CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NC_009512	Pseudomonas putida F1, complete genome	3 crisprs	DEDDh,csa3,cas3,DinG,WYL	0	0	7	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_009512_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_009512_1

121094-121258

Orphan

Consensus_repeat	Method
TTGGCCAGCAGGGCCGGCCCTTTCGCGGGTGAACCCGCTCCTACGATGGCCTG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_009512_1

>merge|NC_009512|1|121094-121258|CRISPRCasFinder
TTGGCCAGCAGGGCCGGCCCTTTCGCGGGTGAACCCGCTCCTACGATGGCCTGTGCCGAACCACCGATGCGTGTAATCGATGGCGGCGGCAACGGTGATCGGCGGGTGGGGATTGGCCAGCAGGGCCGGCCCTTTCGCGGGTGAACCCGCTCCTACGACGGCCTG

>NC_009512|1|1|121094-121258|CRISPRCasFinder
TTGGCCAGCAGGGCCGGCCCTTTCGCGGGTGAACCCGCTCCTACGATGGCCTG	TGCCGAACCACCGATGCGTGTAATCGATGGCGGCGGCAACGGTGATCGGCGGGTGGGGA
TTGGCCAGCAGGGCCGGCCCTTTCGCGGGTGAACCCGCTCCTACGACGGCCTG

Protein	Signature genes	Signature genes Name	Protein_function
NC_009512.1\|WP_003253030.1\|126575_126779_-\|twin-transmembrane-helix-small-protein	unknown	unknown	gnl\|CDD\|378564
NC_009512.1\|WP_011953138.1\|115165_117160_+\|peptidase-M3	unknown	unknown	gnl\|CDD\|341051
NC_009512.1\|WP_011953137.1\|112675_114763_+\|oligopeptidase-A	unknown	unknown	gnl\|CDD\|341051
NC_009512.1\|WP_004575261.1\|119504_121037_+\|SulP-family-inorganic-anion-transporter	unknown	unknown	gnl\|CDD\|223732
NC_009512.1\|WP_003253063.1\|109672_110086_-\|hypothetical-protein	unknown	unknown	unknown
NC_009512.1\|WP_003253046.1\|118592_119312_+\|carbonic-anhydrase	unknown	unknown	gnl\|CDD\|238449
NC_009512.1\|WP_011953140.1\|122307_123435_+\|cytochrome-c-oxidase-subunit-II	unknown	unknown	gnl\|CDD\|224537
NC_009512.1\|WP_003253037.1\|123478_125068_+\|cytochrome-c-oxidase-subunit-I	unknown	unknown	gnl\|CDD\|238833
NC_009512.1\|WP_003253053.1\|114759_115041_+\|YheV-family-putative-metal-binding-protein	unknown	unknown	gnl\|CDD\|312883
NC_009512.1\|WP_011953141.1\|125660_126548_+\|cytochrome-c-oxidase-subunit-3	unknown	unknown	gnl\|CDD\|238834
NC_009512.1\|WP_004575259.1\|129191_130085_+\|protoheme-IX-farnesyltransferase	unknown	unknown	gnl\|CDD\|235293
NC_009512.1\|WP_017147852.1\|110171_111245_+\|aminopeptidase	unknown	unknown	gnl\|CDD\|378359
NC_009512.1\|WP_004575263.1\|112060_112609_-\|gamma-carbonic-anhydrase-family-protein	unknown	unknown	gnl\|CDD\|100051
NC_009512.1\|WP_041168240.1\|126830_127568_+\|SURF1-family-protein	unknown	unknown	gnl\|CDD\|119401
NC_009512.1\|WP_003253042.1\|121296_121938_-\|hypothetical-protein	unknown	unknown	unknown
NC_009512.1\|WP_003253035.1\|125077_125644_+\|cytochrome-c-oxidase-assembly-protein	unknown	unknown	gnl\|CDD\|235341
NC_009512.1\|WP_003253048.1\|117230_118289_+\|PA0069-family-radical-SAM-protein	unknown	unknown	gnl\|CDD\|275263
NC_009512.1\|WP_011953143.1\|127536_128118_+\|hypothetical-protein	unknown	unknown	unknown
NC_009512.1\|WP_004575264.1\|111350_112001_-\|HAD-family-hydrolase	unknown	unknown	gnl\|CDD\|319798
NC_009512.1\|WP_011953144.1\|128127_129207_+\|heme-A-synthase	unknown	unknown	gnl\|CDD\|367131

Protein	Function_ID	Function_description	E-value
NC_009512.1\|WP_011953138.1\|115165_117160_+\|peptidase-M3	gnl\|CDD\|341051	cd06456, M3A_DCP, Peptidase family M3, dipeptidyl carboxypeptidase (DCP). Peptidase family M3 dipeptidyl carboxypeptidase (DCP; Dcp II; peptidyl dipeptidase; EC 3.4.15.5). This metal-binding M3A family also includes oligopeptidase A (OpdA; EC 3.4.24.70). DCP cleaves dipeptides off the C-termini of various peptides and proteins, the smallest substrate being N-blocked tripeptides and unblocked tetrapeptides. DCP from Escherichia coli is inhibited by the anti-hypertensive drug captopril, an inhibitor of the mammalian angiotensin converting enzyme (ACE, also called peptidyl dipeptidase A). OpdA may play a specific role in the degradation of signal peptides after they are released from precursor forms of secreted proteins. It can also cleave N-acetyl-L-Ala. This family also includes Arabidopsis thaliana organellar oligopeptidase OOP (At5g65620), which plays a role in targeting peptide degradation in mitochondria and chloroplasts; it degrades peptide substrates that are between 8 to 23 amino acid residues, and shows a weak preference for hydrophobic residues (F/L) at the P1 position.	9.52387e-108
NC_009512.1\|WP_011953137.1\|112675_114763_+\|oligopeptidase-A	gnl\|CDD\|341051	cd06456, M3A_DCP, Peptidase family M3, dipeptidyl carboxypeptidase (DCP). Peptidase family M3 dipeptidyl carboxypeptidase (DCP; Dcp II; peptidyl dipeptidase; EC 3.4.15.5). This metal-binding M3A family also includes oligopeptidase A (OpdA; EC 3.4.24.70). DCP cleaves dipeptides off the C-termini of various peptides and proteins, the smallest substrate being N-blocked tripeptides and unblocked tetrapeptides. DCP from Escherichia coli is inhibited by the anti-hypertensive drug captopril, an inhibitor of the mammalian angiotensin converting enzyme (ACE, also called peptidyl dipeptidase A). OpdA may play a specific role in the degradation of signal peptides after they are released from precursor forms of secreted proteins. It can also cleave N-acetyl-L-Ala. This family also includes Arabidopsis thaliana organellar oligopeptidase OOP (At5g65620), which plays a role in targeting peptide degradation in mitochondria and chloroplasts; it degrades peptide substrates that are between 8 to 23 amino acid residues, and shows a weak preference for hydrophobic residues (F/L) at the P1 position.	0
NC_009512.1\|WP_004575261.1\|119504_121037_+\|SulP-family-inorganic-anion-transporter	gnl\|CDD\|223732	COG0659, SUL1, Sulfate permease and related transporters (MFS superfamily) [Inorganic ion transport and metabolism].	1.57744e-107
NC_009512.1\|WP_003253046.1\|118592_119312_+\|carbonic-anhydrase	gnl\|CDD\|238449	cd00884, beta_CA_cladeB, Carbonic anhydrases (CA) are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism in which the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide is followed by the regeneration of an active site by ionization of the zinc-bound water molecule and removal of a proton from the active site. CAs are ubiquitous enzymes involved in fundamental processes like photosynthesis, respiration, pH homeostasis and ion transport. There are three evolutionarily distinct families of CAs (the alpha-, beta-, and gamma-CAs) which show no significant sequence identity or structural similarity. Within the beta-CA family there are four evolutionarily distinct clades (A through D). The beta-CAs are multimeric enzymes (forming dimers,tetramers,hexamers and octamers) which are present in higher plants, algae, fungi, archaea and prokaryotes.	1.03662e-102
NC_009512.1\|WP_011953140.1\|122307_123435_+\|cytochrome-c-oxidase-subunit-II	gnl\|CDD\|224537	COG1622, CyoA, Heme/copper-type cytochrome/quinol oxidases, subunit 2 [Energy production and conversion].	2.37622e-70
NC_009512.1\|WP_003253037.1\|123478_125068_+\|cytochrome-c-oxidase-subunit-I	gnl\|CDD\|238833	cd01663, Cyt_c_Oxidase_I, Cytochrome C oxidase subunit I. Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes. It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane. The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Only subunits I and II are essential for function, but subunit III, which is also conserved, may play a role in assembly or oxygen delivery to the active site. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome. Subunit I contains a heme-copper binuclear center (the active site where O2 is reduced to water) formed by a high-spin heme (heme a3) and a copper ion (CuB). It also contains a low-spin heme (heme a), believed to participate in the transfer of electrons to the binuclear center. For every reduction of an O2 molecule, eight protons are taken from the inside aqueous compartment and four electrons are taken from cytochrome c on the opposite side of the membrane. The four electrons and four of the protons are used in the reduction of O2; the four remaining protons are pumped across the membrane. This charge separation of four charges contributes to the electrochemical gradient used for ATP synthesis. Two proton channels, the D-pathway and K-pathway, leading to the binuclear center have been identified in subunit I. A well-defined pathway for the transfer of pumped protons beyond the binuclear center has not been identified. Electrons are transferred from cytochrome c (the electron donor) to heme a via the CuA binuclear site in subunit II, and directly from heme a to the binuclear center.	0
NC_009512.1\|WP_003253053.1\|114759_115041_+\|YheV-family-putative-metal-binding-protein	gnl\|CDD\|312883	pfam09526, DUF2387, Probable metal-binding protein (DUF2387). Members of this family are small proteins, about 70 residues in length, with a basic triplet near the N-terminus and a probable metal-binding motif CPXCX(18)CXXC. Members are found in various proteobacteria.	8.02804e-44
NC_009512.1\|WP_011953141.1\|125660_126548_+\|cytochrome-c-oxidase-subunit-3	gnl\|CDD\|238834	cd01665, Cyt_c_Oxidase_III, Cytochrome c oxidase subunit III. Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes. CcO catalyzes the reduction of O2 and simultaneously pumps protons across the membrane. The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Only subunits I and II are essential for function, but subunit III, which is also conserved, is believed to play a role in assembly of the multimer complex. Rhodobacter CcO subunit III stabilizes the integrity of the binuclear center in subunit I. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome. Subunit III contains bound phospholipids in several crystal structures and is proposed to contain a "lipid pool." These phospholipids are believed to intrinsic constituents similar to cofactors of the enzyme.	6.40714e-89
NC_009512.1\|WP_004575259.1\|129191_130085_+\|protoheme-IX-farnesyltransferase	gnl\|CDD\|235293	PRK04375, PRK04375, protoheme IX farnesyltransferase; Provisional.	2.02864e-145
NC_009512.1\|WP_017147852.1\|110171_111245_+\|aminopeptidase	gnl\|CDD\|378359	pfam10023, Aminopep, Putative aminopeptidase. This family of bacterial proteins has a conserved HEXXH motif, suggesting that members are putative peptidases of zincin fold.	0
NC_009512.1\|WP_004575263.1\|112060_112609_-\|gamma-carbonic-anhydrase-family-protein	gnl\|CDD\|100051	cd04645, LbH_gamma_CA_like, Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E. coli paaY protein, and similar proteins. CAs are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site. They are ubiquitous enzymes involved in fundamental processes like photosynthesis, respiration, pH homeostasis and ion transport. There are three evolutionary distinct groups - alpha, beta and gamma carbonic anhydrases - which show no significant sequence identity or structural similarity. Gamma CAs are trimeric enzymes with left-handed parallel beta helix (LbH) structural domain.	3.16377e-78
NC_009512.1\|WP_041168240.1\|126830_127568_+\|SURF1-family-protein	gnl\|CDD\|119401	cd06662, SURF1, SURF1 superfamily. Surf1/Shy1 has been implicated in the posttranslational steps of the biogenesis of the mitochondrially-encoded Cox1 subunit of cytochrome c oxidase (complex IV). Cytochrome c oxidase (complex IV), the terminal electron-transferring complex of the respiratory chain, is an assemblage of nuclear and mitochondrially-encoded subunits. Its assembly is mediated by nuclear encoded assembly factors, one of which is Surf1/Shy1. Mutations in human Surf1 are a major cause of Leigh syndrome, a severe neurodegenerative disorder.	3.77687e-51
NC_009512.1\|WP_003253030.1\|126575_126779_-\|twin-transmembrane-helix-small-protein	gnl\|CDD\|378564	pfam11137, DUF2909, Protein of unknown function (DUF2909). This is a family of proteins conserved in Proteobacteria of unknown function.	5.11212e-12
NC_009512.1\|WP_003253035.1\|125077_125644_+\|cytochrome-c-oxidase-assembly-protein	gnl\|CDD\|235341	PRK05089, PRK05089, cytochrome C oxidase assembly protein; Provisional.	1.65794e-98
NC_009512.1\|WP_003253048.1\|117230_118289_+\|PA0069-family-radical-SAM-protein	gnl\|CDD\|275263	TIGR04470, hypothetical_protein_ALIPUT_00462, radical SAM mobile pair protein B. Members of this family are the downstream member (B) of a pair of tandem-encoded radical SAM enzymes. Most of these radical SAM gene pairs have an additional upstream regulatory gene in the MarR family. Examples of high sequence identity (over 96 percent) from cassettes in several Treponema species of the oral cavity to those in multiple Firmicutes in the gut microbiome suggest recent lateral gene transfer, as might be expected for antibiotic resistance genes. The function is unknown.	6.54939e-21
NC_009512.1\|WP_004575264.1\|111350_112001_-\|HAD-family-hydrolase	gnl\|CDD\|319798	cd04302, HAD_5NT, haloacid dehalogenase (HAD)-like 5'-nucleotidases similar to the Pseudomonas aeruginosa PA0065. 5'-nucleotidases dephosphorylate nucleoside 5'-monophosphates to nucleosides and inorganic phosphate. Purified Pseudomonas aeruginosa PA0065 displayed high activity toward 5'-UMP and 5'-IMP, significant activity against 5'-XMP and 5'-TMP, and low activity against 5'-CMP. This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	8.36045e-105
NC_009512.1\|WP_011953144.1\|128127_129207_+\|heme-A-synthase	gnl\|CDD\|367131	pfam02628, COX15-CtaA, Cytochrome oxidase assembly protein. This is a family of integral membrane proteins. CtaA is required for cytochrome aa3 oxidase assembly in Bacillus subtilis. COX15 is required for cytochrome c oxidase assembly in yeast.	1.35206e-80

>NC_009512.1|WP_004575261.1|119504_121037_+|SulP-family-inorganic-anion-transporter
MNITQLKAALPRELLASVVVFLVALPLCMGIAIASGMPPAKGLITGIIGGIVVGFLAGSPLQVSGPAAGLAVLVFELVRQHGMAMLGPILLLAGLLQLLAGRLRLGCWFRVTAPAVVYGMLAGIGVLIVLSQVHVMFDTAPQPSGLQNLLAFPATLSAALPQESTGAGWMAGALGLGTIAIMWGWERLRPQRLRFVPGALLGVASMTAISLWLALPVNRVQVPADLSEAIDWLRPADLMQLADPALLVAAFALAFIASAETLLSAAAVDRMHSGQRSDFDRELSAQGIGNMLCGVLGALPMTGVIVRSSANVQAGAQTRASAIFHGLWLLAFVVALSSVLQQIPVASLAGVLVFTGVKLVDFKAFRGLGRYGRMPMFTYAATALAIIFTDLLTGVLLGFALTLLKLAFKAARLKINLVSLAKDGHMELRLSGAATFLKVPALTQVLDTVPAGTTLHVPLGNLSYIDHSCLELLEDWSRSNSANGSRLLIEQRRLKRRIEGRLRTTAGVGA
>NC_009512.1|WP_003253046.1|118592_119312_+|carbonic-anhydrase
MPVKDPSKVVPQVPAESADAALKHIVDGFLRFHHDVFPDQQELFKKLATAQTPRAMFITCADSRIVPELITQSSPGDLFVTRNVGNVVPPYGQMNGGVSSAIEYAVMALKVHHIIICGHSDCGAMRAVLNPQSLTKMPTVGAWLRHAEVARTVVENNCSCGSEHETMQVLTKENVIAQLHHLRTHPSVASRLAAGELFIHGWVYDIETSKIEAYDAASDSFLPLAAGEPVPCATPRGRY
>NC_009512.1|WP_003253048.1|117230_118289_+|PA0069-family-radical-SAM-protein
MIPPAPQKGRGTAHNPHNRFAPGHSVAEDDGWYQEVPQTQGTEVRIETAKSVISRNTSPDLPFDRSINPYRGCEHGCIYCYARPSHAYWDLSPGLDFETKLIAKTNAAEVLAQQLSKPGYVCAPINLGSNTDPYQPIEREQLLTRRLLEVLLRFRHPVTIVTKGSLVLRDLDLLAEMARQRLARVMISLTTLDDGLKRVLEPRAASPGARLRAIRVLREAGVPVGVLCSPMIPMINDSELERLLEAAKEAGAQSAAYMMLRLPLEVAPLFEQWLQDHYPQRAAHVLSLIRQSRGGELYDSRFGVRMRGEGVFAELLAQRFAKAMKRLDFEGREAQALDCSAFCPPGGQMALF
>NC_009512.1|WP_011953138.1|115165_117160_+|peptidase-M3
MANPLLQDSHIPVDYSSITLENMQAAFAHVLQAHENGVERIIRDQRTMPTWDDMVLALDGLDSRLLAVLYAASPLVGRDTAWANVIIDFYRKVTARFEQKFANTGLHDLYARLAGSDIGKQLDVGKRATLRWHLDKFAASGALLDTAGKAHLADLQAQIGTAREAFRSNIDRPGLNITDEAELSGIPQRVRDELAASAQQAGKQGWLIACDTVTTREVLKHAANRQFRERVYRAFHARGVSHDRQQDNSWYLQQLAQLLEEKALLLGYSGHLEQSLQVKSAGSVDQVRGFLHDLADHVRPAMLRWRSQVECWAAEQGLGKPQPWDFEYLRCASRSVFPAEALRDYFPLNTVVSALQQLAQTLFGAVLQPKALPVWDDSVQPFEVWQDSAFIGFLYLDAVQHAGKLPDAVFTTYVRNRRVDAEGICQAASVVVFSDVPQALSGSQPLLNHLSLRKLFHEFGHALHHLLVRTTNHVMSNVTELGTDGVELFGKLFERWVWDADYLVAISARTHDGRQLSRKQANECLRQLRQQGVEEIAGDLCLALFDMDLHGTPNDGRTFEQRLGDARARCGYWPLADFEHPAHAFDHLVNGYDAGYYAYLWSDVHAFDVFTRFEAEGLLNGATGRALQEALFAPGASRPLREGIEAFLGRQSSQAAYLSWHGLR
>NC_009512.1|WP_003253053.1|114759_115041_+|YheV-family-putative-metal-binding-protein
MSEVAVNKTKKRFIAGAVCPACSEPDKLMMWNDDGVPHRECVACGFTDTLNEQGLSVPKELGTRVNHLAPKAAPAKVQTVQFFPNPKLKKPAE
>NC_009512.1|WP_011953137.1|112675_114763_+|oligopeptidase-A
MGQCFFCQGIQTVTANNPLLQSHDLPPFSQIRAEHVLPAIEAILADNRKAIAEILEKQGKNPTWAGLVLAMDELNDRLGAAWSPVSHLNAVCNSAELREAYESCLPALSAYSTELGQNRALFEAYQALINSPEAAGFDVAQKTILEHALRDFRLSGIDLPADKQQRYAEVQSKLSELGSRFSNQLLDATQAWTKHVTDEAALAGLTDSAKAQMAAAAQAKGLDGWLITLEFPSYYAVMTYASDRALREELYAAYCTRASDQGPNAGQFDNGPVMREILDLRQELAELLGYKNYAELSLATKMAESSDQVLSFLRDLAKRSKPFAAQDLQQLKAYAAEQGCPELASWDAGYFGEKLREQRYSVSQEALRAYFPIDKVLGGLFSIVQRLYGIEIAELKGFDSWHPDVRLFEIKENGQHVGRFFFDLYARANKRGGAWMDGARDRRRTAGGQLQSPVANLVCNFTPAAPGKPALLTHDEVTTLFHEFGHGLHHMLTRIEHAGVSGINGVAWDAVELPSQFMENWCWEPEGLALISGHYETGAALPQDLLDKMLAAKNFQSGMMMVRQLEFSLFDFELHASHGDGRSVLQVLEGVRDEVSVMRPPAYNRFPNSFAHIFAGGYAAGYYSYKWAEVLSADAFSRFEEEGVLNAETGRAFREAILARGGSREPMELFVDFRGREPSIDALLRHSGLTEDAAA
>NC_009512.1|WP_004575263.1|112060_112609_-|gamma-carbonic-anhydrase-family-protein
MAIRSFQQHTPKVGPRAFVDRSAVVLGDVEIGEDSSVWPLTVVRGDMHRIRIGARTSVQDGSVLHITHAGPFNPDGFPLIIGDEVTIGHKVMLHGCTLGNRILVGMGSTIMDGAIVEDEVIIGAGSLVPPGKRLVSGYLYMGSPVKQARLLNDKERAFFSYSAGNYVKLKDQHLAEGYDQPE
>NC_009512.1|WP_004575264.1|111350_112001_-|HAD-family-hydrolase
MHQQNILFDLDGTLTDPRLGITRSIQYALAKLGIDEPDLARLEHFIGPPLLQAFMQFYSFDEAKAWDAVNFYRERFRVTGLYENLVFEGVPELLEALNGQGRTLYIATSKPWEFAREIARHFAFDHHFKVIYGSELDGTRTNKVELIRHLLDEEGLDPAHTLMIGDRKHDLIGARSNGLQAVAVGYGFGSREELMAEEPAFHFATVADLHQAFSKA
>NC_009512.1|WP_017147852.1|110171_111245_+|aminopeptidase
MQRSGLGALDRIFTRLVPLLAALLLNGCSNAAYYGQLAQGQWQLLRARQPVEQVLADPATPAPLRAHLQQAEQARLFASQQLKLPDNRSYRVYADLGRPYVVWNVFATPELSLQPVTHCFPIAGCVAYRGYYQQGAARGAAALMRQDGLDVYVGGVEAYSTLGWFDDPILSSMVGWGDERLATLIFHELAHQRFYVQDDTEFNESFASFVEQEGTRQWRAARGLTAVGGDQGKQRDQFIRLVLASRERLQAIYAEPLDDAHKRRAKQAEFERLRREYRQVRDGQWGGDKRYDAWMYGPMSNAKLLPFGLYDQWVPAFAALFREVGGDWVRFYARVEHLGRLPIEARKAALQRLMVSR
>NC_009512.1|WP_003253063.1|109672_110086_-|hypothetical-protein
MRALLVAGSLLLISACSTLPDPDPNQAWIDLTRYDNTSLDAVQVDERDWADSRYFEVQPGSHELTVRYQFPVNPSNIGPVEEPLWRDCQVKLTFKDFSAGQRYQLQAGSIGFRPWIKLYDHQQKLLGQGLPAGCQRT
>NC_009512.1|WP_003253042.1|121296_121938_-|hypothetical-protein
MNIAAVREQVSQAHQHEGQTGQLKQRLELQLPHLHPSIQLPEQDAQGTLARFVSAYIDQVPELLEAAHEVAREAGIESQIKPVLKIAEAYFLQPPSVMQGHVGLDCLLDEAYLAHRLVEEVNDLYIRHFQQPLIPVDTTVANLIAHQLIGESFANQLDEVVHHSVDEMLNDESFAVESVEAYREKLSSPATGEAWKRWPCLSRQLGVELGQPA
>NC_009512.1|WP_011953140.1|122307_123435_+|cytochrome-c-oxidase-subunit-II
MMRHPHVWMGLLLWSVFGQANAAWTVNMHPGATEVSNAVFDLHMTIFWICVIIGIVVFGAMFWSMVIHRRSTGQQAAHFHEHTWVEILWTVVPFLILVAMAIPATKTLIDIYDASDSDIDIQVTGYQWKWHYKYLGQDVEFFSNLATPTDQIHNKAPKDEHYLLEVDQPLVLPVGAKVRFLVTAADVIHSWWVPAFAVKRDAIPGFVNEAWTRIEKPGIYRGQCTELCGKDHGFMPVVVEVKSKADYDTWLGERKAEAAKLKELTSKEWTLEELVARGDKVYHTTCVACHQAEGQGLPPMFPALKGSKIATGPKEDHLSIVFHGKPGTAMAAFGKQLSEVDIAAVVTYERNAWGNNKGDMVTPKDVLALKQAEAK
>NC_009512.1|WP_003253037.1|123478_125068_+|cytochrome-c-oxidase-subunit-I
MSAVIDDHAHGHDHAHGPAKGLMRWVLTTNHKDIGTMYLWFSFIMFLLGGSFAMVIRAELFQPGLQIVEPAFFNQMTTMHGLIMVFGAVMPAFVGLANWMIPLMIGAPDMALPRMNNFSFWLLPAAFLLLVSTLFSPGGGPNFGWTFYAPLSTTYAPASVTFFIFAIHLMGISSIMGAINVIATILNLRAPGMTLMKMPLFVWTWLITAFLLIAVMPVLAGVVTMMLMDIHFGTSFFSAAGGGDPVLFQHVFWFFGHPEVYIMILPAFGAVSSIIPAFSRKPLFGYTSMVYATGAIAFLSFIVWAHHMFVVGIPVVGELFFMYATMLIAVPTGVKVFNWVSTMWEGSLTFETPMLFAIAFVILFTIGGFSGLMLAIAPADFQYHDTYFVVAHFHYVLVPGAIFGIFASAYYWLPKWTGHMYDETLGKLHFWLSFIGMNMAFFPMHFVGLAGMPRRIPDYNLQFADFNMVSSIGAFMFGATQIFFLFIVIKCIRGGAPAPAKPWDGAEGLEWSIPSPAPYHTFQTPPEVK
>NC_009512.1|WP_003253035.1|125077_125644_+|cytochrome-c-oxidase-assembly-protein
MNGLSVKRLVTRLLMLTVVMFAFGFALVPIYDVMCKAFGINGKTGGQYEGSQVSDPTRAVRVQFMSTNASDMVWDFYSTADQLEVNPGAVNQMIFIAHNPTDRPMSAQAIPSITPAEAAAYFHKTECFCFTQQVLQPGERIEMPVRFIVDRDLPASVKHLTLAYTLFDITARHPPVAHVAAQDVQGAR
>NC_009512.1|WP_011953141.1|125660_126548_+|cytochrome-c-oxidase-subunit-3
MASHEHYYVPAQSKWPIIATIGMFITVFGLGTWFNDMKAGHPDSHGPLIFFVGALFLAYMLFGWFGAVVKESHAGLYSPQLDRSFRWGMSWFIFSEVMFFLAFFGALFYVRVLAGPWLGGEGAKGVTHMLWPTFEFTWPLLHTPDPKLFPPPKEVIDPWHLPLINTILLVSSSVTITIAHHALRRDHRGPLKFWMALTIVLGISFIALQAFEYHEAYTKLGLTLGSGIYGATFFMLTGFHGAHVTLGTIILIVMFVRILRGHFNPEKHFGFEAASWYWHFVDVVWVGLFIFVYVL
>NC_009512.1|WP_003253030.1|126575_126779_-|twin-transmembrane-helix-small-protein
MLKAAIVLMLLATIASLFSGLVFLVKDDENSTRLLKALTVRVTLAALTIGLVAWGLISGQLVSHAPF
>NC_009512.1|WP_041168240.1|126830_127568_+|SURF1-family-protein
MRPFRPGWVPTLVVLALLPGLIALGCWQLGRAEEKRVLLATYAERRIEAPIATAQLLSKEDNAFRRVHLYGRFDAEHSVLLDNRMRDGKAGVELLQPFHDQASGLWLLINRGWLPWLDRRVPVHFETPAQALALDASVYVAPGSTFQLHPDPIGGQWPHLLTAIDVAQLWQQLDREGFAQELRLEPGPASYRLDWPVVAMSPEKHVGYAVQWFALATALVLLYLYFGWHKNKEKRHGHRHSTGRA
>NC_009512.1|WP_011953143.1|127536_128118_+|hypothetical-protein
MATATPLDAPERSKPRARGRLQLLLILLVVLGPMVLATSMYKLKFWVPEGRSYHGAMIGNGESRADLGVAGQDERWQLLVSAPQACTEDCQRLVYLARQIQVGLGRDASRASHALAAAQPLSADYQALLGREYPQLQRYPLDAQRYQQKVAEPGPQLWIVDPHGNLVLRYDGKVNGKHVLDDLRHLLKLSNIG
>NC_009512.1|WP_011953144.1|128127_129207_+|heme-A-synthase
MARPGFRLAVFATLLALLVVLLGAYTRLTHAGLGCPDWPGCYGFISVPKSEAQLAHAELHFPEHPVEAAKGWAEMVHRYFAGSLAVVIALLAFQAMRRHARDGQPYRLPMLLLGVVLAQAAFGMWTVTLKLWPQVVTAHLLGGFTTLSLLFLLSLRLSRAFAPLPKLPLSLRRIAALALLVVIGQIALGGWVSANYAAVACIDLPTCHGQWWPAADFSNGFHLTQHVGPNYLGGQLDSDARTAIHISHRLGALLVTCVLLMLSWKLHRCGLPGLARLVLLALALQVGLGISNVVFHLPLAVAVAHNAGGAMLLLSMVLVNYRIRVVDKVRMGVGHGWRLRPVVGVGISHHMRNDSWRRF
>NC_009512.1|WP_004575259.1|129191_130085_+|protoheme-IX-farnesyltransferase
MATLLSVRRARWRDYLELTKPKVVVLMLITSLAGMFLATRAGVSWSVLLFGNLGIGLCAGGAAVVNHVVDRRIDALMARTHKRPLAQGRVEPLPALLFALALALLGMVLLLVFTNALTAWLTLASLLGYAVLYTGFLKRATPQNIVIGGLAGAAPPLLGWVAVSGHVSAEPLLLVLIIFAWTPPHFWALAIHRKEEYAKADIPMLPVTHGERYTKLHILLYTLILLAVSLLPYAIHMSGPLYLACALGLGLRFLHWAWVLYRSSRPHAAIGTFKYSIGYLFALFIALLLDHYLLLSL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_009512_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_009512_2

737609-737701

Orphan

Consensus_repeat	Method
ACAGATTTCAGCCAGTAATCGGTGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_009512_2

>merge|NC_009512|2|737609-737701|CRISPRCasFinder
ACAGATTTCAGCCAGTAATCGGTGCGTGTAGGAGCGGGTTTACCCGCGAAAGGGCCGCAGAAGCCAATACAGATTTCAGCCAGTAATCGGTGC

>NC_009512|2|2|737609-737701|CRISPRCasFinder
ACAGATTTCAGCCAGTAATCGGTGC	GTGTAGGAGCGGGTTTACCCGCGAAAGGGCCGCAGAAGCCAAT
ACAGATTTCAGCCAGTAATCGGTGC

Protein	Signature genes	Signature genes Name	Protein_function
NC_009512.1\|WP_012051121.1\|741180_741933_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213186
NC_009512.1\|WP_012051114.1\|734125_734608_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|378793
NC_009512.1\|WP_012051115.1\|734896_735535_+\|prepilin-type-N-terminal-cleavage/methylation-domain-containing-protein	unknown	unknown	gnl\|CDD\|227301
NC_009512.1\|WP_012051124.1\|746526_747546_-\|outer-membrane-protein-assembly-factor-BamD	unknown	unknown	gnl\|CDD\|274513
NC_009512.1\|WP_003247607.1\|732649_733087_+\|FKBP-type-peptidyl-prolyl-cis-trans-isomerase	unknown	unknown	gnl\|CDD\|223976
NC_009512.1\|WP_012051123.1\|746203_746434_-\|hypothetical-protein	unknown	unknown	unknown
NC_009512.1\|WP_003247577.1\|735997_736387_+\|prepilin-type-N-terminal-cleavage/methylation-domain-containing-protein	unknown	unknown	gnl\|CDD\|227303
NC_009512.1\|WP_012051113.1\|729317_732149_+\|isoleucine--tRNA-ligase	unknown	unknown	gnl\|CDD\|235588
NC_009512.1\|WP_012051120.1\|740485_741181_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213191
NC_009512.1\|WP_003247565.1\|742953_743814_-\|branched-chain-amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|119324
NC_009512.1\|WP_012051117.1\|736441_737539_+\|glycine-oxidase-ThiO	unknown	unknown	gnl\|CDD\|274092
NC_009512.1\|WP_003247609.1\|732141_732657_+\|lipoprotein-signal-peptidase	unknown	unknown	gnl\|CDD\|234739
NC_009512.1\|WP_041168281.1\|734717_734900_+\|prepilin-type-N-terminal-cleavage/methylation-domain-containing-protein	unknown	unknown	gnl\|CDD\|227302
NC_009512.1\|WP_003247567.1\|741932_742952_-\|branched-chain-amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|119323
NC_009512.1\|WP_012051119.1\|739094_740372_-\|Zn-dependent-hydrolase	unknown	unknown	gnl\|CDD\|237250
NC_009512.1\|WP_012051116.1\|735531_735996_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227070
NC_009512.1\|WP_020192253.1\|745172_745937_-\|FadR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225097
NC_009512.1\|WP_004577287.1\|733101_734049_+\|4-hydroxy-3-methylbut-2-enyl-diphosphate-reductase	unknown	unknown	gnl\|CDD\|234893
NC_009512.1\|WP_003247554.1\|747693_748656_+\|23S-rRNA-pseudouridine(1911/1915/1917)-synthase-RluD	unknown	unknown	gnl\|CDD\|183020
NC_009512.1\|WP_003247562.1\|743879_745082_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|380668

Protein	Function_ID	Function_description	E-value
NC_009512.1\|WP_012051121.1\|741180_741933_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|213186	cd03219, ABC_Mj1267_LivG_branched, ATP-binding cassette component of branched chain amino acids transport system. The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine. MJ1267 is a branched-chain amino acid transporter with 29% similarity to both the LivF and LivG components of the E. coli branched-chain amino acid transporter. MJ1267 contains an insertion from residues 114 to 123 characteristic of LivG (Leucine-Isoleucine-Valine) homologs. The branched-chain amino acid transporter from E. coli comprises a heterodimer of ABCs (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ).	5.3197e-111
NC_009512.1\|WP_012051114.1\|734125_734608_-\|hypothetical-protein	gnl\|CDD\|378793	pfam12019, GspH, Type II transport protein GspH. GspH is involved in bacterial type II export systems. Like all pilins, GspH has an N-terminus alpha helix. This helix is followed by nine beta strands forming two beta sheets, one of five antiparallel strands and one of four antiparallel strands. GspH is a minor pseudopilin; it is expressed much less than other pseudopilins in the type II secretion pilus (major pilins). The function and localization of minor pseudo-pilins are still to be fully unraveled. It has been suggested that some minor pseudopilins may assemble either into the base or the tip of pili, or both. They function as initiators or regulators of pilus biogenesis and dynamics, and/or as adaptors between various pseudopilin component and other members of the T2SS.	7.03018e-10
NC_009512.1\|WP_012051115.1\|734896_735535_+\|prepilin-type-N-terminal-cleavage/methylation-domain-containing-protein	gnl\|CDD\|227301	COG4966, PilW, Tfp pilus assembly protein PilW [Cell motility and secretion / Intracellular trafficking and secretion].	4.90483e-13
NC_009512.1\|WP_012051124.1\|746526_747546_-\|outer-membrane-protein-assembly-factor-BamD	gnl\|CDD\|274513	TIGR03302, OM_YfiO, outer membrane assembly lipoprotein YfiO. Members of this protein family include YfiO, a near-essential protein of the outer membrane, part of a complex involved in protein insertion into the bacterial outer membrane. Many proteins in this family are annotated as ComL, based on the involvement of this protein in natural transformation with exogenous DNA in Neisseria gonorrhoeae. This protein family shows sequence similarity to, but is distinct from, the tol-pal system protein YbgF (TIGR02795). [Protein fate, Protein and peptide secretion and trafficking].	8.69896e-100
NC_009512.1\|WP_003247607.1\|732649_733087_+\|FKBP-type-peptidyl-prolyl-cis-trans-isomerase	gnl\|CDD\|223976	COG1047, SlpA, FKBP-type peptidyl-prolyl cis-trans isomerases 2 [Posttranslational modification, protein turnover, chaperones].	2.3483e-49
NC_009512.1\|WP_003247577.1\|735997_736387_+\|prepilin-type-N-terminal-cleavage/methylation-domain-containing-protein	gnl\|CDD\|227303	COG4968, PilE, Tfp pilus assembly protein PilE [Cell motility and secretion / Intracellular trafficking and secretion].	8.22459e-21
NC_009512.1\|WP_012051113.1\|729317_732149_+\|isoleucine--tRNA-ligase	gnl\|CDD\|235588	PRK05743, ileS, isoleucyl-tRNA synthetase; Reviewed.	0
NC_009512.1\|WP_012051120.1\|740485_741181_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|213191	cd03224, ABC_TM1139_LivF_branched, ATP-binding cassette domain of branched-chain amino acid transporter. LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids. The E. coli branched-chain amino acid transporter comprises a heterodimer of ABC transporters (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ). ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.	8.79692e-112
NC_009512.1\|WP_003247565.1\|742953_743814_-\|branched-chain-amino-acid-ABC-transporter-permease	gnl\|CDD\|119324	cd06582, TM_PBP1_LivH_like, Transmembrane subunit (TM) of Escherichia coli LivH and related proteins. LivH is one of two TMs of the E. coli LIV-1/LS transporter, a Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporter involved in the uptake of branched-chain amino acids (AAs). These types of transporters generally bind type 1 PBPs. PBP-dependent ABC transporters consist of a PBP, two TMs, and two cytoplasmic ABCs, and are mainly involved in importing solutes from the environment. The solute is captured by the PBP, which delivers it to a gated translocation pathway formed by the two TMs. The two ABCs bind and hydrolyze ATP and drive the transport reaction. E. coli LivH forms a heterodimer with another TM, LivM, to generate the transmembrane pore. LivM is not included in this subgroup. The LIV-1/LS transporter is comprised of two TMs (LivM and LivH), two ABCs (LivG and LivF), and one of two alternative PBPs, LivJ (LIV-BP) or LivK (LS-BP). In addition to transporting branched-chain AAs including leucine, isoleucine and valine, the E. coli LIV-1/LS transporter is involved in the uptake of the aromatic AA, phenylalanine.	4.0484e-67
NC_009512.1\|WP_012051117.1\|736441_737539_+\|glycine-oxidase-ThiO	gnl\|CDD\|274092	TIGR02352, Glycine_oxidase, glycine oxidase ThiO. This family consists of the homotetrameric, FAD-dependent glycine oxidase ThiO, from species such as Bacillus subtilis that use glycine in thiamine biosynthesis. In general, members of this family will not be found in species such as E. coli that instead use tyrosine and the ThiH protein. [Biosynthesis of cofactors, prosthetic groups, and carriers, Thiamine].	4.41659e-72
NC_009512.1\|WP_003247609.1\|732141_732657_+\|lipoprotein-signal-peptidase	gnl\|CDD\|234739	PRK00376, lspA, lipoprotein signal peptidase.	1.22904e-70
NC_009512.1\|WP_041168281.1\|734717_734900_+\|prepilin-type-N-terminal-cleavage/methylation-domain-containing-protein	gnl\|CDD\|227302	COG4967, PilV, Tfp pilus assembly protein PilV [Cell motility and secretion / Intracellular trafficking and secretion].	2.56307e-07
NC_009512.1\|WP_003247567.1\|741932_742952_-\|branched-chain-amino-acid-ABC-transporter-permease	gnl\|CDD\|119323	cd06581, TM_PBP1_LivM_like, Transmembrane subunit (TM) of Escherichia coli LivM and related proteins. LivM is one of two TMs of the E. coli LIV-1/LS transporter, a Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporter involved in the uptake of branched-chain amino acids (AAs). These types of transporters generally bind type 1 PBPs. PBP-dependent ABC transporters consist of a PBP, two TMs, and two cytoplasmic ABCs, and are mainly involved in importing solutes from the environment. The solute is captured by the PBP, which delivers it to a gated translocation pathway formed by the two TMs. The two ABCs bind and hydrolyze ATP and drive the transport reaction. E. coli LivM forms a heterodimer with another TM, LivH, to generate the transmembrane pore. LivH is not included in this subgroup. The LIV-1/LS transporter is comprised of two TMs (LivM and LivH), two ABCs (LivG and LivF), and one of two alternative PBPs, LivJ (LIV-BP) or LivK (LS-BP). In addition to transporting branched-chain AAs including leucine, isoleucine and valine, the E. coli LIV-1/LS transporter is involved in the uptake of the aromatic AA, phenylalanine.	2.85239e-77
NC_009512.1\|WP_012051119.1\|739094_740372_-\|Zn-dependent-hydrolase	gnl\|CDD\|237250	PRK12893, PRK12893, Zn-dependent hydrolase.	0
NC_009512.1\|WP_012051116.1\|735531_735996_+\|hypothetical-protein	gnl\|CDD\|227070	COG4726, PilX, Tfp pilus assembly protein PilX [Cell motility and secretion / Intracellular trafficking and secretion].	3.71138e-10
NC_009512.1\|WP_020192253.1\|745172_745937_-\|FadR-family-transcriptional-regulator	gnl\|CDD\|225097	COG2186, FadR, Transcriptional regulators [Transcription].	1.38868e-36
NC_009512.1\|WP_004577287.1\|733101_734049_+\|4-hydroxy-3-methylbut-2-enyl-diphosphate-reductase	gnl\|CDD\|234893	PRK01045, ispH, 4-hydroxy-3-methylbut-2-enyl diphosphate reductase; Reviewed.	0
NC_009512.1\|WP_003247554.1\|747693_748656_+\|23S-rRNA-pseudouridine(1911/1915/1917)-synthase-RluD	gnl\|CDD\|183020	PRK11180, rluD, 23S rRNA pseudouridine(1911/1915/1917) synthase RluD.	2.37478e-168
NC_009512.1\|WP_003247562.1\|743879_745082_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|380668	cd20378, PBP1_SBP-like, periplasmic substrate-binding domain of active transport proteins. Periplasmic substrate-binding domain of active transport proteins found in bacteria and Archaea. Members of this group are initial receptors in the process of active transport across cellular membrane, but their substrate specificities are not known in detail. However, they closely resemble the group of AmiC and active transport systems for short-chain amides and urea (FmdDEF), and thus are likely to exhibit a ligand-binding mode similar to that of the amide sensor protein AmiC from Pseudomonas aeruginosa. Moreover, this binding domain has high sequence identity to the family of hydrophobic amino acid transporters (HAAT), and thus it may also be involved in transport of amino acids.	0

>NC_009512.1|WP_012051117.1|736441_737539_+|glycine-oxidase-ThiO
MSKQVVVVGGGVIGLLTAFNLAAKVGQVVVCDQGEVGRESSWAGGGIVSPLYPWRYSAAVTALAHWSQDFYPQLGERLFASTGVDPEVHTTGLYWLDLDDEAEALAWAAREQRPLSAVDISAAYDAVPVLGPGFKHAIYMAGVANVRNPRLVKSLKAALLALPNVTLREHCQITGFVQEKGRVTGVQTADGVLAADEVVLSAGAWSGDLLRTLGLELPVEPVKGQMILFKCAEYFLPSMVLAKGRYAIPRRDGHILVGSTLEHAGYDKTPTGDALESLKASAVELLPELEGATVVAHWAGLRPGSPEGIPYIGPVPGHEGLWLNCGHYRNGLVLAPASCQLFTDLLTGAEPIIDPAPYAPEGRLG
>NC_009512.1|WP_003247577.1|735997_736387_+|prepilin-type-N-terminal-cleavage/methylation-domain-containing-protein
MQQGLSLIELLIVLAVTGILAAIAYPSYSDQLRRAARSEVVGLLHDAALRLERHRVRTGQYAEGDLVLPEGTRYYSLQAQRDSDTFTLRARRLPHGLMAQDGCGDFQLDQAGMQRNPGAVEHSTHCWGS
>NC_009512.1|WP_012051116.1|735531_735996_+|hypothetical-protein
MNRQRGVVLLLALVLSVLLGLLATSALRDALVETRMTGYLSDGLLALEEAEATLLAGERELERSPPDVCNACLPPPRPHDLVGQWQGTQTGFFQLQNLGVSTRAAHMPEGQPVSLFRITAVSKQSRSRHVLEAVYAVAGNQTQRITWRQRLRGD
>NC_009512.1|WP_012051115.1|734896_735535_+|prepilin-type-N-terminal-cleavage/methylation-domain-containing-protein
MRRCQAGFGLLEMVVALAIGLMLLAAASQLFVSAHQTWRLQSTAVRMQDSARLALLRMAQDIRMAGMFGCLRLTPDDFLVSGAEQAFTRPLASGPSSLSLVVAELPGYAGDPDWTLLTNCINTVEVHKERAQGSDTLMAVPVSRHRYAHVGSTLYFERRGRNQPLVDHVRELRVVQVAGERIDLQLTLYEPTLQLEQHHTLSVALRNPVPAS
>NC_009512.1|WP_041168281.1|734717_734900_+|prepilin-type-N-terminal-cleavage/methylation-domain-containing-protein
MHARQGGMTLLEVLLAVVIVAAGLFATAAMQLQALQAADSARRDGLAAMALHSEHERRRR
>NC_009512.1|WP_012051114.1|734125_734608_-|hypothetical-protein
MKQRGVTLIQMLSALAVAVLLTQLGMPAYARMSDDLHRAAAARDLAQALRSARSHAMLQSQPVLVLALDGNWGNGWRVVLEHNRQVLREQRLSKPLKITSNRGEQFKFSALGVPMTSGNSWLGATLEMCERAAARSRYQVALASSGRVRLLTEDRSNDRC
>NC_009512.1|WP_004577287.1|733101_734049_+|4-hydroxy-3-methylbut-2-enyl-diphosphate-reductase
MQIKLANPRGFCAGVDRAIEIVNRALEVFGPPIYVRHEVVHNKFVVEDLRNRGAIFVEELDQVPDDVIVIFSAHGVSQAVRQEAAGRGLKVFDATCPLVTKVHIEVAKYSRDGRECILIGHEGHPEVEGTMGQYDASNGGAIYLVEDEEDVANLQVRDPNHLAFVTQTTLSMDDTSRVIDALRARFPNIGGPRKDDICYATQNRQDAVKQLAGESDVVLVVGSPNSSNSNRLRELAERMGTPAYLIDGAEDMQRGWFDQTARIGITAGASAPEVLVRGVIEQLKAWGATGAEELDGREENITFSMPKELRVRSLI
>NC_009512.1|WP_003247607.1|732649_733087_+|FKBP-type-peptidyl-prolyl-cis-trans-isomerase
MTDTRIGQNTEVTLHFALHLENGDTVDSTFDKAPATFKVGDGNLLPGFENALFGFKAGDKRTVVVAPENAFGQPNPQNVQVMPRSNFEGMELSEGLLIIFNDAANTELPGVVKAFDDDQVTIDFNHPLAGKTLTFEVEILEVKAL
>NC_009512.1|WP_003247609.1|732141_732657_+|lipoprotein-signal-peptidase
MPNPAAGRFGRLAWLWLSLLVLVIDQATKLYFNNALTMYQQIVVIPDYFSWTLAYNTGAAFSFLADGAGWQRWLFALIAVVVSAVLVVWLKRLGRNETWLAVALALVLGGAIGNLYDRIVLGHVVDFILVHWQNRHYFPAFNVADSAITVGAVMLALDMFKSKKSEDPVHD
>NC_009512.1|WP_012051113.1|729317_732149_+|isoleucine--tRNA-ligase
MTDYKATLNLPDTAFPMKAGLPQREPQILQRWDSIGLYQKLREIGKDRPKFVLHDGPPYANGKIHIGHALNKILKDMIVRSKTLAGFDAPYVPGWDCHGLPIEHKVEVTHGKHLSADRTRELCREYAAEQIEGQKTEFIRLGVLGDWDNPYKTMNFANEAGEIRALAEMVKQGFVFKGLKPVNWCFDCGSALAEAEVEYADKKSQTIDVAFPVADEAKLAAAFGLASLTKPAAIVIWTTTPWTIPANQALNIHPEFKYALVDTGERLLVLAEELVESCLKRYNLEGSVVATAQGSALELINFRHPFYDRLSPIYLADYVELGAGTGVVHSSPAYGEDDFVTCKRYGMVNDDILTPVQSNGVYVESLPFFGGQFIWKANPAIVEKLSEVGALMHTETISHSYMHCWRHKTPLIYRATAQWFVGMDKQPSTGEPLRERALKAIEDTKFVPAWGQARLHAMIANRPDWCISRQRNWGVPIPFFLHKQTGELHPRTVELMEEVAKRVEQQGIEAWFKLDAAELLGAEADQYDKIADTLDVWFDSGTTHWHVLRGSHDIGHATGPRADLYLEGSDQHRGWFHSSLLTGCAIDNHAPYRELLTHGFTVDENGRKMSKSLGNTIEPEKVNNTLGADILRLWVSATDYSGEMAVSEQILQRSADAYRRIRNTARFLLSNLSGFDPARDLLASEDMLALDRWAVDRTLLLQRELEEHYSEYRFWNVYSKVHNFCVQELGGFYLDIIKDRQYTTGANSVARRSCQTALFHISEALVRWIAPILAFTADEIWQYLPGERNESVMLNGWYQGLSELPEGTELDRAYWDRVMAVKASVNKELENQRTAKVIGGNLQAEVTLYADEGLSADLGKLGDELRFVLITSAASVVPFAQAPAEAVATEVEGLKLKVVKSGHAKCGRCWHFRADVGSHPEHPEICSRCVDNLSGQGEVRHYA
>NC_009512.1|WP_012051119.1|739094_740372_-|Zn-dependent-hydrolase
MNTRIDPPLHLLGQGPLINRERLWQSLMDLAQLGATAKGGVCRLALTDLDRQARDLFVHWCEQAGCTVSVDAIGNIFARRPGRNPALPPIMTGSHIDTQPTGGKFDGCYGVMAGLEVMRTLNDLHLTTEAPLEVVVWTNEEGSRFPPCMMGSGVFAGKFGLQETLDKVDDQGLSVGAELQRIGYAGPRVPTGHAVGAYFEAHIEQGPVLEDQRTTIGVVQGCLGQKWFDLTLTGVEAHAGPTPMHLRKDALVGAAEVVAAVNRVAHAHQPHACGTVGCLTLHPGSRNVIPGQVHMTIDLRHLDPGHLDAMVSEVRAAIENSTAKHGLSYQLTPTADFPPLYFAEQCVDAVRQGARALGLSHMDIVSGAGHDAIFLAELGPAGMIFVPCEGGISHNEIENAAPQDLADGCDVLLRAMFQAANPGAR
>NC_009512.1|WP_012051120.1|740485_741181_-|ABC-transporter-ATP-binding-protein
MLNVDSIHSYYDKSHVLEGVSLKVEAGELVTLLGRNGAGKTTTLRSILGIVRPRQGQISFNGQQLVGREIFDIARLGIALVPEHRGIFRQLSVEENLKIAVRKASRWQLEDVYSMFPRLKERRRNGGFALSGGEQQMLAIARALLNGPKLLILDEPTEGLAPVIVDELVKILRRIKDEGLSILLVEQNLMVCDALADRHYVLEQGRVAYQGSAAQFREDPSIKNRYLALSA
>NC_009512.1|WP_012051121.1|741180_741933_-|ABC-transporter-ATP-binding-protein
MSDYLLETRQLELAYGPFKAVAGVDLKVRAGTIHTIIGPNGAGKTSLFHCLTGERQATAGKILFNGQDIIRKPSHGRVALGMARSFQLTSLFQNLSVRENLRLAAQGRDGLGALNFWRSVEHKRSHWNTADQVLERLKLSARAETLAGELSHGQQRVLEVGMSICAKPTLLMLDEPTSGMGIDDIPVMTDLISDLGRDHTVLLIEHNMSIVMSISQRITVMSHGQILVEGTPEQVRNDERVRTAYLGEAA
>NC_009512.1|WP_003247567.1|741932_742952_-|branched-chain-amino-acid-ABC-transporter-permease
MSEKNPLPVAKGRAPALLSLVVASLVALPLLLPSATLATEILIFAMAALACNLLLGYTGLLSFGQGIFFGVGAYGAALLMIHLQWGMFAALLGAAVFGAFLALLVGALAIRRTGIYFVMLTLAFSQMAYFLAYTLSGWTGGDNGLLDVPRPNIEIAGHVLVDLADPRHFYVFVAVLFLLIFAAALRVIRSPFGSTLLAIRENETRAAAIGYDTRHFKILVFMLSGAITGIAGALYAMLLHFAPLSNIDLMMSENILIMTIVGGTGSLFGSLLGAGAIVLLGDVLSELWPRWLMLLGVILILVVVFMRGGLWGGLTELGKRLLATRNADDKPQAKTKETL
>NC_009512.1|WP_003247565.1|742953_743814_-|branched-chain-amino-acid-ABC-transporter-permease
MLDLYLFQLLNGLGLGMIYFLIAVGLTIIFGLLNFVNFAHGAFFLLGAYLCYTAVAVTGNFWLALLIAPLVVAALAWAVERLLIKRIYHLPHTFQILVTLGIALIIQEASVLIWGPVGKNIAVPPELRGVLILGDFIYPYYRLFLIGFAALIGIGLWLLLERTRFGALVRAGSESTETVSLLGTNIFRLFSLTFALGVGLAGVAGVLFAPLRGAQPFVGPEILGIAFVVVVIGGMGSFGGALVGGLLVGVVQSMMTSLWPQGASLMIYGAMAAVILVRPYGLFGRA
>NC_009512.1|WP_003247562.1|743879_745082_-|ABC-transporter-substrate-binding-protein
MQRRTLLKAGLALGALGSLPLGAHRAFADQPLTFYGLKSMSGAFASYGKYADMGSRLAIAEHPQLLGHPLKYKVIDTEGNAGKAVRKVQEAIGQDGARFFQGCTLSSSALAVSKEIHKAGGVFMTPVGADEITGKDCNASTFRWSVPTYGAIRETLVPMSRQLPQAKRWYTITPQYVFGDALLDNARKVFAELGVEHIGNSYHSLQEQEFSGYLTNAIAAKPDVLVLLNFGSQASNALRQAVNFGIKDRMKVLMVWSAGLDQFQELGSDVLEGVYLGAQYWHQVDTPLNKQLVAATRKAYGINPNYPLAADYIGTKVMLEAIVKAGSLDGAAVSAALQGMRFQGPTGEELIRPGDHQVLKDYYLLRGKPQGQMRDEDDLAEVISSGRSFVEVDHTGCALA
>NC_009512.1|WP_020192253.1|745172_745937_-|FadR-family-transcriptional-regulator
MLKPKRKRQKLSDVIVESVKRSIVTEALHPGDRLPTERELMEHFECSKGTAREALKALEVEGLVSTRTGPTGGAYLNEVGTEPASRALRNYLHFQHLDGEQVYQLRKVIEVELAVSVMGKLSEADYAALQANIDFCSAPEDSEEGQREQRLAELEFHTLLANRCPNPLLRFMAVFLNDLLRDLVVLKKAYLPKRQQFAAANIDYHKQLLTALRASDEPAVRRLMHEHMCDAEHHMTALEGEVARNFLLEFDHHH
>NC_009512.1|WP_012051123.1|746203_746434_-|hypothetical-protein
MVRLLFWIALIAAAFWLWRKYKVSQQSHPEVKLDAPLKMVRCAHCGVHLPNDRALQQRNEWYCSQAHLQQGPGHQG
>NC_009512.1|WP_012051124.1|746526_747546_-|outer-membrane-protein-assembly-factor-BamD
MRVKHLLLIAILGLTAACSSNKEVIDENLSEAELYQQAQADLDNSSYTSAVNKLKALESRYPFGRYADQAQLELIYANYKNAEPEAAKSAAERFIRLHPQHPNVDYAYYLKGLTSFDQDRGLLARFLPLDMTKRDPGAARDSYNEFAQLTSRFPNSRYAPDAKQRMIYLRNLLASYEIHVADYYLSRQAYVAAANRGRYVVENFQETPSVGDGLAVMVESYQKLHLDELAATSLETLKLNYPDHPSLVDGEFQPKQTESDGRGWLSKATLGLIETDTPLPPGETRANQDVVKQFQDARDEMPRELLPKDENGDPIVPEGPKEAEKDRSWFSYMTFGLFD
>NC_009512.1|WP_003247554.1|747693_748656_+|23S-rRNA-pseudouridine(1911/1915/1917)-synthase-RluD
MSEIIQLSAEVPSELGGQRLDQVAAQLFAEYSRSRLTSWIKEGRLTVDGAVVRPRDLVHGGSLLALEAEQEAQGEWIAEDIELDIVYEDDHILVINKPAGLVVHPAAGHASGTLLNALLHHVPDIVNVPRAGIVHRLDKDTTGLMVVAKTLQAQTKLVEQMQARKVSRIYECIVIGVVTAGGKIDAPIGRHGGMRQRMAVTDGGKPAVSHYRVLKRFRSHTHVRVKLETGRTHQIRVHMAHVGFPLVGDQTYGGRFRIPPAASPTMVEAVKTFPRQALHARFLALAHPITGEVMKWESPLPDDFVWLLSLLNQDRESFIG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_009512_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_009512_3

3707766-3707914

Orphan

Consensus_repeat	Method
CCGCACTTGCCTTCACCACACTTGCCCTCGCCCCCAACCTTGGC	PILER-CR

2 spacers

The CRISPR arrays of NC_009512_3

>merge|NC_009512|3|3707766-3707914|PILER-CR
CCGCACTTGCCTTCACCACACTTGCCCTCGGCCCCAGCCTTGGCGCCGGCGCCGCACTTACCCTCACCGCACTTGCCTTCGCTCTGGGAAGCCTTGCCGCTCCCCCCGCACTTGCCTTCACCACACTTGCCCTCGCCGGCCACTTTGGC

>NC_009512|3|1|3707766-3707914|PILER-CR
CCGCACTTGCCTTCACCACACTTGCCCTCGGCCCCAGCCTTGGC	GCCGGCG
CCGCACTTACCCTCACCGCACTTGCCTTCGCTCTGGGAAGCCTT	GCCGCTCCCCCCGCACTTGCCTT
CACCACACTTGCCCTCGCCGGCCACTTTGGC

Protein	Signature genes	Signature genes Name	Protein_function
NC_009512.1\|WP_012052931.1\|3703338_3704625_+\|HAMP-domain-containing-histidine-kinase	unknown	unknown	gnl\|CDD\|223715
NC_009512.1\|WP_041168480.1\|3701579_3702095_-\|thioredoxin-family-protein	unknown	unknown	gnl\|CDD\|239310
NC_009512.1\|WP_012052937.1\|3708985_3713476_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|339245
NC_009512.1\|WP_012052933.1\|3705421_3705910_+\|DoxX-family-protein	unknown	unknown	gnl\|CDD\|225168
NC_009512.1\|WP_012052938.1\|3713573_3717995_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|339245
NC_009512.1\|WP_012052934.1\|3705943_3706639_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225760
NC_009512.1\|WP_012052939.1\|3718073_3720434_-\|DNA-polymerase-II	unknown	unknown	gnl\|CDD\|235595
NC_009512.1\|WP_004573749.1\|3702105_3702381_-\|DUF2790-domain-containing-protein	unknown	unknown	gnl\|CDD\|371321
NC_009512.1\|WP_003250463.1\|3702601_3703342_+\|response-regulator	unknown	unknown	gnl\|CDD\|181883
NC_009512.1\|WP_012052932.1\|3704789_3705407_+\|membrane-protein	unknown	unknown	unknown
NC_009512.1\|WP_003250449.1\|3708205_3708757_-\|DUF4174-domain-containing-protein	unknown	unknown	gnl\|CDD\|379363
NC_009512.1\|WP_012052935.1\|3706631_3707465_-\|DUF692-domain-containing-protein	unknown	unknown	gnl\|CDD\|235447
NC_009512.1\|WP_012052942.1\|3722685_3723606_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|182990
NC_009512.1\|WP_003250434.1\|3724557_3725184_+\|LysE-family-translocator	unknown	unknown	gnl\|CDD\|224199
NC_009512.1\|WP_014591618.1\|3721808_3722705_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176165
NC_009512.1\|WP_012052943.1\|3725223_3726306_+\|hypothetical-protein	unknown	unknown	unknown
NC_009512.1\|WP_010953345.1\|3723766_3724555_+\|YqcI/YcgG-family-protein	unknown	unknown	gnl\|CDD\|370174
NC_009512.1\|WP_003250469.1\|3700166_3700616_+\|type-II-3-dehydroquinate-dehydratase	unknown	unknown	gnl\|CDD\|237270
NC_009512.1\|WP_012052940.1\|3720500_3721691_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|225371
NC_009512.1\|WP_012052928.1\|3700612_3701461_+\|shikimate-dehydrogenase	unknown	unknown	gnl\|CDD\|183586

Protein	Function_ID	Function_description	E-value
NC_009512.1\|WP_012052931.1\|3703338_3704625_+\|HAMP-domain-containing-histidine-kinase	gnl\|CDD\|223715	COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms].	1.87732e-43
NC_009512.1\|WP_041168480.1\|3701579_3702095_-\|thioredoxin-family-protein	gnl\|CDD\|239310	cd03012, TlpA_like_DipZ_like, TlpA-like family, DipZ-like subfamily; composed uncharacterized proteins containing a TlpA-like TRX domain. Some members show domain architectures similar to that of E. coli DipZ protein (also known as DsbD). The only eukaryotic members of the TlpA family belong to this subfamily. TlpA is a disulfide reductase known to have a crucial role in the biogenesis of cytochrome aa3.	1.10579e-74
NC_009512.1\|WP_012052937.1\|3708985_3713476_-\|hypothetical-protein	gnl\|CDD\|339245	pfam14496, NEL, C-terminal novel E3 ligase, LRR-interacting. This NEL or novel E3 ligase domain is found at the C-terminus of bacterial virulence factors. Its sequence is different from those of the eukaryotic HECT and RING-finger E3 ligases, and it subverts the host ubiquitination process. At the N-terminus of the family-members there is a series of LRR repeats, and the NEL domain interacts with the most N-terminal repeat. The key residue for the ligation step is the cysteine, eg found at position 386 in UniProtKB:E7K2H2. The LRR section sequesters this active site until invasion has occurred.	1.18545e-65
NC_009512.1\|WP_012052933.1\|3705421_3705910_+\|DoxX-family-protein	gnl\|CDD\|225168	COG2259, COG2259, Predicted membrane protein [Function unknown].	1.66097e-19
NC_009512.1\|WP_012052940.1\|3720500_3721691_-\|MFS-transporter	gnl\|CDD\|225371	COG2814, AraJ, Arabinose efflux permease [Carbohydrate transport and metabolism].	4.73444e-60
NC_009512.1\|WP_012052934.1\|3705943_3706639_-\|hypothetical-protein	gnl\|CDD\|225760	COG3219, COG3219, Uncharacterized protein conserved in bacteria [Function unknown].	1.63686e-57
NC_009512.1\|WP_012052939.1\|3718073_3720434_-\|DNA-polymerase-II	gnl\|CDD\|235595	PRK05762, PRK05762, DNA polymerase II; Reviewed.	0
NC_009512.1\|WP_004573749.1\|3702105_3702381_-\|DUF2790-domain-containing-protein	gnl\|CDD\|371321	pfam10976, DUF2790, Protein of unknown function (DUF2790). This family of proteins with unknown function appear to be restricted to Pseudomonadaceae.	1.90778e-24
NC_009512.1\|WP_003250463.1\|3702601_3703342_+\|response-regulator	gnl\|CDD\|181883	PRK09468, ompR, osmolarity response regulator; Provisional.	5.57495e-76
NC_009512.1\|WP_012052938.1\|3713573_3717995_-\|hypothetical-protein	gnl\|CDD\|339245	pfam14496, NEL, C-terminal novel E3 ligase, LRR-interacting. This NEL or novel E3 ligase domain is found at the C-terminus of bacterial virulence factors. Its sequence is different from those of the eukaryotic HECT and RING-finger E3 ligases, and it subverts the host ubiquitination process. At the N-terminus of the family-members there is a series of LRR repeats, and the NEL domain interacts with the most N-terminal repeat. The key residue for the ligation step is the cysteine, eg found at position 386 in UniProtKB:E7K2H2. The LRR section sequesters this active site until invasion has occurred.	1.13838e-58
NC_009512.1\|WP_003250449.1\|3708205_3708757_-\|DUF4174-domain-containing-protein	gnl\|CDD\|379363	pfam13778, DUF4174, Domain of unknown function (DUF4174). This domain of unknown function is found in a putative tumor suppressor gene and in a ligand for the the urokinase-type plasminogen activator receptor, which plays a role in cellular migration and adhesion.	1.20614e-20
NC_009512.1\|WP_012052935.1\|3706631_3707465_-\|DUF692-domain-containing-protein	gnl\|CDD\|235447	PRK05409, PRK05409, hypothetical protein; Provisional.	2.19646e-146
NC_009512.1\|WP_012052942.1\|3722685_3723606_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|182990	PRK11139, PRK11139, DNA-binding transcriptional activator GcvA; Provisional.	8.22547e-66
NC_009512.1\|WP_003250434.1\|3724557_3725184_+\|LysE-family-translocator	gnl\|CDD\|224199	COG1280, RhtB, Putative threonine efflux protein [Amino acid transport and metabolism].	2.84657e-20
NC_009512.1\|WP_014591618.1\|3721808_3722705_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176165	cd08476, PBP2_CrgA_like_7, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 7. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	5.8929e-109
NC_009512.1\|WP_010953345.1\|3723766_3724555_+\|YqcI/YcgG-family-protein	gnl\|CDD\|370174	pfam08892, YqcI_YcgG, YqcI/YcgG family. This family of proteins are functionally uncharacterized. The family include YqcI and YcgG from B. subtilis. The alignment contains a conserved FPC motif at the N-terminus and CPF at the C-terminus.	5.06361e-75
NC_009512.1\|WP_003250469.1\|3700166_3700616_+\|type-II-3-dehydroquinate-dehydratase	gnl\|CDD\|237270	PRK13015, PRK13015, 3-dehydroquinate dehydratase; Reviewed.	2.87001e-96
NC_009512.1\|WP_012052928.1\|3700612_3701461_+\|shikimate-dehydrogenase	gnl\|CDD\|183586	PRK12549, PRK12549, shikimate 5-dehydrogenase; Reviewed.	6.12726e-179

>NC_009512.1|WP_012052935.1|3706631_3707465_-|DUF692-domain-containing-protein
MFPAMLNIGLGLRRGLLPELLAMEAGAVDFLECAPENWIAVGGAYGKGLAQLAERFAVTCHGLSLSLGGSAPLDRHFLEQTRQFLDRYHVRLYSEHLSYCSDDGHLYDLMPIPFTDEAVHHVAARIRQAQEQLERRIAVENISYYAAPYQAMSELDFIQAVLEEADCDLLLDVNNVYVNACNHGYDAQQFLAGLPPARVTGMHVAGHYDEAPDLKVDTHGAAVKEDVWTLYASACVRFGVKPTVLERDFNYPPLAELLAETARMRAVQSAAGGQADE
>NC_009512.1|WP_012052934.1|3705943_3706639_-|hypothetical-protein
MNETLRAQQYALARHLRDPQRHAPPPGVEARRLKVYRELFYGAIEGLLAGSFPVMRQALGEQRWHARVRDFYASYRCQTPLFTEIAETFVDYLQRVALDTPWQLELAHYEWVEAQLYLSDAEDPAHDPGGDLLAGEPLLSCVARVLAYRWPVESIGVDYQPTAAPVSPSLLLVYRDARLQVRFARLAPMAYRLLVEQGTGRERLQALGGDVQQGLALLEALREQGVIVGTV
>NC_009512.1|WP_012052933.1|3705421_3705910_+|DoxX-family-protein
MTTLTRTLTTVDRLGSWSADVPLRVFLAWEFFESGLEKFNGSNWFADLQSSFPFPFNLLPAELNWQLSMWAELVLPLLLLLGLGTRLASLGLMVVTVVAIAAVHWPAHWSGLAELAQGYAITDQGFGNYKLPLIYLVALLPLLLKGAGRLSLDHWLGMRFGR
>NC_009512.1|WP_012052932.1|3704789_3705407_+|membrane-protein
MKALTLPSGWKLFAALAGLTLAMTAIVLASQPDPDGLRSAIRATARSSFALFLLAFLASSLVTLLPGTSSRRILQERRYLGLAFAFSHTVHGVLIYRYAQQFPELFWAGRTLTSSLPGTVGYLFVLLLTATSFKPPMRLLGGRAWQALHSSGMWVLAAVFCLSFYKRIPMGGWYPLAFALMFSAIAVKLTAKVARKQRRTTRALA
>NC_009512.1|WP_012052931.1|3703338_3704625_+|HAMP-domain-containing-histidine-kinase
MKWPRTLASRLALIFFTGLVLAYGLSFGLQAYERYISSRSMMLSNLEQDVATSVAILDRLPAAERAAWLPRLERRTYRYRLDQGLAGEAMPSSDPPMAAASIVKAIGSDYRLTFLEIPGPNAHFQAHLNLADGAPLTIDVTPAPVPVARWLPVVLLIQLAVLLLCTWLAVRLAIGPLTRLAQAVDNLDPDQPGVQLDESGPREVRYAAVAFNALQARIAAHLKERMQLLAAISHDLQTPITRMKLRVEVMDEGVEKDKFGSDLDEMEHLVREGVAYARSMDSSTEATCRVNLDAFLDSLVFDYQDSGAQVERHGSSGTLLETRPHALRRVLVNLVDNALKFAGAAELQVSREGSTTIIRVLDNGPGIPGDELDEVLKPFYRVEGSRNRSTGGTGLGLAIAHQLIQAMGGRLTLSNREQGGLCAQIELT
>NC_009512.1|WP_003250463.1|3702601_3703342_+|response-regulator
MEHVDHILIVDDDREIRELVGNYLKKNGLRTSIVADGRQMRAFLEANSVDLIVLDIMMPGDDGLLLCRELRAGKHRNTPVLMLTARNDETDRIIGLEMGADDYLTKPFSARELLARINAVLRRTRMLPPNLTISESSRLLGFGQWRLDTTARHLLDSEGTLVALSGAEYRLLRVFLDHPQRVLSREQLLNLTQGREADIFDRSIDLLVSRLRQRLGDDAREPSCIKTVRSEGYVFSLPVQLLESPS
>NC_009512.1|WP_004573749.1|3702105_3702381_-|DUF2790-domain-containing-protein
MNVKTIASASLFAVLSFGAIAAQAATAPMQDGGVMQYRYGEPLDVKKVLSVQDDQSNACGLVNTRMDYLDSHGQRQSVQYRTYATGGCHDN
>NC_009512.1|WP_041168480.1|3701579_3702095_-|thioredoxin-family-protein
MLKAGGFALALMGLGLAGHLKARDSYGAMPSLSGASQWLNSPPVDAPGLKGKVVLVDFWTWDCINCRRSLPHVNDWARRYADQGLVVVGVHTPEFDYEHDVDTLRDKLARLGIGYPVAVDNDYKVWNAWGNQFWPAHYFVDRKGQVRHVHVGEGDYGEQEQVIQALLDEKG
>NC_009512.1|WP_012052928.1|3700612_3701461_+|shikimate-dehydrogenase
MSQQAILAGLIGRGIQLSRTPALHEHEGDAQALRYLYRLIDADQLQLDDSALPGLLEAAQHTGFTGLNITYPFKQAILPLLDELSDEARGIGAVNTVVLKDGKRVGHNTDCLGFAEGLRRGLPDVARRQVVQMGAGGAGSAVAHALLGEGVERLVLFEVDATRAQALVDNLNTHFGAERAVLGTDLATALAEADGLVNTTPVGMAKLPGTPLPVALLHPRLWVAEIIYFPLETELLRAARALGCRTLDGSYMAVFQAVKAFELFSGRQADAARMQAHFASFT
>NC_009512.1|WP_003250469.1|3700166_3700616_+|type-II-3-dehydroquinate-dehydratase
MKPLILVLNGPNLNMLGTREPAQYGHETLADLAQGCADTAHAHGLEIEFRQTNHEGELIDWIHAARGRCAGIVINPGAWTHTSVAIRDALVASELPVIEVHLSNVHKREPFRHLSFVSSIAVGVICGLGSHGYRMALSHFAELLQERAA
>NC_009512.1|WP_003250449.1|3708205_3708757_-|DUF4174-domain-containing-protein
MLVRSLTLATLLAVAGPLFAADSDAPLAKELGKARPLVVIAPSSADPTLRGLNKALEDPATQAAFKERNLVLYSVANMMGKREDKNLEQQTTMALIRELKLGASKGTKVILVGKDGERHMLKDDDTGEAIDPQVILKAVDELPASEKAVAAPEPVAAAPQAKDKDSKPAKPAKPAAPPKPLED
>NC_009512.1|WP_012052937.1|3708985_3713476_-|hypothetical-protein
MDTTLPSDAQAAIDAFQDGIIGRRLPPWLRHAPAEQLPEIGRALSNSLRCCEQVNTVLRGIEGLDSFVASALGKALDERYGLGRNPHLLRFLEGRREAVINSQPVGAHLTTVVYEEKPLLEVALRNFTDAQAQEGGQPRGNRLLLPRHGTVKPPTSIEFAGLCRELDLGERYQRHLDAILTPSGSAERLVSQLVDATRYTMLVDAYKARQEGTLDASELNVMVAVCEKGELPRLAGDLVQARQLKLLGCQIEQVTVFVVVEQGVLFNTTRRVLLYVPGDPFSPWRAFESLDKLNRELGRRLRDKAYQRFFSRFVLRRDSQAFFAQVAERFDGLPGWAFRDLEPRLQAYPQPLFISLAQARIHQIKDDAAMIAVPVARLDREVQRQHDLRLAAEGWALLNLASFFVPGLGLALLAVTAYELLGEVYHGAEAWQQGDRQEALDHLTHVATDLAVLATTVAGVGVARRVWARSAKVDAMVPARLEDGTEKLWQHDLTLFQSQAPVAASSRDALGIRRQDGRAWIEMDGHHYRVAEAGDDQWQLYPVDGHGPLLRHNGAGAWRLWSEQPARWTDKYRMFRRLGEPFNRLNDEQIDEVLLFHGLDGDDLRGLHVHAQAPSPGMIDSVERVRLDQRIRSMIGRLRSGEPVADTTVLDHARRLPGASGLTDQALAALAWTQRRTLLQHLFEALQPSDTAGSAALRRVFPRLSARTAQALVQAASSIDRTRLLSSGRVVLGLAEAARGSVLATRQARVFEALYLDTPQHADLARVALGLLRYLPGGEGVCWRLYEGCLGGPMLAKTEQGQRAFDLVHVNGTFQLHGSQGTALGEAGELFDVMAPAYTEAQRAAMGIGDPFTHNLRVILAREAARHRDEISRLLGAVRPGAVRGPMRLADGRIGYPLGGGGVGGFASRGSALRATLRDLFPWLSDEQVETFADDARRSGQQIEHVLTDLRNEFAILRITLNTWVARGQGDVREDREALRQTLFNCWRRSVGVGELQINAQENLHVMFCNFRSSGLPNIPPQVSFRGVTSLSLLHLDLLEVPSSLLLAFPNLQTLDLGGNLLTRLPQPLLQIPQLRHLSLTNNRIVLNTAQTATLASCTSLQSLDLSHNPLGSRFTLAGLAELRWLNLRDTQISQFPLGVFDNAQLVSVDLRDNRIRHIPEGFYQLPVWHRRRFRLNANPLGEAQTLRLQASLSSVDPALDEEQVLLRLQHAREVWGDAVAPEHRGLMLAAWDSLDAGQDAERFFRVLRQLLLSEDFRVNARALGNRVMAVLQAMAITPELRQNLLSVANDEWGCQDGATWCLSNLELNLLVWQVEHAAQGESERALLDLGRRLWRQDAVDMFATRWALQHGRTLEGSEVGLAFRIGLRERLDLPLQVGEMSFLAISGVLEADLAEAEAAVRDAETPEEIARSMVDREFWQAHLERSHPERFAAVDLPFRRQLETVLDDEALSEGARIDQADAIRDAQRAARRGLMLDMTIQAMEMGPKGPSIDVR
>NC_009512.1|WP_012052938.1|3713573_3717995_-|hypothetical-protein
MQNNSRQPSAAVDTLAMAQACQDHYIAQRLPAWMKRLSMAEFSLLSEALAELLACRAGLSSALARLSNLNAFTQPLLQQALGAHGDLDVDRLYFRQWYTFTSPTIHYVTSRLPVVGSDYYDIPLLEAALSNFTAEQQRDQPQGNCLVDVRGARRSELSAPSFARLCRALDLGQKYQAHLDSVLQPEVRGLLTRRQRYSMLVDALQARAQGVLSADELQWVVALCTKDTLGKLEGASVRVRQLAVFGCRLQQIVVLDVIDAGLLFNTSKRVLVYVPGDPHGPWSVRSDLEDYARRVLGKRLREDDYRRFFNRFVRRRDSQRFFSAVSERLDDVPGWATRDLDEQTFAYRLPLFEHLADDWIARIKDDAAVIAPPVALLDREVQAEHARRLRAEGWTLLGVAGFFVPGIGAVLLGVMAWELLEQTFQAVGDWQDNERNAALAHLLNVGKGLLAVGATVAVVATARRAWSVVDNLVPAQLENGEEKLWNADLGPYRCESPPDMAVPDMEGMHRLGERRWISMDGHWYEMTWHNDDEQWQLLPYQGYAPPLRHNGAGAWRLWYEQPAEWGDTRQLFRRLGGPFSDLDDAQIDQSLAIHGLDDQHLRAWHVYGLAPEAALVDTVARVRLAGRIGTLINHLREGGVTADPLLLEQVMRLPQAAGKDGAALADVAWAGRRALLQAVYEEQNPDTETGRLLRQNFASLHRLAADEVLRDASEDDLQLLRETGRVPLPMAEAARLQVARIRIARVYEALSIDTPQNLDLARVVLNLLVHVPGAGGPGWRLYDGDASEPLVTVEGSGQTFDLLHRHGLFRLRTRTHTVAGERGELFETLAAAYDDASQAAIGQGRSFVPALRQALTDVAIEQRQTVVNLLRLEQPTGSFLPPQRLADGRVGYPLAGGRFWGALGRNRPRALQARLRDLYPAFSDEQIGHWLASGDAQARLHRLEQQYGVLKRHLTQWARSALLSSELPARREFRKGLINCWRCLVPELQGQAALDDGRFMLTQTISRLGHLPALPAQVGFPHVSILALRAMRVEHVPDEFLRAFPNLRNLEITHCRLTRLPLPLMLVQKLEVLDLSGNQIALDQGQALVLADCRSLVYLNLSDNPLRRAFSVQAMTELNALYLSNTQLPECPYGLMDAPELHTLNLSGNRISELPEGFHQSQLWRLGRVELSGNRLGGAQVGLSNWHLLEASRVPYRLRILDALPGERRDEMAALWAHLEAEEQSEAFFNTLSMLTESGAFSFSSTASALAARVFDMFQAMSEHDALRQELFEHAAATGCQDNATARFANLELRVMIWRTRHSGSARPERALLKLGARMWRLAVLEQIAAEHAHRVGASAESIEFALAYRIGLRTSLDLPGQPDEMLYAGIPALSSQDLLLARERVLARQTREGIADYLSRQWFWQDYLRKACSVRLQVPQSMHAELERLMALGNRDEEIARLQIRNQQREHAVLLQLTLEALDRNTVQRPLS
>NC_009512.1|WP_012052939.1|3718073_3720434_-|DNA-polymerase-II
MELQQGFVLTRHWHDTPEGTCVEFWLATDAGPRLLRLAAQESVAFIPQAQAEHARVLLANEAGTKLKPLRLKDFEHRPMLGLYARQHRQLMQLEQRLRTAGIDVFEADIRPPERYLMERFITAPVQFTGQPDAQGVYRDAQLKPQPGYRPALRLVSLDIETSERGELYSIALEGCGQRQVYMLGPANGDATGLDFDLEYCADRAALITRLNQWMAKHDPDAIIGWNLVQFDLRLLHEHAKSLQVPLALGRNGAVMTLRSHAGGGHVFADAPGRLLIDGIEALRSATWSFASFSLENVAQTLLGEGKAIDTPYQRMDEINRRFAEDKPALARYNLKDCELVTRIFAHTRLLDFLLERASVTGLAVDRSGGSVAAFCHLYIPQMHRLGFVAPSLGSRPDEASPGGFVMDSRPGLYDSVLVLDYKSLYPSIIRTFLIDPVGLIEGLRQPDDAHSVEGFRGGRFSRTQHCLPAIVERVWQGREAAKREGNAPLSQALKIIMNAFYGVLGSSGCRFFDPRLASSITMRGHQIMRQTRSLIEACGYDVIYGDTDSTFVWLKGAHAEEDAARIGRELVAKVNQWWQAHLHETMNLQSALELQFEVHYRRFLMPTIRGTDEGSKKRYAGLVQRADGAEEMVYKGLESVRTDWSPLARQFQQELYGRVFRSEPYRDYVREYVRRTLAGEQDELLVYRKRLRRPLADYQRNVPPHVRAARLADDYNKRLQRPLQYQRGGWISYVITTAGPEPLENLQAPIDYDHYISRQLLPVADAILPFVGDDFARLTDHQLLLF
>NC_009512.1|WP_012052940.1|3720500_3721691_-|MFS-transporter
MSQTSSAPVLAASNERLPVGGLLALAMTGFIAILSETLPAGLLDQIADGMHISQAMAGQWVTAYALGSLLTAIPLVTLTQGWYRRRALLLAIIGFVLFNGLTALSDSNSLTLVLRFFTGAAAGLAWGLIAGHARRMVPVPLQGRAMALAMLGQPIALSLGLPIATWLGAGLGWRATFVVVTLVASLLVVWVLRSVPDYPGQAAGKRPAAMQVLRTPGVLIVLLVILTWILGHNILYTYIVPLLAAAGMAADIGPVLMVFGLSALAGIGLVGLLVDRHLRKLVLLSLAGFALATLALGQASSWLVYLSIALWGMTYGGAPTLLQTACADAAGQGGDVAQSMLVTVWNCAIALGGIIGGLLLTGAGVAWFGGVVLGLIALAWLLAVAGRGSGFVAGRR
>NC_009512.1|WP_014591618.1|3721808_3722705_+|LysR-family-transcriptional-regulator
MDSLSGFVVFNRVAETRSFVAASQSLGISASAVGKRVARLESRLGVRLFHRSTRSITLTAEGTMFLERSRRILAEIEATEQELSQASETPRGRLRVSMPQVTRLVMPALAEFMALYPQVELDLDFSDRMVDIVGEGFDVVMRGGQPVDSRLSAKFLGHFQHRLVASPEYLRERGTPLHPRDLAAHTCLHYRFPSNGKLETWPLRQEHPEQAYDIPISMVCNHVETRVCFALNHRGITCLPDFNVGRELANGSLVSVLDDFMERRGSFYLLWPSGRQMPPKLRVFIDFMLARVFNRTGS
>NC_009512.1|WP_012052942.1|3722685_3723606_-|LysR-family-transcriptional-regulator
MSERIQALHALRAFEVASRYGSFTRAAEELALTQGAVSHHIKTLEALFGCDLFERRGPKLSLTEHGRLLAQELKVGFKIIENACALLRQDRYGLRLKAPSTLTVRWLLRALDAFKKVEDNCSVQLSSVWMDIDSVDFYSEPYDCAILLASGRFPADIESFKLFDEWLIPVCHPDYMTQAQPQLSDLPRCEFLHPSPDRRDWRRWLARMDALDISIDQGQVFDTLDQGISAAQQGLGISVVDLVLASTDLAAGRLVTPFKHAVATGDGYYMTWLKASPKARQMNKLRDFLLGQVPPLAYKDINYLYG
>NC_009512.1|WP_010953345.1|3723766_3724555_+|YqcI/YcgG-family-protein
MFTGYGNCYRLDALELAAEHGHTMQHWTFKTIEHFRSILANPEFPCLFGRKAVNGETCHILFARAEQLADDIAQGLANYVRTVAPIAPKQRIGSPLVVFLETAAGSSLAEQQALAWKVLRGVHARDPHPWPQGIPTDPDDTGWSFCYAGMPLFINMNFPGHQQMKSRNLGQHITFVINPRENFDEVANANTESGKRIRERIRERVHHYNDGVVPDTLGFFGDTDNYEWKQYQLQEAGSLNPSRCPFHAHAAHQPTPDILIEN
>NC_009512.1|WP_003250434.1|3724557_3725184_+|LysE-family-translocator
MNTALTATYALTVLLLIATPGPVVALIVNTAAASGSRKAMFTAVGTNWASLVLIGAAAWIILTSAAIDKTWLSTMSLLGCLFIGYIAMGTLRDALQAPASDAASEAPKAGRGGLMQGFMVGISNPKDIIFFIAFFPQFIQITESFGKSMVVLSLLWVAIDFAVLSLYIFAIGKIASQRSNRIISLASGVALLLIAAGGLLYNLKELAA
>NC_009512.1|WP_012052943.1|3725223_3726306_+|hypothetical-protein
MTTTDTRPSPSPLQQDYQRFLLLGSRRAPYTLHVHETGYRSGTINTDALGLRYSHCAGKRFSAAEHGGASRINLLVGGSTALGIGASSDEHTVASHLSMLTGEVWLSLAGCGLNATQELMMFLTHQHRLGQLGHVVVLSGLNSLAHEALCEVLAGTNDPQHAKAYQAFLNSFSEGMQPCAPPRRQSLWRRIGQALTPPVVTAPVSWPLSSPEKRLARAADNIGRTLRQWDRLLADSHATLTFILQPLLPWCRDTLPAGEQAMLTALQQQPANFDRLLEGAFDRQLHSAFFRRIKSQADPVPCYDMNCMLDSSPVFGADLFIDRLHLNDLGNNALAKVITAKLGLAQEKHAQRKVTPIKLV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1117427 : 1125206

Thermobifida_phage(16.67%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003255139.1\|1117427_1118282_-	RNase adapter RapZ	A0A0R8VB27	Thermobifida_phage	2.4e-08	31.9
WP_003255137.1\|1118284_1118749_-	PTS IIA-like nitrogen regulatory protein PtsN	NA	NA	NA	NA
WP_003255135.1\|1118761_1119070_-	ribosome-associated translation inhibitor RaiA	A0A0K1LP60	Escherichia_phage	4.4e-05	34.1
WP_003255133.1\|1119149_1120643_-	RNA polymerase factor sigma-54	NA	NA	NA	NA
WP_003255132.1\|1120818_1121544_-	LPS export ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	8.4e-23	26.5
WP_003255131.1\|1121544_1122069_-	lipopolysaccharide transport periplasmic protein LptA	NA	NA	NA	NA
WP_012051313.1\|1122055_1122628_-	LPS export ABC transporter periplasmic protein LptC	NA	NA	NA	NA
WP_012051314.1\|1122636_1123161_-	HAD family hydrolase	A0A140XBD6	Dickeya_phage	6.9e-27	48.1
WP_012051315.1\|1123173_1124148_-	KpsF/GutQ family sugar-phosphate isomerase	A0A2P0VNK5	Tetraselmis_virus	1.0e-36	32.8
WP_012051316.1\|1124396_1125206_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	1.0e-24	33.2

DBSCAN-SWA_2

2104853 : 2115477

uncultured_Caudovirales_phage(66.67%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012051829.1\|2104853_2106134_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	1.5e-94	45.5
WP_012051830.1\|2106134_2107526_+	uroporphyrinogen-III C-methyltransferase	NA	NA	NA	NA
WP_004576098.1\|2107631_2108591_-	glutathione S-transferase family protein	NA	NA	NA	NA
WP_010954805.1\|2108685_2109687_-	glycosyl transferase family protein	A0A2H4JBY5	uncultured_Caudovirales_phage	3.6e-157	80.8
WP_012051831.1\|2109683_2110019_-	TusE/DsrC/DsvC family sulfur relay protein	A0A2H4J8B6	uncultured_Caudovirales_phage	2.2e-42	74.8
WP_003251193.1\|2110015_2110312_-	sulfurtransferase complex subunit TusB	A0A2H4JG28	uncultured_Caudovirales_phage	2.0e-23	58.6
WP_012051832.1\|2110311_2110671_-	sulfurtransferase complex subunit TusC	A0A2H4J8C0	uncultured_Caudovirales_phage	1.9e-36	65.8
WP_003251188.1\|2110672_2111065_-	sulfurtransferase complex subunit TusD	A0A2H4JA39	uncultured_Caudovirales_phage	1.1e-53	79.8
WP_003251186.1\|2111160_2112540_-	uracil-xanthine permease	H9YQ34	environmental_Halophage	1.6e-27	51.1
WP_003251184.1\|2112854_2113526_-	Bax inhibitor-1/YccA family protein	A0A2H4JFM9	uncultured_Caudovirales_phage	2.1e-105	91.0
WP_012051834.1\|2114709_2115477_+	3-oxoacyl-ACP reductase FabG	A0A0M4JSW6	Mollivirus	3.3e-09	23.7

DBSCAN-SWA_3

2194394 : 2198779

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_041168400.1\|2194394_2194778_-	hypothetical protein	A0A0U4JNY7	Pseudomonas_phage	1.3e-27	48.1
WP_042161499.1\|2194880_2195150_+	hypothetical protein	NA	NA	NA	NA
WP_012051889.1\|2195196_2195721_-	hypothetical protein	A0A2H4JAQ1	uncultured_Caudovirales_phage	3.8e-09	55.6
WP_012051890.1\|2195695_2196061_-	hypothetical protein	A0A2H4J0L9	uncultured_Caudovirales_phage	2.1e-54	87.6
WP_012051891.1\|2196142_2196685_-	hypothetical protein	NA	NA	NA	NA
WP_012051892.1\|2196681_2197449_-	recombinase	A0A0M3LPU0	Mannheimia_phage	8.3e-13	28.7
WP_012051893.1\|2197445_2198060_-	single-stranded DNA-binding protein	A0A1B0VMB2	Pseudomonas_phage	1.3e-56	59.8
WP_014756159.1\|2198071_2198779_+	hypothetical protein	A0A2H4J107	uncultured_Caudovirales_phage	2.6e-08	44.8

DBSCAN-SWA_4

2957998 : 3031703

uncultured_Caudovirales_phage(22.22%)

plate,protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004577666.1\|2957998_2958949_-\|transposase	IS110 family transposase	Q75QL1	Wolbachia_phage	4.6e-29	36.7
WP_012052391.1\|2959483_2962564_-	error-prone DNA polymerase	A0A0K1Y906	Streptomyces_phage	1.4e-103	28.6
WP_012052392.1\|2962560_2963979_-	DNA polymerase Y family protein	NA	NA	NA	NA
WP_012052393.1\|2963985_2964606_-	translesion DNA synthesis-associated protein ImuA	NA	NA	NA	NA
WP_012052394.1\|2964605_2965223_-	repressor LexA	A0A2H4JG58	uncultured_Caudovirales_phage	1.4e-07	40.3
WP_012052395.1\|2965314_2965998_+	HAD family phosphatase	NA	NA	NA	NA
WP_012052396.1\|2965994_2967380_-	aromatic acid/H+ symport family MFS transporter	NA	NA	NA	NA
WP_004374204.1\|2967424_2967751_-	NIPSNAP family protein	NA	NA	NA	NA
WP_012052397.1\|2967750_2969466_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_012052398.1\|2969462_2970290_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_012052399.1\|2970466_2971339_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_004576295.1\|2971416_2972190_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_012052400.1\|2972254_2973712_-	amidase	NA	NA	NA	NA
WP_012052401.1\|2973708_2975019_-	MFS transporter	Q6JIH2	Burkholderia_virus	9.6e-86	42.7
WP_012052402.1\|2975102_2976278_-	amidohydrolase	NA	NA	NA	NA
WP_012052403.1\|2976324_2977818_-	RHS repeat protein	NA	NA	NA	NA
WP_012052405.1\|2980932_2981529_-	hypothetical protein	NA	NA	NA	NA
WP_012052406.1\|2981533_2985736_-	type IV secretion protein Rhs	A0A2H4JFP5	uncultured_Caudovirales_phage	3.6e-33	42.9
WP_003248404.1\|2985742_2986210_-	DUF1795 domain-containing protein	NA	NA	NA	NA
WP_012052407.1\|2986244_2986829_-	DcrB-related protein	NA	NA	NA	NA
WP_012052408.1\|2986839_2988696_-	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	1.6e-65	29.7
WP_012052409.1\|2989608_2990160_+	hypothetical protein	NA	NA	NA	NA
WP_014756610.1\|2990306_2990513_-	hypothetical protein	NA	NA	NA	NA
WP_028697263.1\|2990753_2991503_+	hypothetical protein	NA	NA	NA	NA
WP_003248358.1\|2991567_2992107_+	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_003248356.1\|2992121_2993624_+	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_003248355.1\|2993650_2994133_+\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_012052410.1\|2994132_2995953_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_012052411.1\|2995916_2996987_+\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_012052412.1\|2996983_2999581_+	type VI secretion system ATPase TssH	A0A223W0B1	Agrobacterium_phage	4.9e-89	30.8
WP_004576638.1\|2999605_3000328_+	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_003248343.1\|3000324_3001668_+\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_012052413.1\|3001664_3002381_+	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_012052414.1\|3002411_3006215_+	ImcF domain-containing protein	NA	NA	NA	NA
WP_012052415.1\|3006211_3007120_+	type VI secretion system-associated protein TagF	NA	NA	NA	NA
WP_012052416.1\|3007116_3009612_+	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_012052417.1\|3009755_3010274_+	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_012052418.1\|3010369_3011455_+	type VI secretion system protein TssA	NA	NA	NA	NA
WP_012052419.1\|3011622_3014139_+	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	1.1e-159	35.0
WP_012052420.1\|3014223_3015873_+	MFS transporter	NA	NA	NA	NA
WP_012052421.1\|3015869_3017003_+	HlyD family secretion protein	NA	NA	NA	NA
WP_012052422.1\|3017106_3017709_+	hypothetical protein	NA	NA	NA	NA
WP_003248329.1\|3017745_3018621_-	AEC family transporter	NA	NA	NA	NA
WP_012052423.1\|3019048_3020347_+	MFS transporter	NA	NA	NA	NA
WP_003248325.1\|3020428_3020737_+	hypothetical protein	NA	NA	NA	NA
WP_003248323.1\|3020786_3021338_+	YbhB/YbcL family Raf kinase inhibitor-like protein	NA	NA	NA	NA
WP_003248320.1\|3021892_3022954_+	3-deoxy-7-phosphoheptulonate synthase	A0A1Z1LZD8	Serratia_phage	5.1e-85	48.6
WP_003248318.1\|3023034_3023316_+	peptidyl-prolyl cis-trans isomerase	NA	NA	NA	NA
WP_012052424.1\|3023458_3025258_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_012052425.1\|3025254_3026313_+	microcin C ABC transporter permease YejB	NA	NA	NA	NA
WP_012052426.1\|3026312_3027329_+	ABC transporter permease	NA	NA	NA	NA
WP_012052427.1\|3027388_3028771_+	AAA domain-containing protein	NA	NA	NA	NA
WP_004576648.1\|3028995_3030387_+	GntP family permease	NA	NA	NA	NA
WP_012052428.1\|3030397_3031168_+	3-hydroxybutyrate dehydrogenase	NA	NA	NA	NA
WP_012052429.1\|3031223_3031703_+\|protease	serine protease inhibitor ecotin	NA	NA	NA	NA

DBSCAN-SWA_5

3414430 : 3422236

uncultured_Caudovirales_phage(57.14%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012052728.1\|3414430_3415201_+	SDR family NAD(P)-dependent oxidoreductase	Q56AQ6	Bacillus_thuringiensis_phage	4.3e-41	41.1
WP_012052729.1\|3415296_3415989_+	DUF421 domain-containing protein	NA	NA	NA	NA
WP_012052730.1\|3416081_3416621_+	type 1 glutamine amidotransferase	A0A0N7KVR4	Yellowstone_lake_phycodnavirus	1.7e-20	34.9
WP_010953640.1\|3416677_3417202_-	hypothetical protein	NA	NA	NA	NA
WP_012052732.1\|3417396_3418254_+	glucose 1-dehydrogenase	A0A2N9QUX2	Trichoplusia_ni_ascovirus	2.2e-70	50.5
WP_012052733.1\|3418423_3418888_+	hemerythrin domain-containing protein	NA	NA	NA	NA
WP_014756342.1\|3419369_3419717_+	metalloregulator ArsR/SmtB family transcription factor	A0A2H4J145	uncultured_Caudovirales_phage	1.7e-34	61.9
WP_012052736.1\|3419738_3421022_+	arsenic transporter	A0A2H4J144	uncultured_Caudovirales_phage	5.8e-176	75.6
WP_012052737.1\|3421050_3421521_+	arsenate reductase ArsC	A0A2H4J8A6	uncultured_Caudovirales_phage	5.7e-57	69.2
WP_012052738.1\|3421534_3422236_+	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	3.2e-104	79.0

DBSCAN-SWA_6

3754653 : 3828752

Pseudomonas_phage(44.44%)

integrase,coat,head,tail,terminase

attL 3774050:3774075|attR 3836589:3836614

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012052956.1\|3754653_3755625_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_041168611.1\|3755621_3757919_-	fimbrial biogenesis outer membrane usher protein	NA	NA	NA	NA
WP_012052958.1\|3758027_3758804_-	molecular chaperone	NA	NA	NA	NA
WP_012052959.1\|3758844_3759348_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_012052960.1\|3759351_3759885_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_012052961.1\|3759903_3760440_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_041168483.1\|3760470_3760998_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_012052963.1\|3761265_3763512_+	GAF domain-containing protein	Q8QNA6	Ectocarpus_siliculosus_virus	1.9e-20	22.8
WP_003250360.1\|3763527_3763989_+	response regulator	NA	NA	NA	NA
WP_012052964.1\|3764002_3766390_+	response regulator	Q8QNA2	Ectocarpus_siliculosus_virus	2.4e-10	28.6
WP_012052965.1\|3766847_3767090_+	hypothetical protein	NA	NA	NA	NA
WP_012052966.1\|3767222_3768296_+	cell division protein ZapE	NA	NA	NA	NA
WP_012052967.1\|3768399_3769626_+	hypothetical protein	NA	NA	NA	NA
WP_012052968.1\|3769714_3771604_-	propionyl-CoA synthetase	A0A2H4PQU7	Staphylococcus_phage	3.1e-53	28.8
WP_004573884.1\|3771784_3772651_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_012052969.1\|3772624_3773779_-	HPP family protein	NA	NA	NA	NA
3774050:3774075	attL	NA	NA	NA	NA
WP_012052970.1\|3774098_3775418_-	sensor histidine kinase	NA	NA	NA	NA
WP_010953307.1\|3775414_3776083_-	response regulator transcription factor	NA	NA	NA	NA
WP_003250344.1\|3776083_3776398_-	PepSY domain-containing protein	NA	NA	NA	NA
WP_003250340.1\|3776397_3776706_-	peptidase	NA	NA	NA	NA
WP_004573881.1\|3776925_3778005_+	patatin-like phospholipase family protein	NA	NA	NA	NA
WP_012052972.1\|3778240_3779422_+\|integrase	tyrosine-type recombinase/integrase	A0A2H4J5F8	uncultured_Caudovirales_phage	6.6e-211	93.8
WP_012052973.1\|3779407_3779701_-	hypothetical protein	NA	NA	NA	NA
WP_012052974.1\|3779697_3779991_-	hypothetical protein	A0A2H4JER5	uncultured_Caudovirales_phage	1.6e-33	68.0
WP_012052975.1\|3780064_3780289_-	hypothetical protein	A0A2H4JG60	uncultured_Caudovirales_phage	5.9e-28	82.4
WP_041168484.1\|3780613_3781120_+	hypothetical protein	NA	NA	NA	NA
WP_012052978.1\|3782377_3782878_-	DUF2514 domain-containing protein	A0A2H4J3Q6	uncultured_Caudovirales_phage	1.4e-32	53.7
WP_012052979.1\|3782874_3783324_-	hypothetical protein	A0A2R3UAM8	Myoviridae_environmental_samples	3.6e-32	53.4
WP_012052980.1\|3783420_3784230_-	hypothetical protein	NA	NA	NA	NA
WP_012052981.1\|3784254_3786192_-	hypothetical protein	A0A2H5BHG7	Acinetobacter_phage	6.1e-20	29.0
WP_012052982.1\|3786247_3789301_-	hypothetical protein	B5WZT8	Pseudomonas_phage	3.0e-223	41.6
WP_012052983.1\|3789297_3789675_-	hypothetical protein	B5WZT7	Pseudomonas_phage	3.6e-25	44.1
WP_012052984.1\|3789677_3790157_-	DUF1833 family protein	J7I404	Pseudomonas_phage	5.3e-26	42.7
WP_012052985.1\|3790153_3790624_-	hypothetical protein	A0A286S298	Klebsiella_phage	8.7e-21	43.0
WP_012052986.1\|3790811_3793724_-\|tail	tail length tape measure protein	A0A2H4J9A1	uncultured_Caudovirales_phage	7.3e-102	35.4
WP_041168487.1\|3794279_3794519_-	hypothetical protein	NA	NA	NA	NA
WP_012052988.1\|3794626_3795112_-	hypothetical protein	NA	NA	NA	NA
WP_012052989.1\|3795169_3796339_-	Ig domain-containing protein	A0A2C9CX52	Yersinia_phage	4.5e-10	55.3
WP_012052990.1\|3796398_3796806_-	hypothetical protein	NA	NA	NA	NA
WP_012052991.1\|3796802_3797189_-	hypothetical protein	A0A059VF88	Pseudomonas_phage	2.9e-30	51.6
WP_012052992.1\|3797191_3797572_-	hypothetical protein	A0A059VA70	Pseudomonas_phage	2.8e-30	52.8
WP_012052993.1\|3797575_3797968_-	hypothetical protein	A0A0H5AUF0	Pseudomonas_phage	3.3e-05	32.3
WP_041168612.1\|3798007_3798598_-	hypothetical protein	NA	NA	NA	NA
WP_012052995.1\|3798644_3799613_-	hypothetical protein	R9TJ64	Synechococcus_phage	1.4e-113	65.7
WP_012052996.1\|3799625_3800336_-	hypothetical protein	A0A2H4J0Y0	uncultured_Caudovirales_phage	6.9e-38	60.9
WP_012052997.1\|3800453_3801500_-\|head	head morphogenesis protein	A0A1B0VMF3	Pseudomonas_phage	6.4e-48	33.9
WP_012052998.1\|3801489_3802914_-	DUF4055 domain-containing protein	A0A2H4J5M6	uncultured_Caudovirales_phage	3.5e-73	36.8
WP_012052999.1\|3802922_3804224_-\|terminase	terminase	A0A1B1P9C9	Acinetobacter_phage	2.7e-149	59.3
WP_012053000.1\|3804210_3804672_-	DUF2280 domain-containing protein	A0A0S2SY97	Pseudomonas_phage	1.3e-56	85.9
WP_041168488.1\|3804703_3805300_-	hypothetical protein	A0A0S2SYA5	Pseudomonas_phage	5.3e-100	86.4
WP_012053002.1\|3805619_3806057_-	proteasome subunit beta	A0A1B0VNC4	Pseudomonas_phage	2.0e-35	54.9
WP_041168489.1\|3806053_3806293_-	hypothetical protein	NA	NA	NA	NA
WP_012053004.1\|3806502_3806739_+	hypothetical protein	NA	NA	NA	NA
WP_012053005.1\|3806745_3807015_-	hypothetical protein	A0A1B0VME7	Pseudomonas_phage	1.1e-17	58.8
WP_012053006.1\|3807014_3807326_-	hypothetical protein	A0A1B0VME9	Pseudomonas_phage	2.9e-17	50.5
WP_012053007.1\|3807735_3808281_-	hypothetical protein	A0A0H5AWB8	Pseudomonas_phage	3.9e-57	63.6
WP_041168613.1\|3808420_3809026_-	ninG protein	A0A0U1VZM0	Pseudomonas_phage	1.8e-55	55.8
WP_012053009.1\|3809022_3809421_-	NinB family protein	A0A059VG13	Pseudomonas_phage	3.8e-62	84.1
WP_041168490.1\|3809417_3809615_-	hypothetical protein	NA	NA	NA	NA
WP_012053010.1\|3809611_3809890_-	hypothetical protein	A0A2H4JG78	uncultured_Caudovirales_phage	1.8e-05	39.8
WP_012053011.1\|3809889_3810285_-	hypothetical protein	NA	NA	NA	NA
WP_012053012.1\|3810284_3811046_-	hypothetical protein	A0A2D1GNB3	Pseudomonas_phage	3.5e-72	64.1
WP_041168615.1\|3811042_3811816_-	hypothetical protein	A0A2D1GNQ6	Pseudomonas_phage	5.1e-26	51.2
WP_012053014.1\|3811815_3812565_-	hypothetical protein	A0A059VF66	Pseudomonas_phage	9.1e-81	67.2
WP_029885826.1\|3812694_3812880_-	hypothetical protein	NA	NA	NA	NA
WP_012053015.1\|3812898_3813090_-	hypothetical protein	B5WZX7	Pseudomonas_phage	5.4e-06	41.0
WP_012053017.1\|3813462_3814305_+	S24 family peptidase	A0A2D1GNH0	Pseudomonas_phage	3.3e-111	68.2
WP_012053018.1\|3814576_3815152_+	SocA family protein	NA	NA	NA	NA
WP_012053019.1\|3815142_3815547_+	hypothetical protein	NA	NA	NA	NA
WP_012053020.1\|3815587_3815914_-	DUF1654 domain-containing protein	A0A2D1GND3	Pseudomonas_phage	1.2e-29	66.7
WP_012053021.1\|3816425_3816614_+	hypothetical protein	A0A2H4JG89	uncultured_Caudovirales_phage	9.7e-24	90.2
WP_012053022.1\|3816610_3816865_+	hypothetical protein	A0A2H4J0S5	uncultured_Caudovirales_phage	1.7e-31	87.3
WP_041168491.1\|3817276_3817519_+	hypothetical protein	NA	NA	NA	NA
WP_012053024.1\|3817515_3817758_+	DUF551 domain-containing protein	NA	NA	NA	NA
WP_012053025.1\|3817778_3818213_+	hypothetical protein	W6MVG2	Pseudomonas_phage	1.1e-51	65.8
WP_012053026.1\|3818234_3818651_+	hypothetical protein	NA	NA	NA	NA
WP_012053027.1\|3818647_3818851_+	hypothetical protein	NA	NA	NA	NA
WP_012053028.1\|3818847_3819069_+	hypothetical protein	A0A2H4J1S2	uncultured_Caudovirales_phage	4.2e-18	63.0
WP_012053029.1\|3819357_3820089_+	hypothetical protein	A0A2H4J2D5	uncultured_Caudovirales_phage	1.2e-125	95.1
WP_012053030.1\|3820085_3820649_+	siphovirus Gp157 family protein	A0A2H4IZG3	uncultured_Caudovirales_phage	6.6e-92	93.0
WP_012053031.1\|3820656_3821169_+	hypothetical protein	A0A2H4J7C8	uncultured_Caudovirales_phage	5.5e-13	36.1
WP_012053032.1\|3821418_3821940_+	hypothetical protein	A0A2H4JAQ1	uncultured_Caudovirales_phage	3.4e-10	57.1
WP_012053033.1\|3821936_3822383_-	hypothetical protein	NA	NA	NA	NA
WP_041168492.1\|3822496_3823042_+	hypothetical protein	J9Q748	Salmonella_phage	2.1e-18	33.9
WP_012053035.1\|3823065_3823287_-	hypothetical protein	NA	NA	NA	NA
WP_012053037.1\|3823761_3824145_+	hypothetical protein	A0A0U4JNY7	Pseudomonas_phage	1.1e-26	46.5
WP_041168493.1\|3824226_3824643_-	hypothetical protein	NA	NA	NA	NA
WP_041168494.1\|3824669_3825056_-	hypothetical protein	NA	NA	NA	NA
WP_012053039.1\|3825133_3825436_-	hypothetical protein	NA	NA	NA	NA
WP_012053040.1\|3825607_3826402_+	hypothetical protein	Q5QF32	Pseudomonas_virus	3.1e-71	54.2
WP_012053041.1\|3826398_3826668_+	hypothetical protein	A0A2H4J399	uncultured_Caudovirales_phage	2.4e-28	73.3
WP_012053042.1\|3826664_3826988_+	hypothetical protein	A0A2H4J0N7	uncultured_Caudovirales_phage	2.7e-50	88.8
WP_012053043.1\|3826984_3827377_+	DUF2591 family protein	NA	NA	NA	NA
WP_012053044.1\|3827373_3827724_+	hypothetical protein	K7RW03	Vibrio_phage	9.3e-28	62.0
WP_012053045.1\|3827955_3828435_+	hypothetical protein	A0A1B0VM52	Pseudomonas_phage	6.7e-37	55.1
WP_012053046.1\|3828539_3828752_+	AlpA family transcriptional regulator	A0A2H4J8C8	uncultured_Caudovirales_phage	6.8e-34	100.0
3836589:3836614	attR	NA	NA	NA	NA

DBSCAN-SWA_7

4592284 : 4666012

Pseudomonas_phage(31.03%)

integrase,protease,capsid,holin,tRNA,head,portal,tail,terminase

attL 4589488:4589530|attR 4670898:4670940

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
4589488:4589530	attL	NA	NA	NA	NA
WP_012053468.1\|4592284_4593109_-\|tRNA	tRNA 2-thiocytidine(32) synthetase TtcA	A0A0U2S5Z2	Escherichia_phage	4.0e-106	72.0
WP_003252385.1\|4593372_4593972_+	YIP1 family protein	NA	NA	NA	NA
WP_003252383.1\|4594103_4594598_+\|protease	SprT family zinc-dependent metalloprotease	NA	NA	NA	NA
WP_003252381.1\|4594784_4595564_-	ferredoxin--NADP reductase	NA	NA	NA	NA
WP_004574844.1\|4595681_4596608_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_010952700.1\|4596604_4596970_-	diacylglycerol kinase	NA	NA	NA	NA
WP_010952699.1\|4597043_4597694_-	response regulator transcription factor	NA	NA	NA	NA
WP_004574842.1\|4597872_4598583_-	DTW domain-containing protein	NA	NA	NA	NA
WP_012053469.1\|4598799_4599219_+	quorum-sensing-regulated virulence factor family protein	NA	NA	NA	NA
WP_012053470.1\|4599233_4599443_-	hypothetical protein	NA	NA	NA	NA
WP_003252368.1\|4599603_4600722_+	LOG family protein	NA	NA	NA	NA
WP_003252366.1\|4600988_4601459_-	recombination regulator RecX	NA	NA	NA	NA
WP_003252365.1\|4601480_4602548_-	recombinase RecA	A0A0S2MVG1	Bacillus_phage	1.4e-111	62.0
WP_012053471.1\|4602651_4603134_-	CinA family protein	B5TK85	Pseudomonas_phage	1.3e-59	78.0
WP_012053472.1\|4603190_4604258_-	hypothetical protein	NA	NA	NA	NA
WP_041168630.1\|4605084_4605915_+	hypothetical protein	NA	NA	NA	NA
WP_012053474.1\|4605951_4606257_-	hypothetical protein	NA	NA	NA	NA
WP_012052974.1\|4606253_4606547_-	hypothetical protein	A0A2H4JER5	uncultured_Caudovirales_phage	1.6e-33	68.0
WP_012053475.1\|4606620_4606845_-	hypothetical protein	A0A2H4JG60	uncultured_Caudovirales_phage	3.5e-28	82.4
WP_012053476.1\|4606858_4607353_-	DUF2514 domain-containing protein	A0A2H4J3Q6	uncultured_Caudovirales_phage	2.5e-39	61.0
WP_012053477.1\|4607349_4607799_-	hypothetical protein	A0A2R3UAM8	Myoviridae_environmental_samples	1.2e-32	54.1
WP_012053478.1\|4607895_4608702_-	hypothetical protein	NA	NA	NA	NA
WP_012053479.1\|4608726_4610664_-	hypothetical protein	A0A2H5BHG7	Acinetobacter_phage	3.4e-18	28.5
WP_012053480.1\|4610707_4611190_-	hypothetical protein	B5WZT5	Pseudomonas_phage	2.7e-25	52.3
WP_012053481.1\|4611201_4614300_-	hypothetical protein	A0A2H4J0V9	uncultured_Caudovirales_phage	9.1e-284	49.1
WP_012053482.1\|4614271_4614691_-	hypothetical protein	A0A0H5AUG1	Pseudomonas_phage	1.8e-41	59.4
WP_042162696.1\|4614769_4615015_+	hypothetical protein	NA	NA	NA	NA
WP_012053483.1\|4615074_4615557_-	DUF1833 family protein	A0A2H4J983	uncultured_Caudovirales_phage	1.8e-45	55.3
WP_012053484.1\|4615553_4617998_-\|tail	tail tape measure protein	A0A2H4PI09	Pseudomonas_phage	1.2e-142	39.7
WP_012053485.1\|4618053_4618404_-	superinfection immunity protein	A0A0S2SY85	Pseudomonas_phage	1.1e-09	57.7
WP_012053486.1\|4618477_4618678_-	hypothetical protein	Q9MCA3	Pseudomonas_phage	5.1e-07	50.8
WP_012053487.1\|4618701_4619172_-\|tail	phage tail assembly protein	K7PJU9	Enterobacteria_phage	6.6e-37	64.7
WP_012053488.1\|4619180_4619915_-\|tail	tail protein	H2BDC0	Pseudomonas_virus	7.9e-53	50.2
WP_012053489.1\|4619980_4620349_-	DUF3168 domain-containing protein	Q9MCA6	Pseudomonas_phage	1.4e-37	62.3
WP_012053490.1\|4620345_4620831_-	HK97 gp10 family phage protein	A0A0U3TGT7	Pseudomonas_phage	4.8e-59	74.5
WP_041168632.1\|4620823_4621162_-\|head	phage head closure protein	A0A1J0GUY4	Halomonas_phage	9.6e-22	52.7
WP_012053492.1\|4621164_4621488_-\|head,tail	phage gp6-like head-tail connector protein	B5WZS4	Pseudomonas_phage	1.4e-17	44.4
WP_012053493.1\|4621484_4622429_-\|portal	phage portal protein	S4TNN1	Salmonella_phage	4.0e-49	61.2
WP_012053494.1\|4622415_4623783_-\|portal	phage portal protein	F8TVA0	EBPR_siphovirus	1.5e-129	58.2
WP_041168633.1\|4623797_4624016_-	hypothetical protein	NA	NA	NA	NA
WP_012053496.1\|4624069_4626019_-\|capsid	phage major capsid protein	S4TNE3	Salmonella_phage	1.6e-169	51.9
WP_012053497.1\|4626075_4627743_-\|terminase	terminase large subunit	Q3HQS7	Burkholderia_phage	3.9e-209	65.2
WP_012053498.1\|4627745_4628243_-\|terminase	terminase	Q3HQS6	Burkholderia_phage	1.4e-29	54.7
WP_012053499.1\|4628388_4628694_-	HNH endonuclease	A0A0R6PHK1	Moraxella_phage	2.1e-23	64.9
WP_041168520.1\|4628693_4628882_-	hypothetical protein	NA	NA	NA	NA
WP_012053501.1\|4628932_4629181_-	hypothetical protein	NA	NA	NA	NA
WP_012053502.1\|4629177_4629459_-\|holin	phage holin family protein	A0A2H4J0H1	uncultured_Caudovirales_phage	6.3e-43	93.5
WP_012053503.1\|4629459_4629834_-	hypothetical protein	A0A2H4J7X6	uncultured_Caudovirales_phage	2.7e-57	87.9
WP_012053504.1\|4629993_4630680_-	hypothetical protein	A0A1B0VMF2	Pseudomonas_phage	6.0e-79	63.6
WP_012053505.1\|4630690_4631008_-	hypothetical protein	A0A2D1GNG3	Pseudomonas_phage	5.6e-32	63.8
WP_012053507.1\|4631168_4632467_-\|integrase	site-specific integrase	A0A2D1GND4	Pseudomonas_phage	2.4e-121	54.1
WP_012053508.1\|4632463_4632892_-	VRR-NUC domain-containing protein	A0A2D1GNH3	Pseudomonas_phage	7.1e-54	79.4
WP_012053509.1\|4632888_4633185_-	DUF1364 domain-containing protein	A0A220NQY2	Salmonella_phage	2.6e-31	69.9
WP_012053510.1\|4633184_4633979_-	ATP-binding protein	A0A2H4J3E5	uncultured_Caudovirales_phage	1.0e-74	54.9
WP_041168634.1\|4633968_4634781_-	replication protein	A0A0S2SYI8	Pseudomonas_phage	9.4e-23	41.0
WP_012053512.1\|4635264_4636086_+	helix-turn-helix domain-containing protein	H2BD63	Pseudomonas_phage	2.8e-51	44.2
WP_012053513.1\|4636131_4636446_-	DUF1654 domain-containing protein	A0A2D1GND3	Pseudomonas_phage	5.6e-24	60.0
WP_012053514.1\|4636852_4637077_+	hypothetical protein	NA	NA	NA	NA
WP_012053515.1\|4637207_4637591_+	helix-turn-helix transcriptional regulator	A0A2H4JA92	uncultured_Caudovirales_phage	1.4e-24	63.0
WP_012053516.1\|4637610_4637949_+	hypothetical protein	NA	NA	NA	NA
WP_012053517.1\|4637945_4638443_+	single-stranded DNA-binding protein	I3PGW4	Xanthomonas_phage	2.4e-45	69.2
WP_041168521.1\|4638700_4638889_+	hypothetical protein	NA	NA	NA	NA
WP_012053519.1\|4638927_4639533_+	hypothetical protein	NA	NA	NA	NA
WP_012053520.1\|4639620_4640400_+	DUF2786 domain-containing protein	A0A2P9JZH4	Alteromonadaceae_phage	3.9e-18	34.6
WP_012053521.1\|4640396_4641272_+	hypothetical protein	A0A2H4J418	uncultured_Caudovirales_phage	2.6e-95	55.5
WP_012053522.1\|4641278_4642220_+	hypothetical protein	A0A2R3UAM3	Myoviridae_environmental_samples	4.4e-16	43.6
WP_012053524.1\|4642418_4643213_+	hypothetical protein	Q5QF32	Pseudomonas_virus	2.8e-72	54.7
WP_012053525.1\|4643209_4643479_+	hypothetical protein	A0A2H4J399	uncultured_Caudovirales_phage	3.8e-29	74.4
WP_012053526.1\|4643475_4643757_+	hypothetical protein	NA	NA	NA	NA
WP_012053527.1\|4643753_4644149_+	DUF2591 domain-containing protein	J7I4M3	Pseudomonas_phage	1.9e-16	37.6
WP_012053528.1\|4644145_4644502_+	hypothetical protein	K7RW03	Vibrio_phage	5.0e-29	65.0
WP_012053529.1\|4644732_4645125_+	hypothetical protein	NA	NA	NA	NA
WP_016712905.1\|4645160_4645355_+	DUF4224 domain-containing protein	A0A2H4JC20	uncultured_Caudovirales_phage	1.7e-18	66.2
WP_012053531.1\|4645367_4646348_+\|integrase	tyrosine-type recombinase/integrase	A0A1B0VP19	Pseudomonas_phage	2.6e-128	69.3
WP_012053532.1\|4646531_4647257_-	zeta toxin family protein	NA	NA	NA	NA
WP_012053533.1\|4647449_4650023_+	DNA mismatch repair protein MutS	A0A1V0SJ67	Klosneuvirus	5.2e-27	23.2
WP_003252355.1\|4650163_4650487_+	ferredoxin family protein	NA	NA	NA	NA
WP_003252351.1\|4651022_4652030_-	RNA polymerase sigma factor RpoS	G8CLC7	Synechococcus_phage	5.0e-34	35.8
WP_004574839.1\|4652138_4652996_-	peptidoglycan DD-metalloendopeptidase family protein	I3PV79	Clostridium_phage	1.9e-13	36.2
WP_012053535.1\|4653233_4653908_-	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	6.8e-43	52.0
WP_003252346.1\|4653907_4654657_-	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	9.8e-67	52.2
WP_003252344.1\|4654644_4655703_-\|tRNA	tRNA pseudouridine(13) synthase TruD	NA	NA	NA	NA
WP_003252342.1\|4655699_4656173_-	2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase	NA	NA	NA	NA
WP_003252340.1\|4656285_4657140_-	S-formylglutathione hydrolase	NA	NA	NA	NA
WP_003252338.1\|4657148_4658261_-	S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase	E3SJ82	Synechococcus_phage	6.2e-33	28.8
WP_012053536.1\|4658368_4659265_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_003252335.1\|4659388_4660096_-	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	NA	NA	NA	NA
WP_004576849.1\|4660092_4660374_-	cell division protein FtsB	NA	NA	NA	NA
WP_003252333.1\|4660539_4661829_-	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	1.9e-139	59.6
WP_010952685.1\|4661983_4662829_-	3-deoxy-8-phosphooctulonate synthase	E3T537	Cafeteria_roenbergensis_virus	1.1e-50	42.0
WP_003252329.1\|4662832_4664461_-	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	4.0e-158	53.3
WP_012053537.1\|4664728_4666012_-\|tRNA	tRNA lysidine(34) synthetase TilS	NA	NA	NA	NA
4670898:4670940	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_009512

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection