|37036|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP038636 (Cupriavidus oxalaticus strain X32 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

gtgcggttctgcaccgggccgaacgtggccgc	CRISPR spacer
atgcggttctgcaccgggcccatcgcgatatc	Protospacer
.******************* * **.*..  *

144. spacer 1.67|37036|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP016083 (Streptomyces sp. SAT1 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.75

gtgcggttctgcaccgggccgaacg--tggccgc	CRISPR spacer
gtgcgggtcggcaccgggccgaagagctggtt--	Protospacer
****** ** ************* .  ***..

145. spacer 1.67|37036|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP015737 (Shinella sp. HZN7 plasmid pShin-01, complete sequence) position: , mismatch: 8, identity: 0.75

gtgcggttctgcaccgggccgaacgtggccgc	CRISPR spacer
gtgcggttctggaccggcccgaagggctacgg	Protospacer
*********** ***** ***** *    **

146. spacer 1.67|37036|32|NC_009468|CRISPRCasFinder,CRT matches to MT270409 (Phaeobacter phage MD18, complete genome) position: , mismatch: 8, identity: 0.75

gtgcggttctgcaccgggccgaacgtggccgc	CRISPR spacer
tggcggtcctgcaccgggcagaacgccgcacc	Protospacer
  *****.*********** *****. **  *

147. spacer 1.71|37280|32|NC_009468|CRISPRCasFinder,CRT matches to NC_019849 (Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence) position: , mismatch: 8, identity: 0.75

tccggcatcgtttccgcgccggcattcacgcc	CRISPR spacer
cctatcatcgtatccgcgcgggcattcacgaa	Protospacer
.*.. ****** ******* **********

148. spacer 1.71|37280|32|NC_009468|CRISPRCasFinder,CRT matches to NC_003078 (Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

tccggcatcgtttccgcgccggcattcacgcc	CRISPR spacer
cctatcatcgtatccgcgcgggcattcacgaa	Protospacer
.*.. ****** ******* **********

149. spacer 1.71|37280|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP019586 (Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

tccggcatcgtttccgcgccggcattcacgcc	CRISPR spacer
cctatcatcgtatccgcgcgggcattcacgaa	Protospacer
.*.. ****** ******* **********

150. spacer 1.71|37280|32|NC_009468|CRISPRCasFinder,CRT matches to NC_017326 (Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence) position: , mismatch: 8, identity: 0.75

tccggcatcgtttccgcgccggcattcacgcc	CRISPR spacer
cctatcatcgtatccgcgcgggcattcacgaa	Protospacer
.*.. ****** ******* **********

151. spacer 1.71|37280|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP021799 (Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

tccggcatcgtttccgcgccggcattcacgcc	CRISPR spacer
cctatcatcgtatccgcgcgggcattcacgaa	Protospacer
.*.. ****** ******* **********

152. spacer 1.71|37280|32|NC_009468|CRISPRCasFinder,CRT matches to NC_017323 (Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence) position: , mismatch: 8, identity: 0.75

tccggcatcgtttccgcgccggcattcacgcc	CRISPR spacer
cctatcatcgtatccgcgcgggcattcacgaa	Protospacer
.*.. ****** ******* **********

153. spacer 1.71|37280|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP009146 (Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

tccggcatcgtttccgcgccggcattcacgcc	CRISPR spacer
cctatcatcgtatccgcgcgggcattcacgaa	Protospacer
.*.. ****** ******* **********

154. spacer 1.71|37280|32|NC_009468|CRISPRCasFinder,CRT matches to NC_018701 (Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence) position: , mismatch: 8, identity: 0.75

tccggcatcgtttccgcgccggcattcacgcc	CRISPR spacer
cctatcatcgtatccgcgcgggcattcacgaa	Protospacer
.*.. ****** ******* **********

155. spacer 1.71|37280|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP021828 (Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

tccggcatcgtttccgcgccggcattcacgcc	CRISPR spacer
cctatcatcgtatccgcgcgggcattcacgaa	Protospacer
.*.. ****** ******* **********

156. spacer 1.71|37280|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP021802 (Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

tccggcatcgtttccgcgccggcattcacgcc	CRISPR spacer
cctatcatcgtatccgcgcgggcattcacgaa	Protospacer
.*.. ****** ******* **********

157. spacer 1.71|37280|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP021820 (Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

tccggcatcgtttccgcgccggcattcacgcc	CRISPR spacer
cctatcatcgtatccgcgcgggcattcacgaa	Protospacer
.*.. ****** ******* **********

158. spacer 1.71|37280|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP021831 (Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

tccggcatcgtttccgcgccggcattcacgcc	CRISPR spacer
cctatcatcgtatccgcgcgggcattcacgaa	Protospacer
.*.. ****** ******* **********

159. spacer 1.71|37280|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP021823 (Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

tccggcatcgtttccgcgccggcattcacgcc	CRISPR spacer
cctatcatcgtatccgcgcgggcattcacgaa	Protospacer
.*.. ****** ******* **********

160. spacer 1.71|37280|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP021814 (Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

tccggcatcgtttccgcgccggcattcacgcc	CRISPR spacer
cctatcatcgtatccgcgcgggcattcacgaa	Protospacer
.*.. ****** ******* **********

161. spacer 1.71|37280|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP021795 (Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

tccggcatcgtttccgcgccggcattcacgcc	CRISPR spacer
cctatcatcgtatccgcgcgggcattcacgaa	Protospacer
.*.. ****** ******* **********

162. spacer 1.71|37280|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP021810 (Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

tccggcatcgtttccgcgccggcattcacgcc	CRISPR spacer
cctatcatcgtatccgcgcgggcattcacgaa	Protospacer
.*.. ****** ******* **********

163. spacer 1.71|37280|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP021806 (Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

tccggcatcgtttccgcgccggcattcacgcc	CRISPR spacer
cctatcatcgtatccgcgcgggcattcacgaa	Protospacer
.*.. ****** ******* **********

164. spacer 1.71|37280|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP021218 (Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

tccggcatcgtttccgcgccggcattcacgcc	CRISPR spacer
cctatcatcgtatccgcgcgggcattcacgaa	Protospacer
.*.. ****** ******* **********

165. spacer 1.71|37280|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP026527 (Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

tccggcatcgtttccgcgccggcattcacgcc	CRISPR spacer
cctatcatcgtatccgcgcgggcattcacgaa	Protospacer
.*.. ****** ******* **********

166. spacer 1.71|37280|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP019484 (Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

tccggcatcgtttccgcgccggcattcacgcc	CRISPR spacer
cctatcatcgtatccgcgcgggcattcacgaa	Protospacer
.*.. ****** ******* **********

167. spacer 1.71|37280|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP019487 (Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence) position: , mismatch: 8, identity: 0.75

tccggcatcgtttccgcgccggcattcacgcc	CRISPR spacer
cctatcatcgtatccgcgcgggcattcacgaa	Protospacer
.*.. ****** ******* **********

168. spacer 1.71|37280|32|NC_009468|CRISPRCasFinder,CRT matches to NC_020560 (Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

tccggcatcgtttccgcgccggcattcacgcc	CRISPR spacer
cctatcatcgtatccgcgcgggcattcacgaa	Protospacer
.*.. ****** ******* **********

169. spacer 1.72|37341|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP054621 (Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence) position: , mismatch: 8, identity: 0.75

cctgacaccggcgacacggccctcagccgctc	CRISPR spacer
cgttccgccggcgacaccgccatcagccgcat	Protospacer
* *  *.********** *** ******** .

170. spacer 1.73|37402|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP018231 (Rhizobium leguminosarum strain Vaf-108 plasmid unnamed3) position: , mismatch: 8, identity: 0.75

aacgtgacaacgcccgtcgcctgcgcggtgag	CRISPR spacer
aacgtgacaacgcccgtcgaccgccacttaac	Protospacer
******************* *.**    *.*

171. spacer 1.7|35510|33|NC_009468|PILER-CR matches to NC_022049 (Paracoccus aminophilus JCM 7686 plasmid pAMI4, complete sequence) position: , mismatch: 9, identity: 0.727

gcttcgcgccctgatcgacatgcagcgcgaggt	CRISPR spacer
tgcgcgcgccctgatcggcaagcagcgcggtgc	Protospacer
  . *************.** ********. *.

172. spacer 1.7|35510|33|NC_009468|PILER-CR matches to NZ_CP044082 (Paracoccus yeei strain FDAARGOS_643 plasmid unnamed4, complete sequence) position: , mismatch: 9, identity: 0.727

gcttcgcgccctgatcgacatgcagcgcgaggt	CRISPR spacer
ggccagcgacctgatcgacatgcagtgcgatac	Protospacer
* .. *** ****************.**** ..

173. spacer 1.7|35510|33|NC_009468|PILER-CR matches to NZ_CP031080 (Paracoccus yeei strain CCUG 32053 plasmid pYEE2, complete sequence) position: , mismatch: 9, identity: 0.727

gcttcgcgccctgatcgacatgcagcgcgaggt	CRISPR spacer
ggccagcgacctgatcgacatgcagtgcgatac	Protospacer
* .. *** ****************.**** ..

174. spacer 1.9|35632|33|NC_009468|PILER-CR matches to NZ_CP032695 (Rhizobium jaguaris strain CCGE525 plasmid pRCCGE525c, complete sequence) position: , mismatch: 9, identity: 0.727

gttttttgaacagccggaattgattgaacagtt	CRISPR spacer
cctccaggatcagccggaactgattgaacagct	Protospacer
 .*..  ** *********.***********.*

175. spacer 1.10|35693|33|NC_009468|PILER-CR matches to NZ_CP007516 (Rubrobacter radiotolerans strain RSPS-4 plasmid 2, complete sequence) position: , mismatch: 9, identity: 0.727

gcgaatgaggaattcgccgcgttctatacgctc	CRISPR spacer
atatgcgtggaattcgccgcgctctataagctc	Protospacer
... ..* *************.****** ****

176. spacer 1.11|35754|33|NC_009468|PILER-CR matches to KM389229 (UNVERIFIED: Pseudomonas phage F_TK1718sp/PAK clone contig00001 genomic sequence) position: , mismatch: 9, identity: 0.727

gtgtcgcaatccggagtcggctcgctccgccat	CRISPR spacer
acctgcccttccggagacggctccctccgccat	Protospacer
.. *  *  ******* ****** *********

177. spacer 1.20|36303|33|NC_009468|PILER-CR matches to NZ_CP006991 (Rhizobium sp. IE4771 plasmid pRetIE4771e, complete sequence) position: , mismatch: 9, identity: 0.727

ggatatcgttgccagacggcgcacgctcgcaat	CRISPR spacer
tgacgacgttgcccgagggcgcacgctcgccgg	Protospacer
 **.. ******* ** ************* .

178. spacer 1.20|36303|33|NC_009468|PILER-CR matches to NZ_CP021128 (Rhizobium sp. Kim5 plasmid pRetKim5d, complete sequence) position: , mismatch: 9, identity: 0.727

ggatatcgttgccagacggcgcacgctcgcaat	CRISPR spacer
tgacgacgttgcccgagggcgcacgctcgccgg	Protospacer
 **.. ******* ** ************* .

179. spacer 1.20|36303|33|NC_009468|PILER-CR matches to CP007645 (Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803d, complete sequence) position: , mismatch: 9, identity: 0.727

ggatatcgttgccagacggcgcacgctcgcaat	CRISPR spacer
tgacgacgttgcccgagggcgcacgctcgccgg	Protospacer
 **.. ******* ** ************* .

180. spacer 1.32|37035|33|NC_009468|PILER-CR matches to NZ_CP049317 (Caballeronia sp. SBC2 plasmid pSBC2-1, complete sequence) position: , mismatch: 9, identity: 0.727

ggtgcggttctgcaccgggccgaacgtggccgc	CRISPR spacer
tttcgatttccgcaccgggccgaacctggccgt	Protospacer
  *  . ***.************** ******.

181. spacer 1.32|37035|33|NC_009468|PILER-CR matches to NZ_CP049157 (Caballeronia sp. SBC1 plasmid pSBC1_1, complete sequence) position: , mismatch: 9, identity: 0.727

ggtgcggttctgcaccgggccgaacgtggccgc	CRISPR spacer
tttcgatttccgcaccgggccgaacctggccgt	Protospacer
  *  . ***.************** ******.

182. spacer 1.32|37035|33|NC_009468|PILER-CR matches to NZ_CP038636 (Cupriavidus oxalaticus strain X32 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.727

ggtgcggttctgcaccgggccgaacgtggccgc	CRISPR spacer
catgcggttctgcaccgggcccatcgcgatatc	Protospacer
 .******************* * **.*..  *

183. spacer 1.40|35389|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_AP014705 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence) position: , mismatch: 9, identity: 0.719

atgcgcaaggcgcgcaagcgcaagggcaacag	CRISPR spacer
gcctgcaaggcgctcaagcgcaacggcttcac	Protospacer
.. .********* ********* ***  **

184. spacer 1.40|35389|32|NC_009468|CRISPRCasFinder,CRT matches to MN586020 (Microbacterium phage Megan, complete genome) position: , mismatch: 9, identity: 0.719

atgcgcaaggcgcgcaagcgcaagggcaacag	CRISPR spacer
cgccgcaacgcgcccaagcgcaaggggccgag	Protospacer
   ***** **** ************    **

185. spacer 1.42|35511|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_GU811235 (Sphingobium chungbukense strain DJ77 plasmid pSY3, complete sequence) position: , mismatch: 9, identity: 0.719

cttcgcgccctgatcgacatgcagcgcgaggt	CRISPR spacer
gaggatgccctgttcgacatgctgcgcgagga	Protospacer
    ..****** ********* ********

186. spacer 1.42|35511|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP044082 (Paracoccus yeei strain FDAARGOS_643 plasmid unnamed4, complete sequence) position: , mismatch: 9, identity: 0.719

cttcgcgccctgatcgacatgcagcgcgaggt	CRISPR spacer
gccagcgacctgatcgacatgcagtgcgatac	Protospacer
 .. *** ****************.**** ..

187. spacer 1.42|35511|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP031080 (Paracoccus yeei strain CCUG 32053 plasmid pYEE2, complete sequence) position: , mismatch: 9, identity: 0.719

cttcgcgccctgatcgacatgcagcgcgaggt	CRISPR spacer
gccagcgacctgatcgacatgcagtgcgatac	Protospacer
 .. *** ****************.**** ..

188. spacer 1.42|35511|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_LN907828 (Erwinia gerundensis isolate E_g_EM595 plasmid pEM01, complete sequence) position: , mismatch: 9, identity: 0.719

cttcgcgccctgatcgacatgcagcgcgaggt	CRISPR spacer
catctcgccctgctcgacatgcagctgcccct	Protospacer
* ** ******* ************      *

189. spacer 1.42|35511|32|NC_009468|CRISPRCasFinder,CRT matches to NC_010625 (Paraburkholderia phymatum STM815 plasmid pBPHY01, complete sequence) position: , mismatch: 9, identity: 0.719

cttcgcgccctgatcgacatgcagcgcgaggt	CRISPR spacer
gccccagacctgatcgacatagagcgcgaggc	Protospacer
 ..*  * ************. *********.

190. spacer 1.42|35511|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_AP022849 (Bosea sp. ANAM02 plasmid pANAM02, complete sequence) position: , mismatch: 9, identity: 0.719

cttcgcgccctgatcgacatgcagcgcgaggt	CRISPR spacer
gatctgcttctcatcgacatccagcgcgaggt	Protospacer
  **   ..** ******** ***********

191. spacer 1.42|35511|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP016619 (Microvirga ossetica strain V5/3m plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

cttcgcgccctgatcgacatgcagcgcgaggt	CRISPR spacer
tcgggcatcctgttcgacatgcaccgcgaggc	Protospacer
..  **..**** ********** *******.

192. spacer 1.42|35511|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP032349 (Azospirillum brasilense strain MTCC4039 plasmid p3, complete sequence) position: , mismatch: 9, identity: 0.719

cttcgcgccctgatcgacatgcagcgcgaggt	CRISPR spacer
accgccgccctgctcgacctgcagcgcgggtt	Protospacer
 ..  ******* ***** *********.* *

193. spacer 1.46|35755|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP050104 (Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b2, complete sequence) position: , mismatch: 9, identity: 0.719

tgtcgcaatccggagtcggctcgctccgccat	CRISPR spacer
cgcacgacgccggagtcggctccctccgtcat	Protospacer
.*.   *  ************* *****.***

194. spacer 1.46|35755|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP025013 (Rhizobium leguminosarum strain Norway plasmid pRLN1, complete sequence) position: , mismatch: 9, identity: 0.719

tgtcgcaatccggagtcggctcgctccgccat	CRISPR spacer
cgcacgacgccggagtcggctccctccgtcat	Protospacer
.*.   *  ************* *****.***

195. spacer 1.46|35755|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP025507 (Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvA, complete sequence) position: , mismatch: 9, identity: 0.719

tgtcgcaatccggagtcggctcgctccgccat	CRISPR spacer
cgcacgacgccggagtcggctccctccgtcat	Protospacer
.*.   *  ************* *****.***

196. spacer 1.46|35755|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP050109 (Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b2, complete sequence) position: , mismatch: 9, identity: 0.719

tgtcgcaatccggagtcggctcgctccgccat	CRISPR spacer
cgcacgacgccggagtcggctccctccgtcat	Protospacer
.*.   *  ************* *****.***

197. spacer 1.54|36243|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP047177 (Rathayibacter sp. VKM Ac-2759 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

gcagaggcagcagagaggcgatgcaccgaatt	CRISPR spacer
gcagacgcagcggagaggcgatgacgcgtccg	Protospacer
***** *****.***********   **  .

198. spacer 1.60|36609|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP013486 (Vibrio alginolyticus strain ATCC 33787 plasmid pMBL128, complete sequence) position: , mismatch: 9, identity: 0.719

cgacgccggacgctcgcgaaatcgcctttgtg	CRISPR spacer
agctggtggacgctggcgcaatcgcctttgat	Protospacer
 * .* .******* *** ***********

199. spacer 1.67|37036|32|NC_009468|CRISPRCasFinder,CRT matches to MG641885 (Salmonella phage PMBT28, complete genome) position: , mismatch: 9, identity: 0.719

gtgcggttctgcaccgggccgaacgtggccgc	CRISPR spacer
tagaagttctgcaccggggcgaacgtggtgtt	Protospacer
  * .************* *********.  .

200. spacer 1.68|37097|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP051517 (Paraburkholderia aromaticivorans strain AR20-38 plasmid unnamed1) position: , mismatch: 9, identity: 0.719

tcagcgtatcgctcgcggcggcaacgtgggta	CRISPR spacer
tttgcgtagcgatcgcggcggcaacgaagaag	Protospacer
*. ***** ** ************** .*. .

201. spacer 1.68|37097|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP026527 (Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence) position: , mismatch: 9, identity: 0.719

tcagcgtatcgctcgcggcggcaacgtgggta	CRISPR spacer
tgacgccgtcgctcggggcggcaaggtgggtg	Protospacer
* *   ..******* ******** ******.

202. spacer 1.68|37097|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP041223 (Porphyrobacter sp. YT40 plasmid pYT40, complete sequence) position: , mismatch: 9, identity: 0.719

tcagcgtatcgctcgcggcggcaacgtgggta	CRISPR spacer
tctgcgtatcgcccgcggcggcactttccatg	Protospacer
** *********.********** . *  .*.

203. spacer 1.68|37097|32|NC_009468|CRISPRCasFinder,CRT matches to MK310144 (Mycobacterium phage CicholasNage, complete genome) position: , mismatch: 9, identity: 0.719

tcagcgtatcgctcgcggcggcaacgtgggta	CRISPR spacer
tattcaggccgctcgcggcggcaaggtggata	Protospacer
*   *. ..*************** ****.**

204. spacer 1.71|37280|32|NC_009468|CRISPRCasFinder,CRT matches to KX388536 (Agrobacterium tumefaciens strain Chry5 plasmid pTiChry5, complete sequence) position: , mismatch: 9, identity: 0.719

tccggcatcgtttccgcgccggcattcacgcc	CRISPR spacer
ccaccgatcgtatccgggccggcattcacgat	Protospacer
.*    ***** **** ************* .

205. spacer 1.71|37280|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_KY000032 (Agrobacterium fabrum strain CFBP2788 plasmid pTi_CFBP2788, complete sequence) position: , mismatch: 9, identity: 0.719

tccggcatcgtttccgcgccggcattcacgcc	CRISPR spacer
ccaccgatcgtatccgggccggcattcacgat	Protospacer
.*    ***** **** ************* .

206. spacer 1.71|37280|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_KY000032 (Agrobacterium fabrum strain CFBP2788 plasmid pTi_CFBP2788, complete sequence) position: , mismatch: 9, identity: 0.719

tccggcatcgtttccgcgccggcattcacgcc	CRISPR spacer
ccaccgatcgtatccgggccggcattcacgat	Protospacer
.*    ***** **** ************* .

207. spacer 1.71|37280|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP039902 (Agrobacterium tumefaciens strain CFBP5877 plasmid pTiCFBP5877, complete sequence) position: , mismatch: 9, identity: 0.719

tccggcatcgtttccgcgccggcattcacgcc	CRISPR spacer
ccaccgatcgtatccgggccggcattcacgat	Protospacer
.*    ***** **** ************* .

208. spacer 1.71|37280|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP039893 (Agrobacterium tumefaciens strain CFBP5499 plasmid pTiCFBP5499, complete sequence) position: , mismatch: 9, identity: 0.719

tccggcatcgtttccgcgccggcattcacgcc	CRISPR spacer
ccaccgatcgtatccgggccggcattcacgat	Protospacer
.*    ***** **** ************* .

209. spacer 1.71|37280|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_KY000025 (Agrobacterium genomosp. 6 strain AR125 plasmid pTi_AR125, complete sequence) position: , mismatch: 9, identity: 0.719

tccggcatcgtttccgcgccggcattcacgcc	CRISPR spacer
ccaccgatcgtatccgggccggcattcacgat	Protospacer
.*    ***** **** ************* .

210. spacer 1.71|37280|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_KY000074 (Agrobacterium larrymoorei strain CFBP5481 plasmid pTi_CFBP5481, complete sequence) position: , mismatch: 9, identity: 0.719

tccggcatcgtttccgcgccggcattcacgcc	CRISPR spacer
ccaccgatcgtatccgggccggcattcacgat	Protospacer
.*    ***** **** ************* .

211. spacer 1.71|37280|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_KY000029 (Agrobacterium genomosp. 6 strain CFBP5499 plasmid pTi_CFBP5499, complete sequence) position: , mismatch: 9, identity: 0.719

tccggcatcgtttccgcgccggcattcacgcc	CRISPR spacer
ccaccgatcgtatccgggccggcattcacgat	Protospacer
.*    ***** **** ************* .

212. spacer 1.71|37280|32|NC_009468|CRISPRCasFinder,CRT matches to CP047390 (Agrobacterium sp. CGMCC 11546 plasmid pB) position: , mismatch: 9, identity: 0.719

tccggcatcgtttccgcgccggcattcacgcc	CRISPR spacer
ccacccgtcgtgtccgcgccggcgttcacgat	Protospacer
.*   *.**** ***********.****** .

213. spacer 1.7|35510|33|NC_009468|PILER-CR matches to NZ_GU811235 (Sphingobium chungbukense strain DJ77 plasmid pSY3, complete sequence) position: , mismatch: 10, identity: 0.697

gcttcgcgccctgatcgacatgcagcgcgaggt	CRISPR spacer
tgaggatgccctgttcgacatgctgcgcgagga	Protospacer
     ..****** ********* ********

214. spacer 1.36|35145|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP022416 (Sulfitobacter pseudonitzschiae strain SMR1 plasmid pSMR1-1, complete sequence) position: , mismatch: 10, identity: 0.688

ccgcctgggaggatatggagcgctggattgat	CRISPR spacer
tgacgatggaggatatggaacgctggcttgcg	Protospacer
. .*   ************.****** ***

215. spacer 1.40|35389|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP020740 ([Pseudomonas] mesoacidophila strain ATCC 31433 plasmid pATCC31433, complete sequence) position: , mismatch: 10, identity: 0.688

atgcgcaaggcgcgcaagcgcaagggcaacag	CRISPR spacer
cagcgcaaggcgcgcacgcgccaggctcggcg	Protospacer
  ************** **** *** . .  *

216. spacer 1.40|35389|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP010860 (Marinovum algicola DG 898 plasmid pMaD5, complete sequence) position: , mismatch: 10, identity: 0.688

atgcgcaaggcgcgcaagcgcaagggcaacag	CRISPR spacer
ggcggcaaggtgcccaagcgcaagggcgccta	Protospacer
.   ******.** *************. * .

217. spacer 1.42|35511|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_AP018668 (Sphingobium amiense strain DSM 16289 plasmid pSAMIE_5, complete sequence) position: , mismatch: 10, identity: 0.688

cttcgcgccctgatcgacatgcagcgcgaggt	CRISPR spacer
gaggaagccctgttcgacatgctgcgcgatga	Protospacer
    . ****** ********* ****** *

218. spacer 1.42|35511|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP018096 (Chelatococcus daeguensis strain TAD1 plasmid pTAD1, complete sequence) position: , mismatch: 10, identity: 0.688

cttcgcgccctgatcgacatgcagcgcgaggt	CRISPR spacer
gccgtcttcctcatcgacatgaagcgcgaggc	Protospacer
 ..  * .*** ********* *********.

219. spacer 1.42|35511|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP012399 (Chelatococcus sp. CO-6 plasmid pCO-6, complete sequence) position: , mismatch: 10, identity: 0.688

cttcgcgccctgatcgacatgcagcgcgaggt	CRISPR spacer
gccgtcttcctcatcgacatgaagcgcgaggc	Protospacer
 ..  * .*** ********* *********.

220. spacer 1.42|35511|32|NC_009468|CRISPRCasFinder,CRT matches to MN478374 (Bacteriophage Phobos, complete genome) position: , mismatch: 10, identity: 0.688

cttcgcgccctgatcgacatgcagcgcgaggt	CRISPR spacer
agcaaagccctgaacgacatgctgcgcgacga	Protospacer
  . . ******* ******** ****** *

221. spacer 1.47|35816|32|NC_009468|CRISPRCasFinder,CRT matches to KU728633 (Mycobacterium phage Bipper, complete genome) position: , mismatch: 10, identity: 0.688

gggtatacgtgctaccggcgggggctggagta	CRISPR spacer
accgagctgtgcgaccggctggggctggagtg	Protospacer
.   *  .**** ****** ***********.

222. spacer 1.47|35816|32|NC_009468|CRISPRCasFinder,CRT matches to MK977701 (Mycobacterium phage Cracklewink, complete genome) position: , mismatch: 10, identity: 0.688

gggtatacgtgctaccggcgggggctggagta	CRISPR spacer
accgagctgtgcgaccggctggggctggagtg	Protospacer
.   *  .**** ****** ***********.

223. spacer 1.48|35877|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP013426 (Burkholderia sp. MSMB0856 plasmid pMSMB0856, complete sequence) position: , mismatch: 10, identity: 0.688

tggccgatgctcgcgcagaaagtgggcgtgtg	CRISPR spacer
gcatccatgctcgcgcagtaagtgagcgtacc	Protospacer
  ..* ************ *****.****..

224. spacer 1.50|35999|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP015041 (Rhodovulum sp. P5 plasmid pRGUI02, complete sequence) position: , mismatch: 10, identity: 0.688

taaagcgcggcgtccccccgcgccgcaaaagc	CRISPR spacer
tggcacgcgccgtcaccccgcgccgcaaggcg	Protospacer
*.. .**** **** *************..

225. spacer 1.50|35999|32|NC_009468|CRISPRCasFinder,CRT matches to AP017627 (Pleomorphomonas sp. SM30 plasmid pSM30-1 DNA, complete genome) position: , mismatch: 10, identity: 0.688

taaagcgcggcgtccccccgcgccgcaaaagc	CRISPR spacer
accagcgcggcgtctccgcgcgccgcgcgctc	Protospacer
   ***********.** ********. .  *

226. spacer 1.60|36609|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP015420 (Rhodovulum sulfidophilum DSM 1374 plasmid unnamed2, complete sequence) position: , mismatch: 10, identity: 0.688

cgacgccggacgctcgcgaaatcgcctttgtg	CRISPR spacer
ctgcgccggacggtctcgaaatcgcccagcac	Protospacer
* .********* ** **********.

227. spacer 1.60|36609|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_AP014801 (Rhodovulum sulfidophilum plasmid Plasmid1 DNA, complete genome, strain: DSM 2351) position: , mismatch: 10, identity: 0.688

cgacgccggacgctcgcgaaatcgcctttgtg	CRISPR spacer
ctgcgccggacggtctcgaaatcgcccagcac	Protospacer
* .********* ** **********.

228. spacer 1.68|37097|32|NC_009468|CRISPRCasFinder,CRT matches to NC_020548 (Azoarcus sp. KH32C plasmid pAZKH, complete sequence) position: , mismatch: 10, identity: 0.688

tcagcgtatcgctcgcggcggcaacgtgggta	CRISPR spacer
agggcgtctcgctcgcggcggcaacggtttcg	Protospacer
  .**** ******************    ..

229. spacer 1.68|37097|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP032695 (Rhizobium jaguaris strain CCGE525 plasmid pRCCGE525c, complete sequence) position: , mismatch: 10, identity: 0.688

tcagcgtatcgctcgcggcggcaacgtgggta	CRISPR spacer
ccgcaatagcgctggcggcggcaacgtggtcc	Protospacer
.*.  .** **** *************** .

230. spacer 1.68|37097|32|NC_009468|CRISPRCasFinder,CRT matches to MH593834 (Siphoviridae sp. isolate ctbe1, complete genome) position: , mismatch: 10, identity: 0.688

tcagcgtatcgctcgcggcggcaacgtgggta	CRISPR spacer
ggtgagtatcgctcgccgtggcaacgtgctgc	Protospacer
   * *********** *.*********

231. spacer 1.69|37158|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_LN614828 (Legionella fallonii LLAP-10 plasmid II, complete sequence) position: , mismatch: 10, identity: 0.688

tttacgttgtattgggtgcggcgagacgggca	CRISPR spacer
tttatgttgtattgtgtgcggcgttgagcctc	Protospacer
****.********* ********  . *  .

232. spacer 1.72|37341|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 10, identity: 0.688

cctgacaccggcgacacggccctcagccgctc	CRISPR spacer
aggcacaccgccgacacggccatcagcgcgac	Protospacer
    ****** ********** *****    *

233. spacer 1.65|36914|32|NC_009468|CRISPRCasFinder,CRT matches to NZ_CP022305 (Thalassococcus sp. S3 plasmid pS3B, complete sequence) position: , mismatch: 11, identity: 0.656

gattgtcaggtaatcgccgagcgtctgataaa	CRISPR spacer
atcggtcagataatcggcgagcgtctgcaggg	Protospacer
. . *****.****** **********  ...

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

5853 : 56460

Aeromonas_phage(16.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_043508926.1\|5853_7950_+	ATP-dependent helicase	A7KV33	Bacillus_phage	7.7e-69	29.8
WP_011930744.1\|7942_8677_+	SOS response-associated peptidase	A0A291AUP1	Sinorhizobium_phage	1.7e-55	50.2
WP_011930743.1\|8577_9501_-\|transposase	transposase	O80301	Enterobacteria_phage	5.5e-19	32.8
WP_081432838.1\|9624_11154_+\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_011930741.1\|11150_12026_+	ATPase AAA	A0A059NT77	Lactococcus_phage	9.5e-29	33.9
WP_011930740.1\|12088_12448_-	helix-turn-helix domain-containing protein	A0A1I9KF42	Aeromonas_phage	8.4e-08	35.1
WP_011930739.1\|12471_12888_+\|transposase	IS200/IS605 family transposase	I4AZM1	Saccharomonospora_phage	3.0e-25	46.8
WP_155856295.1\|13348_14263_+	hypothetical protein	NA	NA	NA	NA
WP_011930737.1\|14556_15813_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_011930736.1\|15809_16952_+	ABC transporter permease	NA	NA	NA	NA
WP_011930735.1\|16944_17709_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.2e-34	39.8
WP_011930734.1\|18026_18344_-	hypothetical protein	NA	NA	NA	NA
WP_043508872.1\|18374_18614_-	hypothetical protein	NA	NA	NA	NA
WP_011930733.1\|19015_20407_-	replication protein C	L7TKN6	Rhizobium_phage	3.7e-11	27.0
WP_081432823.1\|20589_20802_-	hypothetical protein	NA	NA	NA	NA
WP_043508932.1\|21034_21901_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_011930731.1\|22009_23197_+	YbfB/YjiJ family MFS transporter	NA	NA	NA	NA
WP_011930730.1\|23193_24246_+	nitronate monooxygenase	NA	NA	NA	NA
WP_155856312.1\|24630_24858_-	hypothetical protein	NA	NA	NA	NA
WP_011930728.1\|25325_25595_-	hypothetical protein	NA	NA	NA	NA
WP_043508875.1\|25766_26090_+	hypothetical protein	NA	NA	NA	NA
WP_011930726.1\|26163_28842_+	CRISPR-associated helicase/endonuclease Cas3	NA	NA	NA	NA
WP_011930725.1\|29132_30722_+	type I-E CRISPR-associated protein Cse1/CasA	NA	NA	NA	NA
WP_011930724.1\|30718_31258_+	type I-E CRISPR-associated protein Cse2/CasB	NA	NA	NA	NA
WP_011930723.1\|31257_32370_+	type I-E CRISPR-associated protein Cas7/Cse4/CasC	NA	NA	NA	NA
WP_011930722.1\|32371_33121_+	type I-E CRISPR-associated protein Cas5/CasD	NA	NA	NA	NA
WP_011930721.1\|33126_33804_+	type I-E CRISPR-associated protein Cas6/Cse3/CasE	NA	NA	NA	NA
WP_007424557.1\|33796_34759_+	type I-E CRISPR-associated endonuclease Cas1	NA	NA	NA	NA
WP_081432824.1\|34739_35066_+	type I-E CRISPR-associated endoribonuclease Cas2	NA	NA	NA	NA
WP_011930720.1\|38111_40184_-	hypothetical protein	NA	NA	NA	NA
WP_011930719.1\|40186_41011_-	hypothetical protein	NA	NA	NA	NA
WP_011930718.1\|41007_41421_-	hypothetical protein	NA	NA	NA	NA
WP_043508878.1\|41620_42250_+\|transposase	IS607 family transposase	A0A7Q0	Microcystis_virus	7.2e-63	60.8
WP_011930716.1\|42243_43443_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A7P9	Microcystis_virus	7.3e-72	40.0
WP_043508880.1\|43496_43679_+	hypothetical protein	NA	NA	NA	NA
WP_011930715.1\|43829_44450_+	Holliday junction branch migration protein RuvA	NA	NA	NA	NA
WP_081432825.1\|44446_45445_+	Holliday junction branch migration DNA helicase RuvB	NA	NA	NA	NA
WP_011930713.1\|45444_45996_+	hypothetical protein	NA	NA	NA	NA
WP_081432839.1\|46164_46320_+	DUF2384 domain-containing protein	NA	NA	NA	NA
WP_043508881.1\|46667_46955_-	hypothetical protein	NA	NA	NA	NA
WP_155856296.1\|46977_47367_-	hypothetical protein	NA	NA	NA	NA
WP_043508935.1\|47660_48353_+	polyisoprenoid-binding protein	NA	NA	NA	NA
WP_011930709.1\|48345_48891_+	cytochrome b	NA	NA	NA	NA
WP_155856297.1\|49462_49705_+	hypothetical protein	NA	NA	NA	NA
WP_007421341.1\|49941_50958_+\|transposase	IS1595-like element ISAcr1 family transposase	NA	NA	NA	NA
WP_011930708.1\|51403_52369_-	sensor domain-containing diguanylate cyclase	G3MA91	Bacillus_virus	2.3e-20	31.9
WP_011930707.1\|53071_53572_+	hypothetical protein	NA	NA	NA	NA
WP_011930706.1\|53884_54379_+	LysE family transporter	NA	NA	NA	NA
WP_011930705.1\|54385_55231_-	EamA family transporter	NA	NA	NA	NA
WP_043508886.1\|55334_55844_-	recombinase family protein	A0A219Y9V9	Aeromonas_phage	9.7e-26	49.0
WP_011930703.1\|55947_56460_+\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_2

94822 : 132533

Acidithiobacillus_phage(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011930665.1\|94822_96502_+\|transposase	IS1634 family transposase	NA	NA	NA	NA
WP_081432840.1\|97089_97416_-	WGR domain-containing protein	NA	NA	NA	NA
WP_043508904.1\|97969_98353_+	hypothetical protein	NA	NA	NA	NA
WP_011930662.1\|99227_100943_-	ubiquinone-dependent pyruvate dehydrogenase	E5ERI2	Ostreococcus_lucimarinus_virus	1.4e-15	23.8
WP_011930661.1\|100956_102585_-	FMN-binding glutamate synthase family protein	NA	NA	NA	NA
WP_011930660.1\|103175_104042_+	MipA/OmpV family protein	NA	NA	NA	NA
WP_011930658.1\|104710_105934_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	1.2e-40	45.2
WP_081432828.1\|108920_109058_-\|transposase	transposase	NA	NA	NA	NA
WP_043508907.1\|109406_109601_+	hypothetical protein	NA	NA	NA	NA
WP_043508908.1\|109590_111663_+	recombinase family protein	A0A1B2LRQ3	Wolbachia_phage	5.7e-08	24.0
WP_081432831.1\|114436_114688_-	abortive infection family protein	NA	NA	NA	NA
WP_011930651.1\|114945_115974_-	aldehyde reductase	NA	NA	NA	NA
WP_011930650.1\|116043_116397_+	MerR family transcriptional regulator	NA	NA	NA	NA
WP_011930648.1\|116927_118475_+\|transposase	IS21 family transposase	K4I413	Acidithiobacillus_phage	5.1e-126	47.9
WP_011930647.1\|118492_119239_+	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	7.7e-64	49.8
WP_011930646.1\|120005_120416_-	DUF2000 domain-containing protein	NA	NA	NA	NA
WP_043508912.1\|120450_121287_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_011930644.1\|121974_122688_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_011930643.1\|122848_123253_+	4-carboxymuconolactone decarboxylase	NA	NA	NA	NA
WP_155856304.1\|123249_124173_+	NAD-binding protein	A0A077SLF7	Escherichia_phage	8.2e-15	25.8
WP_011930641.1\|124228_125566_+	MFS transporter	Q6JIH2	Burkholderia_virus	2.9e-13	23.6
WP_155856305.1\|125552_126365_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_011930639.1\|126361_127243_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_011930638.1\|127235_128147_+	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_011930637.1\|128143_128524_+	cupin domain-containing protein	NA	NA	NA	NA
WP_011930636.1\|128520_129273_+	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_011930635.1\|129512_129839_+	NIPSNAP family protein	NA	NA	NA	NA
WP_081432833.1\|130004_130352_-	DUF302 domain-containing protein	NA	NA	NA	NA
WP_155856306.1\|130411_131579_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.5e-37	38.0
WP_011930631.1\|131822_132533_-\|transposase	transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NC_009484

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_009484_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_009484_1

232843-232968

Orphan

Consensus_repeat	Method
GGTGCCGCCGATGCCGCC	CRT

3 spacers

The CRISPR arrays of NC_009484_1

>merge|NC_009484|1|232843-232968|CRT
GGTGCCGCCGATGCCGCCGGGGGCGCGCTGGATGCCGGTGCCGCCGATGCCGCCGGTCTCCTCGCCGATCCCGGTGCCGCCGATGCCGCCGGCTTCCTGTTCAATGCCGGTGCCGCCGATGCCGCC

>NC_009484|1|1|232843-232968|CRT
GGTGCCGCCGATGCCGCC	GGGGGCGCGCTGGATGCC
GGTGCCGCCGATGCCGCC	GGTCTCCTCGCCGATCCC
GGTGCCGCCGATGCCGCC	GGCTTCCTGTTCAATGCC
GGTGCCGCCGATGCCGCC

Protein	Signature genes	Signature genes Name	Protein_function
NC_009484.1\|WP_011941340.1\|219238_220156_+\|2-dehydropantoate-2-reductase	unknown	unknown	gnl\|CDD\|183829
NC_009484.1\|WP_007422226.1\|220128_220764_-\|glycosyltransferase	unknown	unknown	gnl\|CDD\|275102
NC_009484.1\|WP_011941350.1\|234070_234883_+\|hypothetical-protein	unknown	unknown	unknown
NC_009484.1\|WP_011941347.1\|230999_231530_-\|Hsp20/alpha-crystallin-family-protein	unknown	unknown	gnl\|CDD\|223149
NC_009484.1\|WP_011941344.1\|227260_228829_+\|aldehyde-dehydrogenase-(NADP(+))	unknown	unknown	gnl\|CDD\|143447
NC_009484.1\|WP_011941351.1\|237827_239027_+\|glycosyltransferase	unknown	unknown	gnl\|CDD\|340828
NC_009484.1\|WP_011941355.1\|242288_243650_+\|UDP-glucose/GDP-mannose-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|223936
NC_009484.1\|WP_011941341.1\|222873_224613_-\|radical-SAM-protein	unknown	unknown	gnl\|CDD\|223609
NC_009484.1\|WP_007422225.1\|220748_222866_-\|pyridine-nucleotide-disulfide-oxidoreductase	unknown	unknown	gnl\|CDD\|235787
NC_009484.1\|WP_007422019.1\|235042_236467_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227017
NC_009484.1\|WP_011941356.1\|243646_244348_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|181044
NC_009484.1\|WP_011941346.1\|230054_230918_+\|M48-family-metalloprotease	unknown	unknown	gnl\|CDD\|320695
NC_009484.1\|WP_011941345.1\|228857_229571_-\|ribonuclease-activity-regulator-RraA	unknown	unknown	gnl\|CDD\|236200
NC_009484.1\|WP_011941354.1\|241627_242284_+\|histidine-phosphatase-family-protein	unknown	unknown	gnl\|CDD\|366010
NC_009484.1\|WP_007422018.1\|236466_237831_+\|glycosyltransferase	unknown	unknown	gnl\|CDD\|340828
NC_009484.1\|WP_007422021.1\|233059_233893_-\|hypothetical-protein	unknown	unknown	unknown
NC_009484.1\|WP_011941342.1\|224623_226021_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340929
NC_009484.1\|WP_011941343.1\|226340_227264_+\|dihydrodipicolinate-synthase-family-protein	unknown	unknown	gnl\|CDD\|188630
NC_009484.1\|WP_011941352.1\|239023_240832_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224055
NC_009484.1\|WP_011941353.1\|240828_241671_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NC_009484.1\|WP_011941340.1\|219238_220156_+\|2-dehydropantoate-2-reductase	gnl\|CDD\|183829	PRK12921, PRK12921, oxidoreductase.	6.84533e-110
NC_009484.1\|WP_007422226.1\|220128_220764_-\|glycosyltransferase	gnl\|CDD\|275102	TIGR04282, hypothetical_protein, transferase 1, rSAM/selenodomain-associated. Members of this protein family show strongly correlated phylogenetic distribution, and in most cases co-clustering, with an unusual radical SAM enzyme (TIGR04167) whose C-terminal pfam12345 domain often contains a selenocysteine residue. Other members of the conserved gene neighborhood include another putative glycosyltransferase, an alkylhydroperoxidase family protein (TIGR04169), and a phosphoesterase family protein (TIGR04168). The cassette is likely to be biosynthetic but its exact function is unknown. [Unknown function, Enzymes of unknown specificity].	3.71496e-47
NC_009484.1\|WP_011941347.1\|230999_231530_-\|Hsp20/alpha-crystallin-family-protein	gnl\|CDD\|223149	COG0071, IbpA, Molecular chaperone (small heat shock protein) [Posttranslational modification, protein turnover, chaperones].	4.07401e-35
NC_009484.1\|WP_011941344.1\|227260_228829_+\|aldehyde-dehydrogenase-(NADP(+))	gnl\|CDD\|143447	cd07129, ALDH_KGSADH, Alpha-Ketoglutaric Semialdehyde Dehydrogenase. Alpha-Ketoglutaric Semialdehyde (KGSA) Dehydrogenase (KGSADH, EC 1.2.1.26) catalyzes the NAD(P)+-dependent conversion of KGSA to alpha-ketoglutarate. This CD contains such sequences as those seen in Azospirillum brasilense, KGSADH-II (D-glucarate/D-galactarate-inducible) and KGSADH-III (hydroxy-L-proline-inducible). Both show similar high substrate specificity for KGSA and different coenzyme specificity; KGSADH-II is NAD+-dependent and KGSADH-III is NADP+-dependent. Also included in this CD is the NADP(+)-dependent aldehyde dehydrogenase from Vibrio harveyi which catalyzes the oxidation of long-chain aliphatic aldehydes to acids.	0
NC_009484.1\|WP_011941351.1\|237827_239027_+\|glycosyltransferase	gnl\|CDD\|340828	cd03798, GT4_WlbH-like, Bordetella parapertussis WlbH and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. Staphylococcus aureus CapJ may be involved in capsule polysaccharide biosynthesis. WlbH in Bordetella parapertussis has been shown to be required for the biosynthesis of a trisaccharide that, when attached to the B. pertussis lipopolysaccharide (LPS) core (band B), generates band A LPS.	2.77347e-44
NC_009484.1\|WP_011941355.1\|242288_243650_+\|UDP-glucose/GDP-mannose-dehydrogenase-family-protein	gnl\|CDD\|223936	COG1004, Ugd, Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane].	0
NC_009484.1\|WP_011941341.1\|222873_224613_-\|radical-SAM-protein	gnl\|CDD\|223609	COG0535, COG0535, Predicted Fe-S oxidoreductases [General function prediction only].	7.21478e-15
NC_009484.1\|WP_007422225.1\|220748_222866_-\|pyridine-nucleotide-disulfide-oxidoreductase	gnl\|CDD\|235787	PRK06370, PRK06370, FAD-containing oxidoreductase.	1.01481e-140
NC_009484.1\|WP_007422019.1\|235042_236467_+\|hypothetical-protein	gnl\|CDD\|227017	COG4671, COG4671, Predicted glycosyl transferase [General function prediction only].	1.45142e-91
NC_009484.1\|WP_011941346.1\|230054_230918_+\|M48-family-metalloprotease	gnl\|CDD\|320695	cd07336, M48B_HtpX_like, Peptidase M48 subfamily B HtpX-like membrane-bound metallopeptidase. This HtpX family of peptidase M48 subfamily B includes uncharacterized HtpX homologs and consists of proteins smaller than Ste24p, with homology restricted to the C-terminal half of Ste24p. HtpX expression is controlled by the Cpx stress response system, which senses abnormal membrane proteins. HtpX participates in the proteolytic quality control of these misfolded proteins by undergoing self-degradation and collaborating with FtsH, a membrane-bound and ATP-dependent protease, to eliminate them. HtpX, a zinc metalloprotease with an active site motif HEXXH, has an FtsH-like topology, and is capable of introducing endoproteolytic cleavages into SecY (also an FtsH substrate). However, HtpX does not have an ATPase activity and will only act against cytoplasmic regions of a target membrane protein. Thus, HtpX and FtsH have overlapping and/or complementary functions, which are especially important at high temperature; in E. coli and Xylella fastidiosa, HtpX is heat-inducible, while in Streptococcus gordonii it is not.	2.73223e-137
NC_009484.1\|WP_011941345.1\|228857_229571_-\|ribonuclease-activity-regulator-RraA	gnl\|CDD\|236200	PRK08245, PRK08245, hypothetical protein; Validated.	8.9215e-143
NC_009484.1\|WP_011941354.1\|241627_242284_+\|histidine-phosphatase-family-protein	gnl\|CDD\|366010	pfam00300, His_Phos_1, Histidine phosphatase superfamily (branch 1). The histidine phosphatase superfamily is so named because catalysis centers on a conserved His residue that is transiently phosphorylated during the catalytic cycle. Other conserved residues contribute to a 'phosphate pocket' and interact with the phospho group of substrate before, during and after its transfer to the His residue. Structure and sequence analyses show that different families contribute different additional residues to the 'phosphate pocket' and, more surprisingly, differ in the position, in sequence and in three dimensions, of a catalytically essential acidic residue. The superfamily may be divided into two main branches. The larger branch 1 contains a wide variety of catalytic functions, the best known being fructose 2,6-bisphosphatase (found in a bifunctional protein with 2-phosphofructokinase) and cofactor-dependent phosphoglycerate mutase. The latter is an unusual example of a mutase activity in the superfamily: the vast majority of members appear to be phosphatases. The bacterial regulatory protein phosphatase SixA is also in branch 1 and has a minimal, and possible ancestral-like structure, lacking the large domain insertions that contribute to binding of small molecules in branch 1 members.	1.20498e-57
NC_009484.1\|WP_011941356.1\|243646_244348_-\|SDR-family-oxidoreductase	gnl\|CDD\|181044	PRK07577, PRK07577, SDR family oxidoreductase.	1.008e-71
NC_009484.1\|WP_007422018.1\|236466_237831_+\|glycosyltransferase	gnl\|CDD\|340828	cd03798, GT4_WlbH-like, Bordetella parapertussis WlbH and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. Staphylococcus aureus CapJ may be involved in capsule polysaccharide biosynthesis. WlbH in Bordetella parapertussis has been shown to be required for the biosynthesis of a trisaccharide that, when attached to the B. pertussis lipopolysaccharide (LPS) core (band B), generates band A LPS.	7.10327e-55
NC_009484.1\|WP_011941342.1\|224623_226021_-\|MFS-transporter	gnl\|CDD\|340929	cd17371, MFS_MucK, Cis,cis-muconate transport protein and similar proteins of the Major Facilitator Superfamily. This subfamily is composed of Acinetobacter sp. Cis,cis-muconate transport protein (MucK), Escherichia coli putative sialic acid transporter 1, and similar proteins. MucK functions in the uptake of muconate and allows Acinetobacter calcoaceticus ADP1 (BD413) to grow on exogenous cis,cis-muconate as the sole carbon source. The MucK subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	6.17796e-50
NC_009484.1\|WP_011941343.1\|226340_227264_+\|dihydrodipicolinate-synthase-family-protein	gnl\|CDD\|188630	cd00408, DHDPS-like, Dihydrodipicolinate synthase family. Dihydrodipicolinate synthase family. A member of the class I aldolases, which use an active-site lysine which stabilizes a reaction intermediate via Schiff base formation, and have TIM beta/alpha barrel fold. The dihydrodipicolinate synthase family comprises several pyruvate-dependent class I aldolases that use the same catalytic step to catalyze different reactions in different pathways and includes such proteins as N-acetylneuraminate lyase, MosA protein, 5-keto-4-deoxy-glucarate dehydratase, trans-o-hydroxybenzylidenepyruvate hydratase-aldolase, trans-2'-carboxybenzalpyruvate hydratase-aldolase, and 2-keto-3-deoxy- gluconate aldolase. The family is also referred to as the N-acetylneuraminate lyase (NAL) family.	8.22937e-60
NC_009484.1\|WP_011941352.1\|239023_240832_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	1.34999e-159

>NC_009484.1|WP_011941347.1|230999_231530_-|Hsp20/alpha-crystallin-family-protein
MPSTQVEPRPKAAEPERRPQAAPEFWRPFESLRREVNRLFEDFDGGLLRRALPTSLPFEPFLSRGLGAPAVDIVEQEKAFVITAELPGLTEKDVEIKATDDTLAITGEKRTEQETSEADYQLCERRYGKFERRFSLPAGADASKIEARFANGVLTITLPKRPEAIRAERKIEIKAG
>NC_009484.1|WP_011941346.1|230054_230918_+|M48-family-metalloprotease
MPNLIRTGLLMAALTALFVAIGYWIGRGAGAAIALAFAAAGNFVAYWVSDRAVLAMYGAQPANQAAFPRLVAQVDRLASKAGLPPPRVYVIDNDQPNAFATGRNPQHAAIAVTTGLLGALDEAELAGVIAHELSHIRHRDTLTMTVTATLAGAIGMISNLAIFFGGSDERRSSPFAGIAGLLLLLLAPLTATLVQLAISRTREYAADARAASLTGQPLALARALMRIDEMARWVPNDDAERNPATASLFIVNPLSGTTFDTLFATHPPIRERVARLRHMAQFDVSKN
>NC_009484.1|WP_011941345.1|228857_229571_-|ribonuclease-activity-regulator-RraA
MLKPDTREKLTRVSTATLATALYKRGLRQQFIQGALPLSPPERSMVGEAFTLRYIPAREDLNPITVFRDRDHKQRQAIETCPPGAVMVIDSRKDARAASAGGILVTRLMQRGAAGIVTDGGFRDSAEIAALGFPAYHVRPSAPTNLTLHQAIAINDPISCGDAPVFPGDVIVGDADGAIVIPAHLADELADEATEMTVFEDFVTEQVKAGATILGLYPPTDPETETRFAAWRARTGR
>NC_009484.1|WP_011941344.1|227260_228829_+|aldehyde-dehydrogenase-(NADP(+))
MTAEIDIAEGITLLGAGLVKTGGVAFHGRTAATGEPRAPGFGEAGAAEVALACARAEAASVAFADSTPEARAAFLEAAAANIMALGDRLVEAACAESGLPRGRIEGERGRTCGQLRMFAGVLRAGRFADLRIDTAQPARQPLPRPDLRLRNIPLGPVAVFGASNFPLAFSVAGGDTASALAAGCPVVVKAHPAHPLTSALVGHAVADAVASCGLPEGVFTVLFGAGNELGGALVADPRIKAVGFTGSRGGGLALAAIAARRKEPIPVYAEMSSINPVLLMPGALARRGAGLGTAFVGSLTLGAGQFCTNPGLLLAIEGEGLQAFLDAARAGLAAAAAQTMLTGAIRSACERGIEARAAERGVEEVARGPGGALFATDAATFLATPSLAEEIFGAAGILVRCRDAAELRQVIVGLEGQLTATLHLEPEDHAAARDLLPLLERKAGRILANGWPTGVEVCEAMVHGGPFPATTDSRTTSVGSKAIERFLRPVCYQDLPADLLPTALADGNPLAMPRLVDGVMRD
>NC_009484.1|WP_011941343.1|226340_227264_+|dihydrodipicolinate-synthase-family-protein
MTFDRDTFRARLAGISGILATPFDGNDRLDTARLRPVVERAVAAGVHILTANGNTGEFYALTTDEAERAVHAAAELVAGRVPLIAGIGRSIGDALALTRASRAAGASALMVHQPPDPFVAPRGVVEYVRRVAEAGQGLPVVIYLRNDGIGLDAIGDLCAIPEVVSVKWATPAPMRLAAAMKRADPALIWVGGLAETWAPAFYAVGARGFTSGLINVWPAHSLAIHAALEDGDYAKARALIEVMEPFEALRAEEGNGTNVSVVKAALALMGEDCGAVRPPGAWPLAERQQAELHRNLVTWGLLKEHAA
>NC_009484.1|WP_011941342.1|224623_226021_-|MFS-transporter
MTRRPSAPPSDSHLLHTLSELSWNRFHTTAVLLFGLGWALDAFEVTLIGNVLGALRQHFGLGSNAMSVILAAWFVGLMIGAAGFGALSDRLGRRRVFLASLVLYGVATLATAFAPNLAALLVLRLLGGIGVGAEYSAINAAIAELVPSRSRGRAAAIVLNFWPLGSFIAALLAWLVLSSLPPDLGWRVVFGLGGVVALSAAWFRRHLPESPRWLIDADRAEDARAIVAGIEAGLTTLPPASAVPVVHRIRREAGQFGRLVRQYPGRLLLGAALDFAEAAGYYGLFAFLPIVVLPVLHLPADRLPLFYLAGSVGAAVGGLAAASLLDRIGRSWTVGGFYLATALGLVLFALVTGLGAGPIMLGFALVNLLATGSWIAAYPTFSELFPTALRATGIGASVAVGRVGAALSPFLVGYVGARSMPAALVMLAGFWALGAVAILIWRLRGGIEARGLALEQLSAASARGV
>NC_009484.1|WP_011941341.1|222873_224613_-|radical-SAM-protein
MLDMAGSAPAIGPETVPVIEADGPVLVFGGCYSNLQATRALLEAARAHGIPPERMICTGDVVAYGADPQACAALIRDHGIATVMGNCEEQLGAGAADCGCGFTEGSSCDRLAAAWFAYAVARIDDATRRWMAALPRRIDLVIGGRRLAVVHGAPSRINRFLFASDPDLVLEREIGITGCDGVIAGHCGIGFTRRIGDLVWHNAGAIGMPANDGTPRCWYSIVTPTDAGLEIVLHPLDYDHHAAAAAMRSAGLPEEYAGTLESGIWPNLDILPHAERAATATRLECAPAADATVALEGLETLWFNTGTLCNLACEGCYIESSPRNDRLAWLRLDGFRRVLDEAADRHPELREIGLTGGEPFMNPDIEALIGMALDRGYRVLVLTNAMTPMRHHMAAIAGWRGRDLHLRVSLDHHTEAGHAALRGERAWGPALEGIGALFASGFQPSIAARFDPAVEDEAATRAGFARLFAAQGWEIDAFDPEHLVLFPEMDVPAAAAGVSASAWAALRPRGADAMCRTSRMVVQRKGAEALSIVACTLLPYEARFDLGATLEDASRAVTLDHPHCARFCVFGASSCMSAR
>NC_009484.1|WP_007422225.1|220748_222866_-|pyridine-nucleotide-disulfide-oxidoreductase
MSTTTVGRAGRRGTARALGFAALALALVALVVALQRQGLGIARLEGDLAGLRGMVAAHPLAGFLLYFGLYVAATSLSVPGAAVLTLGAGALFGVAEGAVLVSFASSIGASLAFLAARFLLRDFALARFPALFERIERGIARDGAFYLVSLRLAPVVPFFAVNLLAGLTSLRLRSFYLASQIGMLPATLIYVNAGASLATLGGHGPILTQRLVIGLLLLAALPLAAPRLRDALATRRLYARFRRPKRFDRNLVVIGAGAGGLVAAYVASAVKAKVTLVEAGEMGGDCLNSGCVPSKALLHAARAGKDFRAAIADVRAAIAGIAPHDSVARYEGLGVEVRRGRAVIESPWCVAVDGVPITTRAIVIAAGAEPFVPPIPGLAEAPHATSETLWDIEDLPRRLVILGGGPIGCEMAQAFARLGSAVTLVEMSERLLVREDDEVSAAMAAALARDGVAIRTGHRAEAVTRTEAGFALVAASGVQTIELPFDRLLVAIGRRPRVSGYGLEALGIPLTPARTIETDDGLRTLYPNIFACGDVAGPYQFTHMAGYQGGYAALGALFAPFWRFRPSYRAVPAVTYTSPEIARVGLNAREAAARGIEAEITRYDFAELDRAIAEGDTEGFVTVLTRKGSDRILGATIVGPQAGELLTGFTLAMQHGLGLKKLMGTIFPYPTRSEAIRAVAGQWRQAHASARGLAILERFHRWRRG
>NC_009484.1|WP_007422226.1|220128_220764_-|glycosyltransferase
MATRVSLPVIVVFSRIPRLGVGKRRLARTVGDRAAWRLSRIMLSGLLREMRRLRGVVRHLAATPDHHARLATPGFIRTGQGRGDLGARMLRVFRRHPRRPVIIIGSDIPGITAADLRGTLRRLRGAQAVFGPATDGGYWLIGLAGRRPAAPFRDVRWSSPHALADTLRNFPRHRVALLRPLTDLDDAESLGVHARPAASRAIRQAPARRIS
>NC_009484.1|WP_011941340.1|219238_220156_+|2-dehydropantoate-2-reductase
MRILVVGAGSIGGYFGGRLIEAGADVTFLVRPARAAALAETGLAIRSAKGDFHEPAPKLVTADRLGPAFDLVLLSCKAYDLEEAVAALAPAVSQRTLILPLLNGMRHLDVLDARFGAESVLGGQCVISSVLDADGRVLHLNDAHMLTFGPRSAGQEARARAIAELFGQAAFTTRLSDAIMQDMWEKWVFIASLAGITCLMRASVGAIVAAGGAGIALDLAAECAGIAARHGFELRPAAAARLKEWLATEGSPMTASMLRDMEQGGRIEGEHIIGDLLRRGETASCPLLAVANTHLRAYEIRRAGA
>NC_009484.1|WP_007422021.1|233059_233893_-|hypothetical-protein
MESDIEHMLRRLLRPLVAYLMRRGLGYIAFRDLLKRVYVDEALRGHEGDEAPTDSQISVVTGINRREVKRLREIATHPDTAEPRDRMAGVNAAARVVGTWVSAAAFRGPDGAPLPLTTRGEGDDPGFDALLRAAKVDVRARTVIEELERAGVVERLADDRLRLLRTAFTPTEPREKLLFLGANVGDHMRSAFHNLAGETPVFIERALFHNGIGASRLNAARPVLSDMADRLLRQCNEQLLEGNLASTDAAGGDPEREALRRLRLGVYYYETDADDRP
>NC_009484.1|WP_011941350.1|234070_234883_+|hypothetical-protein
MTTGAGVRAKGRGRGRGVLLPALAALATAQWPVLVHAASPAGFTIGLEPSYFTGRFGTRHTIHIYDLPLSITYRHRNLRLRVELPYIAVTGAGIVAGQSIIASTGSGAVRSGPGDMWLKAEYRLDRARGVRPSFEPYVKVKVPVASYAKGLGTGRFDEEAGLRMVWRAGTRVFPYLQLGYRIVGRLPALHLQNVVTFEPGVAVAVAPRQFLSVIVIGHTPIQKRRTAVASAILAYNLRMNFRWELQVYATRGLTSQSAAFGAGFGVMAHF
>NC_009484.1|WP_007422019.1|235042_236467_+|hypothetical-protein
MRDVQVVELDNGPGGAGAVWRQGWMPGRDPRDAEAGDRDPAPSERRHQGNARRARLRPLIPCAGRVGPAVVFLYSHDTFGLGHLRRNLAIAERLLEAGQFSVHLLTGSPVIAQWRLPSGLHVHPLPPVVKTGAETYAAREAGHSFGLVKGYRAALILTLALRYRPDIFLVDHAPAGMNGEILPTLAMMRRDLPDTRVMLGLRDILDSPDTVRATWAEQEILPLLEQAYDDILVYGSRKLFDVVDAYGIAGETAARVRYCGHVVAADLLRPDAEEGTPCWSAARAAGRKVVLVTAGGGGDGFALMEAYLHGLSRMAPGACHSVIVTGPLMSVDQRAALTATAAGREDIDLVDYITDPLPSLRAADLVIAMAGYNTSAELIAARKRTILVPRPAPRAEQRLRAHLLARLGLVRAIEQGPDLADRLAREIPAALAAPPPSSVAWAQLDLNGAERVAAHLATAIEARSAASGIAGEFA
>NC_009484.1|WP_007422018.1|236466_237831_+|glycosyltransferase
MPAFAYLDLAGEPDLADAPIAYVMKRYPRLTETFILNEIRAMERLGTKLHIVSLLPPEPPPHHPMVAEVEAPLHPVPAASARAGRREIAHAHARAIAAAPLRYLGAVARAALWCTRSPTPLSVWKQFLRGGVIATLCRTHGIRHIHAHFANAPAASAWFASMMTGLPFSFTAHAKDLYLTPPEVIRKRGQAARFVATCTGYNVRYLASLLGDQADKIHLVYHGIDLGLFGARKVAEAKPAEGRLILSVGRLVPKKGHDDLIAACALLRDRGIAFRCRIVGEGPLRAELQAQITASGLEGIVTLDGAMTHADLITLYGTADAFALAPRITEDGDRDGIPNVIAEAMAIGVPVVSTSVSGIPELVRDGETGRLVPPRDPAALATAIEATLADRAQARRLAAAGRARLEGEFDLWKTTRRLHALFGCAECEEAPPKGGSRFRAEGLAAQPSLAEVAP
>NC_009484.1|WP_011941351.1|237827_239027_+|glycosyltransferase
MKILYLNLDRGIPVEGDKGASVHVREFVTAAAALGHEVTLACTTRGVGNPPPPARILQFGAPPADMSIGNEIERRERVRLDHDGLVADRICSTLARLGIEPDLVYERHALFHRAGVSIAARLGVPRILEVNAPLVEEQRRFRGLYLVDEALEAEEASYRGADAIIAVSRQVAAQVAGVIGRTDRIHVVPNGVDLARFANVDAIGAVIRARLGLAGRRIAGFIGSFKTWHGVPFLIEAIAAAAAWHPDLHLLAVGDGPEREAVAALVAKLGLANRVTLPGRIPHGEIPGWLGAMDFTVAPYLPQPDFYFSPLKIFESLAAGRAVVAPEIGEIDGIVAHGETGLLYPAGDGIALQAALSRLLADQAACQTMGWRGRQRLAGRDWRDVVRLCLALAPVRLPA
>NC_009484.1|WP_011941352.1|239023_240832_+|ABC-transporter-ATP-binding-protein
MTGPGGAWLRAYLRSEWRALSAGAAVMAARAGVLLMLPWPLKFIIDNVIFQRRLAPWLHGVLPDPLTHRMALLDTLGLAMLGLGIADALLVYLGNRLFLDAGQRIVFAIRADLFAHLQRLSLAFHRRQRAGELMARLTGDVRQLQDFIVAVGIDLLPHGLTILGMATVMLLIDWRYALIALSVAPLLFWIARVYAGRLRHALRQVRRHETTLSGVMQEILGSVQVVQAFGREPHEDGRFGAHAGRSLEAGLHANAVQAQFSPVMNLAIAVATGAIAWYGAATVIRGTLTPGELLIFLAYLRGIATPARQLAKTGRVFGRASVAIERIGEYRAERSSVAEAPEALPFAGRASRIEFREVGFGYRDDHEVLHGVSFALEAGRTIALVGATGSGKSTIASLIPRFYDATSGAVLLDGQDIRGLRLADLRRQVALVLQDPVLFQASVWENIAYGREGAGRDEAIAAARAVGIDAMVEGLPDGFDTMVAERGQSLSGGQRQCIAIARAMLCDAPIVILDEPSSSLDAGTERRVMAALDRLAANRAALVIAHRLSTVRAADEILVLDDGRIVQRGTHEALLAEGGRYKALWQALRDDSPSPQLRLVAQ
>NC_009484.1|WP_011941353.1|240828_241671_+|hypothetical-protein
MTRSVPAVPRLLAGIVAGAALAVPLRAARADPWIPAAGDGVVKPMVRLFHGNQAFPAGGFTTNALRGSSESSKQYRVTGVQGIGHDLSIEYDLRGGRVRSFADRHHIPTASVSSGLQDEEIGLNYGLIQTARFADSITLNVIVPAGRTKPSPALGTGRWSVEPDFQAGISRPWGSLTMVAGARMFLDGAATQLRATIDLSLHLTRRLALTGEVFAVKTIRQSGTIPPGAQGEIYNLVRPAVGLTWRLTKVIRPFLLYEVNVAGEGIHAGSRLELGVAVHY
>NC_009484.1|WP_011941354.1|241627_242284_+|histidine-phosphatase-family-protein
MPAAGWSWALQCITDPRAGGRALLLARHGRTAWTGEGRYQGRSDLPLSPEGWADAAGLAAALSDEPLVSIYTSPLLRARQTAGCIAARRGDVAVIVDDRLAEIAFGDWEGRTQTEIRAATPEALRCWKRDPGGMRFPGGETLAEARARLHGFFADLPQRGGAVLAVTHAGMIRLACLCAEGRGDDGFRGIRIAPCAVRRFSLGGAAVVAPPFQHETVE
>NC_009484.1|WP_011941355.1|242288_243650_+|UDP-glucose/GDP-mannose-dehydrogenase-family-protein
MRIVMIGAGYVGLVSGACFASMGTEVIVVEKDPCRVAALQAGRIPIYEPGLERLVADSVRAGRLRFEAALDRALPGADAVFLAVGTPSRRGDGHADLSHVFAAAAELAAALPAPTVLVTKSTVPVGTGRRLAALMREIRPDLDVPVASNPEFLREGSAIEDFMRPDRIVVGTDSVQAEAVLRALYRPLNPAGVTLLCTGLETAELIKYATNAFLAMKITFINEMADLCEQVGADVHELARGMGLDRRIGPKFLHPGPGFGGSCFPKDTQALMRIAQDAHAPARLVETVVSVNEARKAAMAGRILAAFGGTVRRRRIAVLGLTFKPETDDMRDSPAIPIVHRLVELGAEVVAYDPAGMEQARRDLPAEVVYASGAASALAGADGAVLVTEWNEFRALAPDWLRATMRGRVVVDLRNVFDPAAMRAAGLDHHAIGRPAPHRALAGEAELALAAAD
>NC_009484.1|WP_011941356.1|243646_244348_-|SDR-family-oxidoreductase
MAKERVLVTGGAAGIGAASVARCREEGYEVVVIDRIGDGIVADLSDPAATEAALAEALRGGPITRLVNNVGTVRPAPVEAQTVADLDAVVSLNLRCSLQCVQALLPGMKAAGFGRIVNIASRAALGKEDRTAYAATKAGLIGMAKVWALELGRFGITANAIGPGPIRTELFDRVNPPDDPRTTAIIEGIPVRRIGTPADVAHAIAYLLDQRSGFVTGQVLYVCGGMTVGAAGA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_009484_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_009484_2

1300540-1302395

Orphan

Consensus_repeat	Method
GCACCCGTNGCGCCNGTGGC	CRT

32 spacers

The CRISPR arrays of NC_009484_2

>merge|NC_009484|2|1300540-1302395|CRT
CCACCCGTCGCACCCGTGGCACCCGTCGCGCCGGTGGCTCCGGTTGCGCCCGTGGCACCCGTTGCGCCGGTGGCACCCGTCGCGCCCGTGGCACCCATCGCGCCGGTGGCGCCCGTGGCACCCGTCGCGCCGGTGGCACCCATCGCGCCCGTGGCACCCGTCGCACCCGTCGCGCCGGTGGCACCCATCGCGCCCGTGGCACCCGTCGCACCCGTCGCGCCGGTGGCTCCGGTTGCGCCCGTGGCACCCGTTGCGCCGGTGGCACCCGTCGCGCCCGTGGCACCCATCGCGCCGGTGGCGCCCGTGGCACCCGTCGCGCCGGTGGCTCCGGTGGCTCCGGTTGCGCCCGTGGCTCCGGTGGCACCCGTCGCGCCGGTGGCTCCGGTGGCTCCGGTTGCGCCCGTGGCTCCGGTGGCACCCATCGCGCCCGTGGCACCCGTCACGCCGGTGGCTCCGGTTGCGCCCGTGGCGCCGGTGGCACCCGTTGCGCCGGTGGCACCCGTCGCACCCGTTGCGCCGGTGGCACCCGTCGCACCCGTTGCGCCCGTGGCACCCGTCGCGCCCGTGGCACCCGTCGCGCCCGTTGCGCCCGTGGCTCCGGTCGCACCCATCGCGCCCGTTGCGCCGGTGGCACCCGTTGCGCCGGTGGCACCCGTCGCACCCGTCGCGCCCGTGGCACCCATCGCACCCGTTGCGCCCGTGGCACCCGTCGCGCCCGTGGCGCCTGTGGCACCCGTCGCGCCGGTGGCTCCGGTGGCTCCGGTTGCGCCCGTGGCTCCGGTGGCACCCGTCGCACCCGTGGCACCCATCGCGCCCGTTGCGCCGGTGGCACCCATCGCGCCGGTGGCGCCCGTGGCACCCGTCGCGCCCGTGGCGCCTGTGGCACCCATCGCGCCGGTGGCACCCGTCGCACCCGTGGCACCCGTCGCACCCGTGGCACCCATCGCGCCCGTTGCGCCGGTGGCACCCGTTGCGCCCGTGGCACCCGTCGCACCCATCGCGCCCGTGGCACCCGTCACGCCGGTGGCTCCGGTTGCGCCCGTTGCGCCGGTGGCACCCGTCGCGCCCGTGGCACCCGTCGCGCCGGTGGCGCCCGTGGCACCCGTCGCGCCGGTGGCACCCGTCGCGCCCGTGGCGCCTGTGGCACCCGTCGCACCCGTGGCACCCATCGCGCCCGTGGCGCCCATCGCGCCCGTGGCGCCCGTGGCTCCAGTTGCGCCGGTGGCGCCCGTGGCACCCGTCGCGCCGGTGGCGCCCGTCGCGCCCGTGGCGCCTGTGGCACCCGTCGCACCCGTGGCACCCATCGCGCCCGTTGCGCCGGTGGCACCCATCGCGCCCGTTGCGCCCGTGGCACCCATCGCGCCCGTCGCGCCGGTGGCACCCGTTGCGCCGGTGGCACCCGTCACGCCGGTGGCTCCGGTTGCGCCCGTTGCGCCGGTGGCACCCGTCGCGCCCGTGGCACCCGTCGCGCCGGTGGCGCCCGTGGCACCCGTCGCGCCGGTGGCACCCGTCGCGCCCGTGGCGCCTGTGGCACCCGTCGCACCCGTGGCACCCATCGCGCCCGTGGCGCCCGTGGCTCCAGTTGCGCCGGTGGCGCCCGTGGCACCCGTCGCGCCGGTGGCGCCCGTCGCGCCCGTGGCGCCTGTGGCACCCGTCGCACCCGTGGCACCCATCGCGCCCGTTGCGCCGGTGGCACCCATCGCGCCGGTGGCACCCGTTGCGCCCGTGGCGCCTGTCGCACCCGTTGCGCCGGTGGCACCCATCGCGCCGGTGGCACCCGTCGCGCCCGTGGCACCCGTCGCGCCGGTGGCACCCGTGGCTCCAGTTGCGCCGGCGGCACCCGTAGCGCCCGTCGG

>NC_009484|2|2|1300540-1302395|CRT
CCACCCGTCGCACCCGTGGC	ACCCGTCGCGCCGGTGGCTCCGGTTGCGCCCGTG
GCACCCGTTGCGCCGGTGGC	ACCCGTCGCGCCCGTGGCACCCATCGCGCCGGTGGCGCCCGTG
GCACCCGTCGCGCCGGTGGC	ACCCATCGCGCCCGTGGCACCCGTC
GCACCCGTCGCGCCGGTGGC	ACCCATCGCGCCCGTGGCACCCGTC
GCACCCGTCGCGCCGGTGGC	TCCGGTTGCGCCCGTGGCACCCGTTGCGCCGGTG
GCACCCGTCGCGCCCGTGGC	ACCCATCGCGCCGGTGGCGCCCGTG
GCACCCGTCGCGCCGGTGGC	TCCGGTGGCTCCGGTTGCGCCCGTGGCTCCGGTG
GCACCCGTCGCGCCGGTGGC	TCCGGTGGCTCCGGTTGCGCCCGTGGCTCCGGTGGCACCCATCGCGCCCGTG
GCACCCGTCACGCCGGTGGC	TCCGGTTGCGCCCGTGGCGCCGGTG
GCACCCGTTGCGCCGGTGGC	ACCCGTCGCACCCGTTGCGCCGGTGGCACCCGTC
GCACCCGTTGCGCCCGTGGC	ACCCGTCGCGCCCGTGGCACCCGTC
GCGCCCGTTGCGCCCGTGGC	TCCGGTCGCACCCATCGCGCCCGTTGCGCCGGTG
GCACCCGTTGCGCCGGTGGC	ACCCGTCGCACCCGTCGCGCCCGTGGCACCCATC
GCACCCGTTGCGCCCGTGGC	ACCCGTCGCGCCCGTGGCGCCTGTG
GCACCCGTCGCGCCGGTGGC	TCCGGTGGCTCCGGTTGCGCCCGTGGCTCCGGTG
GCACCCGTCGCACCCGTGGC	ACCCATCGCGCCCGTTGCGCCGGTGGCACCCATCGCGCCGGTGGCGCCCGTG
GCACCCGTCGCGCCCGTGGC	GCCTGTGGCACCCATCGCGCCGGTG
GCACCCGTCGCACCCGTGGC	ACCCGTCGCACCCGTGGCACCCATCGCGCCCGTTGCGCCGGTG
GCACCCGTTGCGCCCGTGGC	ACCCGTCGCACCCATCGCGCCCGTGGCACCCGTCACGCCGGTGGCTCCGGTT
GCGCCCGTTGCGCCGGTGGC	ACCCGTCGCGCCCGTGGCACCCGTCGCGCCGGTGGCGCCCGTG
GCACCCGTCGCGCCGGTGGC	ACCCGTCGCGCCCGTGGCGCCTGTG
GCACCCGTCGCACCCGTGGC	ACCCATCGCGCCCGTGGCGCCCATC
GCGCCCGTGGCGCCCGTGGC	TCCAGTTGCGCCGGTGGCGCCCGTGGCACCCGTCGCGCCGGTG
GCGCCCGTCGCGCCCGTGGC	GCCTGTGGCACCCGTCGCACCCGTGGCACCCATCGCGCCCGTTGCGCCGGTGGCACCCATC
GCGCCCGTTGCGCCCGTGGC	ACCCATCGCGCCCGTCGCGCCGGTGGCACCCGTTGCGCCGGTGGCACCCGTCACGCCGGTGGCTCCGGTT
GCGCCCGTTGCGCCGGTGGC	ACCCGTCGCGCCCGTGGCACCCGTCGCGCCGGTGGCGCCCGTG
GCACCCGTCGCGCCGGTGGC	ACCCGTCGCGCCCGTGGCGCCTGTGGCACCCGTCGCACCCGTG
GCACCCATCGCGCCCGTGGC	GCCCGTGGCTCCAGTTGCGCCGGTGGCGCCCGTG
GCACCCGTCGCGCCGGTGGC	GCCCGTCGCGCCCGTGGCGCCTGTG
GCACCCGTCGCACCCGTGGC	ACCCATCGCGCCCGTTGCGCCGGTGGCACCCATCGCGCCGGTG
GCACCCGTTGCGCCCGTGGC	GCCTGTCGCACCCGTTGCGCCGGTGGCACCCATCGCGCCGGTG
GCACCCGTCGCGCCCGTGGC	ACCCGTCGCGCCGGTGGCACCCGTGGCTCCAGTTGCGCCGGCG
GCACCCGTAGCGCCCGTCGG

Protein	Signature genes	Signature genes Name	Protein_function
NC_009484.1\|WP_011942048.1\|1309318_1309714_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|182121
NC_009484.1\|WP_007422269.1\|1291485_1292292_+\|hydroxypyruvate-isomerase	unknown	unknown	gnl\|CDD\|163190
NC_009484.1\|WP_007424036.1\|1304663_1305902_+\|site-specific-integrase	unknown	unknown	gnl\|CDD\|271182
NC_009484.1\|WP_011942046.1\|1306310_1308464_+\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|316042
NC_009484.1\|WP_011942039.1\|1295789_1297034_+\|M20/M25/M40-family-metallo-hydrolase	unknown	unknown	gnl\|CDD\|349869
NC_009484.1\|WP_011942035.1\|1289681_1291466_+\|glyoxylate-carboligase	unknown	unknown	gnl\|CDD\|183066
NC_009484.1\|WP_011942049.1\|1309851_1310742_+\|cell-envelope-integrity-protein-TolA	unknown	unknown	gnl\|CDD\|274303
NC_009484.1\|WP_007424034.1\|1308726_1309326_+\|hypothetical-protein	unknown	unknown	unknown
NC_009484.1\|WP_011942037.1\|1293166_1294486_+\|glycerate-kinase	unknown	unknown	gnl\|CDD\|225254
NC_009484.1\|WP_011942036.1\|1292288_1293167_+\|2-hydroxy-3-oxopropionate-reductase	unknown	unknown	gnl\|CDD\|185019
NC_009484.1\|WP_011942050.1\|1310945_1311572_+\|TonB-family-protein	unknown	unknown	gnl\|CDD\|367555
NC_009484.1\|WP_081432881.1\|1306155_1306341_+\|AlpA-family-phage-regulatory-protein	unknown	unknown	gnl\|CDD\|225848
NC_009484.1\|WP_011942052.1\|1313302_1313812_-\|pantetheine-phosphate-adenylyltransferase	unknown	unknown	gnl\|CDD\|234674
NC_009484.1\|WP_011942038.1\|1294491_1295787_+\|allantoate-amidohydrolase	unknown	unknown	gnl\|CDD\|349880
NC_009484.1\|WP_011942033.1\|1286955_1288512_-\|xanthine-dehydrogenase-small-subunit	unknown	unknown	gnl\|CDD\|274365
NC_009484.1\|WP_039888986.1\|1311760_1312183_+\|hypothetical-protein	unknown	unknown	unknown
NC_009484.1\|WP_007424414.1\|1312751_1313306_-\|peptidylprolyl-isomerase	unknown	unknown	gnl\|CDD\|223725
NC_009484.1\|WP_011942034.1\|1288606_1289527_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176140
NC_009484.1\|WP_011942040.1\|1297071_1297995_+\|allantoinase-PuuE	unknown	unknown	gnl\|CDD\|211797
NC_009484.1\|WP_007422275.1\|1298014_1298938_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176152

Protein	Function_ID	Function_description	E-value
NC_009484.1\|WP_011942048.1\|1309318_1309714_+\|hypothetical-protein	gnl\|CDD\|182121	PRK09863, PRK09863, putative frv operon regulatory protein; Provisional.	9.59214e-05
NC_009484.1\|WP_007422269.1\|1291485_1292292_+\|hydroxypyruvate-isomerase	gnl\|CDD\|163190	TIGR03234, OH-pyruv-isom, hydroxypyruvate isomerase. This enzyme interconverts tartronate semi-aldehyde (TSA, aka 2-hydroxy 3-oxopropionate) and hydroxypyruvate. The E. coli enzyme has been characterized and found to be specific for TSA, contain no cofactors, and have a rather high Km for hydroxypyruvate of 12.5 mM. The gene is ofter found in association with glyoxalate carboligase (which produces TSA), but has been shown to have no effect on growth on glyoxalate when knocked out. This is consistent with the fact that the gene for tartronate semialdehyde reductase (glxR) is also associated and may have primary responsibility for the catabolism of TSA.	9.84446e-135
NC_009484.1\|WP_007424036.1\|1304663_1305902_+\|site-specific-integrase	gnl\|CDD\|271182	cd00801, INT_P4_C, Bacteriophage P4 integrase, C-terminal catalytic domain. P4-like integrases are found in temperate bacteriophages, integrative plasmids, pathogenicity and symbiosis islands, and other mobile genetic elements. The P4 integrase mediates integrative and excisive site-specific recombination between two sites, called attachment sites, located on the phage genome and the bacterial chromosome. The phage attachment site is often found adjacent to the integrase gene, while the host attachment sites are typically situated near tRNA genes. This family belongs to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	2.08005e-44
NC_009484.1\|WP_011942046.1\|1306310_1308464_+\|AAA-family-ATPase	gnl\|CDD\|316042	pfam13481, AAA_25, AAA domain. This AAA domain is found in a wide variety of presumed DNA repair proteins.	1.47462e-36
NC_009484.1\|WP_011942039.1\|1295789_1297034_+\|M20/M25/M40-family-metallo-hydrolase	gnl\|CDD\|349869	cd02697, M20_like, M20 Zn-peptidases include exopeptidases. Peptidase M20 family; uncharacterized subfamily. These hypothetical proteins have been inferred by homology to be exopeptidases: carboxypeptidases, dipeptidases and a specialized aminopeptidase. In general, the peptidase hydrolyzes the late products of protein degradation in order to complete the conversion of proteins to free amino acids. Members of this subfamily may bind metal ions such as zinc.	0
NC_009484.1\|WP_011942035.1\|1289681_1291466_+\|glyoxylate-carboligase	gnl\|CDD\|183066	PRK11269, PRK11269, glyoxylate carboligase; Provisional.	0
NC_009484.1\|WP_011942049.1\|1309851_1310742_+\|cell-envelope-integrity-protein-TolA	gnl\|CDD\|274303	TIGR02794, Protein_TolA, TolA protein. TolA couples the inner membrane complex of itself with TolQ and TolR to the outer membrane complex of TolB and OprL (also called Pal). Most of the length of the protein consists of low-complexity sequence that may differ in both length and composition from one species to another, complicating efforts to discriminate TolA (the most divergent gene in the tol-pal system) from paralogs such as TonB. Selection of members of the seed alignment and criteria for setting scoring cutoffs are based largely conserved operon struction. //The Tol-Pal complex is required for maintaining outer membrane integrity. Also involved in transport (uptake) of colicins and filamentous DNA, and implicated in pathogenesis. Transport is energized by the proton motive force. TolA is an inner membrane protein that interacts with periplasmic TolB and with outer membrane porins ompC, phoE and lamB. [Transport and binding proteins, Other, Cellular processes, Pathogenesis].	0.000178696
NC_009484.1\|WP_011942037.1\|1293166_1294486_+\|glycerate-kinase	gnl\|CDD\|225254	COG2379, GckA, Putative glycerate kinase [Carbohydrate transport and metabolism].	1.27493e-176
NC_009484.1\|WP_011942036.1\|1292288_1293167_+\|2-hydroxy-3-oxopropionate-reductase	gnl\|CDD\|185019	PRK15059, PRK15059, 2-hydroxy-3-oxopropionate reductase.	3.32201e-117
NC_009484.1\|WP_011942050.1\|1310945_1311572_+\|TonB-family-protein	gnl\|CDD\|367555	pfam03544, TonB_C, Gram-negative bacterial TonB protein C-terminal. The TonB_C domain is the well-characterized C-terminal region of the TonB receptor molecule. This protein is bound to an inner membrane-bound protein ExbB via a globular domain and has a flexible middle region that is likely to help in positioning the C-terminal domain into the iron-transporter barrel in the outer membrane. TonB_C interacts with the N-terminal TonB box of the outer membrane transporter that binds the Fe3+-siderophore complex. The barrel of the transporter, consisting of 22 beta-sheets and an inside plug, binds the iron complex in the barrel entrance.	3.45047e-07
NC_009484.1\|WP_081432881.1\|1306155_1306341_+\|AlpA-family-phage-regulatory-protein	gnl\|CDD\|225848	COG3311, AlpA, Predicted transcriptional regulator [Transcription].	3.79153e-10
NC_009484.1\|WP_011942052.1\|1313302_1313812_-\|pantetheine-phosphate-adenylyltransferase	gnl\|CDD\|234674	PRK00168, coaD, phosphopantetheine adenylyltransferase; Provisional.	2.62386e-85
NC_009484.1\|WP_011942038.1\|1294491_1295787_+\|allantoate-amidohydrolase	gnl\|CDD\|349880	cd03884, M20_bAS, M20 Peptidase beta-alanine synthase, an amidohydrolase. Peptidase M20 family, beta-alanine synthase (bAS; N-carbamoyl-beta-alanine amidohydrolase and beta-ureidopropionase; EC 3.5.1.6) subfamily. bAS is an amidohydrolase and is the final enzyme in the pyrimidine catabolic pathway, which is involved in the regulation of the cellular pyrimidine pool. bAS catalyzes the irreversible hydrolysis of the N-carbamylated beta-amino acids to beta-alanine or aminoisobutyrate with the release of carbon dioxide and ammonia. Also included in this subfamily is allantoate amidohydrolase (allantoate deiminase), which catalyzes the conversion of allantoate to (S)-ureidoglycolate, one of the crucial alternate steps in purine metabolism. It is possible that these two enzymes arose from the same ancestral peptidase that evolved into two structurally related enzymes with distinct catalytic properties and biochemical roles within the cell. Downstream enzyme (S)-ureidoglycolate amidohydrolase (UAH) is homologous in structure and sequence with AAH and catalyzes the conversion of (S)-ureidoglycolate into glyoxylate, releasing two molecules of ammonia as by-products. Yeast requires beta-alanine as a precursor of pantothenate and coenzyme A biosynthesis, but generates it mostly via degradation of spermine. Disorders in pyrimidine degradation and beta-alanine metabolism caused by beta-ureidopropionase deficiency (UPB1 gene) in humans are normally associated with neurological disorders.	9.62958e-172
NC_009484.1\|WP_011942033.1\|1286955_1288512_-\|xanthine-dehydrogenase-small-subunit	gnl\|CDD\|274365	TIGR02963, Includes:_Xanthine_dehydrogenase, xanthine dehydrogenase, small subunit. Members of this protein family are the small subunit (or, in eukaryotes, the N-terminal domain) of xanthine dehydrogenase, an enzyme of purine catabolism via urate. The small subunit contains both an FAD and a 2Fe-2S cofactor. Aldehyde oxidase (retinal oxidase) appears to have arisen as a neofunctionalization among xanthine dehydrogenases in eukaryotes and [Purines, pyrimidines, nucleosides, and nucleotides, Other].	0
NC_009484.1\|WP_007424414.1\|1312751_1313306_-\|peptidylprolyl-isomerase	gnl\|CDD\|223725	COG0652, PpiB, Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family [Posttranslational modification, protein turnover, chaperones].	9.13638e-59
NC_009484.1\|WP_011942034.1\|1288606_1289527_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176140	cd08449, PBP2_XapR, The C-terminal substrate binding domain of LysR-type transcriptional regulator XapR involved in xanthosine catabolism, contains the type 2 periplasmic binding fold. In Escherichia coli, XapR is a positive regulator for the expression of xapA gene, encoding xanthosine phosphorylase, and xapB gene, encoding a polypeptide similar to the nucleotide transport protein NupG. As an operon, the expression of both xapA and xapB is fully dependent on the presence of both XapR and the inducer xanthosine. Expression of the xapR is constitutive but not auto-regulated, unlike many other LysR family proteins. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	7.58883e-87
NC_009484.1\|WP_011942040.1\|1297071_1297995_+\|allantoinase-PuuE	gnl\|CDD\|211797	TIGR03212, uraD_N-term-dom, putative urate catabolism protein. This model represents a protein that is predominantly found just upstream of the UraD protein (OHCU decarboxylase) and in a number of instances as a N-terminal fusion with it. UraD itself catalyzes the last step in the catabolism of urate to allantoate. The function of this protein is presently unknown. It shows homology with the pfam01522 polysaccharide deacetylase domain family.	1.46465e-180
NC_009484.1\|WP_007422275.1\|1298014_1298938_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176152	cd08463, PBP2_DntR_like_4, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator similar to DntR, which is involved in the catabolism of dinitrotoluene; contains the type 2 periplasmic binding fold. This CD includes an uncharacterized LysR-type transcriptional regulator similar to DntR, NahR, and LinR, which are involved in the degradation of aromatic compounds. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	5.1695e-109

>NC_009484.1|WP_007422275.1|1298014_1298938_+|LysR-family-transcriptional-regulator
MTGYRDTVDIYLLRVLHTLLVEGSVTRTAVRLNQSQPAISAALRRLRDITGDPLLVRAKSGMVPTERGLALLEPVTNALHEISRIAIARDAFDPKHSIRSFRIGSPDYLNILFVPSLVERFRAAAPHARLELHPLTSDADYEESLASGTFDLVLGNWPEPPKRLQRRTLFSDEVVCLLAADHPLAQRFRAGGTISEADYLTAAHLAPTPYSPTQRGPIESHLTRARLKRNVQILVPYFSLAPPLLLKTDLIFTTTRRFAEFHARHLPLAVVPSPIDFPAVEYYLLWHPRGHLSDEVQWLINLVASAV
>NC_009484.1|WP_011942040.1|1297071_1297995_+|allantoinase-PuuE
MTGYPRDMKGYGRDRPDPRWPGGALICVQFVVNYEEGGENNILHGDAASEAFLSEIPGAAPWPGERHWNMESIYEYGARAGFWRLWRLFAERRIRTTVFGVATALDRGREQAAAMREAGWEIACHGLKWIDYRSVPRDVEAAHLAAAIRLHREVTGEAPQGFYLGRCSMNTRALTMEQDCFRYSSDSYADDLPYWVRGPAGRHLVIPYTLDANDMRFSTTSGFASGDDFLSYLRDTFDVLYREGESGRPAMMSVGLHCRLAGRPGRLAALARFLDHVAAHENVWVARRIDVAEHFHAHHTGLEVLGG
>NC_009484.1|WP_011942039.1|1295789_1297034_+|M20/M25/M40-family-metallo-hydrolase
MADTETMPVPDAISRYLSGAREAETKFLADLVRLPSDNPPGDCAAHAARTAELLEGLGFTVERHVVPEAEVRANGMISAVNLVVRHRFGPGGKVIALNAHGDVVPPGEGWTRDPYGAEIVDGWMYGRGVAVSKSDFATYAFALLALRESGLELDGAVELHLTYDEEAGGAIGPGILLREKISQPDLAIAAGFSYAVVNAHNGCLHLEVQVDGRSAHAAMPFTGVDALQAANAALSALYATRGTLSATVSRIAGIGSPQLTVGLISGGINTNVVPDRVTFRLDRRMIPEENPQDVEDGLRRLIGAAVATVPGARATIRRILLAEPLTPLPGAEVLSAALCEEASRIMGETITTRGVPLYTDARHYAAAGVPIVLFGAGPHTIEEANAHRADERLKLDDLFKATEVVARALARLLR
>NC_009484.1|WP_011942038.1|1294491_1295787_+|allantoate-amidohydrolase
MDSLTSAAARLPAWRGEAGARIMARLDALARHSSEADALSRLYLTDAHRDALATLGAWMREAGLAVRQDEVGNLIGRREGTAPGLPALLLGSHVDTVRNAGKYDGPLGIVAAIEAVARLNDTPLPFAIEILALGDEEGVRFPAALTGARAFAGTLDPATLAATDAEGITMRAALEAFGGSPDRIAAAARHERDVLAYLELHIEQGPVLEAEGLPVGIVTAIAGAERHVIEVTGVAGHAGTVPMALRHDALAAGAEMVLAVERIARETSDLVATVGQMTALPGAVNVIPSAARFSLDIRSPSDAVRRDAVARLFMHWREIAARRGVTLSSRKNFEEEAAPCAPALMALLDAAVTRAGVRVRHLPSGAGHDGLAIASLCPIGMLFLRCRGGISHNPAEAIAEEDAGLAACILADTLRHFDPAPFASHAQTIKD
>NC_009484.1|WP_011942037.1|1293166_1294486_+|glycerate-kinase
MDAASATLRSDPVGATGLLRGMLDAAIDAARPARVLPPWLPPAPPGRTIVVGAGKAAASMAAAVEAVWTAPLEGLVITRYGHAVPCARIEVVEAAHPVPDEAGLAATERMLGLAASAGPDDLVLTLMSGGGSALLTRPAAGLTLADKQAITRALLASGATIAEMNCVRRHLSAVKGGRLALAAHPARLVTLVISDVPGDDPAIVASGPTLPDSTTAAMAREILARYRVDLPDAVRLHLARDEGGVRPDDPRLAGQSAHLIATPRLALEAAADVARHHGVTPVILGDSIEGEAREVARVMAGIARQAARHGVPAAAPCALISGGETTVTIGPDTPRGARGGRNVEFLLALALELDAQPGIHALAADSDGIDGTEPVAGAVIGPRTLAASRAAGLDPGAILAAHDAHTLFERIGAQVVTGPTLTNVNDIRVILVTAQEAGE
>NC_009484.1|WP_011942036.1|1292288_1293167_+|2-hydroxy-3-oxopropionate-reductase
MRVGFIGLGIMGLPMAGHIAAAGHVLFAHSRSGVPPRLLDAGATACASPADVARQADAIILMLPDTPDVEAVLFGTDGVADGLAAGRMVIDMSSISPLATREFAQRIEAAGCAFVDAPVSGGEVGAKSASLTIMAGGTDDGFARAEPLLRLMGRTITHVGPCGAGQTAKVANQIIVALTIEAVAEALVFAAKAGADPARVREALMGGFASSRVLEVHGQRMIDRAFEPGFRIGLHQKDLELALSGARQLGVSLPNTASCQSLFNACIAASGRDWDHSALVRALERLAAHELS
>NC_009484.1|WP_007422269.1|1291485_1292292_+|hydroxypyruvate-isomerase
MPKFCANLSMLYGEHAFLDRFDAAAADGFGGVEFLFPYAFPAGEIAARLKRNGLVQVLHNLPAGNWDAGERGIACDPDRADEFHAGVAQAIDYATALGCPQVNCLVGIPPAGVDPARIRRTLVANLGRAARELGKARIRLLIEPVNGHDIPGFWLQRVEDAATLIEETGSDNIFIQYDIYHQQRSAGELIATFRRFRDRIAHVQVADNPGRGEPGTGEIGYGRIFAMLDDAGYQGWIGCEYRPAAGTSAGLGWRDTLARPTAGPEIAA
>NC_009484.1|WP_011942035.1|1289681_1291466_+|glyoxylate-carboligase
MSRMRAAEAAIRVLEREGATTLFGVPGAAINPLYAAMRGSNAIRHVLARHVEGASHMAEGFTRAKPGNIGVCVGTSGPAGTDMITGLYSALADSIPILCITGQAPRARLHKEDFQAVDIESIAKPVTKWAVTVREPALVPRVFQQAFHVMRSGRPGPVLIDLPIDVQMAEIEFDEETYAPLPVYRPAATAAQIERALDMLESAERPLIVAGGGVINADAADRLVAFAELTGVPVIPTLMGWGAIPDDHPLMAGMVGLQTSHRYGNATFLESDFVLGIGNRWANRHTGSIETYTRGRRFVHVDIEPTQIGRVFEPDYGIVSDAGAALDLFLSLAAERRAAGRLPDRRGWSEACRARKRTMLRRTHFDAAPIKPQRVYEEMNKAFGRETRYVSTIGLSQIAAAQFLHVFRARNWINCGQAGPLGWTIPAALGAAVAEPDRPVVALSGDYDFQFLIEELAVGAQFSIPYLHVVVNNAYLGLIRQAQRAFGMDYCVDLAFENINAPEQGRAAASGVDHVAVAEGLGCKALRVTEPDGIAPALIRAAAMMKAHRVPVVVEIVLERVTNIAMGPEIDSIQEHDELAEHKDDAPTALAFLD
>NC_009484.1|WP_011942034.1|1288606_1289527_-|LysR-family-transcriptional-regulator
MDRTGMELRHLRYFVAVAETLSFTEAARRLAISQPPLSQQIRDLELEIGTTLIARSSRNVSLTPAGAAFLTRARQILAEAVRARDEARVIGAGRSGTLDIGMTGAVLLGGLGGLVAAFQIFAPGVQVRLHEMPPGEQEAALGAGRLDLCFLRTPGADPALRVEPAWHEGVSAVLPRDHPLAVRRRLALADLRDEPFVFFRRADSRFADHLWTCCIEAGFAPRIVQEVVEAHAVMALVADGFGIALLPDSARRLAPSGLGFRPLAGNPARADVSLVYPREHSAVVGEFIGFARTRLGRGAGSGGPGS
>NC_009484.1|WP_011942033.1|1286955_1288512_-|xanthine-dehydrogenase-small-subunit
MTQQKIRFHFRGGIVAVGDLPITTTVLDWLRESAGQCGTKEGCAEGDCGACTVIVAELAEAAPPAGAVRVGGLDLRPVNACIRFLPTLHGKALLTVEDLRPLAGGALHPVQQALVDCHASQCGFCTPGFAMSLLALYLDHQGATPPNRQAIADRLAGNLCRCTGYRPILDAAERMFTLPPVAFDAAPVEASLRRIAAETPPAFSYEAADPALAADGVPRLNRFHAPRTAERLAALCAEKPAARILGGATDIGLWVNKQFRDVGDLISVNDVAELRAIEATPEGLTIGAAVPLEDAWNALAALVPECREMALRFAGPPVRHAGTMGGNVANGSPIGDAPPVLMALGATLVLQQGGTIRRLPIDAFYLDYMKTARAPGEFLRAIEIPRPDPATRFRAYKISKRHDCDISTLSLGAAVTLRDGAVRDVRLAFGGMAATVRRAAAAEAALRGQPWNEATIAAAMNALGADFTPLTDLRASAGYRMRVARNLLRRLHLELTASAAGPALRTRAVPSGMMAGAA
>NC_009484.1|WP_007424036.1|1304663_1305902_+|site-specific-integrase
MRFTMNRIAALTCPEGRKDALFFDEELPGFGVRVTSTGSKTYLAQYRGATGVRRVSLGKHGVISLADARNAARAILGQVASGGDPIAERRAKDEAARQAQSEAAFTVEALIAAWVADRQESRRASYLKVAAAALRTHLAHLLTVPASAMTVRQAVAALDRVKAAAGPVAGNRLLAYARACFGWACKRQRLAMNPFAGLERPAREKSRDRVLTDAEIGAIWRAAALLDYPAGQFTRMLMLTLGRRDEVASMRWTEIAADGLTWSLPADRAKNGKSHVVHLSEPARGILSALPRFENSDFLFTTTGERPISGFSGFKLAIDRAIEADLGRGIADWRFHDFRRAGVTWLAGAGFPPHVADKLLNHMSGSIQGVAAVYQRAEFLPERERALDAWASHVISAAAGGTTAGNVIALRA
>NC_009484.1|WP_081432881.1|1306155_1306341_+|AlpA-family-phage-regulatory-protein
MIERNLLTTREVCQYVGFSKRTLERLIEDGRGPRRVRISTRRLGYPKTDLDQWLAAREERH
>NC_009484.1|WP_011942046.1|1306310_1308464_+|AAA-family-ATPase
MARCPRRTTLKEKPLLECASGRGVSQIKLKGMIMNLIANNTDNVKSKTPIALTFFHSVTGTTAEQVTMSMAQLVERLCGTEAESKHDLPLISGCRFGDSKTGRGSLRHDGNVSGISAIVADYDAGKLSIEDARDHLAAAGIGALIYATARHTPDSPRWRVVCPLADMQPRDRHKGLVDRLDQALGGKVLANESWTLSQSYFFGFVSKKPKHWDFVEGGFLDQQVDFEAGGITSNEIQSLAAPVAKTAAELTAFDPESLHSLLMQTGPHSMREPEWSSTLRAVKGAFVERPDLGFEAAEHVTAQWTDGVTSPEELAEKWDSQNPRRIGEAEVLRYCGEHGARPDDIGAYVGAAGLGRAQEAFSAEAAPISPPPVTRKRFEISRIALLDHSIRQRELISGWFGLGEFLRLNGSPGCGKTTLAVDWAAHIAGGLPWRGHAVEQGAVLVIELEGAANLQTRVEATCTELGLKQTEIPLFMMADSVSLAVEPEWRPLLDAITDTDFGSPLRLIVIDTQARASAGADENSASDTALIVRAIDEIRAKTGAAVLMLHHLPHGADRARGSTAFLGAVDCEMIARRDESGVGSIKVVKMRNRADPPPVYYKLKSVPIGLGPDGTIVTGAAAIPAEAPGPQKALKPAAQIALDSLLHGGMAEEQWCGAFVKRYPGSASLDGKRKAFRRAVKELTEAGAVVVADGLARLSGTAGGIAPNWHESLGTVQ
>NC_009484.1|WP_007424034.1|1308726_1309326_+|hypothetical-protein
MNDFNDPPLPKPFSPFRRAQGGPPTNSDFMKPWGYDGSWPPASMTFPGGFAASEWTDYESRPIAERARIEALVQIRHTLSLTPRIELWTPPPLVSASTMPILTLQPDHDVGWPGSELRCGIGVIDATLSDQPYDWLSATNFWSAAVIAQPGQYLAALRRAIERRLGGDPRVILVCDTNHASAWAERFHERGILCETWDE
>NC_009484.1|WP_011942048.1|1309318_1309714_+|hypothetical-protein
MNDDPEITQILRKLPDRLRPADVPARAARKPVAAPRGNPPLSYTGIRRLAQAGFSGGEIAEHFGISRRTFYYRLRDDAALADSFKIGRARFSAKIQDRVLKLAFEMKNRTALFKLARQLGIDGKDRDWPQS
>NC_009484.1|WP_011942049.1|1309851_1310742_+|cell-envelope-integrity-protein-TolA
MKTANIGLCIFSYALVFFMINSASAKTFYYPFPEIKMPTSNWKKLNDLAVSDGTINTPPCYSKIVIKNMAFKNIYGKHFISIFSTIWAHKTTTGNYLCETKMSGYRIGGDYKISSLNMNLEFETFSKNGKRYVIYDDDVFSNLVFPLNMKAKIPALPISKDNASKAVGNSNSTKLHGLAALRAAVKEIRNSNSTKLDLSAAELNAIANAVRPCWGIDAGAPGVQDFSVLLQVTTDASGVVREAEVAPADQGKLGDPVFAAFAQRAVSAAKNYKCAKLPLPPYMLGTVHTFTFRFNP
>NC_009484.1|WP_011942050.1|1310945_1311572_+|TonB-family-protein
MNDGGVMRYLRLSIVAIITVATPIIANAKANGNSLDQTNVSPQSSMSGTAFVQFTVAPNGTVKSEKIYRSSGNPLIDRAALSKANIPKFSKFTGKKSRLYVMPISISFPKPHKSDKKSDHAKRWFALTNDDECIPSVPRDPAKLIRFDRLNGLDDAVNIFERSHGMPVGVTVAEPESNGMETVYTFFRTEDACEAYAKAKQGSLNQLQ
>NC_009484.1|WP_039888986.1|1311760_1312183_+|hypothetical-protein
MDDVDRINWSNVAQDAIRQAIATHSIFKEPENMDNVIERLRLSKERFNSTNTKDGKDCGASWARGTAQYEDLLRISDAVHEGLDIDIGTLQRLIDPQDEMDSNDWKAFWEENAGNDVSDAFVKGFAEGATAVFDKVADKL
>NC_009484.1|WP_007424414.1|1312751_1313306_-|peptidylprolyl-isomerase
MIIRRRTLLAAAASTPLAGVFMSESASAASTSNTIHMTLPFGVVTIELRPDLAPKTCEQIRTLTARGFYNGCEFFRVIAGFMAQTGDPTNTGTGGSNLPNVPAEFTDKAKFLTGSVGMARTSDPNSGNSQFFICFAPAAWLDGQYTLFGQVTAGMDYVDEIKKGQGQSGRVTDPTKIIKMELAA
>NC_009484.1|WP_011942052.1|1313302_1313812_-|pantetheine-phosphate-adenylyltransferase
MADGGLIGLYPGTFDPITNGHLDIIGRAAQLCSKLVIGVARNAGKGPLFPTAERVEMVRAEIAPIAERTGTEIDVQAFDSLLIAFAQQVSAQVIVRGLRAVSDFDYEFQMAGMNARLDQRIETIFLMASERHQFISSRFVKEIAQLGGDISSFVPKLTLERTLRRVGRP

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NC_009484_1	1.1\|232861\|18\|NC_009484\|CRT	232861-232878	18	NC_009484.1	216010-216027	2	0.889
NC_009484_1	1.2\|232897\|18\|NC_009484\|CRT	232897-232914	18	NC_009484.1	1629868-1629885	2	0.889
NC_009484_1	1.3\|232933\|18\|NC_009484\|CRT	232933-232950	18	NC_009484.1	748713-748730	2	0.889
NC_009484_1	1.3\|232933\|18\|NC_009484\|CRT	232933-232950	18	NC_009484.1	777160-777177	2	0.889

1. spacer 1.1|232861|18|NC_009484|CRT matches to position: 216010-216027, mismatch: 2, identity: 0.889

gggggcgcgctggatgcc	CRISPR spacer
gggcgcgcgctcgatgcc	Protospacer
*** ******* ******

2. spacer 1.2|232897|18|NC_009484|CRT matches to position: 1629868-1629885, mismatch: 2, identity: 0.889

ggtctcctcgccgatccc	CRISPR spacer
gggctcatcgccgatccc	Protospacer
** *** ***********

3. spacer 1.3|232933|18|NC_009484|CRT matches to position: 748713-748730, mismatch: 2, identity: 0.889

ggcttcctgttcaatgcc	CRISPR spacer
ggcggcctgttcaatgcc	Protospacer
***  *************

4. spacer 1.3|232933|18|NC_009484|CRT matches to position: 777160-777177, mismatch: 2, identity: 0.889

ggcttcctgttcaatgcc	CRISPR spacer
ggcctgctgttcaatgcc	Protospacer
***.* ************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_009484_2	2.22\|1301703\|25\|NC_009484\|CRT	1301703-1301727	25	NZ_CP033971	Cupriavidus pauculus strain FDAARGOS_614 plasmid unnamed2, complete sequence	65387-65411	1	0.96
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	2376925-2376949	2	0.92
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	1250386-1250410	2	0.92
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_AP022611	Mycolicibacterium madagascariense strain JCM 13574 plasmid pJCM13574	63390-63414	2	0.92
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NC_004771	Pasteurella multocida plasmid pJR1, complete sequence	2845-2869	2	0.92
NC_009484_2	2.11\|1301091\|25\|NC_009484\|CRT	1301091-1301115	25	NZ_CP015065	Mesorhizobium ciceri biovar biserrulae strain WSM1284 plasmid pMc1284, complete sequence	248-272	2	0.92
NC_009484_2	2.11\|1301091\|25\|NC_009484\|CRT	1301091-1301115	25	MK686068	Streptomyces phage RemusLoopin, complete genome	15053-15077	2	0.92
NC_009484_2	2.22\|1301703\|25\|NC_009484\|CRT	1301703-1301727	25	NZ_CP026091	Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence	58757-58781	2	0.92
NC_009484_2	2.22\|1301703\|25\|NC_009484\|CRT	1301703-1301727	25	NC_014309	Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome	55632-55656	2	0.92
NC_009484_2	2.22\|1301703\|25\|NC_009484\|CRT	1301703-1301727	25	NZ_CP026093	Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence	58751-58775	2	0.92
NC_009484_2	2.3\|1300677\|25\|NC_009484\|CRT	1300677-1300701	25	NZ_CP033971	Cupriavidus pauculus strain FDAARGOS_614 plasmid unnamed2, complete sequence	65387-65411	3	0.88
NC_009484_2	2.3\|1300677\|25\|NC_009484\|CRT	1300677-1300701	25	MK967384	Gordonia phage Sidious, complete genome	11404-11428	3	0.88
NC_009484_2	2.4\|1300722\|25\|NC_009484\|CRT	1300722-1300746	25	NZ_CP033971	Cupriavidus pauculus strain FDAARGOS_614 plasmid unnamed2, complete sequence	65387-65411	3	0.88
NC_009484_2	2.4\|1300722\|25\|NC_009484\|CRT	1300722-1300746	25	MK967384	Gordonia phage Sidious, complete genome	11404-11428	3	0.88
NC_009484_2	2.6\|1300821\|25\|NC_009484\|CRT	1300821-1300845	25	NZ_CP006368	Aureimonas sp. AU20 plasmid pAU20a, complete sequence	84652-84676	3	0.88
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP017784	Rhodobacter sp. LPB0142 plasmid pEJ03, complete sequence	12196-12220	3	0.88
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	MT081181	Uncultured bacterium plasmid pCu_H_1, complete sequence	5770-5794	3	0.88
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP049911	Diaphorobacter sp. HDW4A plasmid p_unnamed1, complete sequence	136625-136649	3	0.88
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP025470	Klebsiella pneumoniae strain JS187 plasmid p187-4, complete sequence	91771-91795	3	0.88
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NC_022078	Klebsiella pneumoniae JM45 plasmid p1, complete sequence	147926-147950	3	0.88
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP027038	Klebsiella pneumoniae strain 16_GR_13 plasmid IncAC2, complete sequence	136967-136991	3	0.88
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP027055	Klebsiella pneumoniae strain 2_GR_12 plasmid IncAC2	136971-136995	3	0.88
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	CP052444	Klebsiella pneumoniae strain C16KP0098 plasmid pC16KP0098-1, complete sequence	44051-44075	3	0.88
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP039991	Pseudomonas aeruginosa strain T2101 plasmid pBT2101, complete sequence	249490-249514	3	0.88
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP039991	Pseudomonas aeruginosa strain T2101 plasmid pBT2101, complete sequence	216734-216758	3	0.88
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP021071	Mesorhizobium sp. WSM1497 plasmid pWSM1497, complete sequence	431-455	3	0.88
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP015063	Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence	1590-1614	3	0.88
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP045917	Pseudomonas aeruginosa strain CF39S plasmid pCF39S, complete sequence	381005-381029	3	0.88
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP028996	Klebsiella pneumoniae strain AR_0079 plasmid unnamed5, complete sequence	17804-17828	3	0.88
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP010723	Phaeobacter piscinae strain P18 plasmid pP18_h, complete sequence	5246-5270	3	0.88
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP017084	Proteus mirabilis strain T21 plasmid pT212, complete sequence	169765-169789	3	0.88
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP040029	Klebsiella pneumoniae strain KPC160121 plasmid pIncC-L121, complete sequence	45560-45584	3	0.88
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP031122	Providencia sp. WCHPHu000369 strain WCHPr000369 plasmid pIMP69_000369, complete sequence	27032-27056	3	0.88
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP028920	Gemmobacter sp. HYN0069 plasmid unnamed2, complete sequence	123514-123538	3	0.88
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP011580	Enterobacter hormaechei strain CAV1411 plasmid pKPC_CAV1411, complete sequence	65071-65095	3	0.88
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP038103	Aeromonas salmonicida subsp. salmonicida strain SHY16-3432 plasmid pAsa5-3432, complete sequence	120511-120535	3	0.88
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP011649	Enterobacter hormaechei strain CAV1669 plasmid pKPC_CAV1669, complete sequence	65071-65095	3	0.88
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NC_016839	Klebsiella pneumoniae subsp. pneumoniae HS11286 plasmid pKPHS3, complete sequence	36080-36104	3	0.88
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP027695	Klebsiella pneumoniae strain KP30835 plasmid unnamed2, complete sequence	88848-88872	3	0.88
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_MH917284	Klebsiella pneumoniae strain 397108 plasmid p397108-Ct2, complete sequence	53060-53084	3	0.88
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_MF344574	Enterobacter hormaechei strain T5282 plasmid pT5282-Ct2, complete sequence	27032-27056	3	0.88
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_MF150084	Klebsiella pneumoniae strain A64477 plasmid pKP64477a, complete sequence	103735-103759	3	0.88
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_MF150118	Proteus mirabilis strain A64421 plasmid pPM64421a, complete sequence	6526-6550	3	0.88
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP017783	Rhodobacter sp. LPB0142 plasmid pEJ02, complete sequence	21951-21975	3	0.88
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_KX364409	Aeromonas salmonicida subsp. salmonicida strain M16474-11 plasmid pAsa8, complete sequence	19505-19529	3	0.88
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP039989	Pseudomonas aeruginosa strain T2436 plasmid pBT2436, complete sequence	194512-194536	3	0.88
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP030080	Enterobacter hormaechei strain 20710 plasmid pIMP-20710, complete sequence	275694-275718	3	0.88
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP031802	Klebsiella pneumoniae strain MSB1_8A-sc-2280397 plasmid unnamed2, complete sequence	37914-37938	3	0.88
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP040034	Klebsiella pneumoniae strain KPC160117 plasmid pIncC-L117, complete sequence	37804-37828	3	0.88
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP027043	Klebsiella pneumoniae strain 1_GR_13 plasmid IncAC2, complete sequence	174878-174902	3	0.88
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP011571	Enterobacter hormaechei strain CAV1311 plasmid pKPC_CAV1311, complete sequence	45213-45237	3	0.88
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	MG879028	Uncultured bacterium plasmid pEG1-1, complete sequence	38816-38840	3	0.88
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	MN823999	Klebsiella pneumoniae strain 362713 plasmid p362713-FIIK, complete sequence	165352-165376	3	0.88
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	MN842293	Klebsiella pneumoniae strain 20130907-4 plasmid p309074-1FIIK, complete sequence	99804-99828	3	0.88
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP013115	Shewanella xiamenensis strain T17 plasmid pSx1, complete sequence	145073-145097	3	0.88
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP011583	Enterobacter hormaechei strain CAV1668 plasmid pCAV1668-85, complete sequence	58771-58795	3	0.88
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	434323-434347	3	0.88
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	MT011984	Comamonas testosteroni strain NFYY023 plasmid pNFYY023-1, complete sequence	39115-39139	3	0.88
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP030132	Klebsiella pneumoniae strain 160111 plasmid pIncAC2_L111, complete sequence	44808-44832	3	0.88
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_KY883660	Pseudomonas putida strain SY153 plasmid pSY153-MDR, complete sequence	237517-237541	3	0.88
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	1127434-1127458	3	0.88
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP032054	Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence	729164-729188	3	0.88
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP032054	Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence	322433-322457	3	0.88
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP016560	Streptomyces clavuligerus strain F613-1 plasmid pSCL4, complete sequence	386420-386444	3	0.88
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	MN270887	Pectobacterium phage CX5, complete genome	3724-3748	3	0.88
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	MN270888	Pectobacterium phage CX5-1, complete genome	3724-3748	3	0.88
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP034331	Tabrizicola piscis strain K13M18 plasmid unnamed3, complete sequence	1414-1438	3	0.88
NC_009484_2	2.11\|1301091\|25\|NC_009484\|CRT	1301091-1301115	25	NZ_CP033971	Cupriavidus pauculus strain FDAARGOS_614 plasmid unnamed2, complete sequence	251695-251719	3	0.88
NC_009484_2	2.11\|1301091\|25\|NC_009484\|CRT	1301091-1301115	25	NZ_LR134459	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 17, complete sequence	82777-82801	3	0.88
NC_009484_2	2.11\|1301091\|25\|NC_009484\|CRT	1301091-1301115	25	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	2376649-2376673	3	0.88
NC_009484_2	2.11\|1301091\|25\|NC_009484\|CRT	1301091-1301115	25	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	1250662-1250686	3	0.88
NC_009484_2	2.14\|1301244\|25\|NC_009484\|CRT	1301244-1301268	25	NZ_CP033971	Cupriavidus pauculus strain FDAARGOS_614 plasmid unnamed2, complete sequence	251785-251809	3	0.88
NC_009484_2	2.14\|1301244\|25\|NC_009484\|CRT	1301244-1301268	25	NZ_CP015065	Mesorhizobium ciceri biovar biserrulae strain WSM1284 plasmid pMc1284, complete sequence	248-272	3	0.88
NC_009484_2	2.14\|1301244\|25\|NC_009484\|CRT	1301244-1301268	25	MK686068	Streptomyces phage RemusLoopin, complete genome	15053-15077	3	0.88
NC_009484_2	2.14\|1301244\|25\|NC_009484\|CRT	1301244-1301268	25	NZ_CP017422	Arthrobacter sp. ZXY-2 plasmid pZXY21, complete sequence	1360-1384	3	0.88
NC_009484_2	2.21\|1301658\|25\|NC_009484\|CRT	1301658-1301682	25	NZ_CP033971	Cupriavidus pauculus strain FDAARGOS_614 plasmid unnamed2, complete sequence	251785-251809	3	0.88
NC_009484_2	2.21\|1301658\|25\|NC_009484\|CRT	1301658-1301682	25	NZ_CP015065	Mesorhizobium ciceri biovar biserrulae strain WSM1284 plasmid pMc1284, complete sequence	248-272	3	0.88
NC_009484_2	2.21\|1301658\|25\|NC_009484\|CRT	1301658-1301682	25	MK686068	Streptomyces phage RemusLoopin, complete genome	15053-15077	3	0.88
NC_009484_2	2.21\|1301658\|25\|NC_009484\|CRT	1301658-1301682	25	NZ_CP017422	Arthrobacter sp. ZXY-2 plasmid pZXY21, complete sequence	1360-1384	3	0.88
NC_009484_2	2.22\|1301703\|25\|NC_009484\|CRT	1301703-1301727	25	NZ_CP026091	Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence	58766-58790	3	0.88
NC_009484_2	2.22\|1301703\|25\|NC_009484\|CRT	1301703-1301727	25	NC_016037	Komagataeibacter medellinensis NBRC 3288 plasmid pGXY010, complete sequence	56978-57002	3	0.88
NC_009484_2	2.22\|1301703\|25\|NC_009484\|CRT	1301703-1301727	25	NZ_CP010857	Marinovum algicola DG 898 plasmid pMaD2, complete sequence	51300-51324	3	0.88
NC_009484_2	2.29\|1302162\|25\|NC_009484\|CRT	1302162-1302186	25	NC_008757	Polaromonas naphthalenivorans CJ2 plasmid pPNAP01, complete sequence	316921-316945	3	0.88
NC_009484_2	2.29\|1302162\|25\|NC_009484\|CRT	1302162-1302186	25	AJ006589	Bacteriophage phi-C31 complete genome	15948-15972	3	0.88
NC_009484_2	2.29\|1302162\|25\|NC_009484\|CRT	1302162-1302186	25	KP790011	Gordonia phage Gsput1, complete genome	11856-11880	3	0.88
NC_009484_2	2.29\|1302162\|25\|NC_009484\|CRT	1302162-1302186	25	Z99661	Bacteriophage phi-C31 late region gene 49	807-831	3	0.88
NC_009484_2	2.3\|1300677\|25\|NC_009484\|CRT	1300677-1300701	25	MN428048	Gordonia phage DobbysSock, complete genome	3145-3169	4	0.84
NC_009484_2	2.4\|1300722\|25\|NC_009484\|CRT	1300722-1300746	25	MN428048	Gordonia phage DobbysSock, complete genome	3145-3169	4	0.84
NC_009484_2	2.6\|1300821\|25\|NC_009484\|CRT	1300821-1300845	25	NZ_CP033971	Cupriavidus pauculus strain FDAARGOS_614 plasmid unnamed2, complete sequence	65387-65411	4	0.84
NC_009484_2	2.6\|1300821\|25\|NC_009484\|CRT	1300821-1300845	25	MK801727	Gordonia phage ThankyouJordi, complete genome	11951-11975	4	0.84
NC_009484_2	2.6\|1300821\|25\|NC_009484\|CRT	1300821-1300845	25	MT723938	Gordonia phage Bunnybear, complete genome	11941-11965	4	0.84
NC_009484_2	2.6\|1300821\|25\|NC_009484\|CRT	1300821-1300845	25	MK875793	Gordonia phage WelcomeAyanna, complete genome	11951-11975	4	0.84
NC_009484_2	2.6\|1300821\|25\|NC_009484\|CRT	1300821-1300845	25	NC_010510	Methylobacterium radiotolerans JCM 2831 plasmid pMRAD01, complete sequence	271812-271836	4	0.84
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP021071	Mesorhizobium sp. WSM1497 plasmid pWSM1497, complete sequence	89-113	4	0.84
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP021071	Mesorhizobium sp. WSM1497 plasmid pWSM1497, complete sequence	531076-531100	4	0.84
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP021071	Mesorhizobium sp. WSM1497 plasmid pWSM1497, complete sequence	531184-531208	4	0.84
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP021071	Mesorhizobium sp. WSM1497 plasmid pWSM1497, complete sequence	531292-531316	4	0.84
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP021071	Mesorhizobium sp. WSM1497 plasmid pWSM1497, complete sequence	531400-531424	4	0.84
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP021071	Mesorhizobium sp. WSM1497 plasmid pWSM1497, complete sequence	531508-531532	4	0.84
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP015063	Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence	87-111	4	0.84
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP015063	Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence	231-255	4	0.84
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP015063	Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence	375-399	4	0.84
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP015063	Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence	519-543	4	0.84
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP015063	Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence	744-768	4	0.84
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP015063	Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence	843-867	4	0.84
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP015063	Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence	942-966	4	0.84
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP015063	Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence	1041-1065	4	0.84
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP015063	Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence	1140-1164	4	0.84
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP015063	Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence	1248-1272	4	0.84
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP015063	Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence	647921-647945	4	0.84
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP015063	Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence	648038-648062	4	0.84
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	434125-434149	4	0.84
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	434359-434383	4	0.84
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	1156377-1156401	4	0.84
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP021763	Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence	784016-784040	4	0.84
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP015065	Mesorhizobium ciceri biovar biserrulae strain WSM1284 plasmid pMc1284, complete sequence	131-155	4	0.84
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP015065	Mesorhizobium ciceri biovar biserrulae strain WSM1284 plasmid pMc1284, complete sequence	553093-553117	4	0.84
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP015065	Mesorhizobium ciceri biovar biserrulae strain WSM1284 plasmid pMc1284, complete sequence	553201-553225	4	0.84
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP015065	Mesorhizobium ciceri biovar biserrulae strain WSM1284 plasmid pMc1284, complete sequence	553318-553342	4	0.84
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	350827-350851	4	0.84
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP052069	Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence	668893-668917	4	0.84
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP052085	Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence	755816-755840	4	0.84
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP021765	Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence	784057-784081	4	0.84
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP052087	Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence	755816-755840	4	0.84
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP052127	Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence	755816-755840	4	0.84
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP052089	Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence	755820-755844	4	0.84
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP052131	Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence	755816-755840	4	0.84
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP016613	Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence	1962027-1962051	4	0.84
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP042825	Rhizobium sp. WL3 plasmid unnamed2, complete sequence	408002-408026	4	0.84
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NC_016626	Burkholderia sp. YI23 plasmid byi_1p, complete sequence	293233-293257	4	0.84
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NC_019957	Mycobacterium sp. JS623 plasmid pMYCSM01, complete sequence	283575-283599	4	0.84
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_LR026982	Rhodoplanes piscinae isolate Rhod_plasmid plasmid 1, complete sequence	28329-28353	4	0.84
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP052111	Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence	1290652-1290676	4	0.84
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP052113	Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence	1290652-1290676	4	0.84
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	LN997843	Streptomyces reticuli genome assembly TUE45, plasmid : II	137465-137489	4	0.84
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	MN694114	Marine virus AFVG_250M252, complete genome	19706-19730	4	0.84
NC_009484_2	2.11\|1301091\|25\|NC_009484\|CRT	1301091-1301115	25	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	434098-434122	4	0.84
NC_009484_2	2.11\|1301091\|25\|NC_009484\|CRT	1301091-1301115	25	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	434224-434248	4	0.84
NC_009484_2	2.11\|1301091\|25\|NC_009484\|CRT	1301091-1301115	25	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	434305-434329	4	0.84
NC_009484_2	2.11\|1301091\|25\|NC_009484\|CRT	1301091-1301115	25	NZ_CP042264	Litoreibacter sp. LN3S51 plasmid unnamed3, complete sequence	17284-17308	4	0.84
NC_009484_2	2.11\|1301091\|25\|NC_009484\|CRT	1301091-1301115	25	NZ_CP033971	Cupriavidus pauculus strain FDAARGOS_614 plasmid unnamed2, complete sequence	251686-251710	4	0.84
NC_009484_2	2.11\|1301091\|25\|NC_009484\|CRT	1301091-1301115	25	NZ_CP031079	Paracoccus yeei strain CCUG 32053 plasmid pYEE1, complete sequence	463447-463471	4	0.84
NC_009484_2	2.11\|1301091\|25\|NC_009484\|CRT	1301091-1301115	25	NZ_CP029232	Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence	301432-301456	4	0.84
NC_009484_2	2.11\|1301091\|25\|NC_009484\|CRT	1301091-1301115	25	NZ_AP014705	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence	515400-515424	4	0.84
NC_009484_2	2.11\|1301091\|25\|NC_009484\|CRT	1301091-1301115	25	NZ_AP022319	Burkholderia sp. THE68 plasmid BTHE68_p1, complete sequence	919134-919158	4	0.84
NC_009484_2	2.14\|1301244\|25\|NC_009484\|CRT	1301244-1301268	25	NZ_AP014803	Rhodovulum sulfidophilum plasmid Plasmid3 DNA, complete genome, strain: DSM 2351	18484-18508	4	0.84
NC_009484_2	2.14\|1301244\|25\|NC_009484\|CRT	1301244-1301268	25	MK450426	Streptomyces phage Euratis, complete genome	15131-15155	4	0.84
NC_009484_2	2.17\|1301415\|25\|NC_009484\|CRT	1301415-1301439	25	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	2056775-2056799	4	0.84
NC_009484_2	2.17\|1301415\|25\|NC_009484\|CRT	1301415-1301439	25	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	1570536-1570560	4	0.84
NC_009484_2	2.21\|1301658\|25\|NC_009484\|CRT	1301658-1301682	25	NZ_AP014803	Rhodovulum sulfidophilum plasmid Plasmid3 DNA, complete genome, strain: DSM 2351	18484-18508	4	0.84
NC_009484_2	2.21\|1301658\|25\|NC_009484\|CRT	1301658-1301682	25	MK450426	Streptomyces phage Euratis, complete genome	15131-15155	4	0.84
NC_009484_2	2.22\|1301703\|25\|NC_009484\|CRT	1301703-1301727	25	NC_016623	Azospirillum lipoferum 4B plasmid AZO_p3, complete sequence	541935-541959	4	0.84
NC_009484_2	2.22\|1301703\|25\|NC_009484\|CRT	1301703-1301727	25	NZ_CP006370	Aureimonas sp. AU20 plasmid pAU20c, complete sequence	214391-214415	4	0.84
NC_009484_2	2.22\|1301703\|25\|NC_009484\|CRT	1301703-1301727	25	NZ_CP033873	Caulobacter sp. FWC26 plasmid p1, complete sequence	109365-109389	4	0.84
NC_009484_2	2.22\|1301703\|25\|NC_009484\|CRT	1301703-1301727	25	NZ_CP023068	Ensifer sojae CCBAU 05684 plasmid pSJ05684b, complete sequence	36390-36414	4	0.84
NC_009484_2	2.22\|1301703\|25\|NC_009484\|CRT	1301703-1301727	25	NZ_CP054616	Azospirillum oryzae strain KACC 14407 plasmid unnamed2, complete sequence	172784-172808	4	0.84
NC_009484_2	2.22\|1301703\|25\|NC_009484\|CRT	1301703-1301727	25	KP790011	Gordonia phage Gsput1, complete genome	11856-11880	4	0.84
NC_009484_2	2.29\|1302162\|25\|NC_009484\|CRT	1302162-1302186	25	NZ_CP033971	Cupriavidus pauculus strain FDAARGOS_614 plasmid unnamed2, complete sequence	251785-251809	4	0.84
NC_009484_2	2.29\|1302162\|25\|NC_009484\|CRT	1302162-1302186	25	NZ_LR134459	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 17, complete sequence	82777-82801	4	0.84
NC_009484_2	2.29\|1302162\|25\|NC_009484\|CRT	1302162-1302186	25	NZ_CP015065	Mesorhizobium ciceri biovar biserrulae strain WSM1284 plasmid pMc1284, complete sequence	248-272	4	0.84
NC_009484_2	2.29\|1302162\|25\|NC_009484\|CRT	1302162-1302186	25	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	1045162-1045186	4	0.84
NC_009484_2	2.29\|1302162\|25\|NC_009484\|CRT	1302162-1302186	25	NZ_CP017422	Arthrobacter sp. ZXY-2 plasmid pZXY21, complete sequence	1360-1384	4	0.84
NC_009484_2	2.29\|1302162\|25\|NC_009484\|CRT	1302162-1302186	25	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	434098-434122	4	0.84
NC_009484_2	2.29\|1302162\|25\|NC_009484\|CRT	1302162-1302186	25	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	2281679-2281703	4	0.84
NC_009484_2	2.29\|1302162\|25\|NC_009484\|CRT	1302162-1302186	25	MK686068	Streptomyces phage RemusLoopin, complete genome	15053-15077	4	0.84
NC_009484_2	2.3\|1300677\|25\|NC_009484\|CRT	1300677-1300701	25	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	434098-434122	5	0.8
NC_009484_2	2.4\|1300722\|25\|NC_009484\|CRT	1300722-1300746	25	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	434098-434122	5	0.8
NC_009484_2	2.6\|1300821\|25\|NC_009484\|CRT	1300821-1300845	25	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	5034357-5034381	5	0.8
NC_009484_2	2.9\|1300992\|25\|NC_009484\|CRT	1300992-1301016	25	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	399798-399822	5	0.8
NC_009484_2	2.13\|1301190\|34\|NC_009484\|CRT	1301190-1301223	34	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	2376640-2376673	5	0.853
NC_009484_2	2.13\|1301190\|34\|NC_009484\|CRT	1301190-1301223	34	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	1250662-1250695	5	0.853
NC_009484_2	2.13\|1301190\|34\|NC_009484\|CRT	1301190-1301223	34	NZ_CP033971	Cupriavidus pauculus strain FDAARGOS_614 plasmid unnamed2, complete sequence	251686-251719	5	0.853
NC_009484_2	2.14\|1301244\|25\|NC_009484\|CRT	1301244-1301268	25	NZ_CP033971	Cupriavidus pauculus strain FDAARGOS_614 plasmid unnamed2, complete sequence	65387-65411	5	0.8
NC_009484_2	2.21\|1301658\|25\|NC_009484\|CRT	1301658-1301682	25	NZ_CP033971	Cupriavidus pauculus strain FDAARGOS_614 plasmid unnamed2, complete sequence	65387-65411	5	0.8
NC_009484_2	2.22\|1301703\|25\|NC_009484\|CRT	1301703-1301727	25	NZ_KM017071	Sphingomonas sp. JE1 plasmid pJE1, complete sequence	144750-144774	5	0.8
NC_009484_2	2.22\|1301703\|25\|NC_009484\|CRT	1301703-1301727	25	NZ_CP010858	Marinovum algicola DG 898 plasmid pMaD3	106284-106308	5	0.8
NC_009484_2	2.29\|1302162\|25\|NC_009484\|CRT	1302162-1302186	25	NZ_LR134469	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 27, complete sequence	128202-128226	5	0.8
NC_009484_2	2.3\|1300677\|25\|NC_009484\|CRT	1300677-1300701	25	NZ_CP045385	Ruegeria sp. THAF33 plasmid pTHAF33_a, complete sequence	660166-660190	6	0.76
NC_009484_2	2.4\|1300722\|25\|NC_009484\|CRT	1300722-1300746	25	NZ_CP045385	Ruegeria sp. THAF33 plasmid pTHAF33_a, complete sequence	660166-660190	6	0.76
NC_009484_2	2.1\|1300560\|34\|NC_009484\|CRT	1300560-1300593	34	NC_015952	Streptomyces violaceusniger Tu 4113 plasmid pSTRVI02, complete sequence	73239-73272	7	0.794
NC_009484_2	2.28\|1302108\|34\|NC_009484\|CRT	1302108-1302141	34	MN116494	Klebsiella phage vB_KpnP_Bp5, complete genome	13884-13917	7	0.794
NC_009484_2	2.5\|1300767\|34\|NC_009484\|CRT	1300767-1300800	34	NZ_LR134450	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 8, complete sequence	174051-174084	8	0.765
NC_009484_2	2.7\|1300866\|34\|NC_009484\|CRT	1300866-1300899	34	NC_004771	Pasteurella multocida plasmid pJR1, complete sequence	2836-2869	8	0.765
NC_009484_2	2.7\|1300866\|34\|NC_009484\|CRT	1300866-1300899	34	NZ_AP022611	Mycolicibacterium madagascariense strain JCM 13574 plasmid pJCM13574	63390-63423	8	0.765
NC_009484_2	2.13\|1301190\|34\|NC_009484\|CRT	1301190-1301223	34	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	1262263-1262296	8	0.765
NC_009484_2	2.15\|1301289\|34\|NC_009484\|CRT	1301289-1301322	34	NC_004771	Pasteurella multocida plasmid pJR1, complete sequence	2836-2869	8	0.765
NC_009484_2	2.15\|1301289\|34\|NC_009484\|CRT	1301289-1301322	34	NZ_AP022611	Mycolicibacterium madagascariense strain JCM 13574 plasmid pJCM13574	63390-63423	8	0.765
NC_009484_2	2.5\|1300767\|34\|NC_009484\|CRT	1300767-1300800	34	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	1045153-1045186	9	0.735
NC_009484_2	2.7\|1300866\|34\|NC_009484\|CRT	1300866-1300899	34	NZ_CP017783	Rhodobacter sp. LPB0142 plasmid pEJ02, complete sequence	21951-21984	9	0.735
NC_009484_2	2.7\|1300866\|34\|NC_009484\|CRT	1300866-1300899	34	NZ_CP017784	Rhodobacter sp. LPB0142 plasmid pEJ03, complete sequence	12187-12220	9	0.735
NC_009484_2	2.7\|1300866\|34\|NC_009484\|CRT	1300866-1300899	34	NZ_KX364409	Aeromonas salmonicida subsp. salmonicida strain M16474-11 plasmid pAsa8, complete sequence	19505-19538	9	0.735
NC_009484_2	2.7\|1300866\|34\|NC_009484\|CRT	1300866-1300899	34	MT081181	Uncultured bacterium plasmid pCu_H_1, complete sequence	5761-5794	9	0.735
NC_009484_2	2.7\|1300866\|34\|NC_009484\|CRT	1300866-1300899	34	NZ_CP049911	Diaphorobacter sp. HDW4A plasmid p_unnamed1, complete sequence	136616-136649	9	0.735
NC_009484_2	2.7\|1300866\|34\|NC_009484\|CRT	1300866-1300899	34	NZ_CP025470	Klebsiella pneumoniae strain JS187 plasmid p187-4, complete sequence	91762-91795	9	0.735
NC_009484_2	2.7\|1300866\|34\|NC_009484\|CRT	1300866-1300899	34	NC_022078	Klebsiella pneumoniae JM45 plasmid p1, complete sequence	147917-147950	9	0.735
NC_009484_2	2.7\|1300866\|34\|NC_009484\|CRT	1300866-1300899	34	NZ_CP039989	Pseudomonas aeruginosa strain T2436 plasmid pBT2436, complete sequence	194512-194545	9	0.735
NC_009484_2	2.7\|1300866\|34\|NC_009484\|CRT	1300866-1300899	34	NZ_CP027038	Klebsiella pneumoniae strain 16_GR_13 plasmid IncAC2, complete sequence	136958-136991	9	0.735
NC_009484_2	2.7\|1300866\|34\|NC_009484\|CRT	1300866-1300899	34	NZ_CP027055	Klebsiella pneumoniae strain 2_GR_12 plasmid IncAC2	136962-136995	9	0.735
NC_009484_2	2.7\|1300866\|34\|NC_009484\|CRT	1300866-1300899	34	CP052444	Klebsiella pneumoniae strain C16KP0098 plasmid pC16KP0098-1, complete sequence	44042-44075	9	0.735
NC_009484_2	2.7\|1300866\|34\|NC_009484\|CRT	1300866-1300899	34	NZ_CP030080	Enterobacter hormaechei strain 20710 plasmid pIMP-20710, complete sequence	275694-275727	9	0.735
NC_009484_2	2.7\|1300866\|34\|NC_009484\|CRT	1300866-1300899	34	NZ_CP039991	Pseudomonas aeruginosa strain T2101 plasmid pBT2101, complete sequence	216734-216767	9	0.735
NC_009484_2	2.7\|1300866\|34\|NC_009484\|CRT	1300866-1300899	34	NZ_CP039991	Pseudomonas aeruginosa strain T2101 plasmid pBT2101, complete sequence	249481-249514	9	0.735
NC_009484_2	2.7\|1300866\|34\|NC_009484\|CRT	1300866-1300899	34	NZ_CP045917	Pseudomonas aeruginosa strain CF39S plasmid pCF39S, complete sequence	380996-381029	9	0.735
NC_009484_2	2.7\|1300866\|34\|NC_009484\|CRT	1300866-1300899	34	NZ_CP031802	Klebsiella pneumoniae strain MSB1_8A-sc-2280397 plasmid unnamed2, complete sequence	37914-37947	9	0.735
NC_009484_2	2.7\|1300866\|34\|NC_009484\|CRT	1300866-1300899	34	NZ_CP028996	Klebsiella pneumoniae strain AR_0079 plasmid unnamed5, complete sequence	17795-17828	9	0.735
NC_009484_2	2.7\|1300866\|34\|NC_009484\|CRT	1300866-1300899	34	NZ_CP040034	Klebsiella pneumoniae strain KPC160117 plasmid pIncC-L117, complete sequence	37804-37837	9	0.735
NC_009484_2	2.7\|1300866\|34\|NC_009484\|CRT	1300866-1300899	34	NZ_CP027043	Klebsiella pneumoniae strain 1_GR_13 plasmid IncAC2, complete sequence	174878-174911	9	0.735
NC_009484_2	2.7\|1300866\|34\|NC_009484\|CRT	1300866-1300899	34	NZ_CP011571	Enterobacter hormaechei strain CAV1311 plasmid pKPC_CAV1311, complete sequence	45213-45246	9	0.735
NC_009484_2	2.7\|1300866\|34\|NC_009484\|CRT	1300866-1300899	34	NZ_CP010723	Phaeobacter piscinae strain P18 plasmid pP18_h, complete sequence	5237-5270	9	0.735
NC_009484_2	2.7\|1300866\|34\|NC_009484\|CRT	1300866-1300899	34	NZ_CP017084	Proteus mirabilis strain T21 plasmid pT212, complete sequence	169756-169789	9	0.735
NC_009484_2	2.7\|1300866\|34\|NC_009484\|CRT	1300866-1300899	34	NZ_CP040029	Klebsiella pneumoniae strain KPC160121 plasmid pIncC-L121, complete sequence	45551-45584	9	0.735
NC_009484_2	2.7\|1300866\|34\|NC_009484\|CRT	1300866-1300899	34	NZ_CP031122	Providencia sp. WCHPHu000369 strain WCHPr000369 plasmid pIMP69_000369, complete sequence	27023-27056	9	0.735
NC_009484_2	2.7\|1300866\|34\|NC_009484\|CRT	1300866-1300899	34	MG879028	Uncultured bacterium plasmid pEG1-1, complete sequence	38816-38849	9	0.735
NC_009484_2	2.7\|1300866\|34\|NC_009484\|CRT	1300866-1300899	34	NZ_CP028920	Gemmobacter sp. HYN0069 plasmid unnamed2, complete sequence	123505-123538	9	0.735
NC_009484_2	2.7\|1300866\|34\|NC_009484\|CRT	1300866-1300899	34	MN823999	Klebsiella pneumoniae strain 362713 plasmid p362713-FIIK, complete sequence	165352-165385	9	0.735
NC_009484_2	2.7\|1300866\|34\|NC_009484\|CRT	1300866-1300899	34	MN842293	Klebsiella pneumoniae strain 20130907-4 plasmid p309074-1FIIK, complete sequence	99804-99837	9	0.735
NC_009484_2	2.7\|1300866\|34\|NC_009484\|CRT	1300866-1300899	34	NZ_CP011580	Enterobacter hormaechei strain CAV1411 plasmid pKPC_CAV1411, complete sequence	65062-65095	9	0.735
NC_009484_2	2.7\|1300866\|34\|NC_009484\|CRT	1300866-1300899	34	NZ_CP013115	Shewanella xiamenensis strain T17 plasmid pSx1, complete sequence	145073-145106	9	0.735
NC_009484_2	2.7\|1300866\|34\|NC_009484\|CRT	1300866-1300899	34	NZ_CP038103	Aeromonas salmonicida subsp. salmonicida strain SHY16-3432 plasmid pAsa5-3432, complete sequence	120502-120535	9	0.735
NC_009484_2	2.7\|1300866\|34\|NC_009484\|CRT	1300866-1300899	34	NZ_CP011583	Enterobacter hormaechei strain CAV1668 plasmid pCAV1668-85, complete sequence	58771-58804	9	0.735
NC_009484_2	2.7\|1300866\|34\|NC_009484\|CRT	1300866-1300899	34	NZ_CP011649	Enterobacter hormaechei strain CAV1669 plasmid pKPC_CAV1669, complete sequence	65062-65095	9	0.735
NC_009484_2	2.7\|1300866\|34\|NC_009484\|CRT	1300866-1300899	34	NC_016839	Klebsiella pneumoniae subsp. pneumoniae HS11286 plasmid pKPHS3, complete sequence	36071-36104	9	0.735
NC_009484_2	2.7\|1300866\|34\|NC_009484\|CRT	1300866-1300899	34	NZ_CP027695	Klebsiella pneumoniae strain KP30835 plasmid unnamed2, complete sequence	88839-88872	9	0.735
NC_009484_2	2.7\|1300866\|34\|NC_009484\|CRT	1300866-1300899	34	NZ_MH917284	Klebsiella pneumoniae strain 397108 plasmid p397108-Ct2, complete sequence	53051-53084	9	0.735
NC_009484_2	2.7\|1300866\|34\|NC_009484\|CRT	1300866-1300899	34	MT011984	Comamonas testosteroni strain NFYY023 plasmid pNFYY023-1, complete sequence	39115-39148	9	0.735
NC_009484_2	2.7\|1300866\|34\|NC_009484\|CRT	1300866-1300899	34	NZ_MF344574	Enterobacter hormaechei strain T5282 plasmid pT5282-Ct2, complete sequence	27023-27056	9	0.735
NC_009484_2	2.7\|1300866\|34\|NC_009484\|CRT	1300866-1300899	34	NZ_CP030132	Klebsiella pneumoniae strain 160111 plasmid pIncAC2_L111, complete sequence	44808-44841	9	0.735
NC_009484_2	2.7\|1300866\|34\|NC_009484\|CRT	1300866-1300899	34	NZ_MF150084	Klebsiella pneumoniae strain A64477 plasmid pKP64477a, complete sequence	103726-103759	9	0.735
NC_009484_2	2.7\|1300866\|34\|NC_009484\|CRT	1300866-1300899	34	NZ_KY883660	Pseudomonas putida strain SY153 plasmid pSY153-MDR, complete sequence	237517-237550	9	0.735
NC_009484_2	2.7\|1300866\|34\|NC_009484\|CRT	1300866-1300899	34	NZ_MF150118	Proteus mirabilis strain A64421 plasmid pPM64421a, complete sequence	6517-6550	9	0.735
NC_009484_2	2.7\|1300866\|34\|NC_009484\|CRT	1300866-1300899	34	MT897910	Mycobacterium phage VioletZ, complete genome	29904-29937	9	0.735
NC_009484_2	2.7\|1300866\|34\|NC_009484\|CRT	1300866-1300899	34	MN369759	Mycobacterium phage Mithril, complete genome	29846-29879	9	0.735
NC_009484_2	2.7\|1300866\|34\|NC_009484\|CRT	1300866-1300899	34	MT818419	Mycobacterium phage Lolalove, complete genome	29842-29875	9	0.735
NC_009484_2	2.7\|1300866\|34\|NC_009484\|CRT	1300866-1300899	34	MN428050	Mycobacterium phage Apex, complete genome	30011-30044	9	0.735
NC_009484_2	2.7\|1300866\|34\|NC_009484\|CRT	1300866-1300899	34	MK524486	Mycobacterium phage Waleliano, complete genome	29831-29864	9	0.735
NC_009484_2	2.7\|1300866\|34\|NC_009484\|CRT	1300866-1300899	34	MN234171	Mycobacterium phage Magpie, complete genome	29671-29704	9	0.735
NC_009484_2	2.7\|1300866\|34\|NC_009484\|CRT	1300866-1300899	34	MH513970	Mycobacterium phage Hangman, complete genome	29828-29861	9	0.735
NC_009484_2	2.7\|1300866\|34\|NC_009484\|CRT	1300866-1300899	34	KX589269	Mycobacterium phage Fortunato, complete genome	29827-29860	9	0.735
NC_009484_2	2.7\|1300866\|34\|NC_009484\|CRT	1300866-1300899	34	MT639648	Mycobacterium phage Heath, complete genome	29429-29462	9	0.735
NC_009484_2	2.7\|1300866\|34\|NC_009484\|CRT	1300866-1300899	34	NC_042035	Mycobacterium phage Zemanar, complete sequence	29831-29864	9	0.735
NC_009484_2	2.7\|1300866\|34\|NC_009484\|CRT	1300866-1300899	34	NC_042034	Mycobacterium phage ChrisnMich, complete sequence	28796-28829	9	0.735
NC_009484_2	2.7\|1300866\|34\|NC_009484\|CRT	1300866-1300899	34	NC_022331	Mycobacterium phage Bane1, complete genome	29504-29537	9	0.735
NC_009484_2	2.7\|1300866\|34\|NC_009484\|CRT	1300866-1300899	34	KF279413	Mycobacterium phage Bane2, complete genome	29483-29516	9	0.735
NC_009484_2	2.7\|1300866\|34\|NC_009484\|CRT	1300866-1300899	34	KF493881	Mycobacterium phage JAMaL, complete genome	30015-30048	9	0.735
NC_009484_2	2.7\|1300866\|34\|NC_009484\|CRT	1300866-1300899	34	NC_028968	Mycobacterium phage BrownCNA, complete genome	30097-30130	9	0.735
NC_009484_2	2.13\|1301190\|34\|NC_009484\|CRT	1301190-1301223	34	NZ_CP033971	Cupriavidus pauculus strain FDAARGOS_614 plasmid unnamed2, complete sequence	65387-65420	9	0.735
NC_009484_2	2.15\|1301289\|34\|NC_009484\|CRT	1301289-1301322	34	NZ_CP017783	Rhodobacter sp. LPB0142 plasmid pEJ02, complete sequence	21951-21984	9	0.735
NC_009484_2	2.15\|1301289\|34\|NC_009484\|CRT	1301289-1301322	34	NZ_CP017784	Rhodobacter sp. LPB0142 plasmid pEJ03, complete sequence	12187-12220	9	0.735
NC_009484_2	2.15\|1301289\|34\|NC_009484\|CRT	1301289-1301322	34	NZ_KX364409	Aeromonas salmonicida subsp. salmonicida strain M16474-11 plasmid pAsa8, complete sequence	19505-19538	9	0.735
NC_009484_2	2.15\|1301289\|34\|NC_009484\|CRT	1301289-1301322	34	MT081181	Uncultured bacterium plasmid pCu_H_1, complete sequence	5761-5794	9	0.735
NC_009484_2	2.15\|1301289\|34\|NC_009484\|CRT	1301289-1301322	34	NZ_CP049911	Diaphorobacter sp. HDW4A plasmid p_unnamed1, complete sequence	136616-136649	9	0.735
NC_009484_2	2.15\|1301289\|34\|NC_009484\|CRT	1301289-1301322	34	NZ_CP025470	Klebsiella pneumoniae strain JS187 plasmid p187-4, complete sequence	91762-91795	9	0.735
NC_009484_2	2.15\|1301289\|34\|NC_009484\|CRT	1301289-1301322	34	NC_022078	Klebsiella pneumoniae JM45 plasmid p1, complete sequence	147917-147950	9	0.735
NC_009484_2	2.15\|1301289\|34\|NC_009484\|CRT	1301289-1301322	34	NZ_CP039989	Pseudomonas aeruginosa strain T2436 plasmid pBT2436, complete sequence	194512-194545	9	0.735
NC_009484_2	2.15\|1301289\|34\|NC_009484\|CRT	1301289-1301322	34	NZ_CP027038	Klebsiella pneumoniae strain 16_GR_13 plasmid IncAC2, complete sequence	136958-136991	9	0.735
NC_009484_2	2.15\|1301289\|34\|NC_009484\|CRT	1301289-1301322	34	NZ_CP027055	Klebsiella pneumoniae strain 2_GR_12 plasmid IncAC2	136962-136995	9	0.735
NC_009484_2	2.15\|1301289\|34\|NC_009484\|CRT	1301289-1301322	34	CP052444	Klebsiella pneumoniae strain C16KP0098 plasmid pC16KP0098-1, complete sequence	44042-44075	9	0.735
NC_009484_2	2.15\|1301289\|34\|NC_009484\|CRT	1301289-1301322	34	NZ_CP030080	Enterobacter hormaechei strain 20710 plasmid pIMP-20710, complete sequence	275694-275727	9	0.735
NC_009484_2	2.15\|1301289\|34\|NC_009484\|CRT	1301289-1301322	34	NZ_CP039991	Pseudomonas aeruginosa strain T2101 plasmid pBT2101, complete sequence	216734-216767	9	0.735
NC_009484_2	2.15\|1301289\|34\|NC_009484\|CRT	1301289-1301322	34	NZ_CP039991	Pseudomonas aeruginosa strain T2101 plasmid pBT2101, complete sequence	249481-249514	9	0.735
NC_009484_2	2.15\|1301289\|34\|NC_009484\|CRT	1301289-1301322	34	NZ_CP045917	Pseudomonas aeruginosa strain CF39S plasmid pCF39S, complete sequence	380996-381029	9	0.735
NC_009484_2	2.15\|1301289\|34\|NC_009484\|CRT	1301289-1301322	34	NZ_CP031802	Klebsiella pneumoniae strain MSB1_8A-sc-2280397 plasmid unnamed2, complete sequence	37914-37947	9	0.735
NC_009484_2	2.15\|1301289\|34\|NC_009484\|CRT	1301289-1301322	34	NZ_CP028996	Klebsiella pneumoniae strain AR_0079 plasmid unnamed5, complete sequence	17795-17828	9	0.735
NC_009484_2	2.15\|1301289\|34\|NC_009484\|CRT	1301289-1301322	34	NZ_CP040034	Klebsiella pneumoniae strain KPC160117 plasmid pIncC-L117, complete sequence	37804-37837	9	0.735
NC_009484_2	2.15\|1301289\|34\|NC_009484\|CRT	1301289-1301322	34	NZ_CP027043	Klebsiella pneumoniae strain 1_GR_13 plasmid IncAC2, complete sequence	174878-174911	9	0.735
NC_009484_2	2.15\|1301289\|34\|NC_009484\|CRT	1301289-1301322	34	NZ_CP011571	Enterobacter hormaechei strain CAV1311 plasmid pKPC_CAV1311, complete sequence	45213-45246	9	0.735
NC_009484_2	2.15\|1301289\|34\|NC_009484\|CRT	1301289-1301322	34	NZ_CP010723	Phaeobacter piscinae strain P18 plasmid pP18_h, complete sequence	5237-5270	9	0.735
NC_009484_2	2.15\|1301289\|34\|NC_009484\|CRT	1301289-1301322	34	NZ_CP017084	Proteus mirabilis strain T21 plasmid pT212, complete sequence	169756-169789	9	0.735
NC_009484_2	2.15\|1301289\|34\|NC_009484\|CRT	1301289-1301322	34	NZ_CP040029	Klebsiella pneumoniae strain KPC160121 plasmid pIncC-L121, complete sequence	45551-45584	9	0.735
NC_009484_2	2.15\|1301289\|34\|NC_009484\|CRT	1301289-1301322	34	NZ_CP031122	Providencia sp. WCHPHu000369 strain WCHPr000369 plasmid pIMP69_000369, complete sequence	27023-27056	9	0.735
NC_009484_2	2.15\|1301289\|34\|NC_009484\|CRT	1301289-1301322	34	MG879028	Uncultured bacterium plasmid pEG1-1, complete sequence	38816-38849	9	0.735
NC_009484_2	2.15\|1301289\|34\|NC_009484\|CRT	1301289-1301322	34	NZ_CP028920	Gemmobacter sp. HYN0069 plasmid unnamed2, complete sequence	123505-123538	9	0.735
NC_009484_2	2.15\|1301289\|34\|NC_009484\|CRT	1301289-1301322	34	MN823999	Klebsiella pneumoniae strain 362713 plasmid p362713-FIIK, complete sequence	165352-165385	9	0.735
NC_009484_2	2.15\|1301289\|34\|NC_009484\|CRT	1301289-1301322	34	MN842293	Klebsiella pneumoniae strain 20130907-4 plasmid p309074-1FIIK, complete sequence	99804-99837	9	0.735
NC_009484_2	2.15\|1301289\|34\|NC_009484\|CRT	1301289-1301322	34	NZ_CP011580	Enterobacter hormaechei strain CAV1411 plasmid pKPC_CAV1411, complete sequence	65062-65095	9	0.735
NC_009484_2	2.15\|1301289\|34\|NC_009484\|CRT	1301289-1301322	34	NZ_CP013115	Shewanella xiamenensis strain T17 plasmid pSx1, complete sequence	145073-145106	9	0.735
NC_009484_2	2.15\|1301289\|34\|NC_009484\|CRT	1301289-1301322	34	NZ_CP038103	Aeromonas salmonicida subsp. salmonicida strain SHY16-3432 plasmid pAsa5-3432, complete sequence	120502-120535	9	0.735
NC_009484_2	2.15\|1301289\|34\|NC_009484\|CRT	1301289-1301322	34	NZ_CP011583	Enterobacter hormaechei strain CAV1668 plasmid pCAV1668-85, complete sequence	58771-58804	9	0.735
NC_009484_2	2.15\|1301289\|34\|NC_009484\|CRT	1301289-1301322	34	NZ_CP011649	Enterobacter hormaechei strain CAV1669 plasmid pKPC_CAV1669, complete sequence	65062-65095	9	0.735
NC_009484_2	2.15\|1301289\|34\|NC_009484\|CRT	1301289-1301322	34	NC_016839	Klebsiella pneumoniae subsp. pneumoniae HS11286 plasmid pKPHS3, complete sequence	36071-36104	9	0.735
NC_009484_2	2.15\|1301289\|34\|NC_009484\|CRT	1301289-1301322	34	NZ_CP027695	Klebsiella pneumoniae strain KP30835 plasmid unnamed2, complete sequence	88839-88872	9	0.735
NC_009484_2	2.15\|1301289\|34\|NC_009484\|CRT	1301289-1301322	34	NZ_MH917284	Klebsiella pneumoniae strain 397108 plasmid p397108-Ct2, complete sequence	53051-53084	9	0.735
NC_009484_2	2.15\|1301289\|34\|NC_009484\|CRT	1301289-1301322	34	MT011984	Comamonas testosteroni strain NFYY023 plasmid pNFYY023-1, complete sequence	39115-39148	9	0.735
NC_009484_2	2.15\|1301289\|34\|NC_009484\|CRT	1301289-1301322	34	NZ_MF344574	Enterobacter hormaechei strain T5282 plasmid pT5282-Ct2, complete sequence	27023-27056	9	0.735
NC_009484_2	2.15\|1301289\|34\|NC_009484\|CRT	1301289-1301322	34	NZ_CP030132	Klebsiella pneumoniae strain 160111 plasmid pIncAC2_L111, complete sequence	44808-44841	9	0.735
NC_009484_2	2.15\|1301289\|34\|NC_009484\|CRT	1301289-1301322	34	NZ_MF150084	Klebsiella pneumoniae strain A64477 plasmid pKP64477a, complete sequence	103726-103759	9	0.735
NC_009484_2	2.15\|1301289\|34\|NC_009484\|CRT	1301289-1301322	34	NZ_KY883660	Pseudomonas putida strain SY153 plasmid pSY153-MDR, complete sequence	237517-237550	9	0.735
NC_009484_2	2.15\|1301289\|34\|NC_009484\|CRT	1301289-1301322	34	NZ_MF150118	Proteus mirabilis strain A64421 plasmid pPM64421a, complete sequence	6517-6550	9	0.735
NC_009484_2	2.15\|1301289\|34\|NC_009484\|CRT	1301289-1301322	34	MT897910	Mycobacterium phage VioletZ, complete genome	29904-29937	9	0.735
NC_009484_2	2.15\|1301289\|34\|NC_009484\|CRT	1301289-1301322	34	MN369759	Mycobacterium phage Mithril, complete genome	29846-29879	9	0.735
NC_009484_2	2.15\|1301289\|34\|NC_009484\|CRT	1301289-1301322	34	MT818419	Mycobacterium phage Lolalove, complete genome	29842-29875	9	0.735
NC_009484_2	2.15\|1301289\|34\|NC_009484\|CRT	1301289-1301322	34	MN428050	Mycobacterium phage Apex, complete genome	30011-30044	9	0.735
NC_009484_2	2.15\|1301289\|34\|NC_009484\|CRT	1301289-1301322	34	MK524486	Mycobacterium phage Waleliano, complete genome	29831-29864	9	0.735
NC_009484_2	2.15\|1301289\|34\|NC_009484\|CRT	1301289-1301322	34	MN234171	Mycobacterium phage Magpie, complete genome	29671-29704	9	0.735
NC_009484_2	2.15\|1301289\|34\|NC_009484\|CRT	1301289-1301322	34	MH513970	Mycobacterium phage Hangman, complete genome	29828-29861	9	0.735
NC_009484_2	2.15\|1301289\|34\|NC_009484\|CRT	1301289-1301322	34	KX589269	Mycobacterium phage Fortunato, complete genome	29827-29860	9	0.735
NC_009484_2	2.15\|1301289\|34\|NC_009484\|CRT	1301289-1301322	34	MT639648	Mycobacterium phage Heath, complete genome	29429-29462	9	0.735
NC_009484_2	2.15\|1301289\|34\|NC_009484\|CRT	1301289-1301322	34	NC_042035	Mycobacterium phage Zemanar, complete sequence	29831-29864	9	0.735
NC_009484_2	2.15\|1301289\|34\|NC_009484\|CRT	1301289-1301322	34	NC_042034	Mycobacterium phage ChrisnMich, complete sequence	28796-28829	9	0.735
NC_009484_2	2.15\|1301289\|34\|NC_009484\|CRT	1301289-1301322	34	NC_022331	Mycobacterium phage Bane1, complete genome	29504-29537	9	0.735
NC_009484_2	2.15\|1301289\|34\|NC_009484\|CRT	1301289-1301322	34	KF279413	Mycobacterium phage Bane2, complete genome	29483-29516	9	0.735
NC_009484_2	2.15\|1301289\|34\|NC_009484\|CRT	1301289-1301322	34	KF493881	Mycobacterium phage JAMaL, complete genome	30015-30048	9	0.735
NC_009484_2	2.15\|1301289\|34\|NC_009484\|CRT	1301289-1301322	34	NC_028968	Mycobacterium phage BrownCNA, complete genome	30097-30130	9	0.735
NC_009484_2	2.5\|1300767\|34\|NC_009484\|CRT	1300767-1300800	34	NZ_AP019743	Acinetobacter radioresistens DSM 6976 = NBRC 102413 = CIP 103788 strain NBRC 102413 plasmid pARA3, complete sequence	3664-3697	11	0.676
NC_009484_2	2.5\|1300767\|34\|NC_009484\|CRT	1300767-1300800	34	NZ_CP022285	Acinetobacter baumannii strain 7804 plasmid pAba7804b, complete sequence	163310-163343	11	0.676
NC_009484_2	2.5\|1300767\|34\|NC_009484\|CRT	1300767-1300800	34	MK531536	Acinetobacter baumannii strain MC1 plasmid pMC1.1, complete sequence	28066-28099	11	0.676
NC_009484_2	2.5\|1300767\|34\|NC_009484\|CRT	1300767-1300800	34	NZ_CP014652	Acinetobacter sp. DUT-2 plasmid unnamed1, complete sequence	78449-78482	11	0.676
NC_009484_2	2.12\|1301136\|34\|NC_009484\|CRT	1301136-1301169	34	NZ_CP010857	Marinovum algicola DG 898 plasmid pMaD2, complete sequence	51300-51333	11	0.676
NC_009484_2	2.13\|1301190\|34\|NC_009484\|CRT	1301190-1301223	34	NZ_CP022567	Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK03, complete sequence	366216-366249	11	0.676
NC_009484_2	2.28\|1302108\|34\|NC_009484\|CRT	1302108-1302141	34	NZ_CP039918	Agrobacterium tumefaciens strain CFBP6626 plasmid pAtCFBP6626a, complete sequence	263156-263189	11	0.676
NC_009484_2	2.28\|1302108\|34\|NC_009484\|CRT	1302108-1302141	34	NZ_CP048633	Rhizobium oryzihabitans strain M15 plasmid p1, complete sequence	4392-4425	11	0.676
NC_009484_2	2.28\|1302108\|34\|NC_009484\|CRT	1302108-1302141	34	NZ_CP048637	Rhizobium oryzihabitans strain M15 plasmid p5, complete sequence	82716-82749	11	0.676
NC_009484_2	2.28\|1302108\|34\|NC_009484\|CRT	1302108-1302141	34	NZ_KY000062	Agrobacterium genomosp. 3 strain CFBP4424 plasmid pTi_CFBP4424, complete sequence	110337-110370	11	0.676

1. spacer 2.22|1301703|25|NC_009484|CRT matches to NZ_CP033971 (Cupriavidus pauculus strain FDAARGOS_614 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.96

acccatcgcgcccgtggcgcccatc	CRISPR spacer
acccatcgcgcccgtggcgcccacc	Protospacer
***********************.*

2. spacer 2.9|1300992|25|NC_009484|CRT matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 2, identity: 0.92

tccggttgcgcccgtggcgccggtg	CRISPR spacer
gccggttgcgcccgtggcgccggtc	Protospacer
 ***********************

3. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 2, identity: 0.92

tccggttgcgcccgtggcgccggtg	CRISPR spacer
gccggttgcgcccgtggcgccggtc	Protospacer
 ***********************

4. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_AP022611 (Mycolicibacterium madagascariense strain JCM 13574 plasmid pJCM13574) position: , mismatch: 2, identity: 0.92

tccggttgcgcccgtggcgccggtg	CRISPR spacer
gccggttacgcccgtggcgccggtg	Protospacer
 ******.*****************

5. spacer 2.9|1300992|25|NC_009484|CRT matches to NC_004771 (Pasteurella multocida plasmid pJR1, complete sequence) position: , mismatch: 2, identity: 0.92

tccggttgcgcccgtggcgccggtg	CRISPR spacer
tccggttgcgcccgtgacgccggag	Protospacer
****************.****** *

6. spacer 2.11|1301091|25|NC_009484|CRT matches to NZ_CP015065 (Mesorhizobium ciceri biovar biserrulae strain WSM1284 plasmid pMc1284, complete sequence) position: , mismatch: 2, identity: 0.92

acccgtcgcgcccgtggcacccgtc	CRISPR spacer
accggtcgcgcccgtggcacctgtc	Protospacer
*** *****************.***

7. spacer 2.11|1301091|25|NC_009484|CRT matches to MK686068 (Streptomyces phage RemusLoopin, complete genome) position: , mismatch: 2, identity: 0.92

acccgtcgcgcccgtggcacccgtc	CRISPR spacer
acccgtcgcgcccgtggctccggtc	Protospacer
****************** ** ***

8. spacer 2.22|1301703|25|NC_009484|CRT matches to NZ_CP026091 (Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.92

acccatcgcgcccgtggcgcccatc	CRISPR spacer
acccatcgcgcccatcgcgcccatc	Protospacer
*************.* *********

9. spacer 2.22|1301703|25|NC_009484|CRT matches to NC_014309 (Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome) position: , mismatch: 2, identity: 0.92

acccatcgcgcccgtggcgcccatc	CRISPR spacer
acccatcgcgcccatcgcgcccatc	Protospacer
*************.* *********

10. spacer 2.22|1301703|25|NC_009484|CRT matches to NZ_CP026093 (Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.92

acccatcgcgcccgtggcgcccatc	CRISPR spacer
acccatcgcgcccatcgcgcccatc	Protospacer
*************.* *********

11. spacer 2.3|1300677|25|NC_009484|CRT matches to NZ_CP033971 (Cupriavidus pauculus strain FDAARGOS_614 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.88

acccatcgcgcccgtggcacccgtc	CRISPR spacer
acccatcgcgcccgtggcgcccacc	Protospacer
******************.***..*

12. spacer 2.3|1300677|25|NC_009484|CRT matches to MK967384 (Gordonia phage Sidious, complete genome) position: , mismatch: 3, identity: 0.88

acccatcgcgcccgtggcacccgtc	CRISPR spacer
ccccatcgcggtcgtggcacccgtc	Protospacer
 ********* .*************

13. spacer 2.4|1300722|25|NC_009484|CRT matches to NZ_CP033971 (Cupriavidus pauculus strain FDAARGOS_614 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.88

acccatcgcgcccgtggcacccgtc	CRISPR spacer
acccatcgcgcccgtggcgcccacc	Protospacer
******************.***..*

14. spacer 2.4|1300722|25|NC_009484|CRT matches to MK967384 (Gordonia phage Sidious, complete genome) position: , mismatch: 3, identity: 0.88

acccatcgcgcccgtggcacccgtc	CRISPR spacer
ccccatcgcggtcgtggcacccgtc	Protospacer
 ********* .*************

15. spacer 2.6|1300821|25|NC_009484|CRT matches to NZ_CP006368 (Aureimonas sp. AU20 plasmid pAU20a, complete sequence) position: , mismatch: 3, identity: 0.88

acccatcgcgccggtggcgcccgtg	CRISPR spacer
ccccatcgcgacggtggcgcccctg	Protospacer
 ********* *********** **

16. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP017784 (Rhodobacter sp. LPB0142 plasmid pEJ03, complete sequence) position: , mismatch: 3, identity: 0.88

tccggttgcgcccgtggcgccggtg	CRISPR spacer
tccggttgcgcccgtgacgccggac	Protospacer
****************.******

17. spacer 2.9|1300992|25|NC_009484|CRT matches to MT081181 (Uncultured bacterium plasmid pCu_H_1, complete sequence) position: , mismatch: 3, identity: 0.88

tccggttgcgcccgtggcgccggtg	CRISPR spacer
tccggttgcgcccgtgacgccggac	Protospacer
****************.******

18. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP049911 (Diaphorobacter sp. HDW4A plasmid p_unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tccggttgcgcccgtggcgccggtg	CRISPR spacer
tccggttgcgcccgtgacgccggac	Protospacer
****************.******

19. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP025470 (Klebsiella pneumoniae strain JS187 plasmid p187-4, complete sequence) position: , mismatch: 3, identity: 0.88

tccggttgcgcccgtggcgccggtg	CRISPR spacer
tccggttgcgcccgtgacgccggac	Protospacer
****************.******

20. spacer 2.9|1300992|25|NC_009484|CRT matches to NC_022078 (Klebsiella pneumoniae JM45 plasmid p1, complete sequence) position: , mismatch: 3, identity: 0.88

tccggttgcgcccgtggcgccggtg	CRISPR spacer
tccggttgcgcccgtgacgccggac	Protospacer
****************.******

21. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP027038 (Klebsiella pneumoniae strain 16_GR_13 plasmid IncAC2, complete sequence) position: , mismatch: 3, identity: 0.88

tccggttgcgcccgtggcgccggtg	CRISPR spacer
tccggttgcgcccgtgacgccggac	Protospacer
****************.******

22. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP027055 (Klebsiella pneumoniae strain 2_GR_12 plasmid IncAC2) position: , mismatch: 3, identity: 0.88

tccggttgcgcccgtggcgccggtg	CRISPR spacer
tccggttgcgcccgtgacgccggac	Protospacer
****************.******

23. spacer 2.9|1300992|25|NC_009484|CRT matches to CP052444 (Klebsiella pneumoniae strain C16KP0098 plasmid pC16KP0098-1, complete sequence) position: , mismatch: 3, identity: 0.88

tccggttgcgcccgtggcgccggtg	CRISPR spacer
tccggttgcgcccgtgacgccggac	Protospacer
****************.******

24. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP039991 (Pseudomonas aeruginosa strain T2101 plasmid pBT2101, complete sequence) position: , mismatch: 3, identity: 0.88

tccggttgcgcccgtggcgccggtg	CRISPR spacer
tccggttgcgcccgtgacgccggac	Protospacer
****************.******

25. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP039991 (Pseudomonas aeruginosa strain T2101 plasmid pBT2101, complete sequence) position: , mismatch: 3, identity: 0.88

tccggttgcgcccgtggcgccggtg	CRISPR spacer
tccggttgcgcccgtgacgccggac	Protospacer
****************.******

26. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP021071 (Mesorhizobium sp. WSM1497 plasmid pWSM1497, complete sequence) position: , mismatch: 3, identity: 0.88

tccggttgcgcccgtggcgccggtg	CRISPR spacer
cccggttgcgcccgtagcgccggtc	Protospacer
.**************.********

27. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP015063 (Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence) position: , mismatch: 3, identity: 0.88

tccggttgcgcccgtggcgccggtg	CRISPR spacer
cccggttgcgcccgtagcgccggtc	Protospacer
.**************.********

28. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP045917 (Pseudomonas aeruginosa strain CF39S plasmid pCF39S, complete sequence) position: , mismatch: 3, identity: 0.88

tccggttgcgcccgtggcgccggtg	CRISPR spacer
tccggttgcgcccgtgacgccggac	Protospacer
****************.******

29. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP028996 (Klebsiella pneumoniae strain AR_0079 plasmid unnamed5, complete sequence) position: , mismatch: 3, identity: 0.88

tccggttgcgcccgtggcgccggtg	CRISPR spacer
tccggttgcgcccgtgacgccggac	Protospacer
****************.******

30. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP010723 (Phaeobacter piscinae strain P18 plasmid pP18_h, complete sequence) position: , mismatch: 3, identity: 0.88

tccggttgcgcccgtggcgccggtg	CRISPR spacer
tccggttgcgcccgtgacgccggac	Protospacer
****************.******

31. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP017084 (Proteus mirabilis strain T21 plasmid pT212, complete sequence) position: , mismatch: 3, identity: 0.88

tccggttgcgcccgtggcgccggtg	CRISPR spacer
tccggttgcgcccgtgacgccggac	Protospacer
****************.******

32. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP040029 (Klebsiella pneumoniae strain KPC160121 plasmid pIncC-L121, complete sequence) position: , mismatch: 3, identity: 0.88

tccggttgcgcccgtggcgccggtg	CRISPR spacer
tccggttgcgcccgtgacgccggac	Protospacer
****************.******

33. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP031122 (Providencia sp. WCHPHu000369 strain WCHPr000369 plasmid pIMP69_000369, complete sequence) position: , mismatch: 3, identity: 0.88

tccggttgcgcccgtggcgccggtg	CRISPR spacer
tccggttgcgcccgtgacgccggac	Protospacer
****************.******

34. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP028920 (Gemmobacter sp. HYN0069 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.88

tccggttgcgcccgtggcgccggtg	CRISPR spacer
tccggttgcgcccgtgacgccggac	Protospacer
****************.******

35. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP011580 (Enterobacter hormaechei strain CAV1411 plasmid pKPC_CAV1411, complete sequence) position: , mismatch: 3, identity: 0.88

tccggttgcgcccgtggcgccggtg	CRISPR spacer
tccggttgcgcccgtgacgccggac	Protospacer
****************.******

36. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP038103 (Aeromonas salmonicida subsp. salmonicida strain SHY16-3432 plasmid pAsa5-3432, complete sequence) position: , mismatch: 3, identity: 0.88

tccggttgcgcccgtggcgccggtg	CRISPR spacer
tccggttgcgcccgtgacgccggac	Protospacer
****************.******

37. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP011649 (Enterobacter hormaechei strain CAV1669 plasmid pKPC_CAV1669, complete sequence) position: , mismatch: 3, identity: 0.88

tccggttgcgcccgtggcgccggtg	CRISPR spacer
tccggttgcgcccgtgacgccggac	Protospacer
****************.******

38. spacer 2.9|1300992|25|NC_009484|CRT matches to NC_016839 (Klebsiella pneumoniae subsp. pneumoniae HS11286 plasmid pKPHS3, complete sequence) position: , mismatch: 3, identity: 0.88

tccggttgcgcccgtggcgccggtg	CRISPR spacer
tccggttgcgcccgtgacgccggac	Protospacer
****************.******

39. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP027695 (Klebsiella pneumoniae strain KP30835 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.88

tccggttgcgcccgtggcgccggtg	CRISPR spacer
tccggttgcgcccgtgacgccggac	Protospacer
****************.******

40. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_MH917284 (Klebsiella pneumoniae strain 397108 plasmid p397108-Ct2, complete sequence) position: , mismatch: 3, identity: 0.88

tccggttgcgcccgtggcgccggtg	CRISPR spacer
tccggttgcgcccgtgacgccggac	Protospacer
****************.******

41. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_MF344574 (Enterobacter hormaechei strain T5282 plasmid pT5282-Ct2, complete sequence) position: , mismatch: 3, identity: 0.88

tccggttgcgcccgtggcgccggtg	CRISPR spacer
tccggttgcgcccgtgacgccggac	Protospacer
****************.******

42. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_MF150084 (Klebsiella pneumoniae strain A64477 plasmid pKP64477a, complete sequence) position: , mismatch: 3, identity: 0.88

tccggttgcgcccgtggcgccggtg	CRISPR spacer
tccggttgcgcccgtgacgccggac	Protospacer
****************.******

43. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_MF150118 (Proteus mirabilis strain A64421 plasmid pPM64421a, complete sequence) position: , mismatch: 3, identity: 0.88

tccggttgcgcccgtggcgccggtg	CRISPR spacer
tccggttgcgcccgtgacgccggac	Protospacer
****************.******

44. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP017783 (Rhodobacter sp. LPB0142 plasmid pEJ02, complete sequence) position: , mismatch: 3, identity: 0.88

tccggttgcgcccgtggcgccggtg	CRISPR spacer
tccggttgcgcccgtgacgccggac	Protospacer
****************.******

45. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_KX364409 (Aeromonas salmonicida subsp. salmonicida strain M16474-11 plasmid pAsa8, complete sequence) position: , mismatch: 3, identity: 0.88

tccggttgcgcccgtggcgccggtg	CRISPR spacer
tccggttgcgcccgtgacgccggac	Protospacer
****************.******

46. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP039989 (Pseudomonas aeruginosa strain T2436 plasmid pBT2436, complete sequence) position: , mismatch: 3, identity: 0.88

tccggttgcgcccgtggcgccggtg	CRISPR spacer
tccggttgcgcccgtgacgccggac	Protospacer
****************.******

47. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP030080 (Enterobacter hormaechei strain 20710 plasmid pIMP-20710, complete sequence) position: , mismatch: 3, identity: 0.88

tccggttgcgcccgtggcgccggtg	CRISPR spacer
tccggttgcgcccgtgacgccggac	Protospacer
****************.******

48. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP031802 (Klebsiella pneumoniae strain MSB1_8A-sc-2280397 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.88

tccggttgcgcccgtggcgccggtg	CRISPR spacer
tccggttgcgcccgtgacgccggac	Protospacer
****************.******

49. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP040034 (Klebsiella pneumoniae strain KPC160117 plasmid pIncC-L117, complete sequence) position: , mismatch: 3, identity: 0.88

tccggttgcgcccgtggcgccggtg	CRISPR spacer
tccggttgcgcccgtgacgccggac	Protospacer
****************.******

50. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP027043 (Klebsiella pneumoniae strain 1_GR_13 plasmid IncAC2, complete sequence) position: , mismatch: 3, identity: 0.88

tccggttgcgcccgtggcgccggtg	CRISPR spacer
tccggttgcgcccgtgacgccggac	Protospacer
****************.******

51. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP011571 (Enterobacter hormaechei strain CAV1311 plasmid pKPC_CAV1311, complete sequence) position: , mismatch: 3, identity: 0.88

tccggttgcgcccgtggcgccggtg	CRISPR spacer
tccggttgcgcccgtgacgccggac	Protospacer
****************.******

52. spacer 2.9|1300992|25|NC_009484|CRT matches to MG879028 (Uncultured bacterium plasmid pEG1-1, complete sequence) position: , mismatch: 3, identity: 0.88

tccggttgcgcccgtggcgccggtg	CRISPR spacer
tccggttgcgcccgtgacgccggac	Protospacer
****************.******

53. spacer 2.9|1300992|25|NC_009484|CRT matches to MN823999 (Klebsiella pneumoniae strain 362713 plasmid p362713-FIIK, complete sequence) position: , mismatch: 3, identity: 0.88

tccggttgcgcccgtggcgccggtg	CRISPR spacer
tccggttgcgcccgtgacgccggac	Protospacer
****************.******

54. spacer 2.9|1300992|25|NC_009484|CRT matches to MN842293 (Klebsiella pneumoniae strain 20130907-4 plasmid p309074-1FIIK, complete sequence) position: , mismatch: 3, identity: 0.88

tccggttgcgcccgtggcgccggtg	CRISPR spacer
tccggttgcgcccgtgacgccggac	Protospacer
****************.******

55. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP013115 (Shewanella xiamenensis strain T17 plasmid pSx1, complete sequence) position: , mismatch: 3, identity: 0.88

tccggttgcgcccgtggcgccggtg	CRISPR spacer
tccggttgcgcccgtgacgccggac	Protospacer
****************.******

56. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP011583 (Enterobacter hormaechei strain CAV1668 plasmid pCAV1668-85, complete sequence) position: , mismatch: 3, identity: 0.88

tccggttgcgcccgtggcgccggtg	CRISPR spacer
tccggttgcgcccgtgacgccggac	Protospacer
****************.******

57. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tccggttgcgcccgtggcgccggtg	CRISPR spacer
gccggttgcccccgtggcgccggtc	Protospacer
 ******** **************

58. spacer 2.9|1300992|25|NC_009484|CRT matches to MT011984 (Comamonas testosteroni strain NFYY023 plasmid pNFYY023-1, complete sequence) position: , mismatch: 3, identity: 0.88

tccggttgcgcccgtggcgccggtg	CRISPR spacer
tccggttgcgcccgtgacgccggac	Protospacer
****************.******

59. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP030132 (Klebsiella pneumoniae strain 160111 plasmid pIncAC2_L111, complete sequence) position: , mismatch: 3, identity: 0.88

tccggttgcgcccgtggcgccggtg	CRISPR spacer
tccggttgcgcccgtgacgccggac	Protospacer
****************.******

60. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_KY883660 (Pseudomonas putida strain SY153 plasmid pSY153-MDR, complete sequence) position: , mismatch: 3, identity: 0.88

tccggttgcgcccgtggcgccggtg	CRISPR spacer
tccggttgcgcccgtgacgccggac	Protospacer
****************.******

61. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 3, identity: 0.88

tccggttgcgcccgtggcgccggtg	CRISPR spacer
tccggttgcgccggttgcgccggtt	Protospacer
************ ** ********

62. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP032054 (Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence) position: , mismatch: 3, identity: 0.88

tccggttgcgcccgtggcgccggtg	CRISPR spacer
tccggttgcgccggttgcgccggtt	Protospacer
************ ** ********

63. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP032054 (Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence) position: , mismatch: 3, identity: 0.88

tccggttgcgcccgtggcgccggtg	CRISPR spacer
tccggttgcgccggttgcgccggtt	Protospacer
************ ** ********

64. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP016560 (Streptomyces clavuligerus strain F613-1 plasmid pSCL4, complete sequence) position: , mismatch: 3, identity: 0.88

tccggttgcgcccgtggcgccggtg	CRISPR spacer
tccggttgcgccggttgcgccggtt	Protospacer
************ ** ********

65. spacer 2.9|1300992|25|NC_009484|CRT matches to MN270887 (Pectobacterium phage CX5, complete genome) position: , mismatch: 3, identity: 0.88

tccggttgcgcccgtggcgccggtg	CRISPR spacer
tccggttgcgccagtggctccggta	Protospacer
************ ***** *****.

66. spacer 2.9|1300992|25|NC_009484|CRT matches to MN270888 (Pectobacterium phage CX5-1, complete genome) position: , mismatch: 3, identity: 0.88

tccggttgcgcccgtggcgccggtg	CRISPR spacer
tccggttgcgccagtggctccggta	Protospacer
************ ***** *****.

67. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP034331 (Tabrizicola piscis strain K13M18 plasmid unnamed3, complete sequence) position: , mismatch: 3, identity: 0.88

tccggttgcgcccgtggcgccggtg	CRISPR spacer
tccggttgctcccgtgacgccggag	Protospacer
********* ******.****** *

68. spacer 2.11|1301091|25|NC_009484|CRT matches to NZ_CP033971 (Cupriavidus pauculus strain FDAARGOS_614 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.88

acccgtcgcgcccgtggcacccgtc	CRISPR spacer
acccgtcgcacccgttgcacccgtt	Protospacer
*********.***** ********.

69. spacer 2.11|1301091|25|NC_009484|CRT matches to NZ_LR134459 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 17, complete sequence) position: , mismatch: 3, identity: 0.88

acccgtcgcgcccgtggcacccgtc	CRISPR spacer
gcccgtcgcgcccgtggcaccggac	Protospacer
.******************** * *

70. spacer 2.11|1301091|25|NC_009484|CRT matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 3, identity: 0.88

acccgtcgcgcccgtggcacccgtc	CRISPR spacer
acccgtcgcgcccgtggtaccggtg	Protospacer
*****************.*** **

71. spacer 2.11|1301091|25|NC_009484|CRT matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 3, identity: 0.88

acccgtcgcgcccgtggcacccgtc	CRISPR spacer
acccgtcgcgcccgtggtaccggtg	Protospacer
*****************.*** **

72. spacer 2.14|1301244|25|NC_009484|CRT matches to NZ_CP033971 (Cupriavidus pauculus strain FDAARGOS_614 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.88

acccgtcgcgcccgtggcgcctgtg	CRISPR spacer
accggtcgcgcccgttgcgcctgtc	Protospacer
*** *********** ********

73. spacer 2.14|1301244|25|NC_009484|CRT matches to NZ_CP015065 (Mesorhizobium ciceri biovar biserrulae strain WSM1284 plasmid pMc1284, complete sequence) position: , mismatch: 3, identity: 0.88

acccgtcgcgcccgtggcgcctgtg	CRISPR spacer
accggtcgcgcccgtggcacctgtc	Protospacer
*** **************.*****

74. spacer 2.14|1301244|25|NC_009484|CRT matches to MK686068 (Streptomyces phage RemusLoopin, complete genome) position: , mismatch: 3, identity: 0.88

acccgtcgcgcccgtggcgcctgtg	CRISPR spacer
acccgtcgcgcccgtggctccggtc	Protospacer
****************** ** **

75. spacer 2.14|1301244|25|NC_009484|CRT matches to NZ_CP017422 (Arthrobacter sp. ZXY-2 plasmid pZXY21, complete sequence) position: , mismatch: 3, identity: 0.88

acccgtcgcgcccgtggcgcctgtg	CRISPR spacer
atccgtcgcgcccctggcgcctgcg	Protospacer
*.*********** *********.*

76. spacer 2.21|1301658|25|NC_009484|CRT matches to NZ_CP033971 (Cupriavidus pauculus strain FDAARGOS_614 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.88

acccgtcgcgcccgtggcgcctgtg	CRISPR spacer
accggtcgcgcccgttgcgcctgtc	Protospacer
*** *********** ********

77. spacer 2.21|1301658|25|NC_009484|CRT matches to NZ_CP015065 (Mesorhizobium ciceri biovar biserrulae strain WSM1284 plasmid pMc1284, complete sequence) position: , mismatch: 3, identity: 0.88

acccgtcgcgcccgtggcgcctgtg	CRISPR spacer
accggtcgcgcccgtggcacctgtc	Protospacer
*** **************.*****

78. spacer 2.21|1301658|25|NC_009484|CRT matches to MK686068 (Streptomyces phage RemusLoopin, complete genome) position: , mismatch: 3, identity: 0.88

acccgtcgcgcccgtggcgcctgtg	CRISPR spacer
acccgtcgcgcccgtggctccggtc	Protospacer
****************** ** **

79. spacer 2.21|1301658|25|NC_009484|CRT matches to NZ_CP017422 (Arthrobacter sp. ZXY-2 plasmid pZXY21, complete sequence) position: , mismatch: 3, identity: 0.88

acccgtcgcgcccgtggcgcctgtg	CRISPR spacer
atccgtcgcgcccctggcgcctgcg	Protospacer
*.*********** *********.*

80. spacer 2.22|1301703|25|NC_009484|CRT matches to NZ_CP026091 (Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

acccatcgcgcccgtggcgcccatc	CRISPR spacer
gcccatcgcgcccatcgcgcccatc	Protospacer
.************.* *********

81. spacer 2.22|1301703|25|NC_009484|CRT matches to NC_016037 (Komagataeibacter medellinensis NBRC 3288 plasmid pGXY010, complete sequence) position: , mismatch: 3, identity: 0.88

acccatcgcgcccgtggcgcccatc	CRISPR spacer
accaaccgcgcccgtggcgcccatg	Protospacer
*** *.******************

82. spacer 2.22|1301703|25|NC_009484|CRT matches to NZ_CP010857 (Marinovum algicola DG 898 plasmid pMaD2, complete sequence) position: , mismatch: 3, identity: 0.88

acccatcgcgcccgtggcgcccatc	CRISPR spacer
acccatcgcgcccgtggcggcgacc	Protospacer
******************* * *.*

83. spacer 2.29|1302162|25|NC_009484|CRT matches to NC_008757 (Polaromonas naphthalenivorans CJ2 plasmid pPNAP01, complete sequence) position: , mismatch: 3, identity: 0.88

gcccgtcgcgcccgtggcgcctgtg	CRISPR spacer
gcctgtcgcgcccgtggcgcccgcg	Protospacer
***.*****************.*.*

84. spacer 2.29|1302162|25|NC_009484|CRT matches to AJ006589 (Bacteriophage phi-C31 complete genome) position: , mismatch: 3, identity: 0.88

gcccgtcgcgcccgtggcgcctgtg	CRISPR spacer
gcccgtcgcgcccgtgtcgcccttg	Protospacer
**************** ****. **

85. spacer 2.29|1302162|25|NC_009484|CRT matches to KP790011 (Gordonia phage Gsput1, complete genome) position: , mismatch: 3, identity: 0.88

gcccgtcgcgcccgtggcgcctgtg	CRISPR spacer
gcccgtcgcgcccgtagcgcccatg	Protospacer
***************.*****..**

86. spacer 2.29|1302162|25|NC_009484|CRT matches to Z99661 (Bacteriophage phi-C31 late region gene 49) position: , mismatch: 3, identity: 0.88

gcccgtcgcgcccgtggcgcctgtg	CRISPR spacer
gcccgtcgcgcccgtgtcgcccttg	Protospacer
**************** ****. **

87. spacer 2.3|1300677|25|NC_009484|CRT matches to MN428048 (Gordonia phage DobbysSock, complete genome) position: , mismatch: 4, identity: 0.84

acccatcgcgcccgtggcacccgtc	CRISPR spacer
acccagcgcgcccgcggcacccgaa	Protospacer
***** ********.********

88. spacer 2.4|1300722|25|NC_009484|CRT matches to MN428048 (Gordonia phage DobbysSock, complete genome) position: , mismatch: 4, identity: 0.84

acccatcgcgcccgtggcacccgtc	CRISPR spacer
acccagcgcgcccgcggcacccgaa	Protospacer
***** ********.********

89. spacer 2.6|1300821|25|NC_009484|CRT matches to NZ_CP033971 (Cupriavidus pauculus strain FDAARGOS_614 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.84

acccatcgcgccggtggcgcccgtg	CRISPR spacer
acccatcgcgcccgtggcgcccacc	Protospacer
************ *********..

90. spacer 2.6|1300821|25|NC_009484|CRT matches to MK801727 (Gordonia phage ThankyouJordi, complete genome) position: , mismatch: 4, identity: 0.84

acccatcgcgccggtggcgcccgtg	CRISPR spacer
gcccatcgcgccggtcgcgccggtc	Protospacer
.************** ***** **

91. spacer 2.6|1300821|25|NC_009484|CRT matches to MT723938 (Gordonia phage Bunnybear, complete genome) position: , mismatch: 4, identity: 0.84

acccatcgcgccggtggcgcccgtg	CRISPR spacer
gcccatcgcgccggtcgcgccggtc	Protospacer
.************** ***** **

92. spacer 2.6|1300821|25|NC_009484|CRT matches to MK875793 (Gordonia phage WelcomeAyanna, complete genome) position: , mismatch: 4, identity: 0.84

acccatcgcgccggtggcgcccgtg	CRISPR spacer
gcccatcgcgccggtcgcgccggtc	Protospacer
.************** ***** **

93. spacer 2.6|1300821|25|NC_009484|CRT matches to NC_010510 (Methylobacterium radiotolerans JCM 2831 plasmid pMRAD01, complete sequence) position: , mismatch: 4, identity: 0.84

acccatcgcgccggtggcgcccgtg	CRISPR spacer
tcctatcgcgcctgtggcgcccgtc	Protospacer
 **.******** ***********

94. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP021071 (Mesorhizobium sp. WSM1497 plasmid pWSM1497, complete sequence) position: , mismatch: 4, identity: 0.84

tccggttgcgcccgtggcgccggtg	CRISPR spacer
accggttgcacctgtggcgccggtc	Protospacer
 ********.**.***********

95. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP021071 (Mesorhizobium sp. WSM1497 plasmid pWSM1497, complete sequence) position: , mismatch: 4, identity: 0.84

tccggttgcgcccgtggcgccggtg	CRISPR spacer
accggttgctcctgtggcgccggtc	Protospacer
 ******** **.***********

96. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP021071 (Mesorhizobium sp. WSM1497 plasmid pWSM1497, complete sequence) position: , mismatch: 4, identity: 0.84

tccggttgcgcccgtggcgccggtg	CRISPR spacer
accggttgctcctgtggcgccggtc	Protospacer
 ******** **.***********

97. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP021071 (Mesorhizobium sp. WSM1497 plasmid pWSM1497, complete sequence) position: , mismatch: 4, identity: 0.84

tccggttgcgcccgtggcgccggtg	CRISPR spacer
accggttgctcctgtggcgccggtc	Protospacer
 ******** **.***********

98. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP021071 (Mesorhizobium sp. WSM1497 plasmid pWSM1497, complete sequence) position: , mismatch: 4, identity: 0.84

tccggttgcgcccgtggcgccggtg	CRISPR spacer
accggttgcacctgtggcgccggtc	Protospacer
 ********.**.***********

99. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP021071 (Mesorhizobium sp. WSM1497 plasmid pWSM1497, complete sequence) position: , mismatch: 4, identity: 0.84

tccggttgcgcccgtggcgccggtg	CRISPR spacer
accggttgctcctgtggcgccggtc	Protospacer
 ******** **.***********

100. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP015063 (Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence) position: , mismatch: 4, identity: 0.84

tccggttgcgcccgtggcgccggtg	CRISPR spacer
accggttgcacctgtggcgccggtc	Protospacer
 ********.**.***********

101. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP015063 (Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence) position: , mismatch: 4, identity: 0.84

tccggttgcgcccgtggcgccggtg	CRISPR spacer
accggttgcacctgtggcgccggtc	Protospacer
 ********.**.***********

102. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP015063 (Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence) position: , mismatch: 4, identity: 0.84

tccggttgcgcccgtggcgccggtg	CRISPR spacer
accggttgcacctgtggcgccggtc	Protospacer
 ********.**.***********

103. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP015063 (Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence) position: , mismatch: 4, identity: 0.84

tccggttgcgcccgtggcgccggtg	CRISPR spacer
accggttgcacctgtggcgccggtc	Protospacer
 ********.**.***********

104. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP015063 (Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence) position: , mismatch: 4, identity: 0.84

tccggttgcgcccgtggcgccggtg	CRISPR spacer
accggttgcacctgtggcgccggtc	Protospacer
 ********.**.***********

105. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP015063 (Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence) position: , mismatch: 4, identity: 0.84

tccggttgcgcccgtggcgccggtg	CRISPR spacer
accggttgcacctgtggcgccggtc	Protospacer
 ********.**.***********

106. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP015063 (Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence) position: , mismatch: 4, identity: 0.84

tccggttgcgcccgtggcgccggtg	CRISPR spacer
accggttgcacctgtggcgccggtc	Protospacer
 ********.**.***********

107. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP015063 (Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence) position: , mismatch: 4, identity: 0.84

tccggttgcgcccgtggcgccggtg	CRISPR spacer
accggttgcacctgtggcgccggtc	Protospacer
 ********.**.***********

108. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP015063 (Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence) position: , mismatch: 4, identity: 0.84

tccggttgcgcccgtggcgccggtg	CRISPR spacer
gccggttgcacctgtggcgccggtc	Protospacer
 ********.**.***********

109. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP015063 (Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence) position: , mismatch: 4, identity: 0.84

tccggttgcgcccgtggcgccggtg	CRISPR spacer
gccggttgcacctgtggcgccggtc	Protospacer
 ********.**.***********

110. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP015063 (Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence) position: , mismatch: 4, identity: 0.84

tccggttgcgcccgtggcgccggtg	CRISPR spacer
accggttgcacctgtggcgccggtc	Protospacer
 ********.**.***********

111. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP015063 (Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence) position: , mismatch: 4, identity: 0.84

tccggttgcgcccgtggcgccggtg	CRISPR spacer
accggttgctcctgtggcgccggtc	Protospacer
 ******** **.***********

112. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

tccggttgcgcccgtggcgccggtg	CRISPR spacer
cccggtggcacccgtggcgccggtc	Protospacer
.***** **.**************

113. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

tccggttgcgcccgtggcgccggtg	CRISPR spacer
acccgttgcgcctgtggcgccggtc	Protospacer
 ** ********.***********

114. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 4, identity: 0.84

tccggttgcgcccgtggcgccggtg	CRISPR spacer
ccaggttgcgcccgtggcgccgctt	Protospacer
.* ******************* *

115. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP021763 (Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

tccggttgcgcccgtggcgccggtg	CRISPR spacer
gccggttgcgccgggggcgccggtt	Protospacer
 *********** * *********

116. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP015065 (Mesorhizobium ciceri biovar biserrulae strain WSM1284 plasmid pMc1284, complete sequence) position: , mismatch: 4, identity: 0.84

tccggttgcgcccgtggcgccggtg	CRISPR spacer
accggttgctcctgtggcgccggtc	Protospacer
 ******** **.***********

117. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP015065 (Mesorhizobium ciceri biovar biserrulae strain WSM1284 plasmid pMc1284, complete sequence) position: , mismatch: 4, identity: 0.84

tccggttgcgcccgtggcgccggtg	CRISPR spacer
accggttgcacctgtggcgccggtc	Protospacer
 ********.**.***********

118. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP015065 (Mesorhizobium ciceri biovar biserrulae strain WSM1284 plasmid pMc1284, complete sequence) position: , mismatch: 4, identity: 0.84

tccggttgcgcccgtggcgccggtg	CRISPR spacer
accggttgctcctgtggcgccggtc	Protospacer
 ******** **.***********

119. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP015065 (Mesorhizobium ciceri biovar biserrulae strain WSM1284 plasmid pMc1284, complete sequence) position: , mismatch: 4, identity: 0.84

tccggttgcgcccgtggcgccggtg	CRISPR spacer
accggttgcacctgtggcgccggtc	Protospacer
 ********.**.***********

120. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 4, identity: 0.84

tccggttgcgcccgtggcgccggtg	CRISPR spacer
gccggtggcgcccgtggctccggta	Protospacer
 ***** *********** *****.

121. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP052069 (Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.84

tccggttgcgcccgtggcgccggtg	CRISPR spacer
gccggttgcgccgggggcgccggtt	Protospacer
 *********** * *********

122. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP052085 (Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.84

tccggttgcgcccgtggcgccggtg	CRISPR spacer
gccggttgcgccgggggcgccggtt	Protospacer
 *********** * *********

123. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP021765 (Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

tccggttgcgcccgtggcgccggtg	CRISPR spacer
gccggttgcgccgggggcgccggtt	Protospacer
 *********** * *********

124. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP052087 (Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.84

tccggttgcgcccgtggcgccggtg	CRISPR spacer
gccggttgcgccgggggcgccggtt	Protospacer
 *********** * *********

125. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP052127 (Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.84

tccggttgcgcccgtggcgccggtg	CRISPR spacer
gccggttgcgccgggggcgccggtt	Protospacer
 *********** * *********

126. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP052089 (Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.84

tccggttgcgcccgtggcgccggtg	CRISPR spacer
gccggttgcgccgggggcgccggtt	Protospacer
 *********** * *********

127. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP052131 (Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.84

tccggttgcgcccgtggcgccggtg	CRISPR spacer
gccggttgcgccgggggcgccggtt	Protospacer
 *********** * *********

128. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP016613 (Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

tccggttgcgcccgtggcgccggtg	CRISPR spacer
gccggttgcgccgggggcgccggtt	Protospacer
 *********** * *********

129. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP042825 (Rhizobium sp. WL3 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.84

tccggttgcgcccgtggcgccggtg	CRISPR spacer
atcggctgcgcccgtggcgccggag	Protospacer
 .***.***************** *

130. spacer 2.9|1300992|25|NC_009484|CRT matches to NC_016626 (Burkholderia sp. YI23 plasmid byi_1p, complete sequence) position: , mismatch: 4, identity: 0.84

tccggttgcgcccgtggcgccggtg	CRISPR spacer
atcggttgcggccgtgtcgccggtg	Protospacer
 .******** ***** ********

131. spacer 2.9|1300992|25|NC_009484|CRT matches to NC_019957 (Mycobacterium sp. JS623 plasmid pMYCSM01, complete sequence) position: , mismatch: 4, identity: 0.84

tccggttgcgcccgtggcgccggtg	CRISPR spacer
gccggtgccgcccgtggcgccggtc	Protospacer
 *****  ****************

132. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_LR026982 (Rhodoplanes piscinae isolate Rhod_plasmid plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.84

tccggttgcgcccgtggcgccggtg	CRISPR spacer
gccggtggcgcccgcggcgccggtc	Protospacer
 ***** *******.*********

133. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP052111 (Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.84

tccggttgcgcccgtggcgccggtg	CRISPR spacer
gccggttgcgccgggggcgccggtt	Protospacer
 *********** * *********

134. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP052113 (Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.84

tccggttgcgcccgtggcgccggtg	CRISPR spacer
gccggttgcgccgggggcgccggtt	Protospacer
 *********** * *********

135. spacer 2.9|1300992|25|NC_009484|CRT matches to LN997843 (Streptomyces reticuli genome assembly TUE45, plasmid : II) position: , mismatch: 4, identity: 0.84

tccggttgcgcccgtggcgccggtg	CRISPR spacer
cccggctgagcccgtggcgccggtc	Protospacer
.****.** ***************

136. spacer 2.9|1300992|25|NC_009484|CRT matches to MN694114 (Marine virus AFVG_250M252, complete genome) position: , mismatch: 4, identity: 0.84

tccggttgcgcccgtggcgccggtg	CRISPR spacer
gccggttgctcccgttgcgccggtt	Protospacer
 ******** ***** ********

137. spacer 2.11|1301091|25|NC_009484|CRT matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

acccgtcgcgcccgtggcacccgtc	CRISPR spacer
gcccgtcgcgcccgtggcacccacg	Protospacer
.*********************..

138. spacer 2.11|1301091|25|NC_009484|CRT matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

acccgtcgcgcccgtggcacccgtc	CRISPR spacer
gcccgtggcgccagtggcacccgta	Protospacer
.***** ***** ***********

139. spacer 2.11|1301091|25|NC_009484|CRT matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

acccgtcgcgcccgtggcacccgtc	CRISPR spacer
gccggtcgcgcctgtggcacccgtg	Protospacer
.** ********.***********

140. spacer 2.11|1301091|25|NC_009484|CRT matches to NZ_CP042264 (Litoreibacter sp. LN3S51 plasmid unnamed3, complete sequence) position: , mismatch: 4, identity: 0.84

acccgtcgcgcccgtggcacccgtc	CRISPR spacer
ccccgtcgcgcccgaggcacccgag	Protospacer
 ************* ********

141. spacer 2.11|1301091|25|NC_009484|CRT matches to NZ_CP033971 (Cupriavidus pauculus strain FDAARGOS_614 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.84

acccgtcgcgcccgtggcacccgtc	CRISPR spacer
gcccgtcgcacccgtcgcacccgtt	Protospacer
.********.***** ********.

142. spacer 2.11|1301091|25|NC_009484|CRT matches to NZ_CP031079 (Paracoccus yeei strain CCUG 32053 plasmid pYEE1, complete sequence) position: , mismatch: 4, identity: 0.84

acccgtcgcgcccgtggcacccgtc	CRISPR spacer
cgccgtcgcgcccgtcgcgcccgtc	Protospacer
  ************* **.******

143. spacer 2.11|1301091|25|NC_009484|CRT matches to NZ_CP029232 (Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence) position: , mismatch: 4, identity: 0.84

acccgtcgcgcccgtggcacccgtc	CRISPR spacer
ctccgtcgcgcccttggcacccatc	Protospacer
 .*********** ********.**

144. spacer 2.11|1301091|25|NC_009484|CRT matches to NZ_AP014705 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence) position: , mismatch: 4, identity: 0.84

acccgtcgcgcccgtggcacccgtc	CRISPR spacer
accggtcgcgcccgtggtacccgcg	Protospacer
*** *************.*****.

145. spacer 2.11|1301091|25|NC_009484|CRT matches to NZ_AP022319 (Burkholderia sp. THE68 plasmid BTHE68_p1, complete sequence) position: , mismatch: 4, identity: 0.84

acccgtcgcgcccgtggcacccgtc	CRISPR spacer
gaccgtcgcgccggtgccacccgtc	Protospacer
. ********** *** ********

146. spacer 2.14|1301244|25|NC_009484|CRT matches to NZ_AP014803 (Rhodovulum sulfidophilum plasmid Plasmid3 DNA, complete genome, strain: DSM 2351) position: , mismatch: 4, identity: 0.84

acccgtcgcgcccgtggcgcctgtg	CRISPR spacer
acccgtcgcgcccgagccgcctgca	Protospacer
************** * ******..

147. spacer 2.14|1301244|25|NC_009484|CRT matches to MK450426 (Streptomyces phage Euratis, complete genome) position: , mismatch: 4, identity: 0.84

acccgtcgcgcccgtggcgcctgtg	CRISPR spacer
acccgtcgcgcccgtgtcgcccttc	Protospacer
**************** ****. *

148. spacer 2.17|1301415|25|NC_009484|CRT matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 4, identity: 0.84

gcctgtggcacccatcgcgccggtg	CRISPR spacer
gcctgtgccacccatcgcgtcggca	Protospacer
******* ***********.***..

149. spacer 2.17|1301415|25|NC_009484|CRT matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 4, identity: 0.84

gcctgtggcacccatcgcgccggtg	CRISPR spacer
gcctgtgccacccatcgcgtcggca	Protospacer
******* ***********.***..

150. spacer 2.21|1301658|25|NC_009484|CRT matches to NZ_AP014803 (Rhodovulum sulfidophilum plasmid Plasmid3 DNA, complete genome, strain: DSM 2351) position: , mismatch: 4, identity: 0.84

acccgtcgcgcccgtggcgcctgtg	CRISPR spacer
acccgtcgcgcccgagccgcctgca	Protospacer
************** * ******..

151. spacer 2.21|1301658|25|NC_009484|CRT matches to MK450426 (Streptomyces phage Euratis, complete genome) position: , mismatch: 4, identity: 0.84

acccgtcgcgcccgtggcgcctgtg	CRISPR spacer
acccgtcgcgcccgtgtcgcccttc	Protospacer
**************** ****. *

152. spacer 2.22|1301703|25|NC_009484|CRT matches to NC_016623 (Azospirillum lipoferum 4B plasmid AZO_p3, complete sequence) position: , mismatch: 4, identity: 0.84

acccatcgcgcccgtggcgcccatc	CRISPR spacer
ctccaccgcgcccttggcgcccatc	Protospacer
 .***.******* ***********

153. spacer 2.22|1301703|25|NC_009484|CRT matches to NZ_CP006370 (Aureimonas sp. AU20 plasmid pAU20c, complete sequence) position: , mismatch: 4, identity: 0.84

acccatcgcgcccgtggcgcccatc	CRISPR spacer
ctccaccgcgcccttggcgcccatc	Protospacer
 .***.******* ***********

154. spacer 2.22|1301703|25|NC_009484|CRT matches to NZ_CP033873 (Caulobacter sp. FWC26 plasmid p1, complete sequence) position: , mismatch: 4, identity: 0.84

acccatcgcgcccgtggcgcccatc	CRISPR spacer
ctccaccgcgcccttggcgcccatc	Protospacer
 .***.******* ***********

155. spacer 2.22|1301703|25|NC_009484|CRT matches to NZ_CP023068 (Ensifer sojae CCBAU 05684 plasmid pSJ05684b, complete sequence) position: , mismatch: 4, identity: 0.84

acccatcgcgcccgtggcgcccatc	CRISPR spacer
taccatcgcggccgtggcgcgcatc	Protospacer
  ******** ********* ****

156. spacer 2.22|1301703|25|NC_009484|CRT matches to NZ_CP054616 (Azospirillum oryzae strain KACC 14407 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.84

acccatcgcgcccgtggcgcccatc	CRISPR spacer
ttccaccgcgcccttggcgcccatc	Protospacer
 .***.******* ***********

157. spacer 2.22|1301703|25|NC_009484|CRT matches to KP790011 (Gordonia phage Gsput1, complete genome) position: , mismatch: 4, identity: 0.84

acccatcgcgcccgtggcgcccatc	CRISPR spacer
gcccgtcgcgcccgtagcgcccatg	Protospacer
.***.**********.********

158. spacer 2.29|1302162|25|NC_009484|CRT matches to NZ_CP033971 (Cupriavidus pauculus strain FDAARGOS_614 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.84

gcccgtcgcgcccgtggcgcctgtg	CRISPR spacer
accggtcgcgcccgttgcgcctgtc	Protospacer
.** *********** ********

159. spacer 2.29|1302162|25|NC_009484|CRT matches to NZ_LR134459 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 17, complete sequence) position: , mismatch: 4, identity: 0.84

gcccgtcgcgcccgtggcgcctgtg	CRISPR spacer
gcccgtcgcgcccgtggcaccggac	Protospacer
******************.** *

160. spacer 2.29|1302162|25|NC_009484|CRT matches to NZ_CP015065 (Mesorhizobium ciceri biovar biserrulae strain WSM1284 plasmid pMc1284, complete sequence) position: , mismatch: 4, identity: 0.84

gcccgtcgcgcccgtggcgcctgtg	CRISPR spacer
accggtcgcgcccgtggcacctgtc	Protospacer
.** **************.*****

161. spacer 2.29|1302162|25|NC_009484|CRT matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 4, identity: 0.84

gcccgtcgcgcccgtggcgcctgtg	CRISPR spacer
gcccgtggcgcccgtggcgccggac	Protospacer
****** ************** *

162. spacer 2.29|1302162|25|NC_009484|CRT matches to NZ_CP017422 (Arthrobacter sp. ZXY-2 plasmid pZXY21, complete sequence) position: , mismatch: 4, identity: 0.84

gcccgtcgcgcccgtggcgcctgtg	CRISPR spacer
atccgtcgcgcccctggcgcctgcg	Protospacer
..*********** *********.*

163. spacer 2.29|1302162|25|NC_009484|CRT matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

gcccgtcgcgcccgtggcgcctgtg	CRISPR spacer
gcccgtcgcgcccgtggcacccacg	Protospacer
******************.**...*

164. spacer 2.29|1302162|25|NC_009484|CRT matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

gcccgtcgcgcccgtggcgcctgtg	CRISPR spacer
gcccgtggcgcccgtggcgcccggc	Protospacer
****** **************.*

165. spacer 2.29|1302162|25|NC_009484|CRT matches to MK686068 (Streptomyces phage RemusLoopin, complete genome) position: , mismatch: 4, identity: 0.84

gcccgtcgcgcccgtggcgcctgtg	CRISPR spacer
acccgtcgcgcccgtggctccggtc	Protospacer
.***************** ** **

166. spacer 2.3|1300677|25|NC_009484|CRT matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.8

acccatcgcgcccgtggcacccgtc	CRISPR spacer
gcccgtcgcgcccgtggcacccacg	Protospacer
.***.*****************..

167. spacer 2.4|1300722|25|NC_009484|CRT matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.8

acccatcgcgcccgtggcacccgtc	CRISPR spacer
gcccgtcgcgcccgtggcacccacg	Protospacer
.***.*****************..

168. spacer 2.6|1300821|25|NC_009484|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 5, identity: 0.8

acccatcgcgccggtggcgcccgtg	CRISPR spacer
acccatctcgccggtggcgccgcaa	Protospacer
******* *************   .

169. spacer 2.9|1300992|25|NC_009484|CRT matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 5, identity: 0.8

tccggttgcgcccgtggcgccggtg	CRISPR spacer
accggtggcgcccgtggcgccgcct	Protospacer
 ***** *************** .

170. spacer 2.13|1301190|34|NC_009484|CRT matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 5, identity: 0.853

acccgtcgcacccgtcgcgcccgtggcacccatc	CRISPR spacer
gcccgtcgcacccgtcgcgcccgtggtaccggtg	Protospacer
.*************************.*** .*

171. spacer 2.13|1301190|34|NC_009484|CRT matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 5, identity: 0.853

acccgtcgcacccgtcgcgcccgtggcacccatc	CRISPR spacer
gcccgtcgcacccgtcgcgcccgtggtaccggtg	Protospacer
.*************************.*** .*

172. spacer 2.13|1301190|34|NC_009484|CRT matches to NZ_CP033971 (Cupriavidus pauculus strain FDAARGOS_614 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.853

acccgtcgcacccgtcgcgcccgtggcacccatc	CRISPR spacer
gcccgtcgcacccgtcgcacccgttgcacccgtt	Protospacer
.*****************.***** ******.*.

173. spacer 2.14|1301244|25|NC_009484|CRT matches to NZ_CP033971 (Cupriavidus pauculus strain FDAARGOS_614 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.8

acccgtcgcgcccgtggcgcctgtg	CRISPR spacer
acccatcgcgcccgtggcgcccacc	Protospacer
****.****************...

174. spacer 2.21|1301658|25|NC_009484|CRT matches to NZ_CP033971 (Cupriavidus pauculus strain FDAARGOS_614 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.8

acccgtcgcgcccgtggcgcctgtg	CRISPR spacer
acccatcgcgcccgtggcgcccacc	Protospacer
****.****************...

175. spacer 2.22|1301703|25|NC_009484|CRT matches to NZ_KM017071 (Sphingomonas sp. JE1 plasmid pJE1, complete sequence) position: , mismatch: 5, identity: 0.8

acccatcgcgcccgtggcgcccatc	CRISPR spacer
ctggatcgcgcccgtggcgccgatc	Protospacer
 .  ***************** ***

176. spacer 2.22|1301703|25|NC_009484|CRT matches to NZ_CP010858 (Marinovum algicola DG 898 plasmid pMaD3) position: , mismatch: 5, identity: 0.8

acccatcgcgcccgtggcgcccatc	CRISPR spacer
cttgatcgcgcccttggcgcccatc	Protospacer
 .. ********* ***********

177. spacer 2.29|1302162|25|NC_009484|CRT matches to NZ_LR134469 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 27, complete sequence) position: , mismatch: 5, identity: 0.8

gcccgtcgcgcccgtggcgcctgtg	CRISPR spacer
gcccgtcgcgcccgcggcgccgcga	Protospacer
**************.******   .

178. spacer 2.3|1300677|25|NC_009484|CRT matches to NZ_CP045385 (Ruegeria sp. THAF33 plasmid pTHAF33_a, complete sequence) position: , mismatch: 6, identity: 0.76

acccatcgcgcccgtggcacccgtc	CRISPR spacer
acccatcgcgcccgtggcaaatact	Protospacer
*******************  ....

179. spacer 2.4|1300722|25|NC_009484|CRT matches to NZ_CP045385 (Ruegeria sp. THAF33 plasmid pTHAF33_a, complete sequence) position: , mismatch: 6, identity: 0.76

acccatcgcgcccgtggcacccgtc	CRISPR spacer
acccatcgcgcccgtggcaaatact	Protospacer
*******************  ....

180. spacer 2.1|1300560|34|NC_009484|CRT matches to NC_015952 (Streptomyces violaceusniger Tu 4113 plasmid pSTRVI02, complete sequence) position: , mismatch: 7, identity: 0.794

acccgt-cgcgccggtggctccggttgcgcccgtg	CRISPR spacer
-cacgtccgcgccggtcgctccggtcgcgccgccg	Protospacer
 * *** ********* ********.*****  .*

181. spacer 2.28|1302108|34|NC_009484|CRT matches to MN116494 (Klebsiella phage vB_KpnP_Bp5, complete genome) position: , mismatch: 7, identity: 0.794

gcccgtggctccagttgcgccggtggcgcccgtg	CRISPR spacer
tccagcagctccagttgcgccagtggctcccgcg	Protospacer
 ** *..**************.***** ****.*

182. spacer 2.5|1300767|34|NC_009484|CRT matches to NZ_LR134450 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 8, complete sequence) position: , mismatch: 8, identity: 0.765

tccggttgcgcccgtggcacccgttgcgccggtg	CRISPR spacer
cgccggtgcgcccgaggcacccggtgcgccggcc	Protospacer
. * * ******** ******** ********.

183. spacer 2.7|1300866|34|NC_009484|CRT matches to NC_004771 (Pasteurella multocida plasmid pJR1, complete sequence) position: , mismatch: 8, identity: 0.765

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
agctacggctccggttgcgcccgtgacgccggag	Protospacer
  * ..*******************.* **** *

184. spacer 2.7|1300866|34|NC_009484|CRT matches to NZ_AP022611 (Mycolicibacterium madagascariense strain JCM 13574 plasmid pJCM13574) position: , mismatch: 8, identity: 0.765

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
ggcgacgtcgccggttacgcccgtggcgccggtg	Protospacer
  **..* * ******.********** ******

185. spacer 2.13|1301190|34|NC_009484|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 8, identity: 0.765

acccgtcgcacccgtcgcgcccgtggcacccatc	CRISPR spacer
gcgcgtcgcacccgacgcgcccgtcgccgcggtc	Protospacer
.* *********** ********* **  * .**

186. spacer 2.15|1301289|34|NC_009484|CRT matches to NC_004771 (Pasteurella multocida plasmid pJR1, complete sequence) position: , mismatch: 8, identity: 0.765

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
agctacggctccggttgcgcccgtgacgccggag	Protospacer
  * ..*******************.* **** *

187. spacer 2.15|1301289|34|NC_009484|CRT matches to NZ_AP022611 (Mycolicibacterium madagascariense strain JCM 13574 plasmid pJCM13574) position: , mismatch: 8, identity: 0.765

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
ggcgacgtcgccggttacgcccgtggcgccggtg	Protospacer
  **..* * ******.********** ******

188. spacer 2.5|1300767|34|NC_009484|CRT matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 9, identity: 0.735

tccggttgcgcccgtggcacccgttgcgccggtg	CRISPR spacer
ggcgcaggcgcccgtggcgcccgtggcgccggac	Protospacer
  **   ***********.***** *******

189. spacer 2.7|1300866|34|NC_009484|CRT matches to NZ_CP017783 (Rhodobacter sp. LPB0142 plasmid pEJ02, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

190. spacer 2.7|1300866|34|NC_009484|CRT matches to NZ_CP017784 (Rhodobacter sp. LPB0142 plasmid pEJ03, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

191. spacer 2.7|1300866|34|NC_009484|CRT matches to NZ_KX364409 (Aeromonas salmonicida subsp. salmonicida strain M16474-11 plasmid pAsa8, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

192. spacer 2.7|1300866|34|NC_009484|CRT matches to MT081181 (Uncultured bacterium plasmid pCu_H_1, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

193. spacer 2.7|1300866|34|NC_009484|CRT matches to NZ_CP049911 (Diaphorobacter sp. HDW4A plasmid p_unnamed1, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

194. spacer 2.7|1300866|34|NC_009484|CRT matches to NZ_CP025470 (Klebsiella pneumoniae strain JS187 plasmid p187-4, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

195. spacer 2.7|1300866|34|NC_009484|CRT matches to NC_022078 (Klebsiella pneumoniae JM45 plasmid p1, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

196. spacer 2.7|1300866|34|NC_009484|CRT matches to NZ_CP039989 (Pseudomonas aeruginosa strain T2436 plasmid pBT2436, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

197. spacer 2.7|1300866|34|NC_009484|CRT matches to NZ_CP027038 (Klebsiella pneumoniae strain 16_GR_13 plasmid IncAC2, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

198. spacer 2.7|1300866|34|NC_009484|CRT matches to NZ_CP027055 (Klebsiella pneumoniae strain 2_GR_12 plasmid IncAC2) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

199. spacer 2.7|1300866|34|NC_009484|CRT matches to CP052444 (Klebsiella pneumoniae strain C16KP0098 plasmid pC16KP0098-1, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

200. spacer 2.7|1300866|34|NC_009484|CRT matches to NZ_CP030080 (Enterobacter hormaechei strain 20710 plasmid pIMP-20710, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

201. spacer 2.7|1300866|34|NC_009484|CRT matches to NZ_CP039991 (Pseudomonas aeruginosa strain T2101 plasmid pBT2101, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

202. spacer 2.7|1300866|34|NC_009484|CRT matches to NZ_CP039991 (Pseudomonas aeruginosa strain T2101 plasmid pBT2101, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

203. spacer 2.7|1300866|34|NC_009484|CRT matches to NZ_CP045917 (Pseudomonas aeruginosa strain CF39S plasmid pCF39S, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

204. spacer 2.7|1300866|34|NC_009484|CRT matches to NZ_CP031802 (Klebsiella pneumoniae strain MSB1_8A-sc-2280397 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

205. spacer 2.7|1300866|34|NC_009484|CRT matches to NZ_CP028996 (Klebsiella pneumoniae strain AR_0079 plasmid unnamed5, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

206. spacer 2.7|1300866|34|NC_009484|CRT matches to NZ_CP040034 (Klebsiella pneumoniae strain KPC160117 plasmid pIncC-L117, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

207. spacer 2.7|1300866|34|NC_009484|CRT matches to NZ_CP027043 (Klebsiella pneumoniae strain 1_GR_13 plasmid IncAC2, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

208. spacer 2.7|1300866|34|NC_009484|CRT matches to NZ_CP011571 (Enterobacter hormaechei strain CAV1311 plasmid pKPC_CAV1311, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

209. spacer 2.7|1300866|34|NC_009484|CRT matches to NZ_CP010723 (Phaeobacter piscinae strain P18 plasmid pP18_h, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

210. spacer 2.7|1300866|34|NC_009484|CRT matches to NZ_CP017084 (Proteus mirabilis strain T21 plasmid pT212, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

211. spacer 2.7|1300866|34|NC_009484|CRT matches to NZ_CP040029 (Klebsiella pneumoniae strain KPC160121 plasmid pIncC-L121, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

212. spacer 2.7|1300866|34|NC_009484|CRT matches to NZ_CP031122 (Providencia sp. WCHPHu000369 strain WCHPr000369 plasmid pIMP69_000369, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

213. spacer 2.7|1300866|34|NC_009484|CRT matches to MG879028 (Uncultured bacterium plasmid pEG1-1, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

214. spacer 2.7|1300866|34|NC_009484|CRT matches to NZ_CP028920 (Gemmobacter sp. HYN0069 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

215. spacer 2.7|1300866|34|NC_009484|CRT matches to MN823999 (Klebsiella pneumoniae strain 362713 plasmid p362713-FIIK, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

216. spacer 2.7|1300866|34|NC_009484|CRT matches to MN842293 (Klebsiella pneumoniae strain 20130907-4 plasmid p309074-1FIIK, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

217. spacer 2.7|1300866|34|NC_009484|CRT matches to NZ_CP011580 (Enterobacter hormaechei strain CAV1411 plasmid pKPC_CAV1411, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

218. spacer 2.7|1300866|34|NC_009484|CRT matches to NZ_CP013115 (Shewanella xiamenensis strain T17 plasmid pSx1, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

219. spacer 2.7|1300866|34|NC_009484|CRT matches to NZ_CP038103 (Aeromonas salmonicida subsp. salmonicida strain SHY16-3432 plasmid pAsa5-3432, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

220. spacer 2.7|1300866|34|NC_009484|CRT matches to NZ_CP011583 (Enterobacter hormaechei strain CAV1668 plasmid pCAV1668-85, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

221. spacer 2.7|1300866|34|NC_009484|CRT matches to NZ_CP011649 (Enterobacter hormaechei strain CAV1669 plasmid pKPC_CAV1669, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

222. spacer 2.7|1300866|34|NC_009484|CRT matches to NC_016839 (Klebsiella pneumoniae subsp. pneumoniae HS11286 plasmid pKPHS3, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

223. spacer 2.7|1300866|34|NC_009484|CRT matches to NZ_CP027695 (Klebsiella pneumoniae strain KP30835 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

224. spacer 2.7|1300866|34|NC_009484|CRT matches to NZ_MH917284 (Klebsiella pneumoniae strain 397108 plasmid p397108-Ct2, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

225. spacer 2.7|1300866|34|NC_009484|CRT matches to MT011984 (Comamonas testosteroni strain NFYY023 plasmid pNFYY023-1, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

226. spacer 2.7|1300866|34|NC_009484|CRT matches to NZ_MF344574 (Enterobacter hormaechei strain T5282 plasmid pT5282-Ct2, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

227. spacer 2.7|1300866|34|NC_009484|CRT matches to NZ_CP030132 (Klebsiella pneumoniae strain 160111 plasmid pIncAC2_L111, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

228. spacer 2.7|1300866|34|NC_009484|CRT matches to NZ_MF150084 (Klebsiella pneumoniae strain A64477 plasmid pKP64477a, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

229. spacer 2.7|1300866|34|NC_009484|CRT matches to NZ_KY883660 (Pseudomonas putida strain SY153 plasmid pSY153-MDR, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

230. spacer 2.7|1300866|34|NC_009484|CRT matches to NZ_MF150118 (Proteus mirabilis strain A64421 plasmid pPM64421a, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

231. spacer 2.7|1300866|34|NC_009484|CRT matches to MT897910 (Mycobacterium phage VioletZ, complete genome) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
gacggtgccgccggttgcgcccgtggtcaccgtc	Protospacer
  ***** * ****************.. * **

232. spacer 2.7|1300866|34|NC_009484|CRT matches to MN369759 (Mycobacterium phage Mithril, complete genome) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
gacggtgccgccggttgcgcccgtggtcaccgtc	Protospacer
  ***** * ****************.. * **

233. spacer 2.7|1300866|34|NC_009484|CRT matches to MT818419 (Mycobacterium phage Lolalove, complete genome) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
gacggtgccgccggttgcgcccgtggtcaccgtc	Protospacer
  ***** * ****************.. * **

234. spacer 2.7|1300866|34|NC_009484|CRT matches to MN428050 (Mycobacterium phage Apex, complete genome) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
gacggtgccgccggttgcgcccgtggtcaccgtc	Protospacer
  ***** * ****************.. * **

235. spacer 2.7|1300866|34|NC_009484|CRT matches to MK524486 (Mycobacterium phage Waleliano, complete genome) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
gacggtgccgccggttgcgcccgtggtcaccgtc	Protospacer
  ***** * ****************.. * **

236. spacer 2.7|1300866|34|NC_009484|CRT matches to MN234171 (Mycobacterium phage Magpie, complete genome) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
gacggtgccgccggttgcgcccgtggtcaccgtc	Protospacer
  ***** * ****************.. * **

237. spacer 2.7|1300866|34|NC_009484|CRT matches to MH513970 (Mycobacterium phage Hangman, complete genome) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
gacggtgccgccggttgcgcccgtggtcaccgtc	Protospacer
  ***** * ****************.. * **

238. spacer 2.7|1300866|34|NC_009484|CRT matches to KX589269 (Mycobacterium phage Fortunato, complete genome) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
gacggtgccgccggttgcgcccgtggtcaccgtc	Protospacer
  ***** * ****************.. * **

239. spacer 2.7|1300866|34|NC_009484|CRT matches to MT639648 (Mycobacterium phage Heath, complete genome) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
gacggtgccgccggttgcgcccgtggtcaccgtc	Protospacer
  ***** * ****************.. * **

240. spacer 2.7|1300866|34|NC_009484|CRT matches to NC_042035 (Mycobacterium phage Zemanar, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
gacggtgccgccggttgcgcccgtggtcaccgtc	Protospacer
  ***** * ****************.. * **

241. spacer 2.7|1300866|34|NC_009484|CRT matches to NC_042034 (Mycobacterium phage ChrisnMich, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
gacggtgccgccggttgcgcccgtggtcaccgtc	Protospacer
  ***** * ****************.. * **

242. spacer 2.7|1300866|34|NC_009484|CRT matches to NC_022331 (Mycobacterium phage Bane1, complete genome) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
gacggtgccgccggttgcgcccgtggtgaccgtc	Protospacer
  ***** * ****************.  * **

243. spacer 2.7|1300866|34|NC_009484|CRT matches to KF279413 (Mycobacterium phage Bane2, complete genome) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
gacggtgccgccggttgcgcccgtggtgaccgtc	Protospacer
  ***** * ****************.  * **

244. spacer 2.7|1300866|34|NC_009484|CRT matches to KF493881 (Mycobacterium phage JAMaL, complete genome) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
gacggtgccgccggttgcgcccgtggtcaccgtc	Protospacer
  ***** * ****************.. * **

245. spacer 2.7|1300866|34|NC_009484|CRT matches to NC_028968 (Mycobacterium phage BrownCNA, complete genome) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
gacggtgccgccggttgcgcccgtggtcaccgtc	Protospacer
  ***** * ****************.. * **

246. spacer 2.13|1301190|34|NC_009484|CRT matches to NZ_CP033971 (Cupriavidus pauculus strain FDAARGOS_614 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.735

acccgtcgcacccgtcgcgcccgtggcacccatc	CRISPR spacer
atggcgggcacccatcgcgcccgtggcgcccacc	Protospacer
*.     ******.*************.****.*

247. spacer 2.15|1301289|34|NC_009484|CRT matches to NZ_CP017783 (Rhodobacter sp. LPB0142 plasmid pEJ02, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

248. spacer 2.15|1301289|34|NC_009484|CRT matches to NZ_CP017784 (Rhodobacter sp. LPB0142 plasmid pEJ03, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

249. spacer 2.15|1301289|34|NC_009484|CRT matches to NZ_KX364409 (Aeromonas salmonicida subsp. salmonicida strain M16474-11 plasmid pAsa8, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

250. spacer 2.15|1301289|34|NC_009484|CRT matches to MT081181 (Uncultured bacterium plasmid pCu_H_1, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

251. spacer 2.15|1301289|34|NC_009484|CRT matches to NZ_CP049911 (Diaphorobacter sp. HDW4A plasmid p_unnamed1, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

252. spacer 2.15|1301289|34|NC_009484|CRT matches to NZ_CP025470 (Klebsiella pneumoniae strain JS187 plasmid p187-4, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

253. spacer 2.15|1301289|34|NC_009484|CRT matches to NC_022078 (Klebsiella pneumoniae JM45 plasmid p1, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

254. spacer 2.15|1301289|34|NC_009484|CRT matches to NZ_CP039989 (Pseudomonas aeruginosa strain T2436 plasmid pBT2436, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

255. spacer 2.15|1301289|34|NC_009484|CRT matches to NZ_CP027038 (Klebsiella pneumoniae strain 16_GR_13 plasmid IncAC2, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

256. spacer 2.15|1301289|34|NC_009484|CRT matches to NZ_CP027055 (Klebsiella pneumoniae strain 2_GR_12 plasmid IncAC2) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

257. spacer 2.15|1301289|34|NC_009484|CRT matches to CP052444 (Klebsiella pneumoniae strain C16KP0098 plasmid pC16KP0098-1, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

258. spacer 2.15|1301289|34|NC_009484|CRT matches to NZ_CP030080 (Enterobacter hormaechei strain 20710 plasmid pIMP-20710, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

259. spacer 2.15|1301289|34|NC_009484|CRT matches to NZ_CP039991 (Pseudomonas aeruginosa strain T2101 plasmid pBT2101, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

260. spacer 2.15|1301289|34|NC_009484|CRT matches to NZ_CP039991 (Pseudomonas aeruginosa strain T2101 plasmid pBT2101, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

261. spacer 2.15|1301289|34|NC_009484|CRT matches to NZ_CP045917 (Pseudomonas aeruginosa strain CF39S plasmid pCF39S, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

262. spacer 2.15|1301289|34|NC_009484|CRT matches to NZ_CP031802 (Klebsiella pneumoniae strain MSB1_8A-sc-2280397 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

263. spacer 2.15|1301289|34|NC_009484|CRT matches to NZ_CP028996 (Klebsiella pneumoniae strain AR_0079 plasmid unnamed5, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

264. spacer 2.15|1301289|34|NC_009484|CRT matches to NZ_CP040034 (Klebsiella pneumoniae strain KPC160117 plasmid pIncC-L117, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

265. spacer 2.15|1301289|34|NC_009484|CRT matches to NZ_CP027043 (Klebsiella pneumoniae strain 1_GR_13 plasmid IncAC2, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

266. spacer 2.15|1301289|34|NC_009484|CRT matches to NZ_CP011571 (Enterobacter hormaechei strain CAV1311 plasmid pKPC_CAV1311, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

267. spacer 2.15|1301289|34|NC_009484|CRT matches to NZ_CP010723 (Phaeobacter piscinae strain P18 plasmid pP18_h, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

268. spacer 2.15|1301289|34|NC_009484|CRT matches to NZ_CP017084 (Proteus mirabilis strain T21 plasmid pT212, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

269. spacer 2.15|1301289|34|NC_009484|CRT matches to NZ_CP040029 (Klebsiella pneumoniae strain KPC160121 plasmid pIncC-L121, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

270. spacer 2.15|1301289|34|NC_009484|CRT matches to NZ_CP031122 (Providencia sp. WCHPHu000369 strain WCHPr000369 plasmid pIMP69_000369, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

271. spacer 2.15|1301289|34|NC_009484|CRT matches to MG879028 (Uncultured bacterium plasmid pEG1-1, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

272. spacer 2.15|1301289|34|NC_009484|CRT matches to NZ_CP028920 (Gemmobacter sp. HYN0069 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

273. spacer 2.15|1301289|34|NC_009484|CRT matches to MN823999 (Klebsiella pneumoniae strain 362713 plasmid p362713-FIIK, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

274. spacer 2.15|1301289|34|NC_009484|CRT matches to MN842293 (Klebsiella pneumoniae strain 20130907-4 plasmid p309074-1FIIK, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

275. spacer 2.15|1301289|34|NC_009484|CRT matches to NZ_CP011580 (Enterobacter hormaechei strain CAV1411 plasmid pKPC_CAV1411, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

276. spacer 2.15|1301289|34|NC_009484|CRT matches to NZ_CP013115 (Shewanella xiamenensis strain T17 plasmid pSx1, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

277. spacer 2.15|1301289|34|NC_009484|CRT matches to NZ_CP038103 (Aeromonas salmonicida subsp. salmonicida strain SHY16-3432 plasmid pAsa5-3432, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

278. spacer 2.15|1301289|34|NC_009484|CRT matches to NZ_CP011583 (Enterobacter hormaechei strain CAV1668 plasmid pCAV1668-85, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

279. spacer 2.15|1301289|34|NC_009484|CRT matches to NZ_CP011649 (Enterobacter hormaechei strain CAV1669 plasmid pKPC_CAV1669, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

280. spacer 2.15|1301289|34|NC_009484|CRT matches to NC_016839 (Klebsiella pneumoniae subsp. pneumoniae HS11286 plasmid pKPHS3, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

281. spacer 2.15|1301289|34|NC_009484|CRT matches to NZ_CP027695 (Klebsiella pneumoniae strain KP30835 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

282. spacer 2.15|1301289|34|NC_009484|CRT matches to NZ_MH917284 (Klebsiella pneumoniae strain 397108 plasmid p397108-Ct2, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

283. spacer 2.15|1301289|34|NC_009484|CRT matches to MT011984 (Comamonas testosteroni strain NFYY023 plasmid pNFYY023-1, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

284. spacer 2.15|1301289|34|NC_009484|CRT matches to NZ_MF344574 (Enterobacter hormaechei strain T5282 plasmid pT5282-Ct2, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

285. spacer 2.15|1301289|34|NC_009484|CRT matches to NZ_CP030132 (Klebsiella pneumoniae strain 160111 plasmid pIncAC2_L111, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

286. spacer 2.15|1301289|34|NC_009484|CRT matches to NZ_MF150084 (Klebsiella pneumoniae strain A64477 plasmid pKP64477a, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

287. spacer 2.15|1301289|34|NC_009484|CRT matches to NZ_KY883660 (Pseudomonas putida strain SY153 plasmid pSY153-MDR, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

288. spacer 2.15|1301289|34|NC_009484|CRT matches to NZ_MF150118 (Proteus mirabilis strain A64421 plasmid pPM64421a, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
tgctacagctccggttgcgcccgtgacgccggac	Protospacer
* * ...******************.* ****

289. spacer 2.15|1301289|34|NC_009484|CRT matches to MT897910 (Mycobacterium phage VioletZ, complete genome) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
gacggtgccgccggttgcgcccgtggtcaccgtc	Protospacer
  ***** * ****************.. * **

290. spacer 2.15|1301289|34|NC_009484|CRT matches to MN369759 (Mycobacterium phage Mithril, complete genome) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
gacggtgccgccggttgcgcccgtggtcaccgtc	Protospacer
  ***** * ****************.. * **

291. spacer 2.15|1301289|34|NC_009484|CRT matches to MT818419 (Mycobacterium phage Lolalove, complete genome) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
gacggtgccgccggttgcgcccgtggtcaccgtc	Protospacer
  ***** * ****************.. * **

292. spacer 2.15|1301289|34|NC_009484|CRT matches to MN428050 (Mycobacterium phage Apex, complete genome) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
gacggtgccgccggttgcgcccgtggtcaccgtc	Protospacer
  ***** * ****************.. * **

293. spacer 2.15|1301289|34|NC_009484|CRT matches to MK524486 (Mycobacterium phage Waleliano, complete genome) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
gacggtgccgccggttgcgcccgtggtcaccgtc	Protospacer
  ***** * ****************.. * **

294. spacer 2.15|1301289|34|NC_009484|CRT matches to MN234171 (Mycobacterium phage Magpie, complete genome) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
gacggtgccgccggttgcgcccgtggtcaccgtc	Protospacer
  ***** * ****************.. * **

295. spacer 2.15|1301289|34|NC_009484|CRT matches to MH513970 (Mycobacterium phage Hangman, complete genome) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
gacggtgccgccggttgcgcccgtggtcaccgtc	Protospacer
  ***** * ****************.. * **

296. spacer 2.15|1301289|34|NC_009484|CRT matches to KX589269 (Mycobacterium phage Fortunato, complete genome) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
gacggtgccgccggttgcgcccgtggtcaccgtc	Protospacer
  ***** * ****************.. * **

297. spacer 2.15|1301289|34|NC_009484|CRT matches to MT639648 (Mycobacterium phage Heath, complete genome) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
gacggtgccgccggttgcgcccgtggtcaccgtc	Protospacer
  ***** * ****************.. * **

298. spacer 2.15|1301289|34|NC_009484|CRT matches to NC_042035 (Mycobacterium phage Zemanar, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
gacggtgccgccggttgcgcccgtggtcaccgtc	Protospacer
  ***** * ****************.. * **

299. spacer 2.15|1301289|34|NC_009484|CRT matches to NC_042034 (Mycobacterium phage ChrisnMich, complete sequence) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
gacggtgccgccggttgcgcccgtggtcaccgtc	Protospacer
  ***** * ****************.. * **

300. spacer 2.15|1301289|34|NC_009484|CRT matches to NC_022331 (Mycobacterium phage Bane1, complete genome) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
gacggtgccgccggttgcgcccgtggtgaccgtc	Protospacer
  ***** * ****************.  * **

301. spacer 2.15|1301289|34|NC_009484|CRT matches to KF279413 (Mycobacterium phage Bane2, complete genome) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
gacggtgccgccggttgcgcccgtggtgaccgtc	Protospacer
  ***** * ****************.  * **

302. spacer 2.15|1301289|34|NC_009484|CRT matches to KF493881 (Mycobacterium phage JAMaL, complete genome) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
gacggtgccgccggttgcgcccgtggtcaccgtc	Protospacer
  ***** * ****************.. * **

303. spacer 2.15|1301289|34|NC_009484|CRT matches to NC_028968 (Mycobacterium phage BrownCNA, complete genome) position: , mismatch: 9, identity: 0.735

tccggtggctccggttgcgcccgtggctccggtg	CRISPR spacer
gacggtgccgccggttgcgcccgtggtcaccgtc	Protospacer
  ***** * ****************.. * **

304. spacer 2.5|1300767|34|NC_009484|CRT matches to NZ_AP019743 (Acinetobacter radioresistens DSM 6976 = NBRC 102413 = CIP 103788 strain NBRC 102413 plasmid pARA3, complete sequence) position: , mismatch: 11, identity: 0.676

tccggttgcgcccgtggcacccgttgcgccggtg	CRISPR spacer
aacggttgcgcctgtgtcacccgttgcttgacct	Protospacer
  **********.*** ********** . . .

305. spacer 2.5|1300767|34|NC_009484|CRT matches to NZ_CP022285 (Acinetobacter baumannii strain 7804 plasmid pAba7804b, complete sequence) position: , mismatch: 11, identity: 0.676

tccggttgcgcccgtggcacccgttgcgccggtg	CRISPR spacer
aacggttgcgcctgtgtcacccgttgcttgacct	Protospacer
  **********.*** ********** . . .

306. spacer 2.5|1300767|34|NC_009484|CRT matches to MK531536 (Acinetobacter baumannii strain MC1 plasmid pMC1.1, complete sequence) position: , mismatch: 11, identity: 0.676

tccggttgcgcccgtggcacccgttgcgccggtg	CRISPR spacer
aacggttgcgcctgtgtcacccgttgcttgacct	Protospacer
  **********.*** ********** . . .

307. spacer 2.5|1300767|34|NC_009484|CRT matches to NZ_CP014652 (Acinetobacter sp. DUT-2 plasmid unnamed1, complete sequence) position: , mismatch: 11, identity: 0.676

tccggttgcgcccgtggcacccgttgcgccggtg	CRISPR spacer
aacggttgcgcctgtgtcacccgttgcttgacct	Protospacer
  **********.*** ********** . . .

308. spacer 2.12|1301136|34|NC_009484|CRT matches to NZ_CP010857 (Marinovum algicola DG 898 plasmid pMaD2, complete sequence) position: , mismatch: 11, identity: 0.676

tccggtcgcacccatcgcgcccgttgcgccggtg	CRISPR spacer
gtgcgaggcacccatcgcgcccgtggcggcgacc	Protospacer
 .  *  ***************** *** **..

309. spacer 2.13|1301190|34|NC_009484|CRT matches to NZ_CP022567 (Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK03, complete sequence) position: , mismatch: 11, identity: 0.676

acccgtcgcacccgtcgcgcccgtggcacccatc	CRISPR spacer
gatggccgcacccgtcgcgaccgcggcaccgtag	Protospacer
. . *.************* ***.******

310. spacer 2.28|1302108|34|NC_009484|CRT matches to NZ_CP039918 (Agrobacterium tumefaciens strain CFBP6626 plasmid pAtCFBP6626a, complete sequence) position: , mismatch: 11, identity: 0.676

gcccgtggctccagttgcgccggtggcgcccgtg	CRISPR spacer
cgccgtggctccagatgcgccgctggttttcagc	Protospacer
  ************ ******* ***. ..*.

311. spacer 2.28|1302108|34|NC_009484|CRT matches to NZ_CP048633 (Rhizobium oryzihabitans strain M15 plasmid p1, complete sequence) position: , mismatch: 11, identity: 0.676

gcccgtggctccagttgcgccggtggcgcccgtg	CRISPR spacer
cgccgtggctccagatgcgccgctggttttcagc	Protospacer
  ************ ******* ***. ..*.

312. spacer 2.28|1302108|34|NC_009484|CRT matches to NZ_CP048637 (Rhizobium oryzihabitans strain M15 plasmid p5, complete sequence) position: , mismatch: 11, identity: 0.676

gcccgtggctccagttgcgccggtggcgcccgtg	CRISPR spacer
cgccgtggctccagatgcgccgctggttttcagc	Protospacer
  ************ ******* ***. ..*.

313. spacer 2.28|1302108|34|NC_009484|CRT matches to NZ_KY000062 (Agrobacterium genomosp. 3 strain CFBP4424 plasmid pTi_CFBP4424, complete sequence) position: , mismatch: 11, identity: 0.676

gcccgtggctccagttgcgccggtggcgcccgtg	CRISPR spacer
cgccgtggctccagatgcgccgctggttttcagc	Protospacer
  ************ ******* ***. ..*.

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

865695 : 887985

Stx2-converting_phage(40.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011941767.1\|865695_866919_+\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	4.7e-42	46.3
WP_081432875.1\|867271_867607_-	hypothetical protein	NA	NA	NA	NA
WP_050751093.1\|867764_867947_-\|transposase	transposase	NA	NA	NA	NA
WP_007421341.1\|868680_869697_-\|transposase	IS1595-like element ISAcr1 family transposase	NA	NA	NA	NA
WP_050751094.1\|870555_870993_-	hypothetical protein	NA	NA	NA	NA
WP_155856404.1\|870985_872584_-\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	5.4e-107	44.2
WP_011941775.1\|872720_873062_-	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	3.3e-30	57.3
WP_155856350.1\|874680_875169_-	hypothetical protein	NA	NA	NA	NA
WP_011941778.1\|875243_876911_-	DUF262 domain-containing protein	NA	NA	NA	NA
WP_011930484.1\|877364_878573_-\|transposase	IS256 family transposase	A0A220NQR7	Corynebacterium_phage	3.6e-95	46.8
WP_011941779.1\|878934_879207_+	ribbon-helix-helix domain-containing protein	NA	NA	NA	NA
WP_050751095.1\|879203_881039_+	N-6 DNA methylase	NA	NA	NA	NA
WP_011941781.1\|881038_882118_+	restriction endonuclease	NA	NA	NA	NA
WP_081432877.1\|882172_884092_+	AAA family ATPase	NA	NA	NA	NA
WP_011941783.1\|884088_886008_+	ATP-dependent helicase	A0A1P8CWU5	Bacillus_phage	5.9e-15	21.4
WP_011941785.1\|886731_887985_-\|transposase	ISL3 family transposase	NA	NA	NA	NA

DBSCAN-SWA_2

2533449 : 2596657

Acidithiobacillus_phage(12.5%)

transposase,integrase

attL 2567939:2567957|attR 2597501:2597519

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011930648.1\|2533449_2534997_-\|transposase	IS21 family transposase	K4I413	Acidithiobacillus_phage	5.1e-126	47.9
WP_012039952.1\|2535114_2535591_-	bifunctional DNA primase/polymerase	NA	NA	NA	NA
WP_043509202.1\|2535590_2535854_-	hypothetical protein	NA	NA	NA	NA
WP_043509204.1\|2535993_2536182_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_012039954.1\|2536283_2536931_-	hypothetical protein	NA	NA	NA	NA
WP_043509206.1\|2536927_2537131_-	hypothetical protein	NA	NA	NA	NA
WP_012039955.1\|2537127_2537379_-	hypothetical protein	NA	NA	NA	NA
WP_012039956.1\|2537375_2537780_-	hypothetical protein	NA	NA	NA	NA
WP_043509207.1\|2537776_2537971_-	hypothetical protein	NA	NA	NA	NA
WP_155856380.1\|2538066_2539320_-	DUF4102 domain-containing protein	A0A077KET4	Ralstonia_phage	6.6e-100	47.8
WP_012039958.1\|2539798_2540605_+	DUF4102 domain-containing protein	Q8W6M6	Sinorhizobium_phage	4.1e-63	48.5
WP_012039960.1\|2541878_2542673_-	5-deoxy-glucuronate isomerase	NA	NA	NA	NA
WP_012039961.1\|2542704_2544543_-	3D-(3,5/4)-trihydroxycyclohexane-1,2-dione acylhydrolase (decyclizing)	NA	NA	NA	NA
WP_012039962.1\|2544539_2546450_-	5-dehydro-2-deoxygluconokinase	NA	NA	NA	NA
WP_007421524.1\|2546518_2547322_-	sugar ABC transporter ATP-binding protein	A0A076FI99	Aureococcus_anophage	1.1e-07	27.7
WP_007421525.1\|2547323_2548391_-	ABC transporter permease	NA	NA	NA	NA
WP_012039963.1\|2548471_2549434_-	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_007421527.1\|2549598_2550387_-	TIM barrel protein	NA	NA	NA	NA
WP_012039964.1\|2550395_2551406_-	inositol 2-dehydrogenase	NA	NA	NA	NA
WP_043509209.1\|2551407_2552316_-	sugar phosphate isomerase/epimerase	NA	NA	NA	NA
WP_012039966.1\|2552445_2553519_+	LacI family transcriptional regulator	NA	NA	NA	NA
WP_012039968.1\|2554046_2554859_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_012039969.1\|2554855_2555767_-	myo-inosose-2 dehydratase	NA	NA	NA	NA
WP_012039970.1\|2555880_2556825_-	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_012039971.1\|2557148_2557940_+	2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase	NA	NA	NA	NA
WP_007421625.1\|2557941_2558928_+	hydroxyacid dehydrogenase	A0A1B1IVB5	uncultured_Mediterranean_phage	7.9e-16	28.7
WP_012039972.1\|2558998_2559991_+	inositol 2-dehydrogenase	NA	NA	NA	NA
WP_007421623.1\|2559995_2561117_+	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_012039974.1\|2561465_2563892_-	DUF2309 domain-containing protein	NA	NA	NA	NA
WP_012039975.1\|2563911_2565471_-	oxidoreductase	NA	NA	NA	NA
WP_012039976.1\|2565578_2566454_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_012039977.1\|2566985_2567243_+	hypothetical protein	NA	NA	NA	NA
WP_012039978.1\|2567304_2567925_+	RNA polymerase sigma factor	NA	NA	NA	NA
WP_012039979.1\|2567921_2568350_+	hypothetical protein	NA	NA	NA	NA
2567939:2567957	attL	NA	NA	NA	NA
WP_012039980.1\|2568346_2568886_+	periplasmic heavy metal sensor	NA	NA	NA	NA
WP_043509210.1\|2568974_2569163_+	hypothetical protein	NA	NA	NA	NA
WP_043509211.1\|2569211_2569478_+	hypothetical protein	NA	NA	NA	NA
WP_155856381.1\|2569491_2570871_+	DUF1800 family protein	NA	NA	NA	NA
WP_012039982.1\|2570876_2572094_+	DUF1501 domain-containing protein	NA	NA	NA	NA
WP_011930454.1\|2572945_2574199_+\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_155856417.1\|2574424_2575387_+	FAD-binding protein	NA	NA	NA	NA
WP_012039985.1\|2575414_2575840_+	hypothetical protein	NA	NA	NA	NA
WP_043509361.1\|2576039_2577008_+	hypothetical protein	NA	NA	NA	NA
WP_012039987.1\|2577007_2578132_+\|integrase	integrase	NA	NA	NA	NA
WP_012039988.1\|2578332_2578656_+	hypothetical protein	NA	NA	NA	NA
WP_012039989.1\|2578861_2579767_+\|integrase	tyrosine-type recombinase/integrase	S5W9T9	Leptospira_phage	5.2e-30	32.6
WP_012039990.1\|2579771_2580965_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_012039991.1\|2581572_2582007_-	group 1 truncated hemoglobin	NA	NA	NA	NA
WP_050751121.1\|2582027_2583008_-	DUF3034 family protein	NA	NA	NA	NA
WP_012039993.1\|2583945_2585640_+	recombinase family protein	R9TP69	Rhizobium_phage	3.3e-78	36.6
WP_035189036.1\|2591484_2592453_-	NAD-dependent epimerase/dehydratase family protein	A0A0K0KW07	Prochlorococcus_phage	8.3e-10	27.1
WP_007422999.1\|2592449_2593049_-	SIS domain-containing protein	NA	NA	NA	NA
WP_007422998.1\|2593038_2593824_-	3-hydroxybutyrate dehydrogenase	NA	NA	NA	NA
WP_007422997.1\|2594672_2595263_-	heme-binding protein	NA	NA	NA	NA
WP_155856382.1\|2595883_2596657_+\|transposase	IS5 family transposase	NA	NA	NA	NA
2597501:2597519	attR	NA	NA	NA	NA

DBSCAN-SWA_3

2749998 : 2797600

uncultured_virus(45.45%)

terminase,tRNA,protease,portal,tail,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_007423537.1\|2749998_2751234_-\|tRNA	tRNA (N(6)-L-threonylcarbamoyladenosine(37)-C(2))- methylthiotransferase MtaB	NA	NA	NA	NA
WP_012040099.1\|2751230_2752064_-	diaminopimelate epimerase	NA	NA	NA	NA
WP_012040100.1\|2752106_2753576_-	APC family permease	NA	NA	NA	NA
WP_012040101.1\|2753572_2754295_-	endonuclease III	NA	NA	NA	NA
WP_012040102.1\|2754347_2754893_+	DUF2244 domain-containing protein	NA	NA	NA	NA
WP_012040103.1\|2754965_2756114_+	MFS transporter	NA	NA	NA	NA
WP_007423234.1\|2756209_2757859_-	chaperonin GroEL	A0A219YK78	uncultured_virus	2.6e-173	61.2
WP_007423235.1\|2757903_2758218_-	co-chaperone GroES	A0A221S4G8	uncultured_virus	1.8e-22	58.5
WP_012040104.1\|2758435_2758762_+	Usg family protein	NA	NA	NA	NA
WP_012040105.1\|2758881_2759712_+	hypothetical protein	NA	NA	NA	NA
WP_012040106.1\|2759836_2761222_+\|terminase	phage terminase large subunit	A0A1X9SGU8	Bradyrhizobium_phage	2.7e-70	39.3
WP_007423133.1\|2761226_2762639_+\|portal	phage portal protein	NA	NA	NA	NA
WP_007423132.1\|2762635_2763061_+	hypothetical protein	NA	NA	NA	NA
WP_012040107.1\|2763160_2764483_+	DUF4043 family protein	NA	NA	NA	NA
WP_007423130.1\|2764496_2764805_+	hypothetical protein	NA	NA	NA	NA
WP_012040108.1\|2764806_2765214_+	hypothetical protein	NA	NA	NA	NA
WP_012040109.1\|2765221_2765866_+	hypothetical protein	NA	NA	NA	NA
WP_012040110.1\|2765865_2766711_+	hypothetical protein	NA	NA	NA	NA
WP_007421564.1\|2766862_2768419_+\|tail	tail protein	B3GAJ6	uncultured_virus	3.7e-100	46.4
WP_007421565.1\|2768427_2768856_+	hypothetical protein	NA	NA	NA	NA
WP_007421566.1\|2768852_2769158_+	hypothetical protein	NA	NA	NA	NA
WP_043509231.1\|2769321_2770095_+	hypothetical protein	NA	NA	NA	NA
WP_012040112.1\|2770111_2770798_+	hypothetical protein	NA	NA	NA	NA
WP_007422926.1\|2770794_2770989_+	hypothetical protein	NA	NA	NA	NA
WP_012040113.1\|2770960_2771962_+	hypothetical protein	NA	NA	NA	NA
WP_012040114.1\|2771958_2772507_+\|plate	baseplate assembly protein	B3GAJ7	uncultured_virus	5.4e-14	38.7
WP_012040115.1\|2772506_2772875_+	hypothetical protein	NA	NA	NA	NA
WP_012040116.1\|2772893_2774018_+\|plate	baseplate J/gp47 family protein	B3GAJ9	uncultured_virus	1.1e-50	43.3
WP_007422920.1\|2774021_2774696_+	hypothetical protein	NA	NA	NA	NA
WP_012040117.1\|2774788_2776042_+	hypothetical protein	NA	NA	NA	NA
WP_043509232.1\|2776056_2776548_+	hypothetical protein	NA	NA	NA	NA
WP_012040118.1\|2776557_2779101_+	hypothetical protein	A0A2I7S0A8	Vibrio_phage	2.7e-07	28.8
WP_012040119.1\|2779128_2781021_+	collagen-like protein	NA	NA	NA	NA
WP_012040120.1\|2781023_2783162_+	hypothetical protein	NA	NA	NA	NA
WP_007422432.1\|2783167_2783521_+	hypothetical protein	NA	NA	NA	NA
WP_007422431.1\|2783537_2783777_+	hypothetical protein	NA	NA	NA	NA
WP_012040121.1\|2783764_2784160_+	hypothetical protein	NA	NA	NA	NA
WP_012040122.1\|2784156_2784462_+	hypothetical protein	NA	NA	NA	NA
WP_012040123.1\|2784431_2786615_-	RNA degradosome polyphosphate kinase	NA	NA	NA	NA
WP_007422427.1\|2786645_2787359_-	DNA replication protein	NA	NA	NA	NA
WP_012040125.1\|2787381_2788476_-	AI-2E family transporter	NA	NA	NA	NA
WP_012040126.1\|2788630_2789701_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3HVS1	Synechococcus_phage	3.6e-54	39.5
WP_012040127.1\|2789697_2790318_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.4e-23	37.5
WP_154653547.1\|2790458_2790620_+	hypothetical protein	NA	NA	NA	NA
WP_012040128.1\|2790690_2791593_+	EamA family transporter	NA	NA	NA	NA
WP_007423189.1\|2791599_2792541_-	ornithine carbamoyltransferase	NA	NA	NA	NA
WP_081432893.1\|2792537_2793719_-	aspartate aminotransferase family protein	A0A1V0SKB7	Klosneuvirus	2.9e-25	26.9
WP_013640877.1\|2793915_2795421_+	Ppx/GppA family phosphatase	NA	NA	NA	NA
WP_035186673.1\|2795421_2795952_-	DUF2147 domain-containing protein	NA	NA	NA	NA
WP_012040132.1\|2796173_2797169_+	lipid A deacylase LpxR family protein	NA	NA	NA	NA
WP_012040133.1\|2797243_2797600_+\|protease	ATP-dependent Clp protease adapter ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	3.5e-14	48.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NC_009467

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_009467_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_009467_1

157782-157905

Orphan

Consensus_repeat	Method
GCGGGGTGGCGGGCAAGCGGCGGTG	CRISPRCasFinder

2 spacers

csa3

The CRISPR arrays of NC_009467_1

>merge|NC_009467|1|157782-157905|CRISPRCasFinder
GGGGAGTAGCGGGCAAGCGGCGGTGTTGGAGCGGGGAGTAGCGGGCAAGCGGGGTGGCGGGCAAGCGGCGGTGGTCGGGCGCGGATGACGGATGAGATCGCCGGGTGGCGGGCAAGCGGCGGTG

>NC_009467|1|1|157782-157905|CRISPRCasFinder
GGGGAGTAGCGGGCAAGCGGCGGTG	TTGGAGCGGGGAGTAGCGGGCAA
GCGGGGTGGCGGGCAAGCGGCGGTG	GTCGGGCGCGGATGACGGATGAGATC
GCCGGGTGGCGGGCAAGCGGCGGTG

Protein	Signature genes	Signature genes Name	Protein_function
NC_009467.1\|WP_081432812.1\|152599_153028_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|133412
NC_009467.1\|WP_081432817.1\|168316_169006_-\|PEP-CTERM-sorting-domain-containing-protein	unknown	unknown	gnl\|CDD\|377877
NC_009467.1\|WP_081432816.1\|167327_168134_+\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|223816
NC_009467.1\|WP_011930465.1\|154281_155013_-\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293810
NC_009467.1\|WP_155856287.1\|162131_162305_+\|hypothetical-protein	unknown	unknown	unknown
NC_009467.1\|WP_011930456.1\|162992_163553_+\|heme-transporter-CcmB	unknown	unknown	gnl\|CDD\|377902
NC_009467.1\|WP_081432813.1\|153037_154285_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340883
NC_009467.1\|WP_011930458.1\|161919_162135_+\|DUF2442-domain-containing-protein	unknown	unknown	gnl\|CDD\|378424
NC_009467.1\|WP_081432811.1\|147822_149052_-\|heavy-metal-translocating-P-type-ATPase	unknown	unknown	gnl\|CDD\|236827
NC_009467.1\|WP_011930463.1\|155936_156224_-\|HigA-family-addiction-module-antidote-protein	unknown	unknown	gnl\|CDD\|274228
NC_009467.1\|WP_011930454.1\|165731_166985_-\|ISL3-family-transposase	unknown	unknown	gnl\|CDD\|376574
NC_009467.1\|WP_011930460.1\|159793_161017_+\|IS256-family-transposase	unknown	unknown	gnl\|CDD\|307151
NC_009467.1\|WP_011930455.1\|163558_165421_+\|EAL-domain-containing-protein	unknown	unknown	gnl\|CDD\|227334
NC_009467.1\|WP_011930452.1\|169880_170546_-\|metalloregulator-ArsR/SmtB-family-transcription-factor	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|238089
NC_009467.1\|WP_011930469.1\|149875_151402_-\|IS21-family-transposase	unknown	unknown	gnl\|CDD\|226950
NC_009467.1\|WP_011930464.1\|155098_155764_+\|metalloregulator-ArsR/SmtB-family-transcription-factor	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|238089
NC_009467.1\|WP_011930457.1\|162307_162586_+\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	unknown	unknown	gnl\|CDD\|226194
NC_009467.1\|WP_011930468.1\|151499_152534_-\|E1-E2-ATPase-associated-domain-containing-protein	unknown	unknown	gnl\|CDD\|236827
NC_009467.1\|WP_011930470.1\|149079_149886_-\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|366760
NC_009467.1\|WP_011930462.1\|156235_156514_-\|plasmid-maintenance-system-killer	unknown	unknown	gnl\|CDD\|282822

Protein	Function_ID	Function_description	E-value
NC_009467.1\|WP_081432812.1\|152599_153028_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|133412	cd04785, HTH_CadR-PbrR-like, Helix-Turn-Helix DNA binding domain of the CadR- and PbrR-like transcription regulators. Helix-turn-helix (HTH) CadR- and PbrR-like transcription regulators. CadR and PbrR regulate expression of the cadmium and lead resistance operons, respectively. These proteins are comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the C-terminal domains have three conserved cysteines which comprise a putative metal binding site. Some members in this group have a histidine-rich C-terminal extension. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements.	2.30871e-64
NC_009467.1\|WP_081432817.1\|168316_169006_-\|PEP-CTERM-sorting-domain-containing-protein	gnl\|CDD\|377877	pfam07589, VPEP, PEP-CTERM motif. This motif has been identified in a wide range of bacteria at their C-terminus. It has been suggested that this is a protein sorting signal. Based on phylogenetic profiling it has been suggested that the EpsH family of proteins mediate this function.	4.98507e-05
NC_009467.1\|WP_081432816.1\|167327_168134_+\|response-regulator-transcription-factor	gnl\|CDD\|223816	COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription].	1.0611e-16
NC_009467.1\|WP_011930465.1\|154281_155013_-\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293810	cd07724, POD-like_MBL-fold, ETHE1 (PDO type I), persulfide dioxygenase A (PDOA, PDO type II) and related proteins; MBL-fold metallo-hydrolase domain. Persulfide dioxygenase (PDO, also known as sulfur dioxygenase, SDO, EC 1.13.11.18) is a non-heme iron-dependent oxygenase which catalyzes the oxidation of glutathione persulfide to glutathione and persulfite in the mitochondria. Mutations in ethe1 (the human PDO gene) are responsible for a rare autosomal recessive metabolic disorder called ethylmalonic encephalopathy. Arabidopsis thaliana ETHE1 is essential for embryo and endosperm development. Bacterial ETHE1-type PDOs are also called Type 1 PDOs. Type II PDOs (also called PDOAs), are mainly proteobacterial. These enzymes belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions.	6.66057e-60
NC_009467.1\|WP_011930456.1\|162992_163553_+\|heme-transporter-CcmB	gnl\|CDD\|377902	pfam07700, HNOB, Haem-NO-binding. The HNOB (Haem NO Binding) domain, is a predominantly alpha-helical domain and binds heme via a covalent linkage to histidine. It is a haem protein sensor (SONO) that displays femtomolar affinity for nitrous oxide, NO. It is predicted to function as a haem-dependent sensor for gaseous ligands and to transduce diverse downstream signals in both bacteria and animals.	2.6498e-14
NC_009467.1\|WP_081432813.1\|153037_154285_-\|MFS-transporter	gnl\|CDD\|340883	cd17325, MFS_MdtG_SLC18_like, bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily of transporters. This family is composed of eukaryotic solute carrier 18 (SLC18) family transporters and related bacterial multidrug resistance (MDR) transporters including several proteins from Escherichia coli such as multidrug resistance protein MdtG, from Bacillus subtilis such as multidrug resistance proteins 1 (Bmr1) and 2 (Bmr2), and from Staphylococcus aureus such as quinolone resistance protein NorA. The family also includes Escherichia coli arabinose efflux transporters YfcJ and YhhS. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The SLC18 transporter family includes vesicular monoamine transporters (VAT1 and VAT2), vesicular acetylcholine transporter (VAChT), and SLC18B1, which is proposed to be a vesicular polyamine transporter (VPAT). The MdtG/SLC18 family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.69848e-33
NC_009467.1\|WP_011930458.1\|161919_162135_+\|DUF2442-domain-containing-protein	gnl\|CDD\|378424	pfam10387, DUF2442, Protein of unknown function (DUF2442). This family of bacterial and fungal proteins has several members annotated as being putative molybdopterin-guanine dinucleotide biosynthesis protein A; however this could not be verified. Hence the function is not known. This family also includes the DUF3532 that was found to be related and was merged into this family. Members of this family also fall into the NE0471 N-terminal domain-like superfamily, a family of proteins with a unique fold in SCOP:143880.	1.08419e-18
NC_009467.1\|WP_081432811.1\|147822_149052_-\|heavy-metal-translocating-P-type-ATPase	gnl\|CDD\|236827	PRK11033, zntA, zinc/cadmium/mercury/lead-transporting ATPase; Provisional.	1.00681e-173
NC_009467.1\|WP_011930463.1\|155936_156224_-\|HigA-family-addiction-module-antidote-protein	gnl\|CDD\|274228	TIGR02607, Virulence-associated_protein_I, addiction module antidote protein, HigA family. Members of this family form a distinct clade within the larger family HTH_3 of helix-turn-helix proteins, described by pfam01381. Members of this clade are strictly bacterial and nearly always shorter than 110 amino acids. This family includes the characterized member HigA, without which the killer protein HigB cannot be cloned. The hig (host inhibition of growth) system is noted to be unusual in that killer protein is uncoded by the upstream member of the gene pair. [Regulatory functions, DNA interactions, Regulatory functions, Protein interactions, Mobile and extrachromosomal element functions, Other].	1.46675e-30
NC_009467.1\|WP_011930454.1\|165731_166985_-\|ISL3-family-transposase	gnl\|CDD\|376574	pfam01610, DDE_Tnp_ISL3, Transposase. Transposase proteins are necessary for efficient DNA transposition. Contains transposases for IS204, IS1001, IS1096 and IS1165.	8.75695e-75
NC_009467.1\|WP_011930460.1\|159793_161017_+\|IS256-family-transposase	gnl\|CDD\|307151	pfam00872, Transposase_mut, Transposase, Mutator family.	6.53404e-149
NC_009467.1\|WP_011930455.1\|163558_165421_+\|EAL-domain-containing-protein	gnl\|CDD\|227334	COG5001, COG5001, Predicted signal transduction protein containing a membrane domain, an EAL and a GGDEF domain [Signal transduction mechanisms].	6.48688e-116
NC_009467.1\|WP_011930452.1\|169880_170546_-\|metalloregulator-ArsR/SmtB-family-transcription-factor	gnl\|CDD\|238089	cd00158, RHOD, Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein. The cysteine containing enzymatically active version of the domain is also found in the Cdc25 class of protein phosphatases and a variety of proteins such as sulfide dehydrogenases and certain stress proteins such as senesence specific protein 1 in plants, PspE and GlpE in bacteria and cyanide and arsenate resistance proteins. Inactive versions (no active site cysteine) are also seen in dual specificity phosphatases, ubiquitin hydrolases from yeast and in sulfuryltransferases, where they are believed to play a regulatory role in multidomain proteins.	7.91095e-20
NC_009467.1\|WP_011930469.1\|149875_151402_-\|IS21-family-transposase	gnl\|CDD\|226950	COG4584, COG4584, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	1.14931e-14
NC_009467.1\|WP_011930464.1\|155098_155764_+\|metalloregulator-ArsR/SmtB-family-transcription-factor	gnl\|CDD\|238089	cd00158, RHOD, Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein. The cysteine containing enzymatically active version of the domain is also found in the Cdc25 class of protein phosphatases and a variety of proteins such as sulfide dehydrogenases and certain stress proteins such as senesence specific protein 1 in plants, PspE and GlpE in bacteria and cyanide and arsenate resistance proteins. Inactive versions (no active site cysteine) are also seen in dual specificity phosphatases, ubiquitin hydrolases from yeast and in sulfuryltransferases, where they are believed to play a regulatory role in multidomain proteins.	3.36513e-21
NC_009467.1\|WP_011930457.1\|162307_162586_+\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	gnl\|CDD\|226194	COG3668, ParE, Plasmid stabilization system protein [General function prediction only].	2.33828e-12
NC_009467.1\|WP_011930468.1\|151499_152534_-\|E1-E2-ATPase-associated-domain-containing-protein	gnl\|CDD\|236827	PRK11033, zntA, zinc/cadmium/mercury/lead-transporting ATPase; Provisional.	1.70571e-92
NC_009467.1\|WP_011930470.1\|149079_149886_-\|ATP-binding-protein	gnl\|CDD\|366760	pfam01695, IstB_IS21, IstB-like ATP binding protein. This protein contains an ATP/GTP binding P-loop motif. It is found associated with IS21 family insertion sequences. The function of this protein is unknown, but it may perform a transposase function.	2.40545e-65
NC_009467.1\|WP_011930462.1\|156235_156514_-\|plasmid-maintenance-system-killer	gnl\|CDD\|282822	pfam05015, HigB-like_toxin, RelE-like toxin of type II toxin-antitoxin system HigB. This family carries several different examples of type II bacterial toxins of toxin-antitoxin systems including many HigB-like ones. The fold is referred to as the RelE/YoeB/Txe/Yeeu fold suggesting all examples of these are present in this family. Several plasmids with proteic killer gene-systems have been reported. All of them encode a stable toxin and an unstable antidote. Upon loss of the plasmid, the less stable inhibitor is inactivated more rapidly than the toxin, allowing the toxin to be activated. The activation of these systems results in cell filamentation and cessation of viable cell production. It has been verified that both the stable killer and the unstable inhibitor of the systems are short polypeptides. This family corresponds to the toxin.	5.39819e-28

>NC_009467.1|WP_011930462.1|156235_156514_-|plasmid-maintenance-system-killer
MILSFRHKGLEAFYRTGSMRGIQAAQAGKLKRILGLLDVAQTPQDMNIPAFKLHPLKGDLAGHWSVWVNGNWRVTFRFVEAGVELVNYQDYH
>NC_009467.1|WP_011930463.1|155936_156224_-|HigA-family-addiction-module-antidote-protein
MMNNPPHPGELLREDVIGELGLSVTEAAQRLAMSRAALSRVLNARAAISPDLAIRLEQAGVSTAQAWLGMQANYDLWLARQHQQPPVRRFQENAA
>NC_009467.1|WP_011930464.1|155098_155764_+|metalloregulator-ArsR/SmtB-family-transcription-factor
MKSSSGPKQQIFSHLAEIAAALAHPHRIEIIELIAQGERSVEDLAERIGLSLSNTSRHLQVLRRARLAAPRREGKNMFYSLVSETEVVTLLGSLGRVGERNIAEIDQVLQAYFRARDSLEPVSRLTLLERLREGSVTLLDVRPADEFARGHLPGALNIPLDQLDAALGHFTENIPVVAYCRGPYCVLSYEAVAQLRARGVQASRLEDGYPEWKGAGLPIET
>NC_009467.1|WP_011930465.1|154281_155013_-|MBL-fold-metallo-hydrolase
MILRQFLHTDPTAASYLLGCVGKGAGVVVDPLFPIEPYLQAASASATPIRQVIDTHLHADHRSAGRALAEAAGAEYAIHESAKVGYACRRLADGERLELGNVVLEVLHTPGHTPEHLCLTVTDRTRADEPWSVLGGHTLMVGDVGRTELATDAARGARDLFASLVRLKALPDHIEVLPGALAGSVCGRGLSGKPVSTIGFERRYNPAFRIDDAERFVAFMLENIPPAPEGAAELRAWNAGFTA
>NC_009467.1|WP_081432813.1|153037_154285_-|MFS-transporter
MTTVANASDHIRGIAANRGQFTLQALQVFFVGLVIGMERAVLPTLAHEFGVAPGAFLFLASFVLSFGLVKGALNLVAGGLADRFGRKPVLIAGWIAAIPIPLLIWAAPNWWWIVIANVFLGISQGFTWTMTVTSQIDLAGSHQRGLAVGINEATGYVAVGLAGAVAALLAEAVGARNALLIFGMATIVLAFATITRVRDTLAWVKAEHAEAGAGASQDHTLTLREIFVRISFRDRVGRAICQGGIVNKIADTLVWVMFPLFFKSHGAKLIEIGWLTGTYAMVWGVSQLWTGHLGDRVGRRAPVIVGFFLLAAGIAITAAGRDASLWLPGAIVMGLGMALLYPNLIAAMSDRAAPLIRGKALGTYRYWRDTGYALGAVALGLIAQFAQATLPTLWITAVLVAGSGIWLMRDLPRPQ
>NC_009467.1|WP_081432812.1|152599_153028_+|helix-turn-helix-domain-containing-protein
MSGGFLAIGELGRQTATRVETIRYYERIGLLPAPARTAGNYRAYGPEHLNRLSFIRRSRDLGFSLDQVRALLDLADERARSCEAVDAIARDHLAEIDRKIADLRALRRELGNMISQCRQGTVAECRIIDALSPGASQKKRRK
>NC_009467.1|WP_011930468.1|151499_152534_-|E1-E2-ATPase-associated-domain-containing-protein
MAAAISVKLKIEGMDCGGCAVKIENAMKRLPGVTDVSVSFSTASLSLMLDEDRTARTMIEARIRALGFTPLGGTRQADADKVRTESASGNVWWKTRKVRLVGVTGLLLALGFVVTQAEPAWSPWPYVAAALVGLLPIVRRALAGMRTGTPFTMETLMSIASIGALAIGEGADAAIVVFLFALGELLEGVAAGRARAGIEGLIGLVPRTARRVRGDAIETVPVETLAIGDVVTVRAGDRVPSDGTVVGGTSQVNEAPVTGESAPVVKAEGAPVYAGSIAGHGELRIEITRTSADNTIARIIHMVEEAQATKAPTARFIDRFSRWYTPAAMAFSALVMLGPPVDFH
>NC_009467.1|WP_011930469.1|149875_151402_-|IS21-family-transposase
MAFLSIIRRWHKREYVPIREISRRLGVSRNTIRKYLRSDQIEPKFQVPDRPSKLDPYAEKLALWLRREGNRPRKQRRTVKQLHGDLVSLGYDGSYNRVAAFARAWKEECKLLQQTAGRGTFVPLSFAPGEAFQFDWSEDFAVIGSARVKLQVAHTKLCYSRAFIIRAYLLQTHEMLFDAHNHAFRALGGVPRRGIYDNMSTAVDKVGRGKERSVNLRFQAMTSHYLFEPDFCNRAAGWEKGQVEKNVQDARHRLWQSMPPFETLDALNDWLEQRCRELWEQTAHGGEPGSIADVWAQEVESLMPVGRPFDGFVEFTKRVSSTCLIHLERNRYSVPASFANRPVSLRVYPNRLVVAAEGQIICEHPRVVERTHGPGRTIYDWRHYLAVIQRKPGALRNGAPFLELPDAFRHLQRHLLQHPGGDRDMVEILALVLHHDEQLVLMAAELALADGVPSKTHILNRLHRLIDGKQAPPPVITAPQALTLAHEPRADVERYDTLRQTGETRHAS
>NC_009467.1|WP_011930470.1|149079_149886_-|ATP-binding-protein
MRHDPAAGALVIMLRSLKMHGMAQAVDELAQQGAPAFEAAIPVLSQLLKAETAEREVRSMAYQLKAARFPAYRDLAGFDFASSEVNEALVRQLHRCDFIEPADNVVLVGGPGTGKTHIATALGVQAVEHHKKRIRFFSTVELVNALEQEKAQGKAGQIAGRLIHADLVILDELGYLPFSASGGALLFHLLSKLYERTSVAITTNLSFSEWAAVFGDAKMTTALLDRLTHHCHILETGNDSFRFKNSSVQKSQNERRKAALDPIMKPKS
>NC_009467.1|WP_081432811.1|147822_149052_-|heavy-metal-translocating-P-type-ATPase
MPGSLLSGNQQGPPLALGADWFTWIYRGLAVLLIACPCALVISTPAAIASGLASGARYGLLIKGGAALETLGKIRTVAFDKTGTLTMGQPQVTDVVPVEGDVANVLAKAAAVERGSSHPLGAAIVKEAELRGLDMPRVFGGTVAAPGKSVMGRISSGFVTVASPLHAAEQALLDDTAQERISALEDEGKTVVTVCEGKRLIGLIALRDELRADASEAVRTLRALGIRPVMLTGDNLRCAQGIADAAGIEVRASLLPDDKLAAISGYKAEAPIAMVGDGINDAPALAASSVGVAMGSGTDVALETADAALLKNRVTGVAEMVTLSRATIINIWQNIALALGLKSVFLVTSLSGITPLWMAILADTGATVLVTANALRLLRFKPQTQENAIIVHSSINANGSRPKISSQIA
>NC_009467.1|WP_011930460.1|159793_161017_+|IS256-family-transposase
MARRRAPAIPDELLDQLLAGGDAAAALNSGDLVNALKKALAERALSAEMDYHLSDEAEAENSRNGYGRKSVSTGTGKIEIAIPRDRAGSFDPQLIAKYQRRFPGFDDKIISMYARGMSTREIAEHLREIYGMDASAELISTITDAVLDEVTSWQQRPLDPVYPLVFFDAIRVKIRDEGVVRNKAIHIALGVMADGTKVVLGMWIEQNEGAKFWLRVMNELKNRGVEDILLAVVDGLKGFPEAITAVFPETIVQTCIVHLLRNSMDFVSYKDRKAVAAALKDIYRAVDARAAEAALADFEAGPWGQKYPAIGQSWRRVWQEVIPFFSFPGEVRRIVYTTNAIEALNSKLRRAIRVRGHFPSDEAAAKLLYLILNRSEKEWVMPPREWAMAKAQFAVIFGDRFVRALAA
>NC_009467.1|WP_011930458.1|161919_162135_+|DUF2442-domain-containing-protein
MWITLDDGRVLGVPLAWFPRLFYATPEQRVACRISSRGLHWEGLDEDISIAGLLAGRGNQTHRPRSIPSAA
>NC_009467.1|WP_155856287.1|162131_162305_+|hypothetical-protein
MNRTVPQIDLELEAERRLLEAAVAEARADLRSPVPHEQVRADLLREIKRLNLAIAGH
>NC_009467.1|WP_011930457.1|162307_162586_+|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin
MQVEWHQLALEDRDVIVAYLELLNPNAASSVLRGLVLAGDSLALFPTRGRVGLAAGTRELVAVWPYLIVYEVDTSSDTVRILRIWHEAQERP
>NC_009467.1|WP_011930456.1|162992_163553_+|heme-transporter-CcmB
MLGIIPHTIDQYLKTRVPPEARAGILGRAGFPDGQTFRLDTEYDDESCCALVDAIAAETGTTTEAVFDEISAFFLDWAERTFSGFFKVAPDTRGFLLLQPEIHSSLACGLRASGQRKVADKFRVEALPDGVRIHYRSSNRLGYFYCALAHCLAARRGEVAEISFLDGDVGSAAAIIEVRLKPALAA
>NC_009467.1|WP_011930455.1|163558_165421_+|EAL-domain-containing-protein
MDQAETLDRAAVEALCEAMCGVVSGDLSVRLRTASADLTVQKLSLLANFMLETAQRAVERSLAYAGALDNVQRIARLSAWQLVLPDQEVVPVGTAAGLPDAAAAPLQGTAWFLDRVGPGCRAAMAALFQGDGGTLEWLAADGEAWFRTEVAALRDEGRLAGYLVITQDISERRRATERIRYLAEHDPLTGLANRRRLHEQLEGELEAGRRQGTKFAVHVIDVDRFKTVNDLFGHAAGDRLLVDLATCLRQEARESDMIARIGGDEFVVLQVGIGDARDAGALAGRLVGAVSARLAEPGARALAATVSIGIALAPDDGTTAEALLSHADMALYQVKSTGRNGFAFFNTEINEAQLARRRMEAELRGACERGEMAVHYQPLFEIASDRVVGFEALVRWRRDGEDVSPAVFIPIAEESGSIIEIGRFVLREACREAAGWPVKLRVAVNISALQIQDGGLPDLVATVLEETGLEAGRLELEVTESLLLANAEAATEVLARIRALGVTISLDDFGTGYSSLATLRMFPFDKIKLDRSFVNDLGRLGEAEAIVMAVLGLGRALDVSVVAEGVETEEQAAMLRAAGCSLLQGYLIGRPAPIARFSAEVGRDVTSRMTKTPIPADSPG
>NC_009467.1|WP_011930454.1|165731_166985_-|ISL3-family-transposase
MASSDIFTLGLGLTPPWRVVDQRLETDYQPHELHLAVAADPGARFPCPTCGRLCKPHDWKELSWRHLNFFQHACIIEARVPRTDCPEHGVLRIAVPWARPDSGFTLLFEQAALALMREMPVAAAARIIGVTDQRLWRILRYYVGRAIERLDLSGVEAIALDETAAKRGHSYVTVFIDLDAAERPVLFVTPGKGKECMTAFRAFLAEHGGEARRIAEVVCDMSAAFLAAAAESFPQASVTVDWFHVVQIFTTAVEQVRRAEAHQHNLPKGVRWATLKRPENLTMAQRQALDQLENSGFATAEAYRAKEMLRWVRLAATPQAARWRLTNFLNHVTARLDDPDHLLDPVRQAVDTVRRNAKRIIRRWKSGHSNARLEALNGLFQAARARARGYRNTATFACIIYLLGAPINAMLDVFHST
>NC_009467.1|WP_081432816.1|167327_168134_+|response-regulator-transcription-factor
MSAAFTVYRNNKNNYPYSLCVISYEKDVVKALRSKNIILESIVTADDEAIFYSIFDYEQKDSNYDLCILYSENYSSHVITMLSELKLIIEIPIIVISAVYDEAYAVNILRLGADDYIVNNVGRRDLNVRIERIIKNKKNSRIINDNDINTKKQNSEFDDNILIFNNFYKYFTPNEIKVLNKLVENVGEIVYRQDLSIYTRGYYHKQPDRSVDNLISRIRKKLRLIGISDYQIKSSSSLGYVLVGDGSRFFNELSKNIELYEKSIDTKL
>NC_009467.1|WP_081432817.1|168316_169006_-|PEP-CTERM-sorting-domain-containing-protein
MNMSSVRKYLLHGAVVLLGLTGIARADIYNPTWLVTAWTTTTGKIGGTNFINAASQPAPSAVDALASFTYSGQLNFDNTNNQGQSNTYADFFTNTANISNFSGTGGEAAFLGTTMSSPGSSNYSYLEFSLQGPAANIAAGTYVTITHDDGASSYANGNKVTYSPGETQAVSDTGTLPVGSMTSFAVDYVEANGAPAVLKVDVPEPGSVLLLGTGLLVLGLVVRRRQKTL
>NC_009467.1|WP_011930452.1|169880_170546_-|metalloregulator-ArsR/SmtB-family-transcription-factor
MKSSSGPKQQIFSHLAEIAAALAHPHRIEIIELIAQGERSVEDLAERIGLSVSNTSRHLQILRRARLAAPRREGKNMFYSLVSETEVVTLLGSLGRVGERNIAAIDQVMQAYFRARDSLEPVSRLTLLERLREGSVTLLDVRPPEEFAQGHLPGALNVTLDHLDAMLDSLASRSPIVAYCRGPYCVLSFEAVARLRTRGIEAMRLEEGYPEWKAAGFPVKI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NC_009467_1	1.1\|157807\|23\|NC_009467\|CRISPRCasFinder	157807-157829	23	NC_009467.1	157775-157797	0	1.0
NC_009467_1	1.2\|157855\|26\|NC_009467\|CRISPRCasFinder	157855-157880	26	NC_009468.1	106040-106065	0	1.0

1. spacer 1.1|157807|23|NC_009467|CRISPRCasFinder matches to position: 157775-157797, mismatch: 0, identity: 1.0

ttggagcggggagtagcgggcaa	CRISPR spacer
ttggagcggggagtagcgggcaa	Protospacer
***********************

2. spacer 1.2|157855|26|NC_009467|CRISPRCasFinder matches to position: 106040-106065, mismatch: 0, identity: 1.0

gtcgggcgcggatgacggatgagatc	CRISPR spacer
gtcgggcgcggatgacggatgagatc	Protospacer
**************************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_009467_1	1.1\|157807\|23\|NC_009467\|CRISPRCasFinder	157807-157829	23	NC_009467	Acidiphilium cryptum JF-5 plasmid pACRY01, complete sequence	157775-157797	0	1.0
NC_009467_1	1.1\|157807\|23\|NC_009467\|CRISPRCasFinder	157807-157829	23	NC_009467	Acidiphilium cryptum JF-5 plasmid pACRY01, complete sequence	157807-157829	0	1.0
NC_009467_1	1.2\|157855\|26\|NC_009467\|CRISPRCasFinder	157855-157880	26	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	106040-106065	0	1.0
NC_009467_1	1.2\|157855\|26\|NC_009467\|CRISPRCasFinder	157855-157880	26	NC_009467	Acidiphilium cryptum JF-5 plasmid pACRY01, complete sequence	157855-157880	0	1.0
NC_009467_1	1.2\|157855\|26\|NC_009467\|CRISPRCasFinder	157855-157880	26	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	105989-106014	2	0.923

1. spacer 1.1|157807|23|NC_009467|CRISPRCasFinder matches to NC_009467 (Acidiphilium cryptum JF-5 plasmid pACRY01, complete sequence) position: , mismatch: 0, identity: 1.0

ttggagcggggagtagcgggcaa	CRISPR spacer
ttggagcggggagtagcgggcaa	Protospacer
***********************

2. spacer 1.1|157807|23|NC_009467|CRISPRCasFinder matches to NC_009467 (Acidiphilium cryptum JF-5 plasmid pACRY01, complete sequence) position: , mismatch: 0, identity: 1.0

ttggagcggggagtagcgggcaa	CRISPR spacer
ttggagcggggagtagcgggcaa	Protospacer
***********************

3. spacer 1.2|157855|26|NC_009467|CRISPRCasFinder matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 0, identity: 1.0

gtcgggcgcggatgacggatgagatc	CRISPR spacer
gtcgggcgcggatgacggatgagatc	Protospacer
**************************

4. spacer 1.2|157855|26|NC_009467|CRISPRCasFinder matches to NC_009467 (Acidiphilium cryptum JF-5 plasmid pACRY01, complete sequence) position: , mismatch: 0, identity: 1.0

gtcgggcgcggatgacggatgagatc	CRISPR spacer
gtcgggcgcggatgacggatgagatc	Protospacer
**************************

5. spacer 1.2|157855|26|NC_009467|CRISPRCasFinder matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 2, identity: 0.923

gtcgggcgcggatgacggatgagatc	CRISPR spacer
gtcgggcgcggatgacggatgagagg	Protospacer
************************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

9867 : 85164

Streptococcus_phage(18.18%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011930574.1\|9867_10911_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_011930427.1\|11942_12653_-\|transposase	IS6 family transposase	A0A1X9I6E7	Streptococcus_phage	2.3e-25	38.5
WP_011930570.1\|14155_15196_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_011930569.1\|15616_16633_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_155856271.1\|18462_18726_-	hypothetical protein	NA	NA	NA	NA
WP_011930565.1\|18694_20044_-	Na+/H+ antiporter NhaA	A0A2H4J5W3	uncultured_Caudovirales_phage	1.1e-55	37.3
WP_155856272.1\|20404_20665_-	hypothetical protein	NA	NA	NA	NA
WP_155856273.1\|21364_21517_-	entericidin A/B family lipoprotein	NA	NA	NA	NA
WP_011930564.1\|22308_22620_+	hypothetical protein	NA	NA	NA	NA
WP_011930562.1\|23751_24960_-\|transposase	IS256 family transposase	A0A220NQR7	Corynebacterium_phage	1.0e-94	46.6
WP_043508769.1\|25665_26481_-	glyoxalase	NA	NA	NA	NA
WP_011930559.1\|26465_26924_-	cupin	NA	NA	NA	NA
WP_011930558.1\|26920_27385_-	DoxX family protein	NA	NA	NA	NA
WP_011930556.1\|27998_29513_-	mercuric reductase	NA	NA	NA	NA
WP_011930555.1\|29515_30799_-	hypothetical protein	NA	NA	NA	NA
WP_011930554.1\|30804_32238_-	glycoside hydrolase	NA	NA	NA	NA
WP_011930553.1\|32234_33797_-	GMC family oxidoreductase	NA	NA	NA	NA
WP_011930552.1\|33802_34612_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	2.0e-17	29.8
WP_155856274.1\|35439_35766_+	hypothetical protein	NA	NA	NA	NA
WP_011930549.1\|35853_44382_+	glycosyl transferase	NA	NA	NA	NA
WP_011930548.1\|44515_45322_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_011930547.1\|45388_45715_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_011930546.1\|46127_47306_-	class I SAM-dependent methyltransferase	A0A2I2L5L3	Orpheovirus	1.3e-49	41.3
WP_155856275.1\|47455_47911_-	hypothetical protein	NA	NA	NA	NA
WP_011930506.1\|48368_50351_-	AI-2E family transporter	NA	NA	NA	NA
WP_155856276.1\|50395_51673_-	PHB depolymerase family esterase	NA	NA	NA	NA
WP_011930545.1\|51818_51989_-	CsbD family protein	NA	NA	NA	NA
WP_011930509.1\|52423_52981_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_043508772.1\|53110_53335_-	hypothetical protein	NA	NA	NA	NA
WP_011930511.1\|53348_53687_-	hypothetical protein	NA	NA	NA	NA
WP_155856290.1\|53738_53933_-	hypothetical protein	NA	NA	NA	NA
WP_155856277.1\|55009_55258_-	hypothetical protein	NA	NA	NA	NA
WP_011930539.1\|57097_58138_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_011930538.1\|58471_59488_+\|transposase	IS110 family transposase	A0A1S7J231	Thermus_phage	5.1e-10	27.7
WP_011930501.1\|60648_61905_-\|transposase	IS701 family transposase	NA	NA	NA	NA
WP_155856291.1\|62983_63136_+	entericidin A/B family lipoprotein	NA	NA	NA	NA
WP_155856278.1\|63835_64096_+	hypothetical protein	NA	NA	NA	NA
WP_043508774.1\|64361_64541_+	hypothetical protein	NA	NA	NA	NA
WP_011930535.1\|65814_67458_+\|transposase	IS1634 family transposase	NA	NA	NA	NA
WP_011930533.1\|68002_68251_+	hypothetical protein	NA	NA	NA	NA
WP_011930532.1\|68805_69588_-	ATP-binding protein	A0A059NT77	Lactococcus_phage	4.5e-30	34.7
WP_011930482.1\|70522_71398_-	ATPase AAA	A0A059NT77	Lactococcus_phage	2.5e-29	34.2
WP_011930483.1\|71394_72924_-\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_155856279.1\|73406_73739_+	hypothetical protein	NA	NA	NA	NA
WP_011930530.1\|75371_79709_+	response regulator	A0A1V0SGX0	Hokovirus	1.6e-15	25.1
WP_011930529.1\|80153_81200_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_011930484.1\|82616_83825_+\|transposase	IS256 family transposase	A0A220NQR7	Corynebacterium_phage	3.6e-95	46.8
WP_155856280.1\|84296_84566_+	hypothetical protein	NA	NA	NA	NA
WP_011930527.1\|84453_85164_-\|transposase	IS6 family transposase	A0A1X9I6E7	Streptococcus_phage	3.0e-25	38.5

DBSCAN-SWA_2

94195 : 161017

Corynebacterium_phage(13.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011930484.1\|94195_95404_-\|transposase	IS256 family transposase	A0A220NQR7	Corynebacterium_phage	3.6e-95	46.8
WP_081432806.1\|96209_96482_+	hypothetical protein	NA	NA	NA	NA
WP_011930514.1\|96949_97573_+\|transposase	ISAs1 family transposase	NA	NA	NA	NA
WP_155856292.1\|97407_98121_+\|transposase	ISAs1 family transposase	NA	NA	NA	NA
WP_155856290.1\|98879_99074_+	hypothetical protein	NA	NA	NA	NA
WP_011930511.1\|99125_99464_+	hypothetical protein	NA	NA	NA	NA
WP_043508772.1\|99477_99702_+	hypothetical protein	NA	NA	NA	NA
WP_011930509.1\|99831_100389_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_011930545.1\|100823_100994_+	CsbD family protein	NA	NA	NA	NA
WP_155856276.1\|101139_102417_+	PHB depolymerase family esterase	NA	NA	NA	NA
WP_011930506.1\|102461_104444_+	AI-2E family transporter	NA	NA	NA	NA
WP_043508783.1\|104656_105076_-	DUF3141 domain-containing protein	NA	NA	NA	NA
WP_043508784.1\|105466_105886_-	hypothetical protein	NA	NA	NA	NA
WP_011930502.1\|106951_107788_+	slipin family protein	A0A0U2UF06	Niemeyer_virus	7.2e-26	32.5
WP_011930501.1\|108037_109294_+\|transposase	IS701 family transposase	NA	NA	NA	NA
WP_011930499.1\|111081_111759_+	hypothetical protein	NA	NA	NA	NA
WP_011930498.1\|111776_112193_+	hypothetical protein	NA	NA	NA	NA
WP_011930497.1\|112482_114747_+	DUF3141 domain-containing protein	NA	NA	NA	NA
WP_011930496.1\|114876_117558_+	plasma-membrane proton-efflux P-type ATPase	M1HBF8	Paramecium_bursaria_Chlorella_virus	1.5e-48	25.6
WP_011941795.1\|117811_118843_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_011930494.1\|118967_119774_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_099156038.1\|120082_120715_-\|transposase	IS6-like element ISAcr2 family transposase	A0A077SL39	Escherichia_phage	2.2e-83	66.8
WP_081432807.1\|120747_120924_+\|transposase	transposase	NA	NA	NA	NA
WP_011930491.1\|121947_123171_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	1.2e-40	45.1
WP_011930489.1\|123842_124535_-	cyclic nucleotide-binding domain-containing protein	NA	NA	NA	NA
WP_155856283.1\|125943_126285_+	hypothetical protein	NA	NA	NA	NA
WP_043508786.1\|126526_126730_-	hypothetical protein	NA	NA	NA	NA
WP_011930488.1\|127228_128599_+	Na+/H+ antiporter NhaA	A0A2H4J5W3	uncultured_Caudovirales_phage	2.4e-55	37.3
WP_081432809.1\|129083_129350_+	DUF2147 domain-containing protein	NA	NA	NA	NA
WP_011930487.1\|129491_130319_+	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_011930486.1\|130376_130631_-	hypothetical protein	NA	NA	NA	NA
WP_155856284.1\|130925_131180_+	hypothetical protein	NA	NA	NA	NA
WP_011930485.1\|131325_131589_-	zinc-binding dehydrogenase	NA	NA	NA	NA
WP_011930484.1\|131728_132937_+\|transposase	IS256 family transposase	A0A220NQR7	Corynebacterium_phage	3.6e-95	46.8
WP_155856285.1\|132933_133350_+	hypothetical protein	NA	NA	NA	NA
WP_011930483.1\|133464_134994_+\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_011930482.1\|134990_135866_+	ATPase AAA	A0A059NT77	Lactococcus_phage	2.5e-29	34.2
WP_011930481.1\|135928_137575_-\|transposase	IS1634 family transposase	NA	NA	NA	NA
WP_155856286.1\|138165_138375_-	hypothetical protein	NA	NA	NA	NA
WP_011930479.1\|138371_139010_-	hypothetical protein	NA	NA	NA	NA
WP_043508788.1\|139095_144195_-	relaxase domain-containing protein	NA	NA	NA	NA
WP_011930477.1\|144188_144527_-	hypothetical protein	NA	NA	NA	NA
WP_081432810.1\|144790_145345_+	hypothetical protein	NA	NA	NA	NA
WP_011930475.1\|145354_146245_+	hypothetical protein	NA	NA	NA	NA
WP_011930474.1\|146460_146946_+	hypothetical protein	NA	NA	NA	NA
WP_011930473.1\|146950_147355_+	hypothetical protein	NA	NA	NA	NA
WP_081432811.1\|147822_149052_-	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	5.7e-72	44.4
WP_011930470.1\|149079_149886_-	ATP-binding protein	A0A059NT77	Lactococcus_phage	4.9e-32	32.9
WP_011930469.1\|149875_151402_-\|transposase	IS21 family transposase	U5N3F9	Enterobacteria_phage	1.4e-19	25.6
WP_011930468.1\|151499_152534_-	E1-E2 ATPase-associated domain-containing protein	E4ZFI9	Streptococcus_phage	1.1e-44	34.9
WP_081432812.1\|152599_153028_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_081432813.1\|153037_154285_-	MFS transporter	NA	NA	NA	NA
WP_011930465.1\|154281_155013_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_011930464.1\|155098_155764_+	metalloregulator ArsR/SmtB family transcription factor	NA	NA	NA	NA
WP_011930463.1\|155936_156224_-	HigA family addiction module antidote protein	A0A0M3LPV0	Mannheimia_phage	1.5e-12	41.6
WP_011930462.1\|156235_156514_-	plasmid maintenance system killer	A0A2L1IV28	Escherichia_phage	5.8e-17	41.3
WP_011930460.1\|159793_161017_+\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	4.7e-42	45.7

Anti-CRISPR protein detection

Acr_ID: NC_009467.1|WP_155856283.1|125943_126285_+|hypothetical-protein

Click the colored protein region to show detailed information

Acr_ID: NC_009467.1|WP_043508786.1|126526_126730_-|hypothetical-protein

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

NC_009467.1|WP_155856283.1|125943_126285_+|hypothetical-protein

125943_126285_+

113 aa aa

94195-161017

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
NC_009467_1	Orphan	1.1\|157807\|23\|NC_009467\|CRISPRCasFinder	157807-157829	23	157775-157797	0

1. spacer 1.1|157807|23|NC_009467|CRISPRCasFinder matches to NC_009467 position: 157775-157797, mismatch: 0

ttggagcggggagtagcgggcaa	CRISPR spacer
ttggagcggggagtagcgggcaa	Protospacer
***********************

NC_009467.1|WP_043508786.1|126526_126730_-|hypothetical-protein

126526_126730_-

67 aa aa

94195-161017

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
NC_009467_1	Orphan	1.1\|157807\|23\|NC_009467\|CRISPRCasFinder	157807-157829	23	157775-157797	0

1. spacer 1.1|157807|23|NC_009467|CRISPRCasFinder matches to NC_009467 position: 157775-157797, mismatch: 0

ttggagcggggagtagcgggcaa	CRISPR spacer
ttggagcggggagtagcgggcaa	Protospacer
***********************

5. NC_009469

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

12625 : 45584

Acidithiobacillus_phage(14.29%)

transposase,integrase

attL 14909:14926|attR 45219:45236

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155856318.1\|12625_13633_+\|transposase	ISAs1 family transposase	NA	NA	NA	NA
WP_011930760.1\|13616_14444_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_011930761.1\|14665_15412_-	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	3.8e-63	49.4
14909:14926	attL	NA	NA	NA	NA
WP_011930648.1\|15429_16977_-\|transposase	IS21 family transposase	K4I413	Acidithiobacillus_phage	5.1e-126	47.9
WP_011930454.1\|17436_18690_+\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_138919284.1\|19342_19432_+	potassium-transporting ATPase subunit F	NA	NA	NA	NA
WP_155856319.1\|19437_19578_+	hypothetical protein	NA	NA	NA	NA
WP_011930762.1\|19599_21297_+	potassium-transporting ATPase subunit KdpA	NA	NA	NA	NA
WP_011930763.1\|21308_23345_+	potassium-transporting ATPase subunit KdpB	E4ZFI9	Streptococcus_phage	7.8e-34	27.3
WP_007425088.1\|23360_23960_+	potassium-transporting ATPase subunit KdpC	NA	NA	NA	NA
WP_007425087.1\|23976_24477_+	hypothetical protein	NA	NA	NA	NA
WP_011930764.1\|24584_25796_+	outer membrane beta-barrel protein	NA	NA	NA	NA
WP_011930765.1\|26085_28689_+	sensor histidine kinase KdpD	Q8QNA2	Ectocarpus_siliculosus_virus	5.2e-06	26.5
WP_011930766.1\|28685_29381_+	response regulator transcription factor	W8CYM9	Bacillus_phage	4.3e-24	29.0
WP_011930768.1\|29817_32808_-\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	1.9e-246	45.6
WP_011930769.1\|32746_33406_-	recombinase family protein	A0A0A7NPV4	Enterobacteria_phage	4.7e-41	52.0
WP_007425034.1\|34258_34534_-	hypothetical protein	NA	NA	NA	NA
WP_011930771.1\|34956_35931_+	recombinase family protein	A0A286S1P7	Klebsiella_phage	1.6e-32	46.4
WP_007424223.1\|36269_37616_+\|transposase	IS1380-like element ISAcr4 family transposase	NA	NA	NA	NA
WP_043508964.1\|37750_37969_+	WGR domain-containing protein	NA	NA	NA	NA
WP_011930772.1\|38073_38616_-	hypothetical protein	A0A1B1IRD0	uncultured_Mediterranean_phage	9.4e-11	42.5
WP_011930773.1\|38618_39611_-\|integrase	site-specific integrase	A0A1P8DJ76	Virus_Rctr85	2.4e-12	31.2
WP_011930774.1\|39607_40549_-\|integrase	tyrosine-type recombinase/integrase	A0A1B1P7C7	Bacillus_phage	2.6e-08	26.1
WP_011930775.1\|40545_41757_-\|integrase	tyrosine-type recombinase/integrase	A0A1L4BKH1	Thermus_phage	8.5e-12	32.8
WP_043508965.1\|41816_42509_-	DUF1738 domain-containing protein	A0A1B1IWW8	uncultured_Mediterranean_phage	3.9e-09	28.0
WP_043508966.1\|42498_42687_-	hypothetical protein	NA	NA	NA	NA
WP_155856320.1\|43209_44712_+\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_011930778.1\|44708_45584_+	ATPase AAA	A0A059NT77	Lactococcus_phage	1.4e-27	33.5
45219:45236	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage