CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NC_009516	Psychrobacter sp. PRwf-1 plasmid pRWF101, complete sequence	0 crisprs	NA	0	0
NC_009524	Psychrobacter sp. PRwf-1, complete sequence	1 crisprs	cas14j,DEDDh,cas3,csa3,WYL,c2c9_V-U4	2	8
NC_009517	Psychrobacter sp. PRwf-1 plasmid pRWF102, complete sequence	0 crisprs	NA	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_009524_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_009524_1

831244-831511

Orphan

Consensus_repeat	Method
TTTCTAAGTCACCTATGCGGTGATGAAG	CRISPRCasFinder
TTTCTAAGTCACCTATGCGGTGATGAAG	CRT
TTTCTAAGTCACCTATGCGGTGATGAAG	PILER-CR

4 spacers

The CRISPR arrays of NC_009524_1

>merge|NC_009524|1|831244-831511|CRISPRCasFinder,CRT,PILER-CR
CTTCTAAGTCACCTATGCGGTGATGAAGTGGGAATGTCTGTTACTGGCGGCGAGGACAAATTTCTAAGTCACCTATGCGGTGATGAAGTATTAGTAAGTGACTTAACTATATCAATACAATTTCTAAGTCACCTATGCGGTGATGAAGCTGTTTGCATAGCTCGCTTTCTTGTTCAGCATTTTCTAAGTCACCTATGCGGTGATGAAGTATCATTAGCATAGGGTTGTAAGTCTGCTAATTTTCTAAGTCACCTATGCGTTATATCTA

>NC_009524|1|1|831244-831511|CRISPRCasFinder
CTTCTAAGTCACCTATGCGGTGATGAAG	TGGGAATGTCTGTTACTGGCGGCGAGGACAAA
TTTCTAAGTCACCTATGCGGTGATGAAG	TATTAGTAAGTGACTTAACTATATCAATACAA
TTTCTAAGTCACCTATGCGGTGATGAAG	CTGTTTGCATAGCTCGCTTTCTTGTTCAGCAT
TTTCTAAGTCACCTATGCGGTGATGAAG	TATCATTAGCATAGGGTTGTAAGTCTGCTAAT
TTTCTAAGTCACCTATGCGTTATATCTA

>NC_009524|1|1|831244-831511|CRT
CTTCTAAGTCACCTATGCGGTGATGAAG	TGGGAATGTCTGTTACTGGCGGCGAGGACAAA
TTTCTAAGTCACCTATGCGGTGATGAAG	TATTAGTAAGTGACTTAACTATATCAATACAA
TTTCTAAGTCACCTATGCGGTGATGAAG	CTGTTTGCATAGCTCGCTTTCTTGTTCAGCAT
TTTCTAAGTCACCTATGCGGTGATGAAG	TATCATTAGCATAGGGTTGTAAGTCTGCTAAT
TTTCTAAGTCACCTATGCGTTATATCTA

>NC_009524|1|1|831245-831451|PILER-CR
TTCTAAGTCACCTATGCGGTGATGAAGT	GGGAATGTCTGTTACTGGCGGCGAGGACAAAT
TTCTAAGTCACCTATGCGGTGATGAAGT	ATTAGTAAGTGACTTAACTATATCAATACAAT
TTCTAAGTCACCTATGCGGTGATGAAGC	TGTTTGCATAGCTCGCTTTCTTGTTCAGCATT
TTCTAAGTCACCTATGCGGTGATGAAG

Protein	Signature genes	Signature genes Name	Protein_function
NC_009524.1\|WP_011959966.1\|830510_830801_+\|hypothetical-protein	unknown	unknown	unknown
NC_009524.1\|WP_011959968.1\|831814_832081_+\|Serine-protease-inhibitor-like-protein	unknown	unknown	gnl\|CDD\|381043
NC_009524.1\|WP_011959957.1\|822506_823154_+\|glutathione-S-transferase	unknown	unknown	gnl\|CDD\|198305
NC_009524.1\|WP_011959976.1\|839075_839759_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226582
NC_009524.1\|WP_041773283.1\|829317_830508_+\|site-specific-integrase	unknown	unknown	gnl\|CDD\|271189
NC_009524.1\|WP_041773282.1\|828716_828941_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|379188
NC_009524.1\|WP_011959977.1\|839840_840542_+\|VIT-family-protein	unknown	unknown	gnl\|CDD\|153123
NC_009524.1\|WP_011959972.1\|835413_836877_+\|histidine-kinase	unknown	unknown	gnl\|CDD\|182388
NC_009524.1\|WP_011959964.1\|829090_829306_+\|hypothetical-protein	unknown	unknown	unknown
NC_009524.1\|WP_020444569.1\|837559_837874_+\|hypothetical-protein	unknown	unknown	unknown
NC_009524.1\|WP_041773523.1\|823211_823943_-\|amino-acid-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224051
NC_009524.1\|WP_011959973.1\|836976_837567_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377032
NC_009524.1\|WP_011959961.1\|825682_826687_-\|glutamate/aspartate-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|236763
NC_009524.1\|WP_011959959.1\|824128_824803_-\|ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|185062
NC_009524.1\|WP_011959975.1\|837929_839012_+\|FAD:protein-FMN-transferase	unknown	unknown	gnl\|CDD\|224394
NC_009524.1\|WP_011959962.1\|827079_828078_-\|diaminopimelate-dehydrogenase	unknown	unknown	gnl\|CDD\|273877
NC_009524.1\|WP_011959971.1\|834674_835349_+\|response-regulator	unknown	unknown	gnl\|CDD\|182387
NC_009524.1\|WP_011959970.1\|834046_834655_+\|cytochrome-b/b6-domain-containing-protein	unknown	unknown	gnl\|CDD\|226184
NC_009524.1\|WP_011959969.1\|832464_833724_-\|ferredoxin-reductase-family-protein	unknown	unknown	gnl\|CDD\|99795
NC_009524.1\|WP_011959960.1\|824799_825546_-\|amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223836

Protein	Function_ID	Function_description	E-value
NC_009524.1\|WP_011959976.1\|839075_839759_+\|hypothetical-protein	gnl\|CDD\|226582	COG4097, COG4097, Predicted ferric reductase [Inorganic ion transport and metabolism].	1.67971e-11
NC_009524.1\|WP_011959968.1\|831814_832081_+\|Serine-protease-inhibitor-like-protein	gnl\|CDD\|381043	cd19577, serpinJ_IRS-2-like, serpin family J, Ixodes ricinus serpin-2 (IRS-2). The serpin family J clade contains serpins from the Chelicerates. This model includes serpins from the Japanese horseshoe crab, mites, ticks, and spiders. The Limulus intracellular coagulation inhibitor, designated LICI, was isolated from hemocytes of the Japanese horseshoe crab. It blocks the amidolytic activities of Limulus lipopolysaccharide-sensitive serine protease, factor C and also inhibits human alpha-thrombin, rat salivary kallikrein, bovine plasmin, and trypsin but not Limulus clotting enzyme, Limulus factor B, bovine factor Xa, human factor XIa, human tissue plasminogen activator, human urokinase, chymotrypsin, elastase, and papain. Glycosaminoglycans such as heparin and heparan sulfate had no effect on the inhibitory activity. The castor bean tick, Ixodes ricinus serpin-2 (IRS-2) whose structure has been solved, unlike that of the LICI, is found in the saliva of the tick and primarily targets 2 proinflammatory serine proteases: cathepsin G and mast cell chymase, and in higher molar excess, thrombin. It also blocks cathepsin G- and thrombin-induced platelet aggregation. Thus it has a dual role and can interfere with both inflammation and wound healing during tick feeding. In general, SERine Proteinase INhibitors (serpins) exhibit conformational polymorphism shifting from native to cleaved, latent, delta, or polymorphic forms. Many serpins, such as antitrypsin and antichymotrypsin, function as serine protease inhibitors which regulate blood coagulation cascades. Non-inhibitory serpins perform many diverse functions such as chaperoning proteins or transporting hormones. Serpins are of medical interest because mutants have been associated with blood clotting disorders, emphysema, cirrhosis, and dementia. A classification based on evolutionary relatedness has resulted in the assignment of serpins to 16 clades designated A-P along with some orphans.	6.65815e-36
NC_009524.1\|WP_011959957.1\|822506_823154_+\|glutathione-S-transferase	gnl\|CDD\|198305	cd03196, GST_C_5, C-terminal, alpha helical domain of an unknown subfamily 5 of Glutathione S-transferases. Glutathione S-transferase (GST) C-terminal domain family, unknown subfamily 5; composed of uncharacterized bacterial proteins with similarity to GSTs. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain.	2.12438e-60
NC_009524.1\|WP_041773283.1\|829317_830508_+\|site-specific-integrase	gnl\|CDD\|271189	cd01189, INT_ICEBs1_C_like, C-terminal catalytic domain of integrases from bacterial phages and conjugate transposons. This family of tyrosine based site-specific integrases is has origins in bacterial phages and conjugate transposons. One member is the integrase from Bacillus subtilis conjugative transposon ICEBs1. ICEBs1 can be excised and transfered to various recipients in response to DNA damage or high concentrations of potential mating partners. The family belongs to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	1.20276e-34
NC_009524.1\|WP_041773282.1\|828716_828941_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|379188	pfam13443, HTH_26, Cro/C1-type HTH DNA-binding domain. This is a helix-turn-helix domain that probably binds to DNA.	2.26057e-20
NC_009524.1\|WP_011959977.1\|839840_840542_+\|VIT-family-protein	gnl\|CDD\|153123	cd02432, Nodulin-21_like_1, Nodulin-21 and CCC1-related protein family. Nodulin-21_like_1: This is a family of proteins closely related to nodulin-21, a plant nodule-specific protein that may be involved in symbiotic nitrogen fixation. This family is also related to CCC1, a yeast vacuole transmembrane protein that functions as an iron and manganese transporter. .	6.66566e-98
NC_009524.1\|WP_011959972.1\|835413_836877_+\|histidine-kinase	gnl\|CDD\|182388	PRK10337, PRK10337, sensor protein QseC; Provisional.	5.96523e-111
NC_009524.1\|WP_011959969.1\|832464_833724_-\|ferredoxin-reductase-family-protein	gnl\|CDD\|99795	cd06198, FNR_like_3, NAD(P) binding domain of ferredoxin reductase-like proteins catalyze electron transfer between an NAD(P)-binding sub-domain of the alpha/beta class and a discrete (usually N-terminal) domain, which varies in orientation with respect to the NAD(P) binding domain. The N-terminal domain may contain a flavin prosthetic group (as in flavoenzymes) or use flavin as a substrate. Ferredoxin is reduced in the final stage of photosystem I. The flavoprotein Ferredoxin-NADP+ reductase transfers electrons from reduced ferredoxin to FAD (forming FADH2 via a semiquinone intermediate) which then transfers a hydride ion to convert NADP+ to NADPH.	4.35001e-64
NC_009524.1\|WP_041773523.1\|823211_823943_-\|amino-acid-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224051	COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism].	2.43786e-146
NC_009524.1\|WP_011959973.1\|836976_837567_+\|hypothetical-protein	gnl\|CDD\|377032	pfam03413, PepSY, Peptidase propeptide and YPEB domain. This region is likely to have an protease inhibitory function (personal obs:C Yeats). This model is likely to miss some members of this family as the separation from signal to noise is not clear. The name is derived from Peptidase & Bacillus subtilis YPEB.	0.00235304
NC_009524.1\|WP_011959961.1\|825682_826687_-\|glutamate/aspartate-ABC-transporter-substrate-binding-protein	gnl\|CDD\|236763	PRK10797, PRK10797, glutamate and aspartate transporter subunit; Provisional.	7.88336e-135
NC_009524.1\|WP_011959959.1\|824128_824803_-\|ABC-transporter-permease-subunit	gnl\|CDD\|185062	PRK15107, PRK15107, glutamate/aspartate ABC transporter permease GltK.	1.46409e-68
NC_009524.1\|WP_011959975.1\|837929_839012_+\|FAD:protein-FMN-transferase	gnl\|CDD\|224394	COG1477, ApbE, Membrane-associated lipoprotein involved in thiamine biosynthesis [Coenzyme metabolism].	1.7678e-48
NC_009524.1\|WP_011959962.1\|827079_828078_-\|diaminopimelate-dehydrogenase	gnl\|CDD\|273877	TIGR01921, Meso-diaminopimelate_D-dehydrogenase, diaminopimelate dehydrogenase. This model represents the diaminopimelate dehydrogenase enzyme which provides an alternate (shortcut) route of lysine buiosynthesis in Corynebacterium, Bacterioides, Porphyromonas and scattered other species. The enzyme from Corynebacterium glutamicum has been crystallized and characterized.	6.04888e-153
NC_009524.1\|WP_011959971.1\|834674_835349_+\|response-regulator	gnl\|CDD\|182387	PRK10336, PRK10336, two-component system response regulator QseB.	3.57921e-81
NC_009524.1\|WP_011959970.1\|834046_834655_+\|cytochrome-b/b6-domain-containing-protein	gnl\|CDD\|226184	COG3658, COG3658, Cytochrome b [Energy production and conversion].	3.81975e-51
NC_009524.1\|WP_011959960.1\|824799_825546_-\|amino-acid-ABC-transporter-permease	gnl\|CDD\|223836	COG0765, HisM, ABC-type amino acid transport system, permease component [Amino acid transport and metabolism].	6.19062e-63

>NC_009524.1|WP_011959966.1|830510_830801_+|hypothetical-protein
MKIIDYDKLFAEFKPNGYVSEDAHTIANMLIYDLCIQPGYNLARFLEIKPCFDNHMAIRIWVQKRLDASLGYLVDDMYVQLQSEIYELLPPSGYGY
>NC_009524.1|WP_041773283.1|829317_830508_+|site-specific-integrase
MASIRSRNKRLIVDFYYMGKRCRETTNLIDTPANRKKLESIILNMEAEIRLGIFNYAKYFPKSDKAAEMVALNDRKECINTNVPSFKQFATLWFSEKEIEWRDTYKRKIQEIIDMYLLPEFGTKPIHLIKKTDVLAFRSSLGKVTYGKANKHLSAARINSIMVPLGMILKEAAKRYKFDNPYYDIKALKQPKTDIQPLTLEEVWTFINGVREDYRHYYLVRFFTGMRTSEIDGLTWDNVDFNRREIVIKQALVKGKIVPPKTQESYRAIQMSPWVYDALKEQKEISYRRSDYVFCSHTGEPLDYNNVNKRIWHPTLKVLRLKKRNAYQTRHTAATLWLAAGESPEWIASQMGHSTTKMLFNTYSRYVPNMTRQDGSAFEALVNRSQMAQLSTDKET
>NC_009524.1|WP_011959964.1|829090_829306_+|hypothetical-protein
MSHTYLTTQELSERIKYNPRTIRNELKDSVLIEGIHYIRPFGGRKILYVWEEIEKDMRTGITGSINAMALQ
>NC_009524.1|WP_041773282.1|828716_828941_-|helix-turn-helix-transcriptional-regulator
MIVSNLPVLLAERRMKVADLIRMTGISKSTMHKIYNEQTSRIDFETMDKICEALDVGVGELFTYIPNKASEEVK
>NC_009524.1|WP_011959962.1|827079_828078_-|diaminopimelate-dehydrogenase
MTQPIIRVAIAGYGNLGSGAQAAINQNPDMTLMGIFSRRDPASVTLIDNSVPVYAMDDIAQYKDEIDVLILCGGSKSDLPEQGPKLAALFNIVDSFDTHAKIPEYFESLDAPAKQAGKIALLSVGWDPGLFSINRLYGEAILPVGETYTFWGKGLSQGHSDAVRRVAGVKSGVQYTLPSESAMAKVRSGEQPILSTREKHTRECYVVLEAGADEDTVRTAIVNMPDYFADYDTTVHFIDQHTFEREHGKMPHGGFVMRSGSSGTQTDTNHQALEFSLKLESNPQFTASVLVAYARAAYKMNKAGETGAKTVFDVAPGLLSPKTPAQLRKELL
>NC_009524.1|WP_011959961.1|825682_826687_-|glutamate/aspartate-ABC-transporter-substrate-binding-protein
MHYKVKTLTLATLLAFGLTGCNNNQSANTDAPATAEGTSTTEATPSTDAANADASATLNKIKDSGTIVVGFRDSSIPFSYIADDPNQPLGYAHDLEMKVVDAVKDKLNMPDLKIRYNLITSQTRIPLVQNGTIDFECGSTTNNEERQKQVAFSNGFFEIGTRLLTKKDSGINDFEDLKGRTLVTTAGTTSERYIRQYNDEKKLGAKIISAKDHGEAFLMLEKGRADAFMMDDVLLAGEKAKSAHPEEWQIVGTPQSFEIYGCMMRKDDPQFKAIVDEALKNVYASGEINDIYNKWFMNPIPPKNVNMNFEMSDNLKALIANPHDGAQPMAAPAQ
>NC_009524.1|WP_011959960.1|824799_825546_-|amino-acid-ABC-transporter-permease
MNYSWNWGVLFESTGIGDGIYLYWILSGLGWLLLIGTIAWILALGIGTVLGIMRTLPSKTARTIGTMYVTFFRNIPLLVQLFFWFYVAPGWLTPVLQEWWYKGLSPNMSAMISASIGLGLFTAARITEQVRTGIQSLPEGQHNAAYALGFSTAQAYRQVLLPQAFRVILPPLSSELTNCYKNASIASLVGVMELISQTKTISEYTQNNIEIYTYATIIYLLFNLSLIGIMGLIEQKLRIPGLIAGGKK
>NC_009524.1|WP_011959959.1|824128_824803_-|ABC-transporter-permease-subunit
MSAFVTELTTAYPSLISGMIVTLKVLLLAIVGGMALGTVLAMMRLSGIKALELPAKLYVNFFRSVPLLLILLWFYFAVPMIYNGLTGSYITFDTAFTSCVVAFMVFEAAYFSEVVRAGIQSIGSAQVNAAKALGMTYAQTMRLIILPQAFRKMTPLILQQCIILFQDTTLVFAIGLSDFFRSAYVRGELMGYLTPYILGAGAVYFIISLIASIGVQRLQKSMRF
>NC_009524.1|WP_041773523.1|823211_823943_-|amino-acid-ABC-transporter-ATP-binding-protein
MVIEMSNVSKWYGDFQVLTDCTAHVHRGDVVVVCGPSGSGKSTLIKTVNALEPFQKGKIFVNGIAVGDSKTDLPKLRSRVGMVFQHFELFPHLSIIDNLTVAQIKVLGRSDSVAQQKAMAYLDRVGLSAQAKKYPAELSGGQQQRVAIARALAMDPVCMLFDEPTSALDPEMIQEVLDVMVELAKEGMTMMCVTHEMGFASQVANRIIFMDEGHIVENCSKDEFFEGARSDRAQLFLSKILGH
>NC_009524.1|WP_011959957.1|822506_823154_+|glutathione-S-transferase
MNNKLGVLYSFRRCPYAMRARLGLLFAGVSVDLREVVLKNKPPQMLAISPKGTVPVLQLADGTVIEESRDIMLWALNQNDPQCLLDNTVGAQAKALIDQNDTEFKYWLDRYKYADRYPDMSQEAYRQKGEQFLRTLEALLTQHPYLFGERIGVADIAIMPFVRQFAHVDRALFYRLPYVHVQRWLRHWLEHPLFLQAMTKYTPWSEGDDVVVFGS
>NC_009524.1|WP_011959968.1|831814_832081_+|Serine-protease-inhibitor-like-protein
MGMPIAFDSRANYSLFNDKLPLKVDSVIHKAVVEVDEKGTVAAAATGIGVQLVMATHKAEITADHPFMFMIKDNKTDAILFLGQVNKL
>NC_009524.1|WP_011959969.1|832464_833724_-|ferredoxin-reductase-family-protein
MAVKSWQVISSIVLITSITVLMQIPSETWITSATVSLIMGASALACMASSCILASRWHGVERIFGGLDRVYEAHKWIAIWALVFAVYHFLFKAKLDSWELAPILELSKYWTRMVRQLSLVALGLIILLALNRKIPYGNWRWLHKFSGPLFLIVILHWLSFESPITLTSPAGIWLALLCSVGVIAALYKMVFYPFIAKAGEYKLVAISHGKAAVHLEFEPVDKRFPFKAGQFAFISLKEAGLREPHPFTIANAPSDNGRIHFVIRALGDYTKKLNEQAKVGMLADIYAPHGNFKRISNAEREIWIGAGVGISPFISWQEDKTIGHFERATLIYCFDPARVFPSVERMQEMTEQSGVDFVANPSGSNAMAETIRQVASEVNPKQIQISFCGPKGLLGKVQELMKENGIPAKNIHYEFFDFR
>NC_009524.1|WP_011959970.1|834046_834655_+|cytochrome-b/b6-domain-containing-protein
MSQKDTMNWDDDSSAPLSNTPKARQVKVWDILVRVTHWTVAAGIIANLFFTEDGGEWHEYVGYTVLGLVVIRLLWGLVGTRYARFTSFFPTPTRIKHHVSDLSVRRVDEQHLGHNPLAALMMLSLWAVIIGLGLTGYLMESGLFGDKEVLEEIHELLANSLYLLVPLHIIAAIAMSYWQRQNLIKSMITGKKTVTDKPTTMK
>NC_009524.1|WP_011959971.1|834674_835349_+|response-regulator
MARILLIEDDSTIADGIVLGLKSHGMMVDWFSDAKQGEIALQDGMFDAVLLDLTLPKGDGMTVLKNWRAKHIDTPVLIITARDAIANRVAGLNAGADDYLVKPFALDEVVARLQALMRRSQGRCQPEVRYGEVAYQPQNQQVSYQGKMVELTIKEVAILEQMLTHPKQIHSRASLEDKLYGWQQDIESNAIEVHIHHLRKKLGNDFILTKRGIGYYLNPVHNHH
>NC_009524.1|WP_011959972.1|835413_836877_+|histidine-kinase
MKSIQQRLLTSLLIGLPLLWVLTSSFIAWKLWHEINEMNDTQITQVARYLIGVAPKEEDDKDHHRQRDDNKKHTPKIYALKSKQLSGDLGEAEDDYMGFAIWDKKGRLLMADENGQSFAFLPDQHGFLEEHDSAYQRLNPFSKRWRLFYVHDDHDYEGRVIAVGQNLKSRREMITDAMSVQVLPMLIGLFAFMGLVVWLIRRGFMPLTQISSALEQRQPQDDSPITADVPKEIQPLVSALNVLFVKVADTLAREQRFTADASHELRSPLAALKLQADLLQQQILQLSGVEDDNQLFYHAQNISNGIERATHLVDQLLILAKIEPQQQLPPEQLESPDWLMLTDIVLSDVNRLAREKHMQLKRTVNCDNPADILPILINPILFKLLIRNLLDNAIRYCPEGALIELQLDTNAIRVVDNGSGVEPEQLTRLSERFYRPAGQSQLGSGLGLSIANRIAELHGLTLEFANRSQPETGFIVTIRHKKAISSI
>NC_009524.1|WP_011959973.1|836976_837567_+|hypothetical-protein
MSLPLLKPLLLTVGATSLVFFGGVIALSVQSPSADDALSAANAMSQNTDITSISSDLSSFKAVANPLTQSPFANPSPLAALTATQATALAQQDAPNSVLQASPELVNYNGTVAYEVLLDSGATYIDASVGTVLNPVATNDYRAERFDDDDYEDKHHDDDKRKEDKHRKAHDKKYYKENDRLIAMSYQQHDEEEYDD
>NC_009524.1|WP_020444569.1|837559_837874_+|hypothetical-protein
MTNTKSHSTPAVKKTAKKADPFAALKSSIMMVSIAGTMAGWLVLLNQEQKTAPVSTAIISTAVAESDERAVTPTPIADINQLRQVNAVAPVEVIRVVARTRSSQ
>NC_009524.1|WP_011959975.1|837929_839012_+|FAD:protein-FMN-transferase
MHTNMSNQTTPQLATIKLFAMGCHIQISLNTTRLSAQPSQMRIDQQVAFLTNDIQQRLADWEHIFSRFDDSSELMRLNNRGDQWSEVSSELFEVLQRAIHFVSKTQGLVTPTLLHPLWDAGYKHSFETLPKMSVPSLPVTSVSTPTNVQDTTSANHANQQIEGIQLRQLADRQHQVYLPAGMALDLNGYVKGWCAMQLAENISRVHDWHIPCLVDMGGDIAIGVPKNPTDKPVSWGVAVAKPYFANSEHVHNDEDVAILKLSSGAVATSGQDYRRWLHDGRWQHHLIHPHDLRPVTSDVLTATVLAKDAMTAEVYAKYCVLLGVKAAVAWLNKHHIAALLIDRDNKVMVTSAMRPNLLAS
>NC_009524.1|WP_011959976.1|839075_839759_+|hypothetical-protein
MHTDHPTSSHTASNTNVLTQALWVGLTLSIAIGVGGYASLTWGETVSQLLTSTDKHFWYLSRASGVIAYTLFWLAVIFGLLLSTRLGKRFNAARVFVLHQYLSLIAVGFAAFHAGILLADNFLNLNLWQVLMPFGFQTERVGVALGQLGFWFLFICAFSFYIKQYIGQSAWRWLHFLTFMAYMFISIHVFMVGSDSRALPLLLFYAGSQTIVFLLITYRIIALKQAR
>NC_009524.1|WP_011959977.1|839840_840542_+|VIT-family-protein
MHHSIHDEAHLSNRNHWLRAAVLGANDGLISTASLLVGVAAASANSQTLLLTGMAALTAGALSMAAGEYISVSSQADTEKADLDKELHELTHNAERELFELTKIYEKRGLDHVLAHQVAIALTEHDALEAHARDEIGLTDLSQAKPIHASVASGLSFIAGAILPIIGILLLPAQTLVWSLATLTIVGLALLGIISARLGGAPVIPATSRVVIWGVLAMVATSLIGRLFGVAAL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_009524_1	1.2\|831332\|32\|NC_009524\|CRISPRCasFinder,CRT	831332-831363	32	NC_014172	Bacillus thuringiensis BMB171 plasmid pBMB171, complete sequence	301804-301835	6	0.812
NC_009524_1	1.2\|831332\|32\|NC_009524\|CRISPRCasFinder,CRT	831332-831363	32	NZ_CP012100	Bacillus thuringiensis strain HS18-1 plasmid pHS18-1, complete sequence	233556-233587	6	0.812
NC_009524_1	1.2\|831332\|32\|NC_009524\|CRISPRCasFinder,CRT	831332-831363	32	NZ_CP029455	Bacillus cereus strain FORC087 plasmid pFORC087.1, complete sequence	415256-415287	6	0.812
NC_009524_1	1.6\|831333\|32\|NC_009524\|PILER-CR	831333-831364	32	NC_014172	Bacillus thuringiensis BMB171 plasmid pBMB171, complete sequence	301804-301835	6	0.812
NC_009524_1	1.6\|831333\|32\|NC_009524\|PILER-CR	831333-831364	32	NZ_CP012100	Bacillus thuringiensis strain HS18-1 plasmid pHS18-1, complete sequence	233556-233587	6	0.812
NC_009524_1	1.6\|831333\|32\|NC_009524\|PILER-CR	831333-831364	32	NZ_CP029455	Bacillus cereus strain FORC087 plasmid pFORC087.1, complete sequence	415256-415287	6	0.812
NC_009524_1	1.2\|831332\|32\|NC_009524\|CRISPRCasFinder,CRT	831332-831363	32	NZ_CP023312	Vibrio anguillarum strain VIB12 isolate Sea bass plasmid p292, complete sequence	219535-219566	7	0.781
NC_009524_1	1.6\|831333\|32\|NC_009524\|PILER-CR	831333-831364	32	NZ_CP023312	Vibrio anguillarum strain VIB12 isolate Sea bass plasmid p292, complete sequence	219535-219566	7	0.781

1. spacer 1.2|831332|32|NC_009524|CRISPRCasFinder,CRT matches to NC_014172 (Bacillus thuringiensis BMB171 plasmid pBMB171, complete sequence) position: , mismatch: 6, identity: 0.812

tattagtaagtgacttaactatatcaatacaa	CRISPR spacer
ttttatcgagtgatttagctatatcaatacaa	Protospacer
* *** ..*****.***.**************

2. spacer 1.2|831332|32|NC_009524|CRISPRCasFinder,CRT matches to NZ_CP012100 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-1, complete sequence) position: , mismatch: 6, identity: 0.812

tattagtaagtgacttaactatatcaatacaa	CRISPR spacer
ttttatcgagtgatttaactatatcaatgcaa	Protospacer
* *** ..*****.**************.***

3. spacer 1.2|831332|32|NC_009524|CRISPRCasFinder,CRT matches to NZ_CP029455 (Bacillus cereus strain FORC087 plasmid pFORC087.1, complete sequence) position: , mismatch: 6, identity: 0.812

tattagtaagtgacttaactatatcaatacaa	CRISPR spacer
ttttatcgagtgatttagctatatcaatacaa	Protospacer
* *** ..*****.***.**************

4. spacer 1.6|831333|32|NC_009524|PILER-CR matches to NC_014172 (Bacillus thuringiensis BMB171 plasmid pBMB171, complete sequence) position: , mismatch: 6, identity: 0.812

tattagtaagtgacttaactatatcaatacaa	CRISPR spacer
ttttatcgagtgatttagctatatcaatacaa	Protospacer
* *** ..*****.***.**************

5. spacer 1.6|831333|32|NC_009524|PILER-CR matches to NZ_CP012100 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-1, complete sequence) position: , mismatch: 6, identity: 0.812

tattagtaagtgacttaactatatcaatacaa	CRISPR spacer
ttttatcgagtgatttaactatatcaatgcaa	Protospacer
* *** ..*****.**************.***

6. spacer 1.6|831333|32|NC_009524|PILER-CR matches to NZ_CP029455 (Bacillus cereus strain FORC087 plasmid pFORC087.1, complete sequence) position: , mismatch: 6, identity: 0.812

tattagtaagtgacttaactatatcaatacaa	CRISPR spacer
ttttatcgagtgatttagctatatcaatacaa	Protospacer
* *** ..*****.***.**************

7. spacer 1.2|831332|32|NC_009524|CRISPRCasFinder,CRT matches to NZ_CP023312 (Vibrio anguillarum strain VIB12 isolate Sea bass plasmid p292, complete sequence) position: , mismatch: 7, identity: 0.781

tattagtaagtgacttaactatatcaatacaa	CRISPR spacer
tcaaagtaagcgacttaacgatatcaatttaa	Protospacer
*   ******.******** ******** .**

8. spacer 1.6|831333|32|NC_009524|PILER-CR matches to NZ_CP023312 (Vibrio anguillarum strain VIB12 isolate Sea bass plasmid p292, complete sequence) position: , mismatch: 7, identity: 0.781

tattagtaagtgacttaactatatcaatacaa	CRISPR spacer
tcaaagtaagcgacttaacgatatcaatttaa	Protospacer
*   ******.******** ******** .**

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

214402 : 275700

Phage_Gifsy-1(28.57%)

tRNA,transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011959472.1\|214402_215509_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	Q9G0F2	Phage_Gifsy-1	1.0e-27	38.2
WP_011959473.1\|215788_216727_-\|tRNA	tRNA glutamyl-Q(34) synthetase GluQRS	NA	NA	NA	NA
WP_011959474.1\|216758_217193_-	RNA polymerase-binding protein DksA	NA	NA	NA	NA
WP_011959475.1\|217356_218379_-	metallophosphoesterase	NA	NA	NA	NA
WP_011959476.1\|218418_219213_-	metal ABC transporter permease	NA	NA	NA	NA
WP_041773415.1\|219326_220160_-	metal ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.7e-11	32.7
WP_011959478.1\|220277_220856_-	transcriptional repressor	NA	NA	NA	NA
WP_011959479.1\|221383_222361_+	zinc ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_011959480.1\|222497_222965_+	ATP synthase subunit I	NA	NA	NA	NA
WP_011959481.1\|223320_224187_+	F0F1 ATP synthase subunit A	NA	NA	NA	NA
WP_007394515.1\|224221_224467_+	F0F1 ATP synthase subunit C	NA	NA	NA	NA
WP_011959482.1\|224571_225042_+	F0F1 ATP synthase subunit B	NA	NA	NA	NA
WP_011959483.1\|225256_225886_+	F0F1 ATP synthase subunit delta	NA	NA	NA	NA
WP_011959484.1\|226050_227595_+	F0F1 ATP synthase subunit alpha	NA	NA	NA	NA
WP_011959485.1\|227690_228572_+	F0F1 ATP synthase subunit gamma	NA	NA	NA	NA
WP_011959486.1\|228610_230038_+	F0F1 ATP synthase subunit beta	NA	NA	NA	NA
WP_011959487.1\|230168_230585_+	F0F1 ATP synthase subunit epsilon	NA	NA	NA	NA
WP_011959488.1\|230777_231884_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	Q9G0F2	Phage_Gifsy-1	7.0e-29	37.7
WP_011959489.1\|232012_232729_+	response regulator	W8CYM9	Bacillus_phage	4.5e-37	36.0
WP_011959490.1\|232942_234049_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	Q5ULQ4	Lactobacillus_virus	1.1e-26	29.9
WP_011959491.1\|234456_236148_+	HAMP domain-containing protein	NA	NA	NA	NA
WP_011959492.1\|236204_237665_-	HAMP domain-containing protein	NA	NA	NA	NA
WP_011959493.1\|237786_238050_+	30S ribosomal protein S16	NA	NA	NA	NA
WP_011959494.1\|238139_238670_+	ribosome maturation factor RimM	NA	NA	NA	NA
WP_011959495.1\|238760_239522_+\|tRNA	tRNA (guanosine(37)-N1)-methyltransferase TrmD	NA	NA	NA	NA
WP_011959496.1\|239795_240212_+	50S ribosomal protein L19	NA	NA	NA	NA
WP_011959497.1\|240498_242013_+	DUF3360 family protein	NA	NA	NA	NA
WP_011959498.1\|242156_244001_+	excinuclease ABC subunit UvrC	NA	NA	NA	NA
WP_011959499.1\|244033_245140_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	Q5ULQ4	Lactobacillus_virus	1.3e-27	30.3
WP_011959500.1\|245310_246102_-	hypothetical protein	NA	NA	NA	NA
WP_011959501.1\|246170_247502_-	beta-ketoacyl-ACP synthase II	NA	NA	NA	NA
WP_011959502.1\|247574_247985_-	hypothetical protein	NA	NA	NA	NA
WP_011959503.1\|248055_248415_-	SirB2 family protein	NA	NA	NA	NA
WP_011959504.1\|248479_248812_-	BolA family transcriptional regulator	NA	NA	NA	NA
WP_011959505.1\|249033_249837_-	M48 family metallopeptidase	NA	NA	NA	NA
WP_083757354.1\|251348_251501_+	hypothetical protein	NA	NA	NA	NA
WP_011959506.1\|251655_252891_+	pentaheme c-type cytochrome TorC	NA	NA	NA	NA
WP_011959507.1\|252947_255470_+	trimethylamine-N-oxide reductase TorA	NA	NA	NA	NA
WP_011959508.1\|255590_256256_+	molecular chaperone TorD	NA	NA	NA	NA
WP_011959509.1\|256322_257633_+	molybdopterin molybdotransferase MoeA	NA	NA	NA	NA
WP_011959510.1\|257965_259279_+	GTP 3',8-cyclase MoaA	NA	NA	NA	NA
WP_011959511.1\|259364_259892_+	molybdenum cofactor biosynthesis protein B	NA	NA	NA	NA
WP_011959512.1\|259896_260715_+	NTP transferase domain-containing protein	NA	NA	NA	NA
WP_011959513.1\|260927_261494_+	cyclic pyranopterin monophosphate synthase MoaC	NA	NA	NA	NA
WP_011959514.1\|261698_261941_+	molybdopterin converting factor subunit 1	NA	NA	NA	NA
WP_011959515.1\|261972_262488_+	molybdenum cofactor biosynthesis protein MoaE	NA	NA	NA	NA
WP_190272742.1\|262615_263344_-	molybdate ABC transporter permease subunit	NA	NA	NA	NA
WP_011959517.1\|263586_264513_-	molybdate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_011959518.1\|264719_265916_-	aspartate/tyrosine/aromatic aminotransferase	NA	NA	NA	NA
WP_011959519.1\|266106_267591_+	Na+/H+ antiporter NhaC	NA	NA	NA	NA
WP_150097818.1\|267650_268703_+	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	7.5e-89	49.9
WP_011959521.1\|268786_270280_-	capsule assembly Wzi family protein	NA	NA	NA	NA
WP_011959522.1\|270519_272040_-	sugar transferase	NA	NA	NA	NA
WP_011959523.1\|272115_273240_-	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_011959524.1\|273464_274601_-	glycosyltransferase	NA	NA	NA	NA
WP_150097923.1\|274782_274875_-	hypothetical protein	NA	NA	NA	NA
WP_150097821.1\|274835_275303_-\|transposase	transposase family protein	NA	NA	NA	NA
WP_011959525.1\|275574_275700_-\|transposase	IS3 family transposase	NA	NA	NA	NA

DBSCAN-SWA_2

829317 : 874449

uncultured_virus(22.22%)

integrase,transposase,protease

attL 830661:830680|attR 868347:868366

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_041773283.1\|829317_830508_+\|integrase	site-specific integrase	A0A1W6JTA0	Pseudomonas_phage	1.7e-33	30.2
WP_011959966.1\|830510_830801_+	hypothetical protein	NA	NA	NA	NA
830661:830680	attL	NA	NA	NA	NA
WP_011959968.1\|831814_832081_+\|protease	Serine protease inhibitor-like protein	Q9DHG4	Yaba-like_disease_virus	1.2e-06	36.9
WP_011959969.1\|832464_833724_-	ferredoxin reductase family protein	NA	NA	NA	NA
WP_011959970.1\|834046_834655_+	cytochrome b/b6 domain-containing protein	NA	NA	NA	NA
WP_011959971.1\|834674_835349_+	response regulator	NA	NA	NA	NA
WP_011959972.1\|835413_836877_+	histidine kinase	NA	NA	NA	NA
WP_011959973.1\|836976_837567_+	hypothetical protein	NA	NA	NA	NA
WP_020444569.1\|837559_837874_+	hypothetical protein	NA	NA	NA	NA
WP_011959975.1\|837929_839012_+	FAD:protein FMN transferase	NA	NA	NA	NA
WP_011959976.1\|839075_839759_+	hypothetical protein	NA	NA	NA	NA
WP_011959977.1\|839840_840542_+	VIT family protein	NA	NA	NA	NA
WP_011959978.1\|840903_841734_-	cation transporter	NA	NA	NA	NA
WP_011959554.1\|841812_842514_+\|transposase	IS1-like element ISPssp2 family transposase	A0A218MNG1	uncultured_virus	2.0e-37	54.3
WP_150097843.1\|842615_843245_+	hypothetical protein	NA	NA	NA	NA
WP_011959980.1\|843367_844237_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_011959981.1\|844419_845304_-	prolipoprotein diacylglyceryl transferase	NA	NA	NA	NA
WP_011959982.1\|845487_846960_-	two-component sensor histidine kinase	NA	NA	NA	NA
WP_011959983.1\|846961_847696_-	heavy metal response regulator transcription factor	NA	NA	NA	NA
WP_011959984.1\|848021_848348_+	hypothetical protein	NA	NA	NA	NA
WP_011959985.1\|848511_848784_+	hypothetical protein	NA	NA	NA	NA
WP_011959986.1\|848845_849439_+	cytochrome c	NA	NA	NA	NA
WP_011959987.1\|849604_850243_+	hypothetical protein	NA	NA	NA	NA
WP_011959988.1\|850337_852044_+	copper resistance system multicopper oxidase	NA	NA	NA	NA
WP_011959989.1\|852069_853134_+	copper resistance protein B	NA	NA	NA	NA
WP_190272749.1\|853262_853706_+	DUF305 domain-containing protein	A0A0G2Y9T4	Acanthamoeba_polyphaga_mimivirus	6.7e-07	30.8
WP_041773525.1\|854551_856900_+	heavy metal translocating P-type ATPase	A0A218MNH6	uncultured_virus	1.7e-88	36.5
WP_011959992.1\|856980_857265_+	Sec-independent protein translocase subunit TatA	NA	NA	NA	NA
WP_011959993.1\|857320_857707_+	twin-arginine translocase subunit TatB	NA	NA	NA	NA
WP_011959994.1\|857703_858573_+	twin-arginine translocase subunit TatC	NA	NA	NA	NA
WP_011959995.1\|858663_859953_+	hypothetical protein	NA	NA	NA	NA
WP_011959996.1\|860197_860383_+	hypothetical protein	NA	NA	NA	NA
WP_011959997.1\|860845_861439_-	recombinase family protein	NA	NA	NA	NA
WP_011959998.1\|861736_862717_-	GlxA family transcriptional regulator	NA	NA	NA	NA
WP_011959999.1\|862823_863372_+	cysteine hydrolase	NA	NA	NA	NA
WP_011960000.1\|863451_864366_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_190272762.1\|864459_864606_+	hypothetical protein	NA	NA	NA	NA
WP_011960001.1\|864729_865851_-	Fic family protein	A0A1V0E025	Clostridioides_phage	2.9e-06	26.2
WP_041773285.1\|866434_866662_-	helix-turn-helix transcriptional regulator	A0A1P8BMN9	Lactococcus_phage	1.6e-09	46.3
WP_007393965.1\|866778_866994_+	hypothetical protein	NA	NA	NA	NA
WP_011960002.1\|867004_868210_+\|integrase	site-specific integrase	A0A1S5RG59	Helicobacter_phage	3.9e-25	38.2
WP_011960003.1\|868196_868496_+	hypothetical protein	NA	NA	NA	NA
868347:868366	attR	NA	NA	NA	NA
WP_041773286.1\|868506_868824_+	hypothetical protein	NA	NA	NA	NA
WP_041773287.1\|869496_870009_+	hypothetical protein	NA	NA	NA	NA
WP_011960004.1\|870005_872429_+	hypothetical protein	NA	NA	NA	NA
WP_011960005.1\|872394_873222_+	hypothetical protein	NA	NA	NA	NA
WP_150097845.1\|873284_874449_+\|transposase	IS3-like element ISPssp1 family transposase	A0A0P0I4A4	Acinetobacter_phage	3.8e-102	61.3

DBSCAN-SWA_3

1215177 : 1291193

Acinetobacter_phage(23.08%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011960292.1\|1215177_1216593_-\|tRNA	tRNA 5-hydroxyuridine modification protein YegQ	Q6DW11	Phage_TP	2.3e-125	61.4
WP_011960293.1\|1217269_1218070_+	OmpA family protein	NA	NA	NA	NA
WP_150097845.1\|1218112_1219278_-\|transposase	IS3-like element ISPssp1 family transposase	A0A0P0I4A4	Acinetobacter_phage	3.8e-102	61.3
WP_011960294.1\|1219463_1230014_+	Ig-like domain repeat protein	NA	NA	NA	NA
WP_150097845.1\|1230076_1231241_+\|transposase	IS3-like element ISPssp1 family transposase	A0A0P0I4A4	Acinetobacter_phage	3.8e-102	61.3
WP_011960295.1\|1231255_1235845_+	hemolysin-type calcium-binding protein	NA	NA	NA	NA
WP_011960296.1\|1236034_1237270_-	YeiH family putative sulfate export transporter	NA	NA	NA	NA
WP_011960297.1\|1237460_1238486_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_011960298.1\|1238584_1239739_-	S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase	E3SJ82	Synechococcus_phage	3.3e-37	30.7
WP_041773305.1\|1239869_1240754_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_011960300.1\|1240759_1241626_-	mechanosensitive ion channel family protein	NA	NA	NA	NA
WP_011960301.1\|1241817_1243275_-	aminoacyl-histidine dipeptidase	NA	NA	NA	NA
WP_011960302.1\|1243624_1243858_-	hypothetical protein	NA	NA	NA	NA
WP_011960303.1\|1244068_1244644_-	VOC family protein	NA	NA	NA	NA
WP_049751061.1\|1244679_1245960_-	fumarylacetoacetase	NA	NA	NA	NA
WP_011960305.1\|1246145_1247111_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_011960306.1\|1247266_1248385_+	4-hydroxyphenylpyruvate dioxygenase	NA	NA	NA	NA
WP_011960307.1\|1248471_1249269_+	phenylalanine 4-monooxygenase	NA	NA	NA	NA
WP_011960308.1\|1249331_1249673_+	4a-hydroxytetrahydrobiopterin dehydratase	NA	NA	NA	NA
WP_011960309.1\|1249750_1251163_+	Na+/H+ antiporter NhaC	NA	NA	NA	NA
WP_150097963.1\|1251270_1252026_-	PAP2 family lipid A phosphatase	NA	NA	NA	NA
WP_011960311.1\|1252135_1252606_-	diacylglycerol kinase	NA	NA	NA	NA
WP_011960312.1\|1252821_1254156_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_011960313.1\|1254201_1254897_-	response regulator transcription factor	W8CYM9	Bacillus_phage	3.6e-31	36.2
WP_190272737.1\|1254995_1256711_-	phosphoethanolamine--lipid A transferase	NA	NA	NA	NA
WP_011960315.1\|1257383_1258241_+	OmpA family protein	NA	NA	NA	NA
WP_011960316.1\|1258352_1259297_+	hypothetical protein	NA	NA	NA	NA
WP_011960317.1\|1259293_1272586_+	Ig-like domain repeat protein	NA	NA	NA	NA
WP_150097845.1\|1272638_1273803_+\|transposase	IS3-like element ISPssp1 family transposase	A0A0P0I4A4	Acinetobacter_phage	3.8e-102	61.3
WP_011960318.1\|1273803_1275387_+	hypothetical protein	NA	NA	NA	NA
WP_011960320.1\|1276500_1277043_-	helix-turn-helix domain-containing protein	A0A1B1P776	Bacillus_phage	3.0e-09	28.7
WP_041773306.1\|1277120_1277516_+\|transposase	transposase	Q6H9S5	Enterobacteria_phage	1.7e-06	33.7
WP_011960322.1\|1277512_1277857_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_150097967.1\|1278055_1279639_+\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	6.8e-195	65.5
WP_011960324.1\|1279894_1280881_-	glutathione S-transferase family protein	NA	NA	NA	NA
WP_011960325.1\|1281295_1282444_+	spermidine/putrescine ABC transporter ATP-binding protein PotA	Q6GZ03	Mycoplasma_phage	9.2e-32	37.6
WP_190272738.1\|1282436_1283339_+	spermidine/putrescine ABC transporter permease PotB	Q6GZ02	Mycoplasma_phage	1.6e-15	27.9
WP_041773308.1\|1283360_1284125_+	spermidine/putrescine ABC transporter permease PotC	NA	NA	NA	NA
WP_150097858.1\|1284131_1285259_+	extracellular solute-binding protein	NA	NA	NA	NA
WP_041773309.1\|1285268_1285955_+	DUF1345 domain-containing protein	NA	NA	NA	NA
WP_011960330.1\|1286055_1286769_-	3'-5' exonuclease	A0A059VJT9	Pseudomonas_phage	3.0e-41	41.1
WP_011960331.1\|1286930_1288022_-	multidrug resistance efflux transporter family protein	NA	NA	NA	NA
WP_011960332.1\|1288252_1288618_+	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_011960333.1\|1288777_1289704_+	bestrophin family protein	NA	NA	NA	NA
WP_011960334.1\|1290086_1291193_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	Q5ULQ4	Lactobacillus_virus	1.7e-27	29.3

DBSCAN-SWA_4

1300723 : 1382610

Bacillus_phage(16.67%)

integrase,transposase

attL 1370975:1370990|attR 1389697:1389712

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011960342.1\|1300723_1301830_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	Q5ULQ4	Lactobacillus_virus	1.2e-28	30.6
WP_011960343.1\|1301803_1302421_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_041773618.1\|1302702_1304406_+	D-lactate dehydrogenase	NA	NA	NA	NA
WP_011960345.1\|1304574_1306245_+	fatty acid--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	3.2e-25	25.4
WP_190272739.1\|1306522_1307734_+	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_011960347.1\|1307948_1308986_+	alanine racemase	NA	NA	NA	NA
WP_190272740.1\|1308992_1309157_+	hypothetical protein	NA	NA	NA	NA
WP_011960348.1\|1309144_1310482_+	FAD-binding protein	NA	NA	NA	NA
WP_150097862.1\|1310683_1311892_+	WG repeat-containing protein	NA	NA	NA	NA
WP_150097864.1\|1312468_1313422_+	OmpA family protein	NA	NA	NA	NA
WP_011960351.1\|1313660_1328957_+	outer membrane adhesin-like protein	NA	NA	NA	NA
WP_150097967.1\|1329168_1330752_-\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	6.8e-195	65.5
WP_011960322.1\|1330950_1331295_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_041773306.1\|1331291_1331687_-\|transposase	transposase	Q6H9S5	Enterobacteria_phage	1.7e-06	33.7
WP_011960320.1\|1332563_1333106_-	helix-turn-helix domain-containing protein	A0A1B1P776	Bacillus_phage	3.0e-09	28.7
WP_011960352.1\|1333249_1333879_-	glutathione S-transferase	NA	NA	NA	NA
WP_011960353.1\|1333905_1334583_-	type 1 glutamine amidotransferase domain-containing protein	NA	NA	NA	NA
WP_011960354.1\|1334641_1335706_-	NADP-dependent oxidoreductase	NA	NA	NA	NA
WP_011960355.1\|1335941_1337150_-	iron-containing alcohol dehydrogenase	NA	NA	NA	NA
WP_083757358.1\|1337651_1338323_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_011960357.1\|1338860_1343738_+	NAD-glutamate dehydrogenase	NA	NA	NA	NA
WP_011960358.1\|1343890_1347931_-	AAA family ATPase	G3MAB6	Bacillus_virus	1.0e-08	22.6
WP_011960359.1\|1348048_1349662_-	exonuclease SbcCD subunit D C-terminal domain-containing protein	R4JGS2	Bacillus_phage	2.1e-05	34.1
WP_011960360.1\|1349875_1351078_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_011960361.1\|1351314_1352079_+	ABC transporter ATP-binding protein	A0A1V0SE00	Indivirus	4.7e-08	23.0
WP_083757359.1\|1352080_1353199_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_011960363.1\|1353209_1355294_+	Fe(3+)-hydroxamate ABC transporter permease FhuB	A0A2H4IY97	uncultured_Caudovirales_phage	5.2e-17	29.4
WP_011960364.1\|1355314_1356799_+	MFS transporter	NA	NA	NA	NA
WP_011960365.1\|1357160_1359428_+	TonB-dependent receptor	NA	NA	NA	NA
WP_011960366.1\|1359614_1361078_-	uroporphyrinogen-III C-methyltransferase	NA	NA	NA	NA
WP_011960367.1\|1361294_1361924_-	phosphoadenosine phosphosulfate reductase family protein	NA	NA	NA	NA
WP_011960368.1\|1362024_1362627_-	DUF934 domain-containing protein	NA	NA	NA	NA
WP_011960369.1\|1362619_1364302_-	nitrite/sulfite reductase	NA	NA	NA	NA
WP_011960370.1\|1364601_1365861_+	sulfate adenylyltransferase	A0A2K9L4R9	Tupanvirus	2.2e-39	29.3
WP_011960371.1\|1366401_1366776_+	hypothetical protein	NA	NA	NA	NA
WP_011960372.1\|1367054_1368491_+	cardiolipin synthase	NA	NA	NA	NA
WP_011960373.1\|1368633_1369398_-	M48 family metallopeptidase	NA	NA	NA	NA
WP_011960374.1\|1369394_1372718_-	type I restriction endonuclease subunit R	A0A220A398	Liberibacter_phage	3.1e-64	28.5
1370975:1370990	attL	NA	NA	NA	NA
WP_011960375.1\|1372930_1373452_-	hypothetical protein	NA	NA	NA	NA
WP_011960376.1\|1373669_1373930_+\|transposase	transposase	NA	NA	NA	NA
WP_011960377.1\|1374016_1374391_+\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_150097845.1\|1374443_1375608_+\|transposase	IS3-like element ISPssp1 family transposase	A0A0P0I4A4	Acinetobacter_phage	3.8e-102	61.3
WP_041773627.1\|1375723_1376614_-	hypothetical protein	NA	NA	NA	NA
WP_011960379.1\|1377398_1377815_-	hypothetical protein	NA	NA	NA	NA
WP_011960380.1\|1377816_1379784_-	hypothetical protein	NA	NA	NA	NA
WP_011960381.1\|1379783_1381385_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_041773629.1\|1381371_1382610_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
1389697:1389712	attR	NA	NA	NA	NA

DBSCAN-SWA_5

1391636 : 1397746

uncultured_Caudovirales_phage(57.14%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011960392.1\|1391636_1392359_+	sulfate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.4e-30	36.1
WP_150097870.1\|1392551_1393514_-	universal stress protein	A0A2H4J154	uncultured_Caudovirales_phage	7.4e-51	39.0
WP_011960394.1\|1393639_1393909_-	helix-turn-helix transcriptional regulator	A0A218MNF3	uncultured_virus	4.5e-22	54.9
WP_011960395.1\|1394234_1395539_+	arsenic transporter	A0A2H4J144	uncultured_Caudovirales_phage	1.2e-147	66.5
WP_011960396.1\|1395811_1396342_+	arsenate reductase ArsC	A0A2H4J8A6	uncultured_Caudovirales_phage	8.0e-23	39.2
WP_011960397.1\|1396507_1397257_+	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	3.2e-86	65.4
WP_011960398.1\|1397308_1397746_+	MgtC/SapB family protein	G3MA03	Bacillus_virus	1.3e-10	34.7

DBSCAN-SWA_6

1611737 : 1667099

Acinetobacter_phage(11.11%)

integrase,transposase

attL 1611672:1611731|attR 1652060:1653337

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1611672:1611731	attL	NA	NA	NA	NA
WP_150097845.1\|1611737_1612902_+\|transposase	IS3-like element ISPssp1 family transposase	A0A0P0I4A4	Acinetobacter_phage	3.8e-102	61.3
WP_011960564.1\|1612916_1613102_+\|transposase	transposase	NA	NA	NA	NA
WP_011960565.1\|1613345_1614146_-	Zn-ribbon-containing protein	NA	NA	NA	NA
WP_011960566.1\|1614354_1615122_+	trypsin-like peptidase domain-containing protein	NA	NA	NA	NA
WP_011960567.1\|1615182_1615473_-	hypothetical protein	NA	NA	NA	NA
WP_011960568.1\|1615676_1616273_-	hypothetical protein	NA	NA	NA	NA
WP_011960569.1\|1616512_1619464_-	hypothetical protein	Q4L1H3	Burkholderia_phage	7.4e-17	35.2
WP_011960570.1\|1619546_1620245_-	LrgB family protein	NA	NA	NA	NA
WP_011960571.1\|1620254_1620746_-	CidA/LrgA family protein	NA	NA	NA	NA
WP_011960572.1\|1620881_1621763_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_011960573.1\|1621772_1625111_-	type I restriction endonuclease subunit R	NA	NA	NA	NA
WP_011960574.1\|1625153_1626095_-	restriction endonuclease	Q858R6	Enterobacteria_phage	6.5e-52	39.0
WP_011960575.1\|1626118_1627414_-	restriction endonuclease subunit S	A0A2H4PQP5	Staphylococcus_phage	4.8e-29	33.1
WP_011960576.1\|1627413_1629834_-	SAM-dependent DNA methyltransferase	A0A220A2U5	Liberibacter_phage	4.5e-28	26.1
WP_011960577.1\|1630036_1630924_-	hypothetical protein	NA	NA	NA	NA
WP_011960578.1\|1630923_1631613_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_011960579.1\|1631734_1632181_-	VRR-NUC domain-containing protein	M4SRS1	Psychrobacter_phage	1.8e-23	44.5
WP_011960580.1\|1632419_1632683_-	hypothetical protein	NA	NA	NA	NA
WP_011960581.1\|1632673_1633132_-	hypothetical protein	NA	NA	NA	NA
WP_011960582.1\|1633146_1633707_-	hypothetical protein	NA	NA	NA	NA
WP_011960583.1\|1633723_1634608_-	replication protein	A0A2I7RZH8	Vibrio_phage	1.2e-07	48.5
WP_011960584.1\|1634645_1635110_-	hypothetical protein	NA	NA	NA	NA
WP_011960585.1\|1635110_1635455_-	hypothetical protein	NA	NA	NA	NA
WP_041773321.1\|1635457_1635655_-	hypothetical protein	NA	NA	NA	NA
WP_011960587.1\|1635759_1636419_+	helix-turn-helix domain-containing protein	A0A0R6PHW4	Moraxella_phage	3.3e-26	37.9
WP_041773322.1\|1636415_1636643_+	hypothetical protein	NA	NA	NA	NA
WP_011960588.1\|1636654_1637497_+	hypothetical protein	NA	NA	NA	NA
WP_011960589.1\|1637500_1638403_+	DUF3037 domain-containing protein	A0A0R6PJ36	Moraxella_phage	1.0e-33	30.6
WP_011960590.1\|1638532_1639057_+	TIGR00645 family protein	K4K6D8	Caulobacter_phage	5.5e-16	27.9
WP_041773662.1\|1639351_1640698_+	TRAP transporter large permease subunit	NA	NA	NA	NA
WP_011960592.1\|1641285_1641621_+	hypothetical protein	NA	NA	NA	NA
WP_190272725.1\|1641631_1641793_+	hypothetical protein	NA	NA	NA	NA
WP_190272726.1\|1641789_1641951_+	hypothetical protein	NA	NA	NA	NA
WP_011960593.1\|1641943_1642960_+	YqaJ viral recombinase family protein	D2IYT8	Enterococcus_phage	8.6e-50	39.1
WP_011960594.1\|1642959_1643325_+	hypothetical protein	NA	NA	NA	NA
WP_011960595.1\|1643317_1644286_+	hypothetical protein	A0A2H4J6I3	uncultured_Caudovirales_phage	1.7e-42	45.7
WP_011960596.1\|1644346_1645168_+	hypothetical protein	NA	NA	NA	NA
WP_011960597.1\|1645168_1645495_+	hypothetical protein	NA	NA	NA	NA
WP_041773325.1\|1645715_1645931_+	hypothetical protein	NA	NA	NA	NA
WP_011960598.1\|1645932_1646568_+	hypothetical protein	Q6QIE3	Burkholderia_phage	3.4e-28	54.8
WP_041773326.1\|1646577_1646841_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_083757363.1\|1647278_1648361_-	hypothetical protein	NA	NA	NA	NA
WP_083757364.1\|1648391_1648721_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_011960601.1\|1648961_1650053_-	5-methylcytosine-specific restriction endonuclease system specificity protein McrC	NA	NA	NA	NA
WP_011960602.1\|1650054_1650249_-	hypothetical protein	NA	NA	NA	NA
WP_150097845.1\|1650887_1652053_-\|transposase	IS3-like element ISPssp1 family transposase	A0A0P0I4A4	Acinetobacter_phage	3.8e-102	61.3
WP_011960604.1\|1652834_1654802_-	AAA family ATPase	K4I1H4	Acidithiobacillus_phage	1.7e-25	34.7
1652060:1653337	attR	NA	NA	NA	NA
WP_011960605.1\|1655093_1655705_+	DUF2939 domain-containing protein	NA	NA	NA	NA
WP_011960606.1\|1656068_1663058_-	calcium-binding protein	NA	NA	NA	NA
WP_011960320.1\|1663960_1664503_-	helix-turn-helix domain-containing protein	A0A1B1P776	Bacillus_phage	3.0e-09	28.7
WP_041773328.1\|1664580_1664976_+\|transposase	transposase	Q6H9S5	Enterobacteria_phage	1.7e-06	33.7
WP_011960322.1\|1664972_1665317_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_150097967.1\|1665515_1667099_+\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	6.8e-195	65.5

DBSCAN-SWA_7

1785231 : 1865738

uncultured_virus(21.43%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011960697.1\|1785231_1786764_-\|tRNA	lysine--tRNA ligase	A0A1V0SAC0	Catovirus	3.9e-86	37.4
WP_011960698.1\|1786895_1787990_-	peptide chain release factor 1	NA	NA	NA	NA
WP_011960699.1\|1788306_1789452_-	beta-ketoacyl-ACP synthase III	NA	NA	NA	NA
WP_011960700.1\|1789760_1790345_+	ATP-binding protein	A0A1S6UB31	Serratia_phage	1.5e-14	34.3
WP_011960701.1\|1790371_1791592_-	tryptophan synthase subunit beta	NA	NA	NA	NA
WP_011960702.1\|1791912_1793268_+	cation:dicarboxylase symporter family transporter	NA	NA	NA	NA
WP_011960703.1\|1793546_1794605_+	alpha-hydroxy-acid oxidizing protein	NA	NA	NA	NA
WP_011960704.1\|1794866_1795997_+	porin	NA	NA	NA	NA
WP_190272727.1\|1796834_1797239_+	winged helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_041773330.1\|1797265_1797793_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_011960706.1\|1797902_1798823_-	hypothetical protein	NA	NA	NA	NA
WP_011960707.1\|1799365_1799944_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_011960708.1\|1800000_1801476_+	multidrug efflux MFS transporter	NA	NA	NA	NA
WP_011960713.1\|1804081_1804675_+	hypothetical protein	NA	NA	NA	NA
WP_011960714.1\|1806392_1807070_+	leucine-rich repeat domain-containing protein	NA	NA	NA	NA
WP_150097845.1\|1807057_1808223_-\|transposase	IS3-like element ISPssp1 family transposase	A0A0P0I4A4	Acinetobacter_phage	3.8e-102	61.3
WP_011960320.1\|1809370_1809913_-	helix-turn-helix domain-containing protein	A0A1B1P776	Bacillus_phage	3.0e-09	28.7
WP_041773306.1\|1809990_1810386_+\|transposase	transposase	Q6H9S5	Enterobacteria_phage	1.7e-06	33.7
WP_011960322.1\|1810382_1810727_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_150097967.1\|1810925_1812509_+\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	6.8e-195	65.5
WP_011960715.1\|1812835_1813609_-	hypothetical protein	NA	NA	NA	NA
WP_049751001.1\|1813832_1814882_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_011960717.1\|1814962_1817296_-	FepA family TonB-dependent siderophore receptor	NA	NA	NA	NA
WP_011960718.1\|1817681_1818632_+	WG repeat-containing protein	NA	NA	NA	NA
WP_011960719.1\|1818641_1819577_-	hypothetical protein	NA	NA	NA	NA
WP_011960720.1\|1819782_1820331_-	cysteine hydrolase	NA	NA	NA	NA
WP_011960721.1\|1820716_1821151_+	hypothetical protein	NA	NA	NA	NA
WP_011960722.1\|1821765_1823085_-	YjiH family protein	NA	NA	NA	NA
WP_041773333.1\|1825486_1825717_+	hypothetical protein	NA	NA	NA	NA
WP_150097872.1\|1825704_1826870_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	4.4e-98	59.9
WP_011960724.1\|1827021_1827954_+	homocysteine S-methyltransferase family protein	NA	NA	NA	NA
WP_011960725.1\|1827958_1829296_+	amino acid permease	NA	NA	NA	NA
WP_041773334.1\|1829497_1830691_+	sugar transporter	NA	NA	NA	NA
WP_011960727.1\|1830831_1833099_+	TonB-dependent receptor	NA	NA	NA	NA
WP_011960728.1\|1833307_1834981_+	multidrug ABC transporter permease/ATP-binding protein	A0A1V0SJ29	Klosneuvirus	3.9e-07	23.8
WP_011960729.1\|1835130_1836288_+	SIP domain-containing protein	NA	NA	NA	NA
WP_011960730.1\|1836413_1838345_-	TonB-dependent siderophore receptor	NA	NA	NA	NA
WP_011960731.1\|1839822_1841946_-	TonB-dependent receptor	NA	NA	NA	NA
WP_011960732.1\|1842225_1843410_+	hypothetical protein	NA	NA	NA	NA
WP_011960733.1\|1843476_1844283_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_011960734.1\|1844303_1845281_+	iron ABC transporter permease	A0A2H4IY97	uncultured_Caudovirales_phage	4.0e-12	24.0
WP_150097882.1\|1845470_1846301_+	ATP-binding cassette domain-containing protein	M1I0T9	Acanthocystis_turfacea_Chlorella_virus	4.9e-11	30.0
WP_011960736.1\|1846309_1847608_-	PepSY domain-containing protein	NA	NA	NA	NA
WP_011960737.1\|1847842_1848244_-	biopolymer transporter ExbD	NA	NA	NA	NA
WP_011960738.1\|1848286_1848946_-	MotA/TolQ/ExbB proton channel family protein	NA	NA	NA	NA
WP_011960739.1\|1849157_1850153_-	energy transducer TonB	NA	NA	NA	NA
WP_150097886.1\|1850637_1851234_+	YceI family protein	NA	NA	NA	NA
WP_011960741.1\|1851258_1851798_-	DUF924 domain-containing protein	E3T4R4	Cafeteria_roenbergensis_virus	3.1e-06	29.0
WP_150097888.1\|1852025_1852820_+	DUF305 domain-containing protein	A0A218MND9	uncultured_virus	5.9e-38	40.7
WP_011960743.1\|1853320_1854412_+	beta-carotene 15,15'-monooxygenase	NA	NA	NA	NA
WP_011960744.1\|1854519_1856553_-	TonB-dependent receptor	NA	NA	NA	NA
WP_011960745.1\|1857062_1859342_+	nitric-oxide reductase large subunit	NA	NA	NA	NA
WP_083757369.1\|1859588_1860020_-	alpha-hydroxy-acid oxidizing protein	NA	NA	NA	NA
WP_049751004.1\|1860038_1860821_-	alpha-hydroxy-acid oxidizing protein	NA	NA	NA	NA
WP_011960746.1\|1860861_1861641_-	Fe2+-dependent dioxygenase	A0A127KM56	Cyanophage	2.8e-16	35.7
WP_011960747.1\|1861838_1864382_-	TonB-dependent siderophore receptor	NA	NA	NA	NA
WP_011959554.1\|1865036_1865738_+\|transposase	IS1-like element ISPssp2 family transposase	A0A218MNG1	uncultured_virus	2.0e-37	54.3

DBSCAN-SWA_8

2057781 : 2066406

uncultured_virus(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011960882.1\|2057781_2059098_-	phosphopyruvate hydratase	W6LP63	Streptococcus_phage	1.5e-131	57.7
WP_049751094.1\|2059337_2061590_-	cation-translocating P-type ATPase	A0A218MNH6	uncultured_virus	1.2e-224	56.6
WP_011960884.1\|2061861_2062083_-	heavy-metal-associated domain-containing protein	A0A218MNH0	uncultured_virus	5.3e-13	54.3
WP_011960885.1\|2062150_2062399_-	heavy-metal-associated domain-containing protein	NA	NA	NA	NA
WP_011960886.1\|2062442_2063303_-	3-deoxy-8-phosphooctulonate synthase	E3T537	Cafeteria_roenbergensis_virus	1.0e-51	42.3
WP_011960887.1\|2063453_2064560_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	Q9G0F2	Phage_Gifsy-1	2.0e-28	36.8
WP_011960888.1\|2064774_2066406_-	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	8.5e-148	50.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_009524

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection