CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NC_009508	Sphingomonas wittichii RW1 plasmid pSWIT02, complete sequence	0 crisprs	RT,cas3	0	2
NC_009507	Sphingomonas wittichii RW1 plasmid pSWIT01, complete sequence	0 crisprs	NA	0	0
NC_009511	Sphingomonas wittichii RW1, complete sequence	1 crisprs	WYL,csa3,cas3,DEDDh,DinG	1	2

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

12708 : 27570

Mycobacterium_phage(25.0%)

transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011950708.1\|12708_13521_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_011950763.1\|13642_14464_+\|transposase	IS5 family transposase	A0A0M5M147	Mycobacterium_phage	1.6e-06	28.7
WP_011950708.1\|14784_15597_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_158305182.1\|16151_16928_+	FCD domain-containing protein	NA	NA	NA	NA
WP_011950841.1\|17010_17895_+	2,2',3-trihydroxybiphenyl dioxygenase	NA	NA	NA	NA
WP_011950396.1\|18797_20171_-\|transposase	IS1182 family transposase	NA	NA	NA	NA
WP_086014484.1\|21497_22669_-\|transposase	IS3-like element ISSpwi1 family transposase	S5WIU1	Leptospira_phage	1.7e-36	38.0
WP_011950834.1\|23462_24674_+\|transposase	IS256 family transposase	A0A220NQR7	Corynebacterium_phage	3.0e-97	48.0
WP_011950833.1\|24702_24948_-	hypothetical protein	NA	NA	NA	NA
WP_011950832.1\|25041_26328_+\|transposase	IS21 family transposase	U5N3F9	Enterobacteria_phage	1.5e-38	33.3
WP_041380262.1\|27186_27570_+\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_2

95974 : 151177

Paenibacillus_phage(33.33%)

transposase,integrase

attL 106070:106085|attR 147275:147290

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011950768.1\|95974_97468_+\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_007686288.1\|97464_98232_+	ATP-binding protein	A0A059NT77	Lactococcus_phage	2.9e-42	39.2
WP_041380290.1\|98304_98568_+	hypothetical protein	NA	NA	NA	NA
WP_148219021.1\|98905_99760_+	hypothetical protein	NA	NA	NA	NA
WP_158305187.1\|99897_101979_+	family 16 glycosylhydrolase	NA	NA	NA	NA
WP_011950763.1\|102430_103252_+\|transposase	IS5 family transposase	A0A0M5M147	Mycobacterium_phage	1.6e-06	28.7
WP_081435222.1\|103253_104537_+	carbamoyltransferase	E3SK81	Synechococcus_phage	4.5e-27	30.2
WP_011950761.1\|104869_107515_+	AAA family ATPase	NA	NA	NA	NA
106070:106085	attL	NA	NA	NA	NA
WP_041380291.1\|107622_108162_-	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	B3FJI5	Pseudomonas_phage	8.7e-25	47.0
WP_011950759.1\|108443_109355_-	Abi family protein	A0A059NT88	Lactococcus_phage	4.7e-15	27.5
WP_041380293.1\|109546_110656_+	DNA repair exonuclease	NA	NA	NA	NA
WP_011950757.1\|110652_113298_+	AAA family ATPase	NA	NA	NA	NA
WP_011950755.1\|114315_115146_-	type IV toxin-antitoxin system AbiEi family antitoxin domain-containing protein	NA	NA	NA	NA
WP_041380295.1\|115399_116158_-	DNA transfer protein	NA	NA	NA	NA
WP_041380357.1\|116345_118316_-	type IV secretory system conjugative DNA transfer family protein	NA	NA	NA	NA
WP_011950752.1\|118323_119328_-	P-type DNA transfer ATPase VirB11	NA	NA	NA	NA
WP_011950751.1\|119331_120549_-	type IV secretion system protein VirB10	NA	NA	NA	NA
WP_011950750.1\|120554_121412_-	P-type conjugative transfer protein VirB9	NA	NA	NA	NA
WP_011950749.1\|121408_122098_-	conjugal transfer protein TraJ	NA	NA	NA	NA
WP_011950748.1\|122432_123377_-	type IV secretion system protein	NA	NA	NA	NA
WP_041380297.1\|123391_123610_-	EexN family lipoprotein	NA	NA	NA	NA
WP_011950747.1\|123606_124323_-	type IV secretion system protein	NA	NA	NA	NA
WP_011950746.1\|124327_126745_-	VirB4 family type IV secretion/conjugal transfer ATPase	NA	NA	NA	NA
WP_011950745.1\|126737_127073_-	VirB3 family type IV secretion system protein	NA	NA	NA	NA
WP_011950744.1\|127083_127425_-	TrbC/VirB2 family protein	NA	NA	NA	NA
WP_011950743.1\|127421_128096_-	lytic transglycosylase domain-containing protein	NA	NA	NA	NA
WP_081435223.1\|128092_128455_-	hypothetical protein	NA	NA	NA	NA
WP_041380358.1\|128697_129456_-	autoinducer binding domain-containing protein	NA	NA	NA	NA
WP_011950741.1\|129718_130285_+	hypothetical protein	NA	NA	NA	NA
WP_086014485.1\|132215_132973_-\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	2.0e-22	40.4
WP_167535078.1\|133172_134675_-	CoA-acylating methylmalonate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_011950737.1\|134766_135651_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_011950736.1\|135735_136938_-	3-oxoadipyl-CoA thiolase	NA	NA	NA	NA
WP_011950735.1\|136942_137713_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_011950733.1\|138413_139124_-	CoA transferase subunit A	NA	NA	NA	NA
WP_148219016.1\|140066_142490_-	TonB-dependent receptor	NA	NA	NA	NA
WP_011950729.1\|142569_143028_+	N-acyl-L-homoserine lactone synthetase-like protein	NA	NA	NA	NA
WP_049771342.1\|143834_145175_+\|integrase	site-specific integrase	A0A077KET4	Ralstonia_phage	1.2e-86	44.4
WP_086014486.1\|145948_146705_+\|transposase	IS5 family transposase	A0A0N9SJT9	Paenibacillus_phage	1.0e-10	38.0
WP_011950725.1\|146867_147692_+	SDR family oxidoreductase	NA	NA	NA	NA
147275:147290	attR	NA	NA	NA	NA
WP_011950724.1\|147748_148486_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_011950723.1\|148478_149234_+	aldolase	NA	NA	NA	NA
WP_011950722.1\|149245_150268_+	cupin domain-containing protein	NA	NA	NA	NA
WP_086014486.1\|150419_151177_-\|transposase	IS5 family transposase	A0A0N9SJT9	Paenibacillus_phage	1.0e-10	38.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NC_009511

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_009511_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_009511_1

1477011-1477104

Orphan

Consensus_repeat	Method
TTCCTCCCCGCGGCGCCTTGCAGCGCCGAG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_009511_1

>merge|NC_009511|1|1477011-1477104|CRISPRCasFinder
TTCCTCCCCGCGGCGCCTTGCAGCGCCGAGCAAATCGGGCGGACAGCCCCCGGCTGTCCGCTAGTTCCTCCCCGCGGCGCCTTGCGGCGCCGAG

>NC_009511|1|1|1477011-1477104|CRISPRCasFinder
TTCCTCCCCGCGGCGCCTTGCAGCGCCGAG	CAAATCGGGCGGACAGCCCCCGGCTGTCCGCTAG
TTCCTCCCCGCGGCGCCTTGCGGCGCCGAG

Protein	Signature genes	Signature genes Name	Protein_function
NC_009511.1\|WP_011952162.1\|1476045_1476474_+\|type-II-toxin-antitoxin-system-VapC-family-toxin	unknown	unknown	gnl\|CDD\|350222
NC_009511.1\|WP_011952167.1\|1481476_1483609_-\|S9-family-peptidase	unknown	unknown	gnl\|CDD\|224422
NC_009511.1\|WP_011952164.1\|1477145_1478738_-\|glutamine-hydrolyzing-GMP-synthase	unknown	unknown	gnl\|CDD\|234614
NC_009511.1\|WP_011952163.1\|1476504_1476873_-\|YciI-family-protein	unknown	unknown	gnl\|CDD\|226318
NC_009511.1\|WP_011952155.1\|1468324_1468732_-\|succinate-dehydrogenase,-cytochrome-b556-subunit	unknown	unknown	gnl\|CDD\|239579
NC_009511.1\|WP_011952169.1\|1484323_1485385_-\|DNA-directed-RNA-polymerase-subunit-alpha	unknown	unknown	gnl\|CDD\|235359
NC_009511.1\|WP_011952159.1\|1472209_1475224_+\|GGDEF-domain-containing-protein	unknown	unknown	gnl\|CDD\|143635
NC_009511.1\|WP_011952160.1\|1475231_1475678_-\|EVE-domain-containing-protein	unknown	unknown	gnl\|CDD\|376640
NC_009511.1\|WP_011952156.1\|1468899_1470159_+\|methyl-accepting-chemotaxis-sensory-transducer	unknown	unknown	gnl\|CDD\|214599
NC_009511.1\|WP_011952158.1\|1471085_1472063_+\|50S-ribosomal-protein-L11-methyltransferase	unknown	unknown	gnl\|CDD\|225173
NC_009511.1\|WP_011952173.1\|1487745_1489107_-\|NADP-specific-glutamate-dehydrogenase	unknown	unknown	gnl\|CDD\|181834
NC_009511.1\|WP_011952165.1\|1478846_1479326_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|236466
NC_009511.1\|WP_011952161.1\|1475806_1476049_+\|type-II-toxin-antitoxin-system-Phd/YefM-family-antitoxin	unknown	unknown	gnl\|CDD\|226603
NC_009511.1\|WP_011952171.1\|1485919_1486288_-\|30S-ribosomal-protein-S13	unknown	unknown	gnl\|CDD\|235358
NC_009511.1\|WP_011952168.1\|1483724_1484147_-\|50S-ribosomal-protein-L17	unknown	unknown	gnl\|CDD\|235522
NC_009511.1\|WP_011952172.1\|1486575_1487706_+\|acyltransferase	unknown	unknown	gnl\|CDD\|224748
NC_009511.1\|WP_011952170.1\|1485467_1485857_-\|30S-ribosomal-protein-S11	unknown	unknown	gnl\|CDD\|180007
NC_009511.1\|WP_148218884.1\|1479423_1481313_-\|PQQ-binding-like-beta-propeller-repeat-protein	unknown	unknown	gnl\|CDD\|199835
NC_009511.1\|WP_041379058.1\|1470385_1471096_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|212491
NC_009511.1\|WP_011952154.1\|1467935_1468325_-\|succinate-dehydrogenase,-hydrophobic-membrane-anchor-protein	unknown	unknown	gnl\|CDD\|239575

Protein	Function_ID	Function_description	E-value
NC_009511.1\|WP_011952162.1\|1476045_1476474_+\|type-II-toxin-antitoxin-system-VapC-family-toxin	gnl\|CDD\|350222	cd09874, PIN_MT3492-like, VapC-like PIN domain of the hypothetical protein MT3492 of Mycobacterium tuberculosis CDC1551 and other uncharacterized, annotated PilT protein domain proteins. Virulence associated protein C (VapC)-like PIN (PilT N terminus) domain of Mycobacterium tuberculosis CDC1551, hypothetical protein MT3492, and similar bacterial and archaeal proteins are included in this subfamily. They are PIN domain homologs of the Mycobacterium tuberculosis VapC and Neisseria gonorrhoeae FitB toxins of the prokaryotic toxin/antitoxin operons, VapBC and FitAB, respectively, which are believed to be involved in growth inhibition by regulating translation. These toxins are nearly always co-expressed with an antitoxin, a cognate protein inhibitor, forming an inert protein complex. Disassociation of the protein complex activates the ribonuclease activity of the toxin by an, as yet undefined mechanism. The PIN domain belongs to a large nuclease superfamily. The structural properties of the PIN (PilT N terminus) domain indicate its active center, consisting of three highly conserved catalytic residues which coordinate metal ions, in some members, additional metal coordinating residues can be found. Some members of the superfamily lack several of these key catalytic residues. The PIN active site is geometrically similar in the active center of structure-specific 5' nucleases, PIN-domain ribonucleases of eukaryotic rRNA editing proteins, and bacterial toxins of toxin-antitoxin (TA) operons.	2.99049e-39
NC_009511.1\|WP_011952167.1\|1481476_1483609_-\|S9-family-peptidase	gnl\|CDD\|224422	COG1505, COG1505, Serine proteases of the peptidase family S9A [Amino acid transport and metabolism].	0
NC_009511.1\|WP_011952164.1\|1477145_1478738_-\|glutamine-hydrolyzing-GMP-synthase	gnl\|CDD\|234614	PRK00074, guaA, GMP synthase; Reviewed.	0
NC_009511.1\|WP_011952163.1\|1476504_1476873_-\|YciI-family-protein	gnl\|CDD\|226318	COG3795, COG3795, Uncharacterized protein conserved in bacteria [Function unknown].	4.31917e-41
NC_009511.1\|WP_011952155.1\|1468324_1468732_-\|succinate-dehydrogenase,-cytochrome-b556-subunit	gnl\|CDD\|239579	cd03499, SQR_TypeC_SdhC, Succinate:quinone oxidoreductase (SQR) Type C subfamily, Succinate dehydrogenase C (SdhC) subunit; composed of bacterial SdhC and eukaryotic large cytochrome b binding (CybL) proteins. SQR catalyzes the oxidation of succinate to fumarate coupled to the reduction of quinone to quinol. Members of this family reduce high potential quinones such as ubiquinone. SQR is also called succinate dehydrogenase or Complex II, and is part of the citric acid cycle and the aerobic respiratory chain. SQR is composed of a flavoprotein catalytic subunit, an iron-sulfur protein and one or two hydrophobic transmembrane subunits. Proteins in this subfamily are classified as Type C SQRs because they contain two transmembrane subunits and one heme group. The heme and quinone binding sites reside in the transmembrane subunits. The SdhC or CybL protein is one of the two transmembrane subunits of bacterial and eukaryotic SQRs. The two-electron oxidation of succinate in the flavoprotein active site is coupled to the two-electron reduction of quinone in the membrane anchor subunits via electron transport through FAD and three iron-sulfur centers. The reversible reduction of quinone is an essential feature of respiration, allowing transfer of electrons between respiratory complexes.	2.14774e-35
NC_009511.1\|WP_011952169.1\|1484323_1485385_-\|DNA-directed-RNA-polymerase-subunit-alpha	gnl\|CDD\|235359	PRK05182, PRK05182, DNA-directed RNA polymerase subunit alpha; Provisional.	0
NC_009511.1\|WP_011952159.1\|1472209_1475224_+\|GGDEF-domain-containing-protein	gnl\|CDD\|143635	cd01949, GGDEF, Diguanylate-cyclase (DGC) or GGDEF domain. Diguanylate-cyclase (DGC) or GGDEF domain: Originally named after a conserved residue pattern, and initially described as a domain of unknown function 1 (DUF1). This domain is widely present in bacteria, linked to a wide range of non-homologous domains in a variety of cell signaling proteins. The domain shows homology to the adenylyl cyclase catalytic domain. This correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate. Together with the EAL domain, GGDEF might be involved in regulating cell surface adhesion in bacteria.	3.78847e-55
NC_009511.1\|WP_011952160.1\|1475231_1475678_-\|EVE-domain-containing-protein	gnl\|CDD\|376640	pfam01878, EVE, EVE domain. This domain was formerly known as DUF55. Crystal structures have shown that this domain is part of the PUA superfamily. This domain has been named EVE and is thought to be RNA-binding.	1.04236e-54
NC_009511.1\|WP_011952156.1\|1468899_1470159_+\|methyl-accepting-chemotaxis-sensory-transducer	gnl\|CDD\|214599	smart00283, MA, Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer). Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.	1.68513e-34
NC_009511.1\|WP_011952158.1\|1471085_1472063_+\|50S-ribosomal-protein-L11-methyltransferase	gnl\|CDD\|225173	COG2264, PrmA, Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis].	8.41873e-69
NC_009511.1\|WP_011952173.1\|1487745_1489107_-\|NADP-specific-glutamate-dehydrogenase	gnl\|CDD\|181834	PRK09414, PRK09414, NADP-specific glutamate dehydrogenase.	0
NC_009511.1\|WP_011952165.1\|1478846_1479326_-\|hypothetical-protein	gnl\|CDD\|236466	PRK09325, PRK09325, coenzyme F420-reducing hydrogenase subunit beta; Validated.	0.000854437
NC_009511.1\|WP_011952161.1\|1475806_1476049_+\|type-II-toxin-antitoxin-system-Phd/YefM-family-antitoxin	gnl\|CDD\|226603	COG4118, Phd, Antitoxin of toxin-antitoxin stability system [Cell division and chromosome partitioning].	2.71043e-13
NC_009511.1\|WP_011952171.1\|1485919_1486288_-\|30S-ribosomal-protein-S13	gnl\|CDD\|235358	PRK05179, rpsM, 30S ribosomal protein S13; Validated.	2.18157e-81
NC_009511.1\|WP_011952168.1\|1483724_1484147_-\|50S-ribosomal-protein-L17	gnl\|CDD\|235522	PRK05591, rplQ, 50S ribosomal protein L17; Validated.	2.925e-64
NC_009511.1\|WP_011952172.1\|1486575_1487706_+\|acyltransferase	gnl\|CDD\|224748	COG1835, COG1835, Predicted acyltransferases [Lipid metabolism].	1.17823e-24
NC_009511.1\|WP_011952170.1\|1485467_1485857_-\|30S-ribosomal-protein-S11	gnl\|CDD\|180007	PRK05309, PRK05309, 30S ribosomal protein S11; Validated.	1.34804e-83
NC_009511.1\|WP_148218884.1\|1479423_1481313_-\|PQQ-binding-like-beta-propeller-repeat-protein	gnl\|CDD\|199835	cd10277, PQQ_ADH_I, Ethanol dehydrogenase, a bacterial quinoprotein (PQQ-dependent type I alcohol dehydrogenase). This bacterial family of homodimeric ethanol dehydrogenases utilize pyrroloquinoline quinone (PQQ) as a cofactor. It represents proteins whose expression may be induced by ethanol, and which are similar to quinoprotein methanol dehydrogenases, but have higher specificities for ethanol and other primary and secondary alcohols. Dehydrogenases with PQQ cofactors, such as ethanol, methanol, and membrane-bound glucose dehydrogenases, form an 8-bladed beta-propeller.	3.72698e-39
NC_009511.1\|WP_041379058.1\|1470385_1471096_+\|SDR-family-oxidoreductase	gnl\|CDD\|212491	cd05233, SDR_c, classical (c) SDRs. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human prostaglandin dehydrogenase (PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, PGDH numbering) and/or an Asn (Asn-107, PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	3.24661e-53
NC_009511.1\|WP_011952154.1\|1467935_1468325_-\|succinate-dehydrogenase,-hydrophobic-membrane-anchor-protein	gnl\|CDD\|239575	cd03495, SQR_TypeC_SdhD_like, Succinate:quinone oxidoreductase (SQR) Type C subfamily, Succinate dehydrogenase D (SdhD) subunit-like; composed of predominantly uncharacterized bacterial proteins with similarity to the E. coli SdhD subunit. One characterized protein is the respiratory Complex II SdhD subunit of the only eukaryotic member, Reclinomonas americana. SQR catalyzes the oxidation of succinate to fumarate coupled to the reduction of quinone to quinol. It is also called succinate dehydrogenase or Complex II, and is part of the citric acid cycle and the aerobic respiratory chain. SQR is composed of a flavoprotein catalytic subunit, an iron-sulfur protein and one or two hydrophobic transmembrane subunits. E. coli SQR is classified as Type C SQRs because it contains two transmembrane subunits and one heme group. The SdhD and SdhC subunits are membrane anchor subunits containing heme and quinone binding sites. The two-electron oxidation of succinate in the flavoprotein active site is coupled to the two-electron reduction of quinone in the membrane anchor subunits via electron transport through FAD and three iron-sulfur centers. The reversible reduction of quinone is an essential feature of respiration, allowing transfer of electrons between respiratory complexes.	2.78142e-31

>NC_009511.1|WP_011952163.1|1476504_1476873_-|YciI-family-protein
MRVMVLVKATEDSEQGFRPTPEALAMFEAMGKFNDELVKAGIMVSGDGLTPSSRGKRVAFDGPGRTVIDGPFAHPNELVAGFWLWQVKDMDEAVAWVKRCPNPMMGPSEIEIRPLYELEDLQ
>NC_009511.1|WP_011952162.1|1476045_1476474_+|type-II-toxin-antitoxin-system-VapC-family-toxin
MTAYLDTSLIVAALSNEATTSRVQGWLAEQDADQLLISDWTITEMSSAMAIKLRTGQIDADHRAAALATFNRLVAESFTVLSITGGHFRTAAKFVDQHALGLRAGDALHLAIASDHGATVQTLDRRLAEAGLSLGVPTRLLA
>NC_009511.1|WP_011952161.1|1475806_1476049_+|type-II-toxin-antitoxin-system-Phd/YefM-family-antitoxin
MDRISLAEAKAHLSELVDRVEAGDSIDITRRGKPVARLTTVAMSRKPIDSALLRSLTETMPPQDESAADLVRSMRDGDRY
>NC_009511.1|WP_011952160.1|1475231_1475678_-|EVE-domain-containing-protein
MAADRRRKEMKVMAASHWLVKSEPNSYSYADLERDGRTVWDGVRNNAAALHLKAMKEGDEVLFYHSQEGLAVVGVARVVRTAFPDATDPAGRFVAVELAPIRALAKPVTLAAMKAEPALAGMAMLRQSRLSVSPVSDAEWDVILKMAA
>NC_009511.1|WP_011952159.1|1472209_1475224_+|GGDEF-domain-containing-protein
MLAMCALAFAAAGPVRAAPRWTNLVTTVFHNYGRDQGLPHPVPTALAQDRDGFIWIGTQGGLTRWDGYRFRAYKADPDVPGSLPDDWVQILHVDPAGTLWIGGGAGGLARYDAPRDRFVRVPLGPSGGRTHIGAIADDGRGGLWVGTDQGLHHLNPANGAVRTTPIAIADAPVRALLRDRSGALWVGTSKGLLRRAPGSAGWTIVALDHAAVSITALYEDVEGRVWIGTQRRGLLLIDRPGARPRAVGEGPILSAGSVSAISPASPRELWVGMRGNGVVAIDVATLQPRFIRHDRTVANSLAHDDVWALLRDKAGSLWVGCMGGLSYHPRTSGLISAMLASENSVDGLSATDPQSVLATRDGRVWMGYLDGGVDVIDPAVGRVAALRPGDSGGHRTILPPDIVFALAEDRWGGVYIGTRRGLYHSGPAADGVRLVPLPGRDPQMSVTALAFDDGVLWVGGDEDGLLGVVPDRAGQPGRVLFGPKDNARLTDDGVNVIRRGLGHDLWIGTRNGLYRLDLATHAIDHIAFDATDRGALPGRNVVAMLIDRRNRLWVGTFGGGLAMMTGRDAAGRWRFHRIGVAQGLPHMNVDSLQMDGSGTIWAGTDDGLARVDPTSFAVRAVRQADGSALVDYYAGAGATSAVGEALFGAKGGLTIVRPGPLPRWTLQPPLVVTDLRIGGVTLPVAQVNQATATAPLTVPPDANSLAVEFAALDYTAPERNHYAYRLDGFDRDWTETDANRRLAIYTNLPPGNYVLRLRGSNRAGVWTERERTLPIRVLPAWYQRLWLKLVGGVLLLLGVAMIVRWRTRYLRRRQADLERQIAERTADLRAANERLGHLALTDPLTGCANRRHFLALAEDQIGAARRGGRPLCLAILDLDEFKAVNDRHGHPGGDAVLEMAGILLLDHLREGDAAGRIGGEEFAILMPNTAIADARLFADRLREAIATARITVDGLSIGVSVSMGVAELCDDEDFGRLYARADTGLYAAKQAGRNRVETVVAPAS
>NC_009511.1|WP_011952158.1|1471085_1472063_+|50S-ribosomal-protein-L11-methyltransferase
MSARRKAEPKGDGVTGFPFAPEREGSWKITLPCTKAEAEMLAGDLPEMAAFDPPPTLMTSEPDPDRPDDWQLDVYVETRPAKALVTAIAALVPSAAGMKPVITHIPEDDWVTLSQSGLEPIHAGRFFVHTPHNADHVPEGMTGFMIDAGRAFGTGHHETTTGCLMMLDQLKRGGLRFDDIADIGTGTGLLAFAARTLWPAARVIASDIDPVSIEVTAENAAVNGVSVGRGRGQVELAVAAGLAHRRLKARLPYDLLIANILAGPLIELAPVFANAVLPGGTVILAGLLDSQAEAVAQAYRRQGFYLAGQIVRGDWPTLRLVKRKR
>NC_009511.1|WP_041379058.1|1470385_1471096_+|SDR-family-oxidoreductase
MTINILATGTSRGIGRAIVDRFADEDVRIVGHRSSDGDDDSIAADLSDPTAPRRIWDQALERLGGRIDVLVNNAGIFEAASIDAPDIAWTEAWNRTMQVNLTAAAELCRLAVLHFRRHGGGRIVNIASRAAHRGDSPAHWHYAASKAGMVAMTKTIARGYAAEGILAFAVCPGFTVTGMAEDYLASRGGDKLLADIPLGRVADPAEIAETVRFLALAAPASMTGAVLDINGASYVR
>NC_009511.1|WP_011952156.1|1468899_1470159_+|methyl-accepting-chemotaxis-sensory-transducer
MMNGQDVESIGLSDQEISRKLALYDRSADLDARLRAIGARLGGDGLDARWQALLTEGVTPAGLRAYADQAATQAARGGGAGEIARKTREAVTHLCGEIARRFAEDADFVGRSCEALVAVHAIHFDLAFAVAGAQDRASQHQGLADEGRAFRTNISETLGRALDDSRGLRQRTGQTSQSARGMLGKTSEVAAAAEQSALAMREAAHTAAGLIRAIEESRAEVEVAAQIATRAADRSIHAVAISEVLSDHAQAIESILGLIRDIAGQTNLLALNATIEAARAGDAGRGFAVVAQEVKSLASQTARATDDIAAKIAAIQAATRQTVEANGAIRDIVGEVQTSAERIRTTMESQAQTVTMITAAVDETALAADSMSTTISAIRADTENVAGEIDHLEAGFRRVDGELSKLETITGDFVSRIAA
>NC_009511.1|WP_011952155.1|1468324_1468732_-|succinate-dehydrogenase,-cytochrome-b556-subunit
MSRNPGRPLSPHLTIWKWGPHMAVSILHRATGVGLAIVAGLAFVWWLVAAASGPDAYATFYKVATSWFGYLVAIGLTWSFFQHLFSGLRHFVLDIGAGYELKINKTGSIATMVGSVLVTLLIWVPILLSLSKGAH
>NC_009511.1|WP_011952154.1|1467935_1468325_-|succinate-dehydrogenase,-hydrophobic-membrane-anchor-protein
MGNGTGIGRVRGLGSAKHGAMHWWRQRVTAAGNLLLATWFVVSLFRLPNLGHDVVVQWIGSPIVAVPLVLLTVSVFYHMRLGLQVVLEDYVHEDAGKVFSLLLLNLYTIAGAALAIFSILKIAFGGVSA
>NC_009511.1|WP_011952164.1|1477145_1478738_-|glutamine-hydrolyzing-GMP-synthase
MTAQLPATAPKASQPHESILIVDFGSQVTQLIARRVREAGVYSEIAPFNAADAAFDRLQPKGIILSGGPASVAEMGSPRAPQRFFEAGVPILGICYGQQTMCQQLGGSVTPSHDSREFGRAFIEIKTRSALFDGLWKEGEHHQVWMSHGDKVDALPPGFSPVAVSEGAPYAVTSDEKRRFYGVQFHPEVVHTPDGGKLIANFARHVCGLTGDWTMAEFRATKIEEIRQQVGDGRVICGLSGGVDSAVAAVLIHEAIGDQLTCVFVDHGLMRMGEADQVVGLFREHYGIPLVHVNAETLFLNGLKGVTDPEAKRKFIGKTFIEVFEAEAKKIGGADFLAQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLPERMNMKLVEPLRELFKDEVRALGRELGLPEIFVGRHPFPGPGLAIRIPGEVTKERCDILRKADAVYLDEIRRAGLYDAIWQAFAVLLPVRSVGVMGDGRTYDSVCALRAVTSTDGMTADVYPFDAAFLSRVATRIVNEVQGINRVTYDYTSKPPGTIEWE
>NC_009511.1|WP_011952165.1|1478846_1479326_-|hypothetical-protein
MIKAFITSATAAALLAGAAAPAMARPYWGGGYHHRHGGGGDTFGNILLGAIIGGGAIAIASSASKNKRDQVPSRRGDDQRDDLRDSGDDARQVASICTDAVENMARGPVSSVDSVGRDGPDGWRVDGVVRGERGDRHFFCAVREGQIETIDMGDRMAAR
>NC_009511.1|WP_148218884.1|1479423_1481313_-|PQQ-binding-like-beta-propeller-repeat-protein
MSLAIAVAVIGAGAVTGQPVSESEALEKTRIRSTDDFQAKDASAVDPATAPGKAIFAEHCAVCHEGGVPKAPSPTFLAMMPGDAIVAALTGGVMKAQGAALSPAQRIEVAEFVTRRRLSGEAKPKLPPVCTGARLAFDAKDPPRAVGWGHDNRRFIPADMAKLAAADVPKLALKWAYAFPGALRARSQPGYGWGTMFVGSQDGTVYAFDLDSGCTKWTRRVSAEIRTAIVADAATKRLYFGDLLGRAYALDAFTGKILWSEKLDDHPDATITGTPALGGGLLYVPVSSLEVAQPADPKYACCSFRGSVVALDPATGAVRWRAYTVPQPPTEQGRNPADAPILGPSGAPVWNSPTYDAEQGRVYFGSGENYSSPADDNSDAVFAVDARTGRRLWHTQLTKGDAWNVACMLGSGSCPKENGPDHDVAASTLLIPIGGGRRMLVIGQKSGEAWGLDPDSGRIAWQRQLGHGGTQGGVHFGMAADGTRVFVPINDMPDTGDARVYDASIRGSGLHAIDAATGRVIWNARAPEDCAGRKFCDTGISAAVTAIPGVVFAGHLDGTFRAYDAATGTVLWQVDTTRPVPTITGIEGKGGSMSGPGALVVDGHVVINSGYGMYSHMAGNLLMVFAPAQ
>NC_009511.1|WP_011952167.1|1481476_1483609_-|S9-family-peptidase
MPSMMLRAALACVLMSTALPLSAENPKLPPYPETRRGDVVEEQFGEAIADPYRWLENDVREDAEVARWVDAENKVTEAYLDALPGRDAIRKRLKTLWNYERYGVPRKRGGRYFYTYNSGLQNQSVLLVRDGLDGKERELLDPNRWAKDGATALDEWRPSNSGDLLLYSIQDGGSDWRTLRVIDVATGKTLDDEIKWVKFSDLSWDGDGRGFYYSRFPEPKAGAAFQQLNLNHQVYYHRIGTPQSEDRLLYATPNRPRLNHSVETTQDGRYALVTSSEGTDERYELTLFDLAEPNAKPRKLVTGFTNEWALAGSVGSKLYFRTNLKAPRQRVVMLDVAERKPKPVEIIAQTSDTLVGVSLVGSRLILAYLGDAKTEAQLFELTGQPVGPINLPDIGTGAGFGGRTGDPETFFSFSSFATPSTIYRFNSATRKMEEFIKPKLSFDPRDYIVDQQFYRSKDGTEIPMFVARKKSTGPGAPALLYGYGGFNISMTPGFSPAILDWMEMGGVYAVANLRGGGEYGKVWHEAGRLANKQNVFDDFIAAGEYLVSSGISAKGRLAAMGRSNGGLLIGAVVNQRPDLFAAVNPAVGVMDMLRFNRFTAGRYWVDDYGDPGKEEDFHVLRGYSPYHNVKGGADYPAILVTTADTDDRVVPGHSFKYTAALQAADIGARPHLIRIETRAGHGSGKPTDKIIDEYADLWAFMGYWTGMRLP
>NC_009511.1|WP_011952168.1|1483724_1484147_-|50S-ribosomal-protein-L17
MRHRVGGRKLQRTASHRTALFRNQSAALIKHEQILTTLAKAKELRPYVEKLITLAKKGGLANRRLAHARLQDDTQLKKLFEVLAERYASRNGGYTRIVKAGIRASDAASMAIIEFVDRDVSAKGQDSGPVETDEDVAEAA
>NC_009511.1|WP_011952169.1|1484323_1485385_-|DNA-directed-RNA-polymerase-subunit-alpha
MAVNAKNWQELKKPNGLEKKSGGDGKRKATFVAEPLERGFGLTLGNSLRRVLLSSLQGAAVTSIKIENVLHEFSSLAGVREDVTDIVLNVKQIALKMQGDGPRRLQLSATGPAEVTAGMIAASGDIEVMNTDLVICHLDDGATLNMELTADVGKGYVTAAANRPVDAPIGLIPVDALYSPVRQVAYKVENTRVGQELDYDKLTLTIETDGTVTPEDALAYSARILQDQLQLFVHFDDGMAISAPAAGAGAAGGAAGEPEGDANQLNRYLLKKVDELELSVRSANCLKNDNIIYIGDLVQKTEAEMLRTPNFGRKSLNEIKEVLASMGLRLGMEIPGWPPENIEEMAKKLEQEF
>NC_009511.1|WP_011952170.1|1485467_1485857_-|30S-ribosomal-protein-S11
MAREPQRIRRRERKNITAGVAHVNASFNNTMITITDAQGNAIAWSSAGMMGFKGSRKSTPYAAQVAAEDAGKKAAEHGVRTLEVEVKGPGSGRESALRALQAVGFHITSIRDVTPIPHNGVRPSKRRRV
>NC_009511.1|WP_011952171.1|1485919_1486288_-|30S-ribosomal-protein-S13
MARIAGVNIPTNKRVEIALTYIHGIGPAKAKEITAKLGIEPQRRVQDLSDQEVLQIREAIDAGYTVEGDLRRQVAMNIKRLMDLACYRGLRHRKGLPVRGQRTHTNARTRKGKAKPIAGKKK
>NC_009511.1|WP_011952172.1|1486575_1487706_+|acyltransferase
MDRMLVPADRGRFYRNNFDALRLAMALLVVFSHSFALRFGTEAFEPVSLATNGYYNAGHVGVWGFFIVSGFLIAHSHERSRSIGGYAAKRVRRIYPAYLVATAICAFVVTPLFAPPGFALTAAEAARTISANLLLANHFPLPDLFAANPVHAVNGSLWSIRFEFLCYVGVALLGVLALPLRRWAVPLIYVAVVATWCWLDLTGRKPGGPALVADVIGWPYMWFRVLPNFLAGMIVYLHRDNIPRSTPLLLAGLAACFLGFHLGGHGPAGIVAAHVLAPPVMAYLVFWIAFHPRIDLSRAARFGDISYGTYLYAYVIQQMLVAQAAALPFPLFVLASMLLALAAGALSWWLVERHFLDHGRRPAEHRPERKEAPALP
>NC_009511.1|WP_011952173.1|1487745_1489107_-|NADP-specific-glutamate-dehydrogenase
MAVSDHVDLASFVEGVKKRNPGQPEFVQAVTEVAEDIFDFIADKEEYHKYQILRRIAEPDRVISFRVCWEDDKGNIRVQRGWRVQNNNSIGPYKGGIRFHPSVTESVLKFLAFEQTFKNALTGLPMGGGKGGSNFNPKGKSTNEVMRFCQSFVNELYRHIGADTDVPAGDIGVGGREIGYMFGQYKRLTNEFTGVLTGKGLEYGGSLIRTEATGYGAVYFLHEMLKTKGKDLVGLNAVISGSGNVATHAAEKINQLGGKVLTLSDSEGFIYDPEGITQDKVNWVKDLKTRKRGRISEYVKEFKGSEFHGNGARPWGVECDVAVPCATQNELNEEEAKTLVKNGCFAVSEGANMPTTLEGTHVFKKAKILFAPGKAANAGGVAVSGLEMSQNSARISWKEEELQRLLVDIMQGIHARCVEYGGSAGTDHVDYVKGANIAGFKKVADAMLAYGVV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_009511_1	1.1\|1477041\|34\|NC_009511\|CRISPRCasFinder	1477041-1477074	34	NC_023136	Leisingera methylohalidivorans DSM 14336 plasmid unnamed, complete sequence	249512-249545	9	0.735

1. spacer 1.1|1477041|34|NC_009511|CRISPRCasFinder matches to NC_023136 (Leisingera methylohalidivorans DSM 14336 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.735

caaatcgggcggacagcccccggctgtccgctag	CRISPR spacer
cgcgcagggcagacagcccctggctgtccggcag	Protospacer
*. .. ****.*********.********* .**

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

46706 : 55169

Burkholderia_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011950898.1\|46706_46979_+	HU family DNA-binding protein	Q6QIE5	Burkholderia_phage	1.7e-21	64.0
WP_011950899.1\|47309_47702_-	type II toxin-antitoxin system HicB family antitoxin	A0A0D4DCG1	Acinetobacter_phage	1.1e-05	34.8
WP_029548810.1\|47724_47907_-	type II toxin-antitoxin system HicA family toxin	D6R431	Bacillus_phage	1.4e-06	42.9
WP_011950901.1\|47975_48782_-	aminoglycoside phosphotransferase family protein	NA	NA	NA	NA
WP_011950902.1\|48910_49090_+	hypothetical protein	NA	NA	NA	NA
WP_011950903.1\|49130_49778_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_011950904.1\|49890_50949_+	aminotransferase class V-fold PLP-dependent enzyme	A0A1X6WFP1	Pacmanvirus	1.1e-15	27.0
WP_011950905.1\|50945_52040_+	cysteine desulfurase	H7BUW1	unidentified_phage	2.9e-27	37.7
WP_011950906.1\|52036_52372_+	2Fe-2S iron-sulfur cluster binding domain-containing protein	NA	NA	NA	NA
WP_011950907.1\|52455_53235_+	hypothetical protein	NA	NA	NA	NA
WP_011950908.1\|53420_55169_+	DNA polymerase III subunit gamma/tau	A0A1L2BWV7	Bacteriophage	5.1e-42	36.7

DBSCAN-SWA_2

2414593 : 2455530

Stenotrophomonas_phage(28.57%)

tail,protease,portal,terminase,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011952989.1\|2414593_2415571_+\|protease	aspartyl protease family protein	NA	NA	NA	NA
WP_011952990.1\|2415646_2416198_+	peroxiredoxin	NA	NA	NA	NA
WP_011952991.1\|2416200_2416866_+	hypothetical protein	NA	NA	NA	NA
WP_011952992.1\|2417202_2418237_+	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_011952993.1\|2418387_2419185_-	DUF72 domain-containing protein	NA	NA	NA	NA
WP_011952994.1\|2419184_2419535_-	GFA family protein	NA	NA	NA	NA
WP_011952995.1\|2419548_2419902_-	DUF1428 domain-containing protein	NA	NA	NA	NA
WP_011952996.1\|2419977_2420874_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_011952997.1\|2420967_2422113_+	acyl-CoA dehydrogenase family protein	NA	NA	NA	NA
WP_011952998.1\|2422285_2423887_+	acetyl-CoA carboxylase subunit beta	A0A1B2ITV7	Pike_perch_iridovirus	1.2e-18	62.5
WP_011952999.1\|2424107_2425979_+	ATP-grasp domain-containing protein	NA	NA	NA	NA
WP_011953000.1\|2425998_2426697_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_011953001.1\|2426689_2427148_-	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_011953002.1\|2427279_2428092_-	hypothetical protein	NA	NA	NA	NA
WP_011953003.1\|2428427_2429294_+	hypothetical protein	NA	NA	NA	NA
WP_011950708.1\|2429591_2430404_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_041379233.1\|2430892_2431207_+	hypothetical protein	NA	NA	NA	NA
WP_041379234.1\|2431308_2431746_-	hypothetical protein	NA	NA	NA	NA
WP_011953005.1\|2431745_2432120_-	hypothetical protein	NA	NA	NA	NA
WP_041379668.1\|2432202_2432634_-	hypothetical protein	A0A218MKM6	uncultured_virus	2.0e-24	44.3
WP_011953007.1\|2432771_2433212_-	hypothetical protein	NA	NA	NA	NA
WP_011953008.1\|2433278_2433572_-	hypothetical protein	NA	NA	NA	NA
WP_011953009.1\|2433568_2436169_-	hypothetical protein	G8GWG3	Rhodobacter_phage	2.7e-23	40.5
WP_011953010.1\|2436179_2436779_-	DUF4376 domain-containing protein	NA	NA	NA	NA
WP_011953011.1\|2436784_2439700_-	DUF1983 domain-containing protein	NA	NA	NA	NA
WP_011953012.1\|2439699_2440500_-	hypothetical protein	NA	NA	NA	NA
WP_011953013.1\|2440503_2440866_-	hypothetical protein	NA	NA	NA	NA
WP_011953014.1\|2440865_2443892_-\|tail	phage tail length tape measure family protein	NA	NA	NA	NA
WP_011953015.1\|2443983_2444475_-	hypothetical protein	NA	NA	NA	NA
WP_011953016.1\|2444535_2445246_-	hypothetical protein	NA	NA	NA	NA
WP_158305156.1\|2445232_2445382_-	hypothetical protein	NA	NA	NA	NA
WP_011953017.1\|2445405_2446089_-	hypothetical protein	NA	NA	NA	NA
WP_011953018.1\|2446152_2446428_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_011953019.1\|2446473_2446782_+	HigA family addiction module antidote protein	A0A2L1IV52	Escherichia_phage	3.6e-07	34.6
WP_011953020.1\|2446782_2448012_-	hypothetical protein	NA	NA	NA	NA
WP_011953021.1\|2448024_2448465_-	hypothetical protein	NA	NA	NA	NA
WP_011953022.1\|2448461_2448785_-	hypothetical protein	NA	NA	NA	NA
WP_011953023.1\|2448784_2449156_-	hypothetical protein	NA	NA	NA	NA
WP_011953024.1\|2449225_2449564_-	DUF2190 family protein	NA	NA	NA	NA
WP_011953025.1\|2449643_2451710_-\|protease	Clp protease ClpP	B7SYD7	Stenotrophomonas_phage	1.1e-96	43.3
WP_041379671.1\|2451722_2453186_-\|portal	phage portal protein	B7SYD6	Stenotrophomonas_phage	2.6e-71	36.2
WP_011953027.1\|2453212_2453440_-	hypothetical protein	NA	NA	NA	NA
WP_081435153.1\|2453421_2455530_-\|terminase	phage terminase large subunit family protein	A0A2H4J898	uncultured_Caudovirales_phage	8.4e-31	27.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_009508

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NC_009511

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection