CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NC_012587	Sinorhizobium fredii NGR234, complete sequence	2 crisprs	csa3,WYL,cas3,DEDDh	6	5
NC_000914	Sinorhizobium fredii NGR234 plasmid pNGR234a, complete sequence	0 crisprs	NA	0	2
NC_012586	Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence	0 crisprs	PrimPol,casR,csa3,RT	0	4

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_012587_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_012587_1

1777110-1777704

Orphan

Consensus_repeat	Method
CTGCTCNTCGGCCTGNTGC	CRT

13 spacers

The CRISPR arrays of NC_012587_1

>merge|NC_012587|1|1777110-1777704|CRT
CTGCTCTTCGGCCTGCTGCTGGCGCTTCTTGCGAGTGGGAGCCTGCTCTTCGGCCTGCTGCGGAGCGCCCTCTTCGGCGGCGGGCTGCTGCTCCTCGGCCTGCTGCTGGCGTTTCTTGCGCTTGGGAGTCTCCTGCTCCTCTGCCTGTTGCGGGGCAGCTTCTTCGGCCGCCGGCTGCTGCTCCTCAGCCTGTTGCTGACGCTTCTTGCGCTTGGGAGTTTCCTGCTCCTCTGCCTGTTGCGGGGCAGCTTCTTCGGCCGCCGGCTGCTGTTCCTCGGCCTGTTGCTGACGCTTCTTGCGCTTGGGAGTTTCCTGCTCCTCTGCCTGTTGCGGGGCAGCTTCTTCGGCCGCCGGCTGCTGCTCCTCGGCCTGCTGCTGGCGCTTCTTGCGTCTGGGAGCCTGCTCTTCGGCCTGCTGCGGAGCGCTCTCCTCGGCGGCGGGCTGCTGCTCCTCGGCCTGTTGCTGGCGCTTCTTGCGCCTTGGAGCCTGCTCTTCGGCCTGCTGCGGAGCGCTCTCCTCGGCGGCGGGTTGCTGCTCTTCGGCCTGCTGCTGGCGCTTCTTGCGTCTTGGCGCTTCCTGTTCTTCGGCTTGCGGC

>NC_012587|1|1|1777110-1777704|CRT
CTGCTCTTCGGCCTGCTGC	TGGCGCTTCTTGCGAGTGGGAGC
CTGCTCTTCGGCCTGCTGC	GGAGCGCCCTCTTCGGCGGCGGGCTG
CTGCTCCTCGGCCTGCTGC	TGGCGTTTCTTGCGCTTGGGAGTCTC
CTGCTCCTCTGCCTGTTGC	GGGGCAGCTTCTTCGGCCGCCGGCTG
CTGCTCCTCAGCCTGTTGC	TGACGCTTCTTGCGCTTGGGAGTTTC
CTGCTCCTCTGCCTGTTGC	GGGGCAGCTTCTTCGGCCGCCGGCTG
CTGTTCCTCGGCCTGTTGC	TGACGCTTCTTGCGCTTGGGAGTTTC
CTGCTCCTCTGCCTGTTGC	GGGGCAGCTTCTTCGGCCGCCGGCTG
CTGCTCCTCGGCCTGCTGC	TGGCGCTTCTTGCGTCTGGGAGC
CTGCTCTTCGGCCTGCTGC	GGAGCGCTCTCCTCGGCGGCGGGCTG
CTGCTCCTCGGCCTGTTGC	TGGCGCTTCTTGCGCCTTGGAGC
CTGCTCTTCGGCCTGCTGC	GGAGCGCTCTCCTCGGCGGCGGGTTG
CTGCTCTTCGGCCTGCTGC	TGGCGCTTCTTGCGTCTTGGCGCTTC
CTGTTCTTCGGCTTGCGGC

Protein	Signature genes	Signature genes Name	Protein_function
NC_012587.1\|WP_164924351.1\|1767577_1768063_+\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224759
NC_012587.1\|WP_164924353.1\|1785485_1786184_+\|DNA-alkylation-repair-protein	unknown	unknown	gnl\|CDD\|227249
NC_012587.1\|WP_012708247.1\|1773741_1774398_+\|molybdenum-cofactor-guanylyltransferase-MobA	unknown	unknown	gnl\|CDD\|234725
NC_012587.1\|WP_012708251.1\|1778296_1779079_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270420
NC_012587.1\|WP_012708257.1\|1783243_1784533_+\|MgtC/SapB-family-protein	unknown	unknown	gnl\|CDD\|225715
NC_012587.1\|WP_012708253.1\|1780144_1780975_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|226634
NC_012587.1\|WP_012708255.1\|1781442_1782168_-\|DUF2270-domain-containing-protein	unknown	unknown	gnl\|CDD\|227817
NC_012587.1\|WP_012708241.1\|1766612_1767530_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|184875
NC_012587.1\|WP_012708249.1\|1774909_1775515_-\|Sel1-repeat-protein	unknown	unknown	gnl\|CDD\|276807
NC_012587.1\|WP_012708256.1\|1782352_1783177_+\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|227310
NC_012587.1\|WP_012708246.1\|1772820_1773729_+\|DMT-family-transporter	unknown	unknown	gnl\|CDD\|223769
NC_012587.1\|WP_012708245.1\|1769816_1772357_-\|HAMP-domain-containing-protein	unknown	unknown	gnl\|CDD\|214599
NC_012587.1\|WP_012708248.1\|1774394_1774913_+\|molybdopterin-guanine-dinucleotide-biosynthesis-protein-B	unknown	unknown	gnl\|CDD\|367391
NC_012587.1\|WP_012708243.1\|1768081_1768456_-\|DUF971-domain-containing-protein	unknown	unknown	gnl\|CDD\|226066
NC_012587.1\|WP_164924352.1\|1768618_1769668_+\|GTP-3',8-cyclase-MoaA	unknown	unknown	gnl\|CDD\|234672
NC_012587.1\|WP_012708254.1\|1781139_1781406_+\|usg-protein	unknown	unknown	gnl\|CDD\|227712
NC_012587.1\|WP_012708252.1\|1779344_1780148_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|226670
NC_012587.1\|WP_012708260.1\|1786255_1786744_-\|Lrp/AsnC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224439
NC_012587.1\|WP_012708258.1\|1784619_1785489_+\|NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|224995
NC_012587.1\|WP_012708240.1\|1765912_1766521_-\|pyridoxamine-5'-phosphate-oxidase-family-protein	unknown	unknown	gnl\|CDD\|274926

Protein	Function_ID	Function_description	E-value
NC_012587.1\|WP_164924351.1\|1767577_1768063_+\|MarR-family-transcriptional-regulator	gnl\|CDD\|224759	COG1846, MarR, Transcriptional regulators [Transcription].	2.80507e-16
NC_012587.1\|WP_164924353.1\|1785485_1786184_+\|DNA-alkylation-repair-protein	gnl\|CDD\|227249	COG4912, COG4912, Predicted DNA alkylation repair enzyme [DNA replication, recombination, and repair].	3.56503e-69
NC_012587.1\|WP_012708247.1\|1773741_1774398_+\|molybdenum-cofactor-guanylyltransferase-MobA	gnl\|CDD\|234725	PRK00317, mobA, molybdopterin-guanine dinucleotide biosynthesis protein MobA; Reviewed.	4.81633e-69
NC_012587.1\|WP_012708251.1\|1778296_1779079_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|270420	cd13702, PBP2_mlr5654_like, Substrate binding domain of ABC-type histidine/lysine/arginine/ornithine transporter-like; the type 2 periplasmic-binding protein fold. This group includes uncharacterized periplasmic substrate-binding protein similar to HisJ and LAO proteins which serve as initial receptors in the ABC transport of histidine-, arginine, and lysine-arginine-ornithine amino acids. This group belongs to the type 2 periplasmic-binding fold protein (PBP2) superfamily, whose members are involved in chemotaxis and uptake of nutrients and other small molecules from the extracellular space as a primary receptor. PBP2 typically comprises of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two receptor cytoplasmically-located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	5.02445e-133
NC_012587.1\|WP_012708257.1\|1783243_1784533_+\|MgtC/SapB-family-protein	gnl\|CDD\|225715	COG3174, COG3174, Predicted membrane protein [Function unknown].	2.64707e-49
NC_012587.1\|WP_012708253.1\|1780144_1780975_+\|ABC-transporter-permease	gnl\|CDD\|226634	COG4160, ArtM, ABC-type arginine/histidine transport system, permease component [Amino acid transport and metabolism].	4.05071e-104
NC_012587.1\|WP_012708255.1\|1781442_1782168_-\|DUF2270-domain-containing-protein	gnl\|CDD\|227817	COG5530, COG5530, Predicted integral membrane protein [Function unknown].	3.26715e-128
NC_012587.1\|WP_012708241.1\|1766612_1767530_-\|alpha/beta-hydrolase	gnl\|CDD\|184875	PRK14875, PRK14875, acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional.	1.23409e-10
NC_012587.1\|WP_012708249.1\|1774909_1775515_-\|Sel1-repeat-protein	gnl\|CDD\|276807	sd00010, SLR, Sel1-like repeat. Sel1-like repeats (SLRs) share similar alpha-helical conformations with Tetratricopeptide repeats (TPRs), but with different consensus sequence lengths and superhelical topologies. SLRs contain 36 to 44 amino acids and are present in bacteria and eukaryotes but not in archaea. SLR proteins are involved in a variety of functions, and many serve as adaptor proteins for the assembly of macromolecular complexes. The SLR family was named after the Caenorhabditis elegans Sel1 protein which is predicted to fold into 11 SLRs, a transmembrane domain, and an N-terminal signal sequence. The human Sel1L protein contains an additional fibronectin type-II domain and an N-terminal PEST sequence. Its downregulation is associated with the development of breast and pancreatic carcinomas.	2.82822e-41
NC_012587.1\|WP_012708256.1\|1782352_1783177_+\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|227310	COG4976, COG4976, Predicted methyltransferase (contains TPR repeat) [General function prediction only].	2.88215e-139
NC_012587.1\|WP_012708246.1\|1772820_1773729_+\|DMT-family-transporter	gnl\|CDD\|223769	COG0697, RhaT, Permeases of the drug/metabolite transporter (DMT) superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / General function prediction only].	8.01219e-12
NC_012587.1\|WP_012708245.1\|1769816_1772357_-\|HAMP-domain-containing-protein	gnl\|CDD\|214599	smart00283, MA, Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer). Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.	4.19937e-61
NC_012587.1\|WP_012708248.1\|1774394_1774913_+\|molybdopterin-guanine-dinucleotide-biosynthesis-protein-B	gnl\|CDD\|367391	pfam03205, MobB, Molybdopterin guanine dinucleotide synthesis protein B. This protein contains a P-loop.	7.0384e-71
NC_012587.1\|WP_012708243.1\|1768081_1768456_-\|DUF971-domain-containing-protein	gnl\|CDD\|226066	COG3536, COG3536, Uncharacterized protein conserved in bacteria [Function unknown].	2.89816e-72
NC_012587.1\|WP_164924352.1\|1768618_1769668_+\|GTP-3',8-cyclase-MoaA	gnl\|CDD\|234672	PRK00164, moaA, GTP 3',8-cyclase MoaA.	0
NC_012587.1\|WP_012708254.1\|1781139_1781406_+\|usg-protein	gnl\|CDD\|227712	COG5425, COG5425, Usg protein, probable subunit of phosphoribosylanthranilate isomerase [Amino acid transport and metabolism].	1.48786e-54
NC_012587.1\|WP_012708252.1\|1779344_1780148_+\|ABC-transporter-permease	gnl\|CDD\|226670	COG4215, ArtQ, ABC-type arginine transport system, permease component [Amino acid transport and metabolism].	6.1158e-101
NC_012587.1\|WP_012708260.1\|1786255_1786744_-\|Lrp/AsnC-family-transcriptional-regulator	gnl\|CDD\|224439	COG1522, Lrp, Transcriptional regulators [Transcription].	2.08065e-48
NC_012587.1\|WP_012708258.1\|1784619_1785489_+\|NAD(P)-dependent-oxidoreductase	gnl\|CDD\|224995	COG2084, MmsB, 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism].	1.03099e-123
NC_012587.1\|WP_012708240.1\|1765912_1766521_-\|pyridoxamine-5'-phosphate-oxidase-family-protein	gnl\|CDD\|274926	TIGR04025, hypothetical_protein, PPOX class probable FMN-dependent enzyme, DR_2398 family. Members of the PPOX family (see pfam01243) may contain either FMN or F420 as cofactor. This subfamily consists of proteins mostly from species that lack the capability to synthesize F420, and therefore most likely all bind FMN.	3.0279e-109

>NC_012587.1|WP_012708249.1|1774909_1775515_-|Sel1-repeat-protein
MKYRSIGLALIVASALAAGLAPAGAQESAASLDAPLALVAKHDPQAQFVIGSMYYKGSSGVRRDHAMAAKWYRTAAEQGHVKAQVNLGSLYFEGEGVPQDYVEAARWFRKAAEDGNAAMAQYNLAMIYAHGMGVVANPVEAAHWYRKAAEQGDAAAQLQLGLMYERGEGVPRDAALAADWLQKAVRELPEARQHLDRLRKN
>NC_012587.1|WP_012708248.1|1774394_1774913_+|molybdopterin-guanine-dinucleotide-biosynthesis-protein-B
MTAPRIFGIAGWKNSGKTGLMVRLVAEMTQRGHVVSTVKHAHHDFDIDKVGADSYRHREAGAHEVTIVSSTRFAIMHELRGAPEPSFEEILSRLAPCDLVLIEGYKREPIPKIEARRLESANREPLAPTDPHIVAIAADHPVADSDLPVFDLDDTVAIADFVETTVGLRRLT
>NC_012587.1|WP_012708247.1|1773741_1774398_+|molybdenum-cofactor-guanylyltransferase-MobA
MVDKTSDSGRCPAVVLAGGRSSRMGSPKAAVLLGGQTMLDRVIERLSPQVASIAVNLNAHSGGALPSGHPAIADTIPGLPGPLAGVLAAMRHARQVAPGASHVLTVPIDAPFFPGTLAARLQGALIVGDEIAVAWSLGEMHPLFALWPLAIADDLDSWIRTDEKRRVRAFIARHASVAVDFPVVATKAGPLDPFLNVNTPQQLEEAEEWLNRLEDSAI
>NC_012587.1|WP_012708246.1|1772820_1773729_+|DMT-family-transporter
MHSSANIRGIVFMTLAMAGFSCNDALVKSVTGAMNTGQIMFIRGLMTTLMIFVLAYRFGALRPVRTVFRPVIMLRIAMEALASLTYISALGHIPLANASAIMQALPLAVTLGAALFLSEPVGWRRWTAIVVGFVGVLIVLRPGPEGFTPAALTVVACVFFTATRDLCTRRIGSDVPSLFITVTTASVTTLVGAALIVPFGGWQPVSMISFSHLAGASVLLMLGYQTIVLAMRDGDISVVAPFRYTGLLWAITIGIVFFSEAPDRWMLVGVAIIVGSGLYTFYRESLRGRQAVAQRSVAGPLE
>NC_012587.1|WP_012708245.1|1769816_1772357_-|HAMP-domain-containing-protein
MSVIDRLLQRLRIVTKVLLFVVPLVALIAGIGLAGFFTARTLNGHMTVTRETINNLSDFQALRSALQDFLDNPSEESRGLLAKMVYEQEAGVKALESLLTQEDDRAKIASVVALGEEMRSQTDKLWSVQVERETETKSLETALAEMTKNGNNAYKQIDILQAESGEKEAFAKALLFDAAAYQGLAERIKKFRLPVTMAVNPDAKIEQANKLLPHLMKQIDESERIASDKVKKPIGELKGQAQKIQAVLAGGEDNEAKKNALVPILSKFSKYEADFAKEAAKNSDTAAKRFVSMDGEISTLKTLIAVMDNTFKGLASTRLHISELHRKLDAANREPIVADIKAVRETAGKLSELGAKNAALRDLPAKLGPSLENIDKGTAALIDVGARWQAAKAEASSLVAKASGTLESFVSSAQEAGKQDSQRSATVSIVAMVAGTLLAIIGGLMLVETLRGPLKRVTETMTRLANGDLEVAIEGRNRGDEIGDMVRSVAVFRDNAVENVRLEREAQAARSLSAEEEARRSEERARIEAEQMQALNALSDVLAQLAAGNLEEGMAEDLPADYVMMARTYNNAVDALRATLMDVRVVTEEITGGTGNLSASADDLARRTEQQAAALEESSRALRQLTEIVRTTAESARKTTVSVDETNSYAQHSGQVVAKAIDAMAEINRSSEKIGTIIGVIDEIAFQTNLLALNAGVEAARAGEAGRGFAVVAQEVRELAQRCAGAAREIKGLISASSAQVRSGVALVQETGDALSVINDHISTIHQLVANIEAAAAEQYTGLNEVNTAVHEVELITQQNAAMVEENTAEIHGLRRQVEVLNEKIERFKTGTGHDAQGQYRSTYAA
>NC_012587.1|WP_164924352.1|1768618_1769668_+|GTP-3',8-cyclase-MoaA
MNTAAIDQTNARPLDKMTAPMIDPFGRMVTYLRVSVTDRCDFRCTYCMAEHMTFLPKKDLLTLEELQRLCSAFIAKGVRKLRLTGGEPLVRKNIMFLVRELGKEIEAGRLDELTLTTNGSQLSKFAAELADCGVRRINVSLDTLDPDKFREITRWGELTKVIEGIDAAQAAGLKVKINAVALKGFNDAEIPDLMRWAHGRGMDLTLIETMPMGEIDEDRTDHYLPLSEMRERLERDFTLKDIPYRTGGPARYVEVAETGGRLGLITPMTHNFCESCNRVRLTCTGTLYMCLGQNDAADLRAALRSTDDDAYLSQVIDEAIGRKPKGHDFIIDREHNRPAVARHMSVTGG
>NC_012587.1|WP_012708243.1|1768081_1768456_-|DUF971-domain-containing-protein
MSEFWPTELRVSKDRHRLTVSFDDGSSFDLAAELLRVLSPSAEVQGHGPGQRVTVPGKRNVQIISVQPTGNYAVRIGFDDFHDTGIYTWTYLRELGEKGDELFRAYEQELAEKGMSRDRSEKPR
>NC_012587.1|WP_164924351.1|1767577_1768063_+|MarR-family-transcriptional-regulator
MNKKQVSTEHYHFPWDHPRFRSWIAVGRACQLMQQTLTRRLAHLDVKPPHLDILINLYRFDGITQQELARKLLVGRSNMSMLLPQLETRGLIQRRGDARDKRVLRLSLTAAGRTLTEEAMEIQTALIENSLGGAPIDDCMKIAESMERIIATLLKEDAELS
>NC_012587.1|WP_012708241.1|1766612_1767530_-|alpha/beta-hydrolase
MASFATKVIRLSLRAVSAVSPTTAGELAFRIFCLTPSRKPKSDKERALLNAAAPLMEESRKVTLSFAGGWVFARHFQRRGGGRGPRVLLTHGWGSRSDYLAAMIDGLLTAGAEVVALDWPGHGASPGRSLIMPQAVRSIDAAWRHFDGFDVCIGHSFGGASLACAAGGVLCDVPARVPAKLVLIGAPSEMAWLFKGFGKIMRLAPAAQAVFEGMVERLSGRRVEGFDAARILGALRRPVLVVHAEDDKEVSADHARRYGAVGSNVELHWANGLGHRRIVSAPLVIEKIVAFLGENEVLAQLRKIA
>NC_012587.1|WP_012708240.1|1765912_1766521_-|pyridoxamine-5'-phosphate-oxidase-family-protein
MTIITTVEELKTVYGETAEASIVKVTNALTVEYRQMIEASPFAALATVGPEGLDCSPRGDDLAVVRIADDKTVLLPDWRGNNRIDSLANIVRDPRVALLFLVPGSNTTMRINGTAAVSVDPALIESFEVDGKHPRTVVVITIGEFYFQCARALLRSQLWNPERFVEPVSLPTPGALLKAAKADFDKEAYDREWPGRAAKTMW
>NC_012587.1|WP_012708251.1|1778296_1779079_+|ABC-transporter-substrate-binding-protein
MRISRRLVAAASAAVFVLMAGTSMAEGEKVVIGTEGAYPPFNNLAADGSLTGFDVDIAKALCEEMKVECTFVTQDWEGIIPALIAKKFDAIIASMSITEERKQKVDFTNKYYNTPPAIVVPKDSPITEATEAALQGKILGAQASTTHSNYAEAHMKGAEIKLYPTADEYKLDIANGRVDAVIDDVVVLSEWLKSEDGACCKLLGTLPIDPVINGEGAGIAVRKGDDALREKFNKAIEAIRANGKYKEINEKYFPFDVYGS
>NC_012587.1|WP_012708252.1|1779344_1780148_+|ABC-transporter-permease
MSGLFAAIYSGIAGILSIIDPFCGPAGIFRWFASGTLLACGDSGWGDEIAYGFLVTASLAIATLPIGLAIGFFIALAKQSPERSLRLSANIYTTIFRGLPELLTLFIVYYGLQILVQQFLATLGYEEPVEINAFVAGMIALGVVFSAYCSEVLLSAFKAIPQGQYEAGDALGFHRGKTMRLIILPQLVRIALPGLGNLWMALLKDTALVSVIGLQDILRQTGQAARMTKQAFQFFGVACVLFLVLAMISSVVFSALERSTKRAEMSR
>NC_012587.1|WP_012708253.1|1780144_1780975_+|ABC-transporter-permease
MSIAETMIPPQAPPPAPPRPYTLARFFGSVALGAWLAFGVGIFLTIVDGWDPEKFSRYGPSFLSGLGVTLLLVISSIPMGAVLSFPVALGRMSKNRFWSWIAYIYVYFFRGTPLIAQLFLVYYGLGSFRPQLESIGLWWFFRDAWNCALFTFTLNTAAYQAEILRGAIESVPRGQHEGAAALGLPERIAFFKVILPQAMIVALRPYGNEIILMIKGSAIVAIVTVFDLMGETRRAFSRTFDFQMYVWAAVLYLLIVEFLRNIWAWIEARLTRHLKR
>NC_012587.1|WP_012708254.1|1781139_1781406_+|usg-protein
MTNDMELQLKGYGLTTAQILYRMPDHPALLQTYIWQHYDIAPDFPEMRSFLRFWQEKLDGPLHSVRYVHRKLISATEWRALKGELILH
>NC_012587.1|WP_012708255.1|1781442_1782168_-|DUF2270-domain-containing-protein
MSAELSPLTLETEMPERQGPPLPQSSQETINTIVHYYRGELGRMAGWRDRIDRTSNWAITVVAAMLSVSLSTPSSHHGVLLFAMLLITLLLLIEARRYRFFDVYRARVRQLERGYFAQILAPEGTQSFKWSVAIAKSLRRPAFLMTYREAVCRRLQRNYCWMYLILLLAWALKISSPKIASTGIPFGHVRSWTDFAENAALGLLPGWSVMIVVALFYGVVLYGSLHKEAHEGELAHGEVHV
>NC_012587.1|WP_012708256.1|1782352_1783177_+|class-I-SAM-dependent-methyltransferase
MTQKNKKIDEEALAEAYNRALSLEKSGSFDAAAAAYREVLDLDPDDHGGASVRLASMGRGETPVKAPDAYVATLFDQHADVFDNVLVDQLGYCVPLLVRQRVQALDLGPFKRVLDLGCGTGLTGGALRDMAEDITGIDLSENMVEIAHEKDLYETLYVAEAVDFLDDNEEAPFDLIVATDVLPYMGALEALFFGAVDNLVPGGLLIFSSETLPDETFAGNPFMVGPHQRFAHSEAYLRDRLTATGFEIVEVTDITVRMEEGEPIAGQLVIARFL
>NC_012587.1|WP_012708257.1|1783243_1784533_+|MgtC/SapB-family-protein
MELVEVFQRLSVAFSVGLLVGCERGWQERDERSGGRTAGIRTFGLAGFLGGLSGYLQTLAGPVAPAVVLLLFGSAFVLFRMREAKEEEDFGVTTVVAALVVFALGATAVVGDVRVAAAGSVATTALLAAKRSLHTFLEKLTWLELRAAIVLLAMTLVALPLLPNETVDPWNVLNPFELWLLTITIAAISFAGYVAIRVAGASRGILFAGAAGGLVSSTALTLSFARFAAEAPESARRLASGAAIAGALSLIRVLVIGAALAPVLLVPLAIGLVPAVLMMLAASVVVILRDASKKAAPDLHLDNPFELGEVLRFGALLGTVIVASKVLVDKIGATMLFAVAAISGLMDLDAITLSTARLTGTTVDTTTAVAAILIAVVVNLLTKVVLAFTAGGKGPYALTLAVTTALAIAAGALGYFVLGSFVPASFMPA
>NC_012587.1|WP_012708258.1|1784619_1785489_+|NAD(P)-dependent-oxidoreductase
MAKVAFIGLGVMGYPMAGHLKSRGGHEVTVYNRTFAKAERWAAEFGGRAAATPAEAAKDQDFVFACVGNDDDLRSVTTGKDGAFETIAPGTIFIDNTTASAEVARELYAAAGAKGAHFIDAPVSGGQAGAENGVLTVMCGGDAEAFDKAKPVIEAYARMVGLMGPAGAGQLTKMINQICIAGLVQGLAEGIHFGKKAGLDIKNVIDVISKGAAGSWQMENRHKTMNAGKYDFGFAVDWMRKDLDIVLAEARRNGAKLPVTALVDQFYAEVQALGGSRWDTSSLLARLEK
>NC_012587.1|WP_164924353.1|1785485_1786184_+|DNA-alkylation-repair-protein
MTLSPASSAEEIIEHMRGLASAENRAGMARFGIATETALGISNVELRRIARSTKTDHARALELWQSGIREARILAAYTADPKALTLDEARLWAADCNSWEVVDTVADLFVAARFEQVLIPEFANDNREFVRRLAFAMIATCAVHLKQEPDSALLAWLPLIEAHAGDERNFVKKAVNWALRQIGKRSAACHGPALTLAEKLAASGNRAARWTGKDARRELDSPKVRVKLGLAG
>NC_012587.1|WP_012708260.1|1786255_1786744_-|Lrp/AsnC-family-transcriptional-regulator
MDRLDRKILRLLQEDSTLAVADLAKKVGLSTTPCWRRIQKMEEDGVIRRRVALLDPVKVNTKVTVFVSVRTSAHSMEWLRRFSEVVADFPEVVEFYRMSGDVDYLLRVVVPDIAAYDAFYKRLIAKIEIRDVSSAFAMEQIKYTTQLPLDYMVIDQAKSSDD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_012587_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_012587_2

2000486-2000570

Orphan

Consensus_repeat	Method
CGCGGCGCCCTCTGAAATCCCCT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_012587_2

>merge|NC_012587|2|2000486-2000570|CRISPRCasFinder
CGCGGCGCCCTCTGAAATCCCCTCTCGCCGCTGCAAATCCCTTCAACGGGGCGCAGGAGACCCGCGGCGCCCTCTGAAGTCCCCT

>NC_012587|2|1|2000486-2000570|CRISPRCasFinder
CGCGGCGCCCTCTGAAATCCCCT	CTCGCCGCTGCAAATCCCTTCAACGGGGCGCAGGAGACC
CGCGGCGCCCTCTGAAGTCCCCT

Protein	Signature genes	Signature genes Name	Protein_function
NC_012587.1\|WP_012708485.1\|2012896_2014009_+\|AI-2E-family-transporter	unknown	unknown	gnl\|CDD\|182881
NC_012587.1\|WP_012708473.1\|1998638_2000411_+\|tetratricopeptide-repeat-protein	unknown	unknown	gnl\|CDD\|227903
NC_012587.1\|WP_012708470.1\|1994955_1995624_-\|TRAP-transporter-small-permease-subunit	unknown	unknown	gnl\|CDD\|227011
NC_012587.1\|WP_012708481.1\|2007679_2009704_-\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224099
NC_012587.1\|WP_012708482.1\|2009711_2010692_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270265
NC_012587.1\|WP_164924382.1\|1990556_1990916_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|182242
NC_012587.1\|WP_164924383.1\|2006473_2006698_+\|hypothetical-protein	unknown	unknown	unknown
NC_012587.1\|WP_012708479.1\|2005658_2006267_-\|glutathione-S-transferase-family-protein	unknown	unknown	gnl\|CDD\|223698
NC_012587.1\|WP_012708486.1\|2014176_2015295_+\|efflux-RND-transporter-periplasmic-adaptor-subunit	unknown	unknown	gnl\|CDD\|273776
NC_012587.1\|WP_012708474.1\|2000879_2002130_+\|IS110-family-transposase	unknown	unknown	gnl\|CDD\|376564
NC_012587.1\|WP_012708464.1\|1989049_1990174_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225360
NC_012587.1\|WP_012708468.1\|1991611_1992781_+\|hypothetical-protein	unknown	unknown	unknown
NC_012587.1\|WP_012708463.1\|1986549_1988574_+\|tetratricopeptide-repeat-protein	unknown	unknown	gnl\|CDD\|227903
NC_012587.1\|WP_012708487.1\|2015298_2018529_+\|multidrug-efflux-RND-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|223911
NC_012587.1\|WP_012708472.1\|1997102_1998443_+\|sorbosone-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|225044
NC_012587.1\|WP_012708465.1\|1990183_1990486_-\|hypothetical-protein	unknown	unknown	unknown
NC_012587.1\|WP_012708477.1\|2003584_2003779_+\|hypothetical-protein	unknown	unknown	unknown
NC_012587.1\|WP_012708478.1\|2003804_2005517_-\|HAD-IIB-family-hydrolase	unknown	unknown	gnl\|CDD\|273651
NC_012587.1\|WP_012708471.1\|1995703_1996846_-\|twin-arginine-translocation-signal-domain-containing-protein	unknown	unknown	gnl\|CDD\|227009
NC_012587.1\|WP_012708469.1\|1993219_1994959_-\|TRAP-transporter-large-permease-subunit	unknown	unknown	gnl\|CDD\|227010

Protein	Function_ID	Function_description	E-value
NC_012587.1\|WP_012708473.1\|1998638_2000411_+\|tetratricopeptide-repeat-protein	gnl\|CDD\|227903	COG5616, COG5616, Predicted integral membrane protein [Function unknown].	1.28238e-63
NC_012587.1\|WP_012708470.1\|1994955_1995624_-\|TRAP-transporter-small-permease-subunit	gnl\|CDD\|227011	COG4665, FcbT2, TRAP-type mannitol/chloroaromatic compound transport system, small permease component [Secondary metabolites biosynthesis, transport, and catabolism].	5.05375e-74
NC_012587.1\|WP_012708481.1\|2007679_2009704_-\|iron-ABC-transporter-permease	gnl\|CDD\|224099	COG1178, ThiP, ABC-type Fe3+ transport system, permease component [Inorganic ion transport and metabolism].	1.22359e-106
NC_012587.1\|WP_012708482.1\|2009711_2010692_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|270265	cd13547, PBP2_Fbp_like_2, Substrate binding domain of an uncharacterized ferric iron transporter, a member of the type 2 periplasmic binding fold superfamily. The periplasmic iron binding protein plays an essential role in the iron uptake pathway of Gram-negative pathogenic bacteria from the Pasteurellaceae and Neisseriaceae families and is critical for survival of these pathogens within the host. This periplasmic domain (Fbp) has high affinity for ferric iron and serves as the primary receptor for transport. After binding iron with high affinity, Fbp interacts with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. The ferric iron-binding proteins belong to the PBP2 superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. They have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	1.39711e-110
NC_012587.1\|WP_164924382.1\|1990556_1990916_-\|hypothetical-protein	gnl\|CDD\|182242	PRK10101, csgB, curlin minor subunit CsgB; Provisional.	0.00108281
NC_012587.1\|WP_012708479.1\|2005658_2006267_-\|glutathione-S-transferase-family-protein	gnl\|CDD\|223698	COG0625, Gst, Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones].	7.83317e-45
NC_012587.1\|WP_012708486.1\|2014176_2015295_+\|efflux-RND-transporter-periplasmic-adaptor-subunit	gnl\|CDD\|273776	TIGR01730, COG0845:_Membrane-fusion_protein, RND family efflux transporter, MFP subunit. This model represents the MFP (membrane fusion protein) component of the RND family of transporters. RND refers to Resistance, Nodulation, and cell Division. It is, in part, a subfamily of pfam00529 (Pfam release 7.5) but hits substantial numbers of proteins missed by that model. The related HlyD secretion protein, for which pfam00529 is named, is outside the scope of this model. Attributed functions imply outward transport. These functions include nodulation, acriflavin resistance, heavy metal efflux, and multidrug resistance proteins. Most members of this family are found in Gram-negative bacteria. The proposed function of MFP proteins is to bring the inner and outer membranes together and enable transport to the outside of the outer membrane. Note, however, that a few members of this family are found in Gram-positive bacteria, where there is no outer membrane. [Transport and binding proteins, Unknown substrate].	1.54095e-71
NC_012587.1\|WP_012708474.1\|2000879_2002130_+\|IS110-family-transposase	gnl\|CDD\|376564	pfam01548, DEDD_Tnp_IS110, Transposase. Transposase proteins are necessary for efficient DNA transposition. This family includes an amino-terminal region of the pilin gene inverting protein (PIVML) and of members of the IS111A/IS1328/IS1533 family of transposases. The C-terminus is represented by family pfam02371.	4.59064e-35
NC_012587.1\|WP_012708464.1\|1989049_1990174_+\|hypothetical-protein	gnl\|CDD\|225360	COG2771, CsgD, DNA-binding HTH domain-containing proteins [Transcription].	4.27319e-07
NC_012587.1\|WP_012708463.1\|1986549_1988574_+\|tetratricopeptide-repeat-protein	gnl\|CDD\|227903	COG5616, COG5616, Predicted integral membrane protein [Function unknown].	3.88292e-33
NC_012587.1\|WP_012708487.1\|2015298_2018529_+\|multidrug-efflux-RND-transporter-permease-subunit	gnl\|CDD\|223911	COG0841, AcrB, Cation/multidrug efflux pump [Defense mechanisms].	0
NC_012587.1\|WP_012708472.1\|1997102_1998443_+\|sorbosone-dehydrogenase-family-protein	gnl\|CDD\|225044	COG2133, COG2133, Glucose/sorbosone dehydrogenases [Carbohydrate transport and metabolism].	5.00959e-118
NC_012587.1\|WP_012708485.1\|2012896_2014009_+\|AI-2E-family-transporter	gnl\|CDD\|182881	PRK10983, PRK10983, AI-2E family transporter YdiK.	2.65718e-53
NC_012587.1\|WP_012708478.1\|2003804_2005517_-\|HAD-IIB-family-hydrolase	gnl\|CDD\|273651	TIGR01484, Putative_mannosyl-3-phosphoglycerate_phosphatase, HAD-superfamily hydrolase, subfamily IIB. This subfamily falls within the Haloacid Dehalogenase (HAD) superfamily of aspartate-nucleophile hydrolases. The Class II subfamilies are characterized by a domain that is located between the second and third conserved catalytic motifs of the superfamily domain. The IIB subfamily is distinguished from the IIA subfamily (TIGR01460) by homology and the predicted secondary structure of this domain by PSI-PRED. The IIB subfamily's Class II domain has the following predicted structure: Helix-Sheet-Sheet-(Helix or Sheet)-Helix-Sheet-(variable)-Helix-Sheet-Sheet. The IIB subfamily consists of Trehalose-6-phosphatase (TIGR00685), plant and cyanobacterial Sucrose-phosphatase and a closely related group of bacterial and archaeal sequences, eukaryotic phosphomannomutase (pfam03332), a large subfamily ("Cof-like hydrolases", TIGR00099) containing many closely related bacterial sequences, a hypothetical equivalog containing the E. coli YedP protein, as well as two small clusters containing OMNI\|TC0379 and OMNI\|SA2196 whose relationship to the other groups is unclear. [Unknown function, Enzymes of unknown specificity].	1.35772e-38
NC_012587.1\|WP_012708471.1\|1995703_1996846_-\|twin-arginine-translocation-signal-domain-containing-protein	gnl\|CDD\|227009	COG4663, FcbT1, TRAP-type mannitol/chloroaromatic compound transport system, periplasmic component [Secondary metabolites biosynthesis, transport, and catabolism].	1.25994e-150
NC_012587.1\|WP_012708469.1\|1993219_1994959_-\|TRAP-transporter-large-permease-subunit	gnl\|CDD\|227010	COG4664, FcbT3, TRAP-type mannitol/chloroaromatic compound transport system, large permease component [Secondary metabolites biosynthesis, transport, and catabolism].	1.6936e-90

>NC_012587.1|WP_012708473.1|1998638_2000411_+|tetratricopeptide-repeat-protein
MRRLAAILDADVVGYSRLMGLDEAGTFSALKACRSTLILPTIAAHSGRIVKQTGDGLLAEFASVVDAVGCAMTIQQMMPQHNEKGSTQRLELRIGIHLGDVFVEDDDIHGDGVTVAARLQEIAPPGGICVSQQVHDHVASKLHFPATDFGKRTLSDVRGPVRIWGWQPGGTPEPAPAAPPPDERPLQERQRPSIAVLPFVNLSSVGEQEHFSDGFTEELIATLARCRWLRVVARNSSFTYKGKSVDVRKVAEDLGVKYVIEGSVRHSGNRIRITAQLLSGESGMLLWAERYDRTLDDIFVLQDEIAGQITGTVEPELGIIEFAALRGHPTADMDAWNIYLKGLWHLYKFNIDDLKTAKQLFERAIGLEPTFAQAHARLAYVHIQLGWYGPLEERAERIGDAIRLAERAIALDSREPAAHLALGRALALGGQPERGIDHLRNALRLDPSFAQGHFALGQALCYVERPEEGITAINEAFRLSPRDPHLWTFHNMLAIAHYQAGRLAESVAAARASLRQENVTFWPAMVLAAALGAEGPSVEAGEAVAALLCRRPDLTADKARAEFYFGSLPAMPEHFIDRFVDDLRHAGLKA
>NC_012587.1|WP_012708472.1|1997102_1998443_+|sorbosone-dehydrogenase-family-protein
MKTGFPRNSLIIILGALLVGCTSVSAQRTGAIAGSGGYGPNPTLPKPRPTLIPTIRIAEAKGWPGGALPQPAKGLKVNVFASGLDHPRWLHVLPNGDVLVAESNAPEKKNSGFSLRKLVMGAAMKRAGAATKSANRITLLRDTNGDGVADLRRPFLEGLNSPFGMTLSNGRLYVANTDALVAFPYRSGRTRITARPEKIVDLPAGDLNHHWTKDVIASPDGRKLYVTVGSNSNVGENGMAAEINRAGVLEVDRASRRTRVFASGLRNPNGLSWNPESGELWVAVNERDEIGDDLVPDYMTSVRAGGFYGWPYSYFGQNVDARVKPQRPDLVARAIKPDYALGSHTASLGLTFSKKAKLGPSYRNGAFVGQHGSWNRSVYSGYKVVFVPFRNGEPNGPPRDVLTGFIGRDNKAMGRPVGVAIDRTGALLVADDVGNIIWRVTPAKGR
>NC_012587.1|WP_012708471.1|1995703_1996846_-|twin-arginine-translocation-signal-domain-containing-protein
MKQGTRTRGRTSRRQFLSGAAMAGAAAVAAPSVVKAQGPTNMRWQSTWPSKDIFHEFAIDFAKKVNDMTGGDLKIEVLPSGAVVPAFGLLDAVSQGTLDGGHGVVAYHYGKQSALALWGSGPGFAMDANMLLAWHKYGGGKDLLAKLYESIGANVVSFLYGPMPTQPLGWFKKPVAKAEDIQGLKFRTVGISIDVFTGLGAAVNALPGGEIVAALDRGLLDAAEFNNASSDRVLGFPDVSKICMLQSYHQNAEQFEVLFNKARYDQLPEQIKAIIANAAEAASQDMHWKAIDRYSRDYVEMQTTDQVKFYKTPEAILKRQLEVYDEVVKKKSAENPLFKEVIQSQIAFAERATRWEQDTLVGRRLAFDHYFGKEGVAKSL
>NC_012587.1|WP_012708470.1|1994955_1995624_-|TRAP-transporter-small-permease-subunit
MDVQHFLISIDKLSVWAGKAAAWLIIGLMTLVCVEVFKRYIMNAPTAWIFDASNMLYGTLFMLAGAYALAQNAHVRGDFIYSSLKPRTQAALDLALYILFFLPGVAALVYAGYDYAALSWRIGEHSTVTAEGPPIYYFKTVIPVAGALVMLQGLAEIVRCIACLRTGEWPRRMEDVEEMDVVAEQLAHSEHVDVEARAAAIERAQDIEKAARQRGLGGEEEP
>NC_012587.1|WP_012708469.1|1993219_1994959_-|TRAP-transporter-large-permease-subunit
MSDPFLGLTMLMLIVVVILMGFPTAFTLMGLGMVFGFYAFYNPAEHWIDNRVFDLMVQRTYGAMTNDVLICIPLFVLMGYVMERGALVDKMFYSVQLSFRRVPASLAVTTLIICTFWGIASGLVGAVVVLMGVIAMNPMLRAGYDVKLASGVITAGGTLGILIPPSVMIIVYAAVAGQSVVKLYAATMFPGFFLALLYLAYVLGWAALNPKIAPALPEEETRVPVPAWMRRFEALYSRNMLVGLLAALFSPRRAWAIETEEGPLTYWKLLKNAAAALVPFLLTSGTLALVWWYVVIHPEGAEAEAPEGLEELGAPSADAAPTGADGPATGFYLWFGLAAAVALILLVRYYRKMTAERLQVVKLLTSSVMPLAILTIVVLGVILFGITTATESAAVGAAGAFLLALQAGTLNWKRTKEAVFLTAKTTAMVCWLFVGSALFSAVFAILGGQALVEEWVLALDLTPLQFMILSQAIIFILGWPLEWTEIIIIFVPIFLPMLRHFDIDPIVWGVLVFVNLQAAFLSPPVAMSAYYLKGVSPPHVTLRQIFAGMMPYMLIVILCMIIMYIWPGMTLWLPNYLYG
>NC_012587.1|WP_012708468.1|1991611_1992781_+|hypothetical-protein
MMSSADVPTFSWSFGARWEDIDTPDLASNVMAPVGTGLDPPDTVGVRTAFSFRLPLEEAGSGPFFLEWDGTISHASGSSRTVVQPVGSSFDLTAGEPAGGSISLATATDLTGATAAGTIHFTDSSGDDSGIMAFAHSPAGNGNAITQYATGGTRTGAAFMALVTRGTPSAAAYAAFADDRGLFFQALGDLEGSVVRSSVEQRANHFDQTLWLGSSLDLGNGWTITPRFGPTYRSTRQDTVFRTEVDIDEGVVSGVAIPAIGYQETIKLSADYYGVVSGLTAETPVAENIRFQVNLNAGVAHYRARLDNHATAIFPEADISLSSSEQKRSGGTFLADVSAAMIFSSHESLSVKFEAGTSFLADVPVYRSGTLDTDDTQSYYLAVGLVHRF
>NC_012587.1|WP_164924382.1|1990556_1990916_-|hypothetical-protein
MIKTLAISALLAFSTVSGAYAGNNVSVTSQKGFGNMSATGQSGWGNFSGTGQVGKGNQSVSVQEGKGNISGTAQFGKNHKAITLQKGKYNASGTFQFGYGNKSLTHQDGEGNLSITVQD
>NC_012587.1|WP_012708465.1|1990183_1990486_-|hypothetical-protein
MISVDAIAYAPIECVIEHSRTNNLTSLVATLHSDWTERGTYHFKVMTGSSTNVQAGAFASEQAGRQELSTIMVSAAPDVWTARLSVYGADGVLLCESSVP
>NC_012587.1|WP_012708464.1|1989049_1990174_+|hypothetical-protein
MSDAYQDKLLLSLIQAIYETVLLPSAWDRIVADLTKLARAESGAILGFEGLDNKKISLAVKGVQRSALLDVDTLSALDDATLAMGLGAIATLPVTLANSAPWSSALRRCFGEDGKLLVLLVSKEGSRRIFVACFFPHAADNHLAIAAETLMKVLPHFQTAFALQKAMVNEREKSTRTERALRSCATSSAIVTADLRVKFANRRFGRFVDASGSFIEFSDEGLEFQDEELQSEVEDLIEQARVNKHDHHLRWAKSKRTGVSWIVSVDFLSFGSDTYRFGNVFSSNEPSFLLTIRELSRNTLLTPDDIKTVFGLTPTEAALVHSLANGDAPSDIAKRRGVSKNTVHNQLASAMGRLGVRRQAQLLSSLAVLSFFTK
>NC_012587.1|WP_012708463.1|1986549_1988574_+|tetratricopeptide-repeat-protein
MSEGPRFSESVHASRVNFTLLGGFAVCSGKGEALILPTAKVRLLAAYLALTAGQYQARSKLCALFWEDRGADQARASLRNALASIRFVLGDRILIANRDAVMFDPDFISVDVSELEALAAGSAATAGAETARRLSSPFLEGSTVSGEELSEWIEFERTRCRNLSEILLAKTAEQLAGVGEEAAAVALAQQLAALDPFREKSHRLLMRLYARQGEHALAMAQFQRCRQLLADELGTEPSPQTVALADELSLKGMPAREARRPEVASTSLQRQTARAAETDFRISIAVLPFLRPAEDADQSFLAEGLAEDLITELSRHKDFLVIARQSTLALDPEPRHAEHAARALDVRYVLTGNLRRRGEDLSLGVQLVDTATHRTVWAERYTRKLEEIFAVQEEIVGLIITAVDAEVRSSERERALRKLPETMDAWELFHRGLWHVYNFSIDQIEAAEECFRRATVLHPRFALGHAGLAQAAVVRIVWQMSEDIPATLESGLAHARHAVALDGAHPYPHVMLGRLLTCQGELGLAHDHLRIAIELNPSYAHAFYALAQVHIWSGRPGEALSYIDRAIRFSPRDPLLSMFMTVRSVCLFLIGDIAGAEASARAAIGRQARECWSRLGLAAALAESGRTDEALATVAEAKTILPNLSIATLDNLIGRMAPAPRQRIINALNRAGLE
>NC_012587.1|WP_012708474.1|2000879_2002130_+|IS110-family-transposase
MTDQKQFYAGVDWASESHHVFLTDGDGRKIGERVFRHGGEGLAELAAWLTATSGATEAGQIQVAIEVPHGPVVETLIERGCQVHAINPKQMDRFRDRFTLAGAKDDSRDAEVMASALRTDRRCFRLLAAADPVVIELREWSRMAEDLGAERNRLTNRMREQLWRYFPALLELENDLGAEWLLDLWEAGPTPAKAARIRAATIAKLLKRNRIRRVDATHVLAVLRTPPVKVAAGTTEAASAHIATLIARIRLVNRQLKQAHQRLDTLTARLVPTEETEPGQRKQHDVEILASLPGVGRIVLATLLAEAFDALQRRDHAALRSLTGVAPVTKRSGKSCIVIRRQACHDRLANAMYHWARVAIQHDSRSRLKYAALRSRGHSHGRALRSVADRLLNVACAMLKTGTTFNPSLAEQKLSC
>NC_012587.1|WP_012708477.1|2003584_2003779_+|hypothetical-protein
MGVDQAPTTKGKKSAGGLHKSAAKEEKKVEAQKGSDLAKGADRFEERSKSSDGRSAGAKQKPKR
>NC_012587.1|WP_012708478.1|2003804_2005517_-|HAD-IIB-family-hydrolase
MYFMALATDYDGTLAEDGMVRPETLDALKRLKQTGRKLLLVTGRELPDLKRVFPEIDLFDKVVVENGALLYSPDTGEETPIAPAPPREFVERLRQKGVDDISVGRSIVATWEPHQAAALEAINELGLELEIIFNKGAVMILPTGVNKATGLKAALKEMQLSFLNVVAVGDAENDHALLRMCGCGAAVANALPALKDTADFALEGARGEGVEELIVAMVERDYAFCTNQRHLVPVGESENGPVEIGPPDVLLIAGSSGVGKSMLATALSEHLRERRFQFCVFDPEGDYEDLEGAVTVGNGSTTPTDSQVLEILANPDDNVVVSALGFEPEERPSFFAKLMSGLSAQRARTGRPHWLIIDAVDHLMPAARDGAPLAPADDISGTIMITDHPDAASPGVLAAVTAVVALGPKAHEAIETFCRAVGEASPAGLEKFHEDEEVLFWRRAPGASVQRIRAEKPKQVRTRNARKYAEGHLGEEASFYFRGPEDKLNLRADNLTIFLQIAEGIDDETWEHHLRAGDYSKWFGESIGDPDLSQKAAGIEEDRSLSPAESRNKLAEAVRRRYIAAASGTR
>NC_012587.1|WP_012708479.1|2005658_2006267_-|glutathione-S-transferase-family-protein
MKLHQGMGPNSYRVRIFLKEKAIDVPMVEVDFAKGEHKAPEFLKLNSLGQIPVLELDDRAIITESVAICRYFEETHPEPPLFGSDAVSRAKVEMWNRRAELVIFATIGNVALHSDAFFKDRLTQFPAFAETERRAVPKKWAWLDRELADGRPFLAGDDFSIADITAGVCGWLGDVFGMEIPASLENVKRWNERVRSRRSWNA
>NC_012587.1|WP_164924383.1|2006473_2006698_+|hypothetical-protein
MTRGSKRKPFKTLQKSCSFMDPRVKPEDDGGPEAVRPETSSVHANACAPRPPQSRQPPAITNGAICPSAIATLL
>NC_012587.1|WP_012708481.1|2007679_2009704_-|iron-ABC-transporter-permease
MTRADEIARSRGAPVESDAEGGSGFPEPPRRLPSGARRFGRLRSFFRGFFFGGGEAAEGRRPRTTFGKLPGALTRTLSGVELPPMPHVREAGFPKARPPRCSREGRRFGFRPRKPRVPGGEPAWLLPFVLCAVLLLSVLPLARLAGAGVNGLVDGEAARLIFAPATLAALRNTLLTATGGMVVSLILGSLFAFALALTDIRGKLILSFAFMLPMMIPPQVTALAWVEMSGPASPLLKTLGLAPPLGSPQPLYSLSGIALLLGVQHAPLVFLALKAGLAASPRDGIEAARLAGAGPLRVFRDIVLPLGAPGLIAGGAIAFVSGVGNFGIPAILGIPAGIETLPTLIFSRLASFGAATFGEIALISTLIAAISAAGLIVQQRALQGRDYRLIGHSGARAAFSLGRFRVAVEALLWAVLVLVLAAPLLALVASSLVPAYGVPLNFDTMSLDAYGEILFRQSITLTALKNSLFLASAAALGLLAVTVPAAYLLARRKGALAGLVAILIEIPYALPGIVLAVAFILTFAAPLPVVGVSLYGTIWIILAAYFSSFLAVSLKPVVSAMLQMDPALEEAARLAGAGFFRRMRDVLLPLVAPAAGASVILVFLIAANELTVSALLWSAGTQTLGVAIFNLDDSGSSDLAAALSVLVVLLVIALMTALELLAKHLPEGVLPWRN
>NC_012587.1|WP_012708482.1|2009711_2010692_-|ABC-transporter-substrate-binding-protein
MKTLLSAVAATLVAGLLSTAAHAESLVLYTSQPNEDAQATVDAFEAANPGVEVEWVREGTTKIMAKLMAEIEAGNPVADVLLIADTVTMQRLKEGGHLLAYKSPEAAGYDAALYDADGAYYSTKMITTGIVYNTSAAMKPEGWQDLAKPEAKGLVTMPSPLTSGAALIHAETLAAIPGLGWDYYKALAENGATAAGGNGGVLKAVATGEKAYGMLVDFMAIREKAKGAPVEFVFPAEGVSAVTEPVGILKTARNVDAAKKFVDFLISEEGQKVAVKMGYIPARNGVALPEGYPARETIKVLPVDAAAAVKNSEAALKTFSGIFGTN
>NC_012587.1|WP_012708485.1|2012896_2014009_+|AI-2E-family-transporter
MDDAQTPVKAEPAAPPASIEPRVTEFLRLGVLALFAYWSLTLVAPFAIIAIWAGILAVALYPVFRALAALFGGRPRLAAAAITVVALAVIAGPLAAIALSFAEAVQAVLAKLASGTLVVPAPPDAVRDWPLIGNWLHAAWAQASGNLEATLQRLAPSLLQAGGTVLGKIAGIGVDLIGFIVSVIIAGFLFRPGPRLGEGLKLFARRVAGERGAGFVDLAGATIRNVARGVIGVALLQALLAGLAFSLFGIPAASVLAFAVLIFCIMQIGPAPVLLPVAIWAWTAMETRATLGLTLILVLIGLIDNVLKPVLVARGLKTPMLVILAGVIGGTLSYGLIGLFLGPIVLGVFYDLVVAWMRSVPRPEDETKPA
>NC_012587.1|WP_012708486.1|2014176_2015295_+|efflux-RND-transporter-periplasmic-adaptor-subunit
MRGSRTLAAVLSSTLLAAVSLAPDKLGAQQAPAPAVVVAPAAIMDLRETADFTGRIVAVQKVDIRARVSGFLEKVNFTEGQKVIAGSVLYEVEDGTYRAAVQEIQGSIEAAEASRELAVLERDRAQRLISSNTVAQATVDTANAQVKKAEADIVRLKGSKQAAELNLSYTRIVAPFDGIVGLSAVDVGGLVGPDSGSLVTLTRLDPISVQFPVATSILLDYRERSVRGEVPAGGDVEITLPNGMTYPKRGVINFVASDVSQGTDTITVRAELPNPDSLLLDGTLVRVTFEQTEKQEVLAVPQQAIQRDQQGAFVMVVGADSKVELRRVDVARSSRGQAVIAKGLKEGEQVITEGVGKVRPGVTVDAAPAAGG
>NC_012587.1|WP_012708487.1|2015298_2018529_+|multidrug-efflux-RND-transporter-permease-subunit
MISEIFIDRPRFAAVISIVLTLAGLIALTALPVAQFPDIVPPQVSVTASYPGAGAEVVESTVAQPIESQIVGVDDMLYMKSTSGADGSYTLTVTFAVGTDPDIATVNVQNRVSLAEARLPSEVKQSGVSVRKKSSALMQVIAIHGENDSFDNLFLSNYATINVMDTIKRVPGVGDAALFGAQDYSMRVVLDIDRLTSLGMTPTDVINALKAQNVQAAIGRIGAQPMTDDPLFQLNLQTQGRLADPKQFEDVVLRAEADGSFVRIRDVAKVELGAASADSSSRFNGKPVAMIGTYLAPGANALAAAEGVRTALERLSQAFPEGLTYKISYDTSEFVEASVENVVHTLIEAFVLVILVVFLFLGNWRATLIPLIAVPVALIGTFAVILAMGFSLNTVSLLALVLAIGIVVDDAIVVVENVERVMEENPGMQAPEAARLAMGEITGAIVAITLVLLSVFVPVAFIPGLSGQLFQQFAVAVSVSMVISAINALTLSPALCAVLLKPHHGEKRGILGWISRRIDNGRDGYVFVAEKIARRAVIGLVLLAVAIAASGWLFRVVPTGFLPSEDQGMFFTEVRLPEGASYNRTDAALRRVETFLRDIEGVQDVTSVSGYSFLDGLSKSNSAFAVVTMKPFGEREAASASVNSAIATAMAKGLTVREAQVFSFNLPPILGLGTGSGFEYQLLDLQGRSAADLAATAGGLIIAANQNPELGPTFTTYSASAPQLYLDVDRDRVQALGVSISDLFATLQGTLGSYYVNDFNLFGRSWKVNLQAGQADRDSVNDIQRLHVRNAAGGMVPVASVARVDYIVGPQTMVRYNNNRSITLNGQPATGVSSGEALQAMAALSATTLPPGYSYEWTGTALQELEAAGQTTVILALAVLFAYLFLVALYESWTIPVPVLLSVAIGVTGALISVLIAGLSFDVYAQIGLVVLIALASKNAILIVEFAKFQREKGAGIVEAAVEGARARFRAVMMTSFAFIVGLIPLVTADGAGMLSRRAVGTGVAGGMLAASLLGIFVIPALYVTFQWLRERGHRFAGLSGPHRGETLPPTPVEEEKHDRRAPATAATAAQSPPAP

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_012587_1	1.2\|1777171\|26\|NC_012587\|CRT	1777171-1777196	26	NZ_CP024427	Paracoccus yeei strain TT13 plasmid pTT13-5, complete sequence	70160-70185	3	0.885
NC_012587_1	1.2\|1777171\|26\|NC_012587\|CRT	1777171-1777196	26	NZ_CP040764	Paracoccus sp. 2251 plasmid unnamed3, complete sequence	39106-39131	3	0.885
NC_012587_1	1.2\|1777171\|26\|NC_012587\|CRT	1777171-1777196	26	NZ_CP020443	Paracoccus yeei strain FDAARGOS_252 plasmid unnamed3, complete sequence	83545-83570	4	0.846
NC_012587_1	1.2\|1777171\|26\|NC_012587\|CRT	1777171-1777196	26	NZ_CP031079	Paracoccus yeei strain CCUG 32053 plasmid pYEE1, complete sequence	468201-468226	4	0.846
NC_012587_1	1.2\|1777171\|26\|NC_012587\|CRT	1777171-1777196	26	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2346743-2346768	4	0.846
NC_012587_1	1.2\|1777171\|26\|NC_012587\|CRT	1777171-1777196	26	JN106170	Uncultured bacterium plasmid pAKD25, complete sequence	62370-62395	4	0.846
NC_012587_1	1.2\|1777171\|26\|NC_012587\|CRT	1777171-1777196	26	JN106171	Uncultured bacterium plasmid pAKD26, complete sequence	81533-81558	4	0.846
NC_012587_1	1.2\|1777171\|26\|NC_012587\|CRT	1777171-1777196	26	JN106175	Uncultured bacterium plasmid pAKD34, complete sequence	54499-54524	4	0.846
NC_012587_1	1.2\|1777171\|26\|NC_012587\|CRT	1777171-1777196	26	JN106167	Uncultured bacterium plasmid pAKD16, complete sequence	64423-64448	4	0.846
NC_012587_1	1.2\|1777171\|26\|NC_012587\|CRT	1777171-1777196	26	NC_013860	Azospirillum sp. B510 plasmid pAB510f, complete sequence	51146-51171	4	0.846
NC_012587_1	1.2\|1777171\|26\|NC_012587\|CRT	1777171-1777196	26	JX194160	Uncultured bacterium plasmid pM02_c6 clone c6, complete sequence	10202-10227	4	0.846
NC_012587_1	1.2\|1777171\|26\|NC_012587\|CRT	1777171-1777196	26	NZ_MG288682	Klebsiella aerogenes strain E20 plasmid pE20-HI3, complete sequence	80472-80497	4	0.846
NC_012587_1	1.4\|1777261\|26\|NC_012587\|CRT	1777261-1777286	26	NZ_CP030129	Indioceanicola profundi strain SCSIO 08040 plasmid unnamed3, complete sequence	295430-295455	4	0.846
NC_012587_1	1.4\|1777261\|26\|NC_012587\|CRT	1777261-1777286	26	NZ_CP016453	Sphingobium sp. RAC03 plasmid pBSY17_1, complete sequence	582219-582244	4	0.846
NC_012587_1	1.6\|1777351\|26\|NC_012587\|CRT	1777351-1777376	26	NZ_CP030129	Indioceanicola profundi strain SCSIO 08040 plasmid unnamed3, complete sequence	295430-295455	4	0.846
NC_012587_1	1.6\|1777351\|26\|NC_012587\|CRT	1777351-1777376	26	NZ_CP016453	Sphingobium sp. RAC03 plasmid pBSY17_1, complete sequence	582219-582244	4	0.846
NC_012587_1	1.8\|1777441\|26\|NC_012587\|CRT	1777441-1777466	26	NZ_CP030129	Indioceanicola profundi strain SCSIO 08040 plasmid unnamed3, complete sequence	295430-295455	4	0.846
NC_012587_1	1.8\|1777441\|26\|NC_012587\|CRT	1777441-1777466	26	NZ_CP016453	Sphingobium sp. RAC03 plasmid pBSY17_1, complete sequence	582219-582244	4	0.846
NC_012587_1	1.10\|1777528\|26\|NC_012587\|CRT	1777528-1777553	26	MG099948	Mycobacterium phage Philonius, complete genome	20427-20452	4	0.846
NC_012587_1	1.10\|1777528\|26\|NC_012587\|CRT	1777528-1777553	26	MH926055	Mycobacterium phage Chewbacca, complete genome	20427-20452	4	0.846
NC_012587_1	1.10\|1777528\|26\|NC_012587\|CRT	1777528-1777553	26	MT723932	Mycobacterium phage Schnauzer, complete genome	20427-20452	4	0.846
NC_012587_1	1.10\|1777528\|26\|NC_012587\|CRT	1777528-1777553	26	KU935726	Mycobacterium phage Xerxes, complete genome	20424-20449	4	0.846
NC_012587_1	1.10\|1777528\|26\|NC_012587\|CRT	1777528-1777553	26	KU935730	Mycobacterium phage Pipsqueaks, complete genome	20427-20452	4	0.846
NC_012587_1	1.10\|1777528\|26\|NC_012587\|CRT	1777528-1777553	26	MH316570	Mycobacterium phage Silvafighter, complete genome	20427-20452	4	0.846
NC_012587_1	1.10\|1777528\|26\|NC_012587\|CRT	1777528-1777553	26	MK524518	Mycobacterium phage Smurph, complete genome	20427-20452	4	0.846
NC_012587_1	1.10\|1777528\|26\|NC_012587\|CRT	1777528-1777553	26	MK977707	Mycobacterium phage LilSpotty, complete genome	21395-21420	4	0.846
NC_012587_1	1.10\|1777528\|26\|NC_012587\|CRT	1777528-1777553	26	MK524515	Mycobacterium phage Parmesanjohn, complete genome	20427-20452	4	0.846
NC_012587_1	1.10\|1777528\|26\|NC_012587\|CRT	1777528-1777553	26	MH697585	Mycobacterium phage Gex, complete genome	20423-20448	4	0.846
NC_012587_1	1.10\|1777528\|26\|NC_012587\|CRT	1777528-1777553	26	KM588359	Mycobacterium phage Carcharodon, complete genome	20427-20452	4	0.846
NC_012587_1	1.10\|1777528\|26\|NC_012587\|CRT	1777528-1777553	26	MH697576	Mycobacterium phage Aggie, complete genome	20428-20453	4	0.846
NC_012587_1	1.10\|1777528\|26\|NC_012587\|CRT	1777528-1777553	26	MH697593	Mycobacterium phage Tapioca, complete genome	20427-20452	4	0.846
NC_012587_1	1.10\|1777528\|26\|NC_012587\|CRT	1777528-1777553	26	JN256079	Mycobacterium phage Charlie, complete genome	20427-20452	4	0.846
NC_012587_1	1.10\|1777528\|26\|NC_012587\|CRT	1777528-1777553	26	NZ_CP031754	Rhodobacter sphaeroides strain EBL0706 plasmid p.C, complete sequence	32224-32249	4	0.846
NC_012587_1	1.10\|1777528\|26\|NC_012587\|CRT	1777528-1777553	26	NZ_CP044991	Deinococcus sp. AJ005 plasmid p115k, complete sequence	105970-105995	4	0.846
NC_012587_1	1.2\|1777171\|26\|NC_012587\|CRT	1777171-1777196	26	NC_015583	Novosphingobium sp. PP1Y plasmid Mpl, complete sequence	293952-293977	5	0.808
NC_012587_1	1.2\|1777171\|26\|NC_012587\|CRT	1777171-1777196	26	MG869615	Polaromonas sp. E10S plasmid pE10SP1, complete sequence	5939-5964	5	0.808
NC_012587_1	1.2\|1777171\|26\|NC_012587\|CRT	1777171-1777196	26	NZ_CP019037	Massilia putida strain 6NM-7 plasmid unnamed2, complete sequence	32140-32165	5	0.808
NC_012587_1	1.2\|1777171\|26\|NC_012587\|CRT	1777171-1777196	26	NZ_CP015232	Epibacterium mobile F1926 plasmid unnamed2, complete sequence	139046-139071	5	0.808
NC_012587_1	1.2\|1777171\|26\|NC_012587\|CRT	1777171-1777196	26	NC_008826	Methylibium petroleiphilum PM1 plasmid RPME01, complete sequence	198129-198154	5	0.808
NC_012587_1	1.2\|1777171\|26\|NC_012587\|CRT	1777171-1777196	26	NZ_CP012399	Chelatococcus sp. CO-6 plasmid pCO-6, complete sequence	756071-756096	5	0.808
NC_012587_1	1.2\|1777171\|26\|NC_012587\|CRT	1777171-1777196	26	NZ_CP023068	Ensifer sojae CCBAU 05684 plasmid pSJ05684b, complete sequence	1952565-1952590	5	0.808
NC_012587_1	1.2\|1777171\|26\|NC_012587\|CRT	1777171-1777196	26	NZ_CP044079	Paracoccus yeei strain FDAARGOS_643 plasmid unnamed2, complete sequence	225440-225465	5	0.808
NC_012587_1	1.2\|1777171\|26\|NC_012587\|CRT	1777171-1777196	26	NZ_CP039640	Azospirillum sp. TSH100 plasmid p1, complete sequence	252799-252824	5	0.808
NC_012587_1	1.2\|1777171\|26\|NC_012587\|CRT	1777171-1777196	26	LC208019	Aeropyrum globular virus 1 genomic DNA, complete genome	4241-4266	5	0.808
NC_012587_1	1.4\|1777261\|26\|NC_012587\|CRT	1777261-1777286	26	NZ_CP042332	Bosea sp. F3-2 plasmid pB32-1, complete sequence	399137-399162	5	0.808
NC_012587_1	1.4\|1777261\|26\|NC_012587\|CRT	1777261-1777286	26	NZ_CP018225	Tardibacter chloracetimidivorans strain JJ-A5 plasmid pHSL4, complete sequence	48799-48824	5	0.808
NC_012587_1	1.4\|1777261\|26\|NC_012587\|CRT	1777261-1777286	26	NZ_CP023450	Rhizorhabdus dicambivorans strain Ndbn-20 plasmid p1, complete sequence	17729-17754	5	0.808
NC_012587_1	1.4\|1777261\|26\|NC_012587\|CRT	1777261-1777286	26	NZ_CP010956	Sphingobium sp. YBL2 plasmid 2pYBL2-2, complete sequence	107161-107186	5	0.808
NC_012587_1	1.4\|1777261\|26\|NC_012587\|CRT	1777261-1777286	26	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	1426106-1426131	5	0.808
NC_012587_1	1.4\|1777261\|26\|NC_012587\|CRT	1777261-1777286	26	NC_015146	Pseudarthrobacter phenanthrenivorans Sphe3 plasmid pASPHE301, complete sequence	68609-68634	5	0.808
NC_012587_1	1.4\|1777261\|26\|NC_012587\|CRT	1777261-1777286	26	NZ_CP005190	Sphingobium sp. MI1205 plasmid pMI1, complete sequence	7084-7109	5	0.808
NC_012587_1	1.6\|1777351\|26\|NC_012587\|CRT	1777351-1777376	26	NZ_CP042332	Bosea sp. F3-2 plasmid pB32-1, complete sequence	399137-399162	5	0.808
NC_012587_1	1.6\|1777351\|26\|NC_012587\|CRT	1777351-1777376	26	NZ_CP018225	Tardibacter chloracetimidivorans strain JJ-A5 plasmid pHSL4, complete sequence	48799-48824	5	0.808
NC_012587_1	1.6\|1777351\|26\|NC_012587\|CRT	1777351-1777376	26	NZ_CP023450	Rhizorhabdus dicambivorans strain Ndbn-20 plasmid p1, complete sequence	17729-17754	5	0.808
NC_012587_1	1.6\|1777351\|26\|NC_012587\|CRT	1777351-1777376	26	NZ_CP010956	Sphingobium sp. YBL2 plasmid 2pYBL2-2, complete sequence	107161-107186	5	0.808
NC_012587_1	1.6\|1777351\|26\|NC_012587\|CRT	1777351-1777376	26	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	1426106-1426131	5	0.808
NC_012587_1	1.6\|1777351\|26\|NC_012587\|CRT	1777351-1777376	26	NC_015146	Pseudarthrobacter phenanthrenivorans Sphe3 plasmid pASPHE301, complete sequence	68609-68634	5	0.808
NC_012587_1	1.6\|1777351\|26\|NC_012587\|CRT	1777351-1777376	26	NZ_CP005190	Sphingobium sp. MI1205 plasmid pMI1, complete sequence	7084-7109	5	0.808
NC_012587_1	1.8\|1777441\|26\|NC_012587\|CRT	1777441-1777466	26	NZ_CP042332	Bosea sp. F3-2 plasmid pB32-1, complete sequence	399137-399162	5	0.808
NC_012587_1	1.8\|1777441\|26\|NC_012587\|CRT	1777441-1777466	26	NZ_CP018225	Tardibacter chloracetimidivorans strain JJ-A5 plasmid pHSL4, complete sequence	48799-48824	5	0.808
NC_012587_1	1.8\|1777441\|26\|NC_012587\|CRT	1777441-1777466	26	NZ_CP023450	Rhizorhabdus dicambivorans strain Ndbn-20 plasmid p1, complete sequence	17729-17754	5	0.808
NC_012587_1	1.8\|1777441\|26\|NC_012587\|CRT	1777441-1777466	26	NZ_CP010956	Sphingobium sp. YBL2 plasmid 2pYBL2-2, complete sequence	107161-107186	5	0.808
NC_012587_1	1.8\|1777441\|26\|NC_012587\|CRT	1777441-1777466	26	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	1426106-1426131	5	0.808
NC_012587_1	1.8\|1777441\|26\|NC_012587\|CRT	1777441-1777466	26	NC_015146	Pseudarthrobacter phenanthrenivorans Sphe3 plasmid pASPHE301, complete sequence	68609-68634	5	0.808
NC_012587_1	1.8\|1777441\|26\|NC_012587\|CRT	1777441-1777466	26	NZ_CP005190	Sphingobium sp. MI1205 plasmid pMI1, complete sequence	7084-7109	5	0.808
NC_012587_1	1.10\|1777528\|26\|NC_012587\|CRT	1777528-1777553	26	MN234196	Gordonia phage CloverMinnie, complete genome	775-800	5	0.808
NC_012587_1	1.12\|1777615\|26\|NC_012587\|CRT	1777615-1777640	26	MG099948	Mycobacterium phage Philonius, complete genome	20427-20452	5	0.808
NC_012587_1	1.12\|1777615\|26\|NC_012587\|CRT	1777615-1777640	26	MH926055	Mycobacterium phage Chewbacca, complete genome	20427-20452	5	0.808
NC_012587_1	1.12\|1777615\|26\|NC_012587\|CRT	1777615-1777640	26	MT723932	Mycobacterium phage Schnauzer, complete genome	20427-20452	5	0.808
NC_012587_1	1.12\|1777615\|26\|NC_012587\|CRT	1777615-1777640	26	KU935726	Mycobacterium phage Xerxes, complete genome	20424-20449	5	0.808
NC_012587_1	1.12\|1777615\|26\|NC_012587\|CRT	1777615-1777640	26	KU935730	Mycobacterium phage Pipsqueaks, complete genome	20427-20452	5	0.808
NC_012587_1	1.12\|1777615\|26\|NC_012587\|CRT	1777615-1777640	26	MH316570	Mycobacterium phage Silvafighter, complete genome	20427-20452	5	0.808
NC_012587_1	1.12\|1777615\|26\|NC_012587\|CRT	1777615-1777640	26	MK524518	Mycobacterium phage Smurph, complete genome	20427-20452	5	0.808
NC_012587_1	1.12\|1777615\|26\|NC_012587\|CRT	1777615-1777640	26	MK977707	Mycobacterium phage LilSpotty, complete genome	21395-21420	5	0.808
NC_012587_1	1.12\|1777615\|26\|NC_012587\|CRT	1777615-1777640	26	MK524515	Mycobacterium phage Parmesanjohn, complete genome	20427-20452	5	0.808
NC_012587_1	1.12\|1777615\|26\|NC_012587\|CRT	1777615-1777640	26	MH697585	Mycobacterium phage Gex, complete genome	20423-20448	5	0.808
NC_012587_1	1.12\|1777615\|26\|NC_012587\|CRT	1777615-1777640	26	KM588359	Mycobacterium phage Carcharodon, complete genome	20427-20452	5	0.808
NC_012587_1	1.12\|1777615\|26\|NC_012587\|CRT	1777615-1777640	26	MH697576	Mycobacterium phage Aggie, complete genome	20428-20453	5	0.808
NC_012587_1	1.12\|1777615\|26\|NC_012587\|CRT	1777615-1777640	26	MH697593	Mycobacterium phage Tapioca, complete genome	20427-20452	5	0.808
NC_012587_1	1.12\|1777615\|26\|NC_012587\|CRT	1777615-1777640	26	JN256079	Mycobacterium phage Charlie, complete genome	20427-20452	5	0.808
NC_012587_1	1.12\|1777615\|26\|NC_012587\|CRT	1777615-1777640	26	NZ_CP032342	Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence	207363-207388	5	0.808
NC_012587_1	1.12\|1777615\|26\|NC_012587\|CRT	1777615-1777640	26	NZ_CP033321	Azospirillum brasilense strain Cd plasmid p3, complete sequence	44594-44619	5	0.808
NC_012587_1	1.12\|1777615\|26\|NC_012587\|CRT	1777615-1777640	26	NZ_CP031754	Rhodobacter sphaeroides strain EBL0706 plasmid p.C, complete sequence	32224-32249	5	0.808
NC_012587_1	1.12\|1777615\|26\|NC_012587\|CRT	1777615-1777640	26	NZ_CP033315	Azospirillum brasilense strain Sp 7 plasmid p3, complete sequence	635159-635184	5	0.808
NC_012587_1	1.2\|1777171\|26\|NC_012587\|CRT	1777171-1777196	26	NZ_CP011298	Rhodococcus erythropolis strain BG43 plasmid pRSLBG43, complete sequence	3478-3503	6	0.769
NC_012587_1	1.10\|1777528\|26\|NC_012587\|CRT	1777528-1777553	26	NZ_CP015065	Mesorhizobium ciceri biovar biserrulae strain WSM1284 plasmid pMc1284, complete sequence	335756-335781	6	0.769
NC_012587_1	1.10\|1777528\|26\|NC_012587\|CRT	1777528-1777553	26	NZ_CP015063	Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence	353761-353786	6	0.769
NC_012587_1	1.12\|1777615\|26\|NC_012587\|CRT	1777615-1777640	26	NC_003903	Streptomyces coelicolor A3(2) plasmid SCP1, complete sequence	166486-166511	6	0.769
NC_012587_1	1.12\|1777615\|26\|NC_012587\|CRT	1777615-1777640	26	MN234196	Gordonia phage CloverMinnie, complete genome	775-800	6	0.769
NC_012587_1	1.12\|1777615\|26\|NC_012587\|CRT	1777615-1777640	26	NZ_CP044991	Deinococcus sp. AJ005 plasmid p115k, complete sequence	105970-105995	7	0.731

1. spacer 1.2|1777171|26|NC_012587|CRT matches to NZ_CP024427 (Paracoccus yeei strain TT13 plasmid pTT13-5, complete sequence) position: , mismatch: 3, identity: 0.885

ggagcgccctcttcggcggcgggctg	CRISPR spacer
gttgcgccctattcggcggcgggctg	Protospacer
*  ******* ***************

2. spacer 1.2|1777171|26|NC_012587|CRT matches to NZ_CP040764 (Paracoccus sp. 2251 plasmid unnamed3, complete sequence) position: , mismatch: 3, identity: 0.885

ggagcgccctcttcggcggcgggctg	CRISPR spacer
tgaccgccctcttcggcggcgggcag	Protospacer
 ** ******************** *

3. spacer 1.2|1777171|26|NC_012587|CRT matches to NZ_CP020443 (Paracoccus yeei strain FDAARGOS_252 plasmid unnamed3, complete sequence) position: , mismatch: 4, identity: 0.846

ggagcgccctcttcggcggcgggctg	CRISPR spacer
tttgcgccctattcggcggcgggctg	Protospacer
   ******* ***************

4. spacer 1.2|1777171|26|NC_012587|CRT matches to NZ_CP031079 (Paracoccus yeei strain CCUG 32053 plasmid pYEE1, complete sequence) position: , mismatch: 4, identity: 0.846

ggagcgccctcttcggcggcgggctg	CRISPR spacer
tttgcgccctattcggcggcgggctg	Protospacer
   ******* ***************

5. spacer 1.2|1777171|26|NC_012587|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 4, identity: 0.846

ggagcgccctcttcggcggcgggctg--	CRISPR spacer
ggagcggcctcttcggcggc--gccggt	Protospacer
****** *************  **.*

6. spacer 1.2|1777171|26|NC_012587|CRT matches to JN106170 (Uncultured bacterium plasmid pAKD25, complete sequence) position: , mismatch: 4, identity: 0.846

ggagcgccctcttcggcggcgggctg	CRISPR spacer
gcggcgcgctcttcgccggcgggctg	Protospacer
* .**** ******* **********

7. spacer 1.2|1777171|26|NC_012587|CRT matches to JN106171 (Uncultured bacterium plasmid pAKD26, complete sequence) position: , mismatch: 4, identity: 0.846

ggagcgccctcttcggcggcgggctg	CRISPR spacer
gcggcgcgctcttcgccggcgggctg	Protospacer
* .**** ******* **********

8. spacer 1.2|1777171|26|NC_012587|CRT matches to JN106175 (Uncultured bacterium plasmid pAKD34, complete sequence) position: , mismatch: 4, identity: 0.846

ggagcgccctcttcggcggcgggctg	CRISPR spacer
gcggcgcgctcttcgccggcgggctg	Protospacer
* .**** ******* **********

9. spacer 1.2|1777171|26|NC_012587|CRT matches to JN106167 (Uncultured bacterium plasmid pAKD16, complete sequence) position: , mismatch: 4, identity: 0.846

ggagcgccctcttcggcggcgggctg	CRISPR spacer
gcggcgcgctcttcgccggcgggctg	Protospacer
* .**** ******* **********

10. spacer 1.2|1777171|26|NC_012587|CRT matches to NC_013860 (Azospirillum sp. B510 plasmid pAB510f, complete sequence) position: , mismatch: 4, identity: 0.846

ggagcgccctcttcggcggcgggctg	CRISPR spacer
gcggcgtcctgttcggcggcgggctg	Protospacer
* .***.*** ***************

11. spacer 1.2|1777171|26|NC_012587|CRT matches to JX194160 (Uncultured bacterium plasmid pM02_c6 clone c6, complete sequence) position: , mismatch: 4, identity: 0.846

ggagcgccctcttcggcggcgggctg	CRISPR spacer
gcggcgcgctcttcgccggcgggctg	Protospacer
* .**** ******* **********

12. spacer 1.2|1777171|26|NC_012587|CRT matches to NZ_MG288682 (Klebsiella aerogenes strain E20 plasmid pE20-HI3, complete sequence) position: , mismatch: 4, identity: 0.846

ggagcgccctcttcggcggcgggctg	CRISPR spacer
gcggcgcgctcttcgccggcgggctg	Protospacer
* .**** ******* **********

13. spacer 1.4|1777261|26|NC_012587|CRT matches to NZ_CP030129 (Indioceanicola profundi strain SCSIO 08040 plasmid unnamed3, complete sequence) position: , mismatch: 4, identity: 0.846

ggggcagcttcttcggccgccggctg	CRISPR spacer
tgggccgcttctccggccgccggcag	Protospacer
 **** ******.*********** *

14. spacer 1.4|1777261|26|NC_012587|CRT matches to NZ_CP016453 (Sphingobium sp. RAC03 plasmid pBSY17_1, complete sequence) position: , mismatch: 4, identity: 0.846

ggggcagcttcttcggccgccggctg	CRISPR spacer
ggcgcagcttcttcggccgcaggatt	Protospacer
** ***************** ** *

15. spacer 1.6|1777351|26|NC_012587|CRT matches to NZ_CP030129 (Indioceanicola profundi strain SCSIO 08040 plasmid unnamed3, complete sequence) position: , mismatch: 4, identity: 0.846

ggggcagcttcttcggccgccggctg	CRISPR spacer
tgggccgcttctccggccgccggcag	Protospacer
 **** ******.*********** *

16. spacer 1.6|1777351|26|NC_012587|CRT matches to NZ_CP016453 (Sphingobium sp. RAC03 plasmid pBSY17_1, complete sequence) position: , mismatch: 4, identity: 0.846

ggggcagcttcttcggccgccggctg	CRISPR spacer
ggcgcagcttcttcggccgcaggatt	Protospacer
** ***************** ** *

17. spacer 1.8|1777441|26|NC_012587|CRT matches to NZ_CP030129 (Indioceanicola profundi strain SCSIO 08040 plasmid unnamed3, complete sequence) position: , mismatch: 4, identity: 0.846

ggggcagcttcttcggccgccggctg	CRISPR spacer
tgggccgcttctccggccgccggcag	Protospacer
 **** ******.*********** *

18. spacer 1.8|1777441|26|NC_012587|CRT matches to NZ_CP016453 (Sphingobium sp. RAC03 plasmid pBSY17_1, complete sequence) position: , mismatch: 4, identity: 0.846

ggggcagcttcttcggccgccggctg	CRISPR spacer
ggcgcagcttcttcggccgcaggatt	Protospacer
** ***************** ** *

19. spacer 1.10|1777528|26|NC_012587|CRT matches to MG099948 (Mycobacterium phage Philonius, complete genome) position: , mismatch: 4, identity: 0.846

ggagcgctctcctcggcggcgggctg	CRISPR spacer
cgagcgctcttctcggcggcgggcaa	Protospacer
 *********.************* .

20. spacer 1.10|1777528|26|NC_012587|CRT matches to MH926055 (Mycobacterium phage Chewbacca, complete genome) position: , mismatch: 4, identity: 0.846

ggagcgctctcctcggcggcgggctg	CRISPR spacer
cgagcgctcttctcggcggcgggcaa	Protospacer
 *********.************* .

21. spacer 1.10|1777528|26|NC_012587|CRT matches to MT723932 (Mycobacterium phage Schnauzer, complete genome) position: , mismatch: 4, identity: 0.846

ggagcgctctcctcggcggcgggctg	CRISPR spacer
cgagcgctcttctcggcggcgggcaa	Protospacer
 *********.************* .

22. spacer 1.10|1777528|26|NC_012587|CRT matches to KU935726 (Mycobacterium phage Xerxes, complete genome) position: , mismatch: 4, identity: 0.846

ggagcgctctcctcggcggcgggctg	CRISPR spacer
cgagcgctcttctcggcggcgggcaa	Protospacer
 *********.************* .

23. spacer 1.10|1777528|26|NC_012587|CRT matches to KU935730 (Mycobacterium phage Pipsqueaks, complete genome) position: , mismatch: 4, identity: 0.846

ggagcgctctcctcggcggcgggctg	CRISPR spacer
cgagcgctcttctcggcggcgggcaa	Protospacer
 *********.************* .

24. spacer 1.10|1777528|26|NC_012587|CRT matches to MH316570 (Mycobacterium phage Silvafighter, complete genome) position: , mismatch: 4, identity: 0.846

ggagcgctctcctcggcggcgggctg	CRISPR spacer
cgagcgctcttctcggcggcgggcaa	Protospacer
 *********.************* .

25. spacer 1.10|1777528|26|NC_012587|CRT matches to MK524518 (Mycobacterium phage Smurph, complete genome) position: , mismatch: 4, identity: 0.846

ggagcgctctcctcggcggcgggctg	CRISPR spacer
cgagcgctcttctcggcggcgggcaa	Protospacer
 *********.************* .

26. spacer 1.10|1777528|26|NC_012587|CRT matches to MK977707 (Mycobacterium phage LilSpotty, complete genome) position: , mismatch: 4, identity: 0.846

ggagcgctctcctcggcggcgggctg	CRISPR spacer
cgagcgctcttctcggcggcgggcaa	Protospacer
 *********.************* .

27. spacer 1.10|1777528|26|NC_012587|CRT matches to MK524515 (Mycobacterium phage Parmesanjohn, complete genome) position: , mismatch: 4, identity: 0.846

ggagcgctctcctcggcggcgggctg	CRISPR spacer
cgagcgctcttctcggcggcgggcaa	Protospacer
 *********.************* .

28. spacer 1.10|1777528|26|NC_012587|CRT matches to MH697585 (Mycobacterium phage Gex, complete genome) position: , mismatch: 4, identity: 0.846

ggagcgctctcctcggcggcgggctg	CRISPR spacer
cgagcgctcttctcggcggcgggcaa	Protospacer
 *********.************* .

29. spacer 1.10|1777528|26|NC_012587|CRT matches to KM588359 (Mycobacterium phage Carcharodon, complete genome) position: , mismatch: 4, identity: 0.846

ggagcgctctcctcggcggcgggctg	CRISPR spacer
cgagcgctcttctcggcggcgggcaa	Protospacer
 *********.************* .

30. spacer 1.10|1777528|26|NC_012587|CRT matches to MH697576 (Mycobacterium phage Aggie, complete genome) position: , mismatch: 4, identity: 0.846

ggagcgctctcctcggcggcgggctg	CRISPR spacer
cgagcgctcttctcggcggcgggcaa	Protospacer
 *********.************* .

31. spacer 1.10|1777528|26|NC_012587|CRT matches to MH697593 (Mycobacterium phage Tapioca, complete genome) position: , mismatch: 4, identity: 0.846

ggagcgctctcctcggcggcgggctg	CRISPR spacer
cgagcgctcttctcggcggcgggcaa	Protospacer
 *********.************* .

32. spacer 1.10|1777528|26|NC_012587|CRT matches to JN256079 (Mycobacterium phage Charlie, complete genome) position: , mismatch: 4, identity: 0.846

ggagcgctctcctcggcggcgggctg	CRISPR spacer
cgagcgctcttctcggcggcgggcaa	Protospacer
 *********.************* .

33. spacer 1.10|1777528|26|NC_012587|CRT matches to NZ_CP031754 (Rhodobacter sphaeroides strain EBL0706 plasmid p.C, complete sequence) position: , mismatch: 4, identity: 0.846

ggagcgctctcctcggcggcgggctg	CRISPR spacer
ggagagctctccccggcggcgggcgc	Protospacer
**** *******.***********

34. spacer 1.10|1777528|26|NC_012587|CRT matches to NZ_CP044991 (Deinococcus sp. AJ005 plasmid p115k, complete sequence) position: , mismatch: 4, identity: 0.846

ggagcgctctcctcggcggcg--ggctg	CRISPR spacer
ccagcgctctcctcggcggcgatggc--	Protospacer
  *******************  ***

35. spacer 1.2|1777171|26|NC_012587|CRT matches to NC_015583 (Novosphingobium sp. PP1Y plasmid Mpl, complete sequence) position: , mismatch: 5, identity: 0.808

ggagcgccctcttcggcggcgggctg	CRISPR spacer
ctggcgccctcttcggcggcgcgctt	Protospacer
  .****************** ***

36. spacer 1.2|1777171|26|NC_012587|CRT matches to MG869615 (Polaromonas sp. E10S plasmid pE10SP1, complete sequence) position: , mismatch: 5, identity: 0.808

ggagcgccctcttcggcggcgggctg	CRISPR spacer
acagcgccctgttcggctgcgggctc	Protospacer
. ******** ****** *******

37. spacer 1.2|1777171|26|NC_012587|CRT matches to NZ_CP019037 (Massilia putida strain 6NM-7 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.808

ggagcgccctcttcggcggcgggctg	CRISPR spacer
acggcgccgtcatcggcggcgggctg	Protospacer
. .***** ** **************

38. spacer 1.2|1777171|26|NC_012587|CRT matches to NZ_CP015232 (Epibacterium mobile F1926 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.808

ggagcgccctcttcggcggcgggctg	CRISPR spacer
atcgcgcccgctttggcggcgggctg	Protospacer
.  ****** ***.************

39. spacer 1.2|1777171|26|NC_012587|CRT matches to NC_008826 (Methylibium petroleiphilum PM1 plasmid RPME01, complete sequence) position: , mismatch: 5, identity: 0.808

ggagcgccctcttcggcggcgggctg	CRISPR spacer
agcccgccctcttcggaggcgggctc	Protospacer
.*  ************ ********

40. spacer 1.2|1777171|26|NC_012587|CRT matches to NZ_CP012399 (Chelatococcus sp. CO-6 plasmid pCO-6, complete sequence) position: , mismatch: 5, identity: 0.808

ggagcgccctcttcggcggcgggctg	CRISPR spacer
actgggccctcttcgtcggcgggctg	Protospacer
.  * ********** **********

41. spacer 1.2|1777171|26|NC_012587|CRT matches to NZ_CP023068 (Ensifer sojae CCBAU 05684 plasmid pSJ05684b, complete sequence) position: , mismatch: 5, identity: 0.808

ggagcgccctcttcggcggcgggctg	CRISPR spacer
acggcgccgtcatcggcggcgggctg	Protospacer
. .***** ** **************

42. spacer 1.2|1777171|26|NC_012587|CRT matches to NZ_CP044079 (Paracoccus yeei strain FDAARGOS_643 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.808

ggagcgccctcttcggcggcgggctg	CRISPR spacer
tttgcgccctattcggcagcgggctg	Protospacer
   ******* ******.********

43. spacer 1.2|1777171|26|NC_012587|CRT matches to NZ_CP039640 (Azospirillum sp. TSH100 plasmid p1, complete sequence) position: , mismatch: 5, identity: 0.808

ggagcgccctcttcggcggcgggctg	CRISPR spacer
agtcggcccgcttcggcggcgggctg	Protospacer
.*   **** ****************

44. spacer 1.2|1777171|26|NC_012587|CRT matches to LC208019 (Aeropyrum globular virus 1 genomic DNA, complete genome) position: , mismatch: 5, identity: 0.808

ggagcgccctcttcggcggcgggctg	CRISPR spacer
ggtgggccctcttcggcggcggggac	Protospacer
** * ******************

45. spacer 1.4|1777261|26|NC_012587|CRT matches to NZ_CP042332 (Bosea sp. F3-2 plasmid pB32-1, complete sequence) position: , mismatch: 5, identity: 0.808

ggggcagcttcttcggccgccggctg	CRISPR spacer
ggggcagcttcttcgcccgccgcgat	Protospacer
*************** ******

46. spacer 1.4|1777261|26|NC_012587|CRT matches to NZ_CP018225 (Tardibacter chloracetimidivorans strain JJ-A5 plasmid pHSL4, complete sequence) position: , mismatch: 5, identity: 0.808

ggggcagcttcttcggccgccggctg	CRISPR spacer
cgggcggcttcttcggccgccgcgag	Protospacer
 ****.****************   *

47. spacer 1.4|1777261|26|NC_012587|CRT matches to NZ_CP023450 (Rhizorhabdus dicambivorans strain Ndbn-20 plasmid p1, complete sequence) position: , mismatch: 5, identity: 0.808

ggggcagcttcttcggccgccggctg	CRISPR spacer
cgggcggcttcttcggccgccgcgag	Protospacer
 ****.****************   *

48. spacer 1.4|1777261|26|NC_012587|CRT matches to NZ_CP010956 (Sphingobium sp. YBL2 plasmid 2pYBL2-2, complete sequence) position: , mismatch: 5, identity: 0.808

ggggcagcttcttcggccgccggctg	CRISPR spacer
cgggcggcttcttcggccgccgcgag	Protospacer
 ****.****************   *

49. spacer 1.4|1777261|26|NC_012587|CRT matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 5, identity: 0.808

ggggcagcttcttcggccgccggctg	CRISPR spacer
tcggcggcttcttcggcggccggctc	Protospacer
  ***.*********** *******

50. spacer 1.4|1777261|26|NC_012587|CRT matches to NC_015146 (Pseudarthrobacter phenanthrenivorans Sphe3 plasmid pASPHE301, complete sequence) position: , mismatch: 5, identity: 0.808

ggggcagcttcttcggccgccggctg	CRISPR spacer
tcagcagcgtcttcggccgccggccg	Protospacer
  .***** ***************.*

51. spacer 1.4|1777261|26|NC_012587|CRT matches to NZ_CP005190 (Sphingobium sp. MI1205 plasmid pMI1, complete sequence) position: , mismatch: 5, identity: 0.808

ggggcagcttcttcggccgccggctg	CRISPR spacer
cgggcggcttcttcggccgccgcgag	Protospacer
 ****.****************   *

52. spacer 1.6|1777351|26|NC_012587|CRT matches to NZ_CP042332 (Bosea sp. F3-2 plasmid pB32-1, complete sequence) position: , mismatch: 5, identity: 0.808

ggggcagcttcttcggccgccggctg	CRISPR spacer
ggggcagcttcttcgcccgccgcgat	Protospacer
*************** ******

53. spacer 1.6|1777351|26|NC_012587|CRT matches to NZ_CP018225 (Tardibacter chloracetimidivorans strain JJ-A5 plasmid pHSL4, complete sequence) position: , mismatch: 5, identity: 0.808

ggggcagcttcttcggccgccggctg	CRISPR spacer
cgggcggcttcttcggccgccgcgag	Protospacer
 ****.****************   *

54. spacer 1.6|1777351|26|NC_012587|CRT matches to NZ_CP023450 (Rhizorhabdus dicambivorans strain Ndbn-20 plasmid p1, complete sequence) position: , mismatch: 5, identity: 0.808

ggggcagcttcttcggccgccggctg	CRISPR spacer
cgggcggcttcttcggccgccgcgag	Protospacer
 ****.****************   *

55. spacer 1.6|1777351|26|NC_012587|CRT matches to NZ_CP010956 (Sphingobium sp. YBL2 plasmid 2pYBL2-2, complete sequence) position: , mismatch: 5, identity: 0.808

ggggcagcttcttcggccgccggctg	CRISPR spacer
cgggcggcttcttcggccgccgcgag	Protospacer
 ****.****************   *

56. spacer 1.6|1777351|26|NC_012587|CRT matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 5, identity: 0.808

ggggcagcttcttcggccgccggctg	CRISPR spacer
tcggcggcttcttcggcggccggctc	Protospacer
  ***.*********** *******

57. spacer 1.6|1777351|26|NC_012587|CRT matches to NC_015146 (Pseudarthrobacter phenanthrenivorans Sphe3 plasmid pASPHE301, complete sequence) position: , mismatch: 5, identity: 0.808

ggggcagcttcttcggccgccggctg	CRISPR spacer
tcagcagcgtcttcggccgccggccg	Protospacer
  .***** ***************.*

58. spacer 1.6|1777351|26|NC_012587|CRT matches to NZ_CP005190 (Sphingobium sp. MI1205 plasmid pMI1, complete sequence) position: , mismatch: 5, identity: 0.808

ggggcagcttcttcggccgccggctg	CRISPR spacer
cgggcggcttcttcggccgccgcgag	Protospacer
 ****.****************   *

59. spacer 1.8|1777441|26|NC_012587|CRT matches to NZ_CP042332 (Bosea sp. F3-2 plasmid pB32-1, complete sequence) position: , mismatch: 5, identity: 0.808

ggggcagcttcttcggccgccggctg	CRISPR spacer
ggggcagcttcttcgcccgccgcgat	Protospacer
*************** ******

60. spacer 1.8|1777441|26|NC_012587|CRT matches to NZ_CP018225 (Tardibacter chloracetimidivorans strain JJ-A5 plasmid pHSL4, complete sequence) position: , mismatch: 5, identity: 0.808

ggggcagcttcttcggccgccggctg	CRISPR spacer
cgggcggcttcttcggccgccgcgag	Protospacer
 ****.****************   *

61. spacer 1.8|1777441|26|NC_012587|CRT matches to NZ_CP023450 (Rhizorhabdus dicambivorans strain Ndbn-20 plasmid p1, complete sequence) position: , mismatch: 5, identity: 0.808

ggggcagcttcttcggccgccggctg	CRISPR spacer
cgggcggcttcttcggccgccgcgag	Protospacer
 ****.****************   *

62. spacer 1.8|1777441|26|NC_012587|CRT matches to NZ_CP010956 (Sphingobium sp. YBL2 plasmid 2pYBL2-2, complete sequence) position: , mismatch: 5, identity: 0.808

ggggcagcttcttcggccgccggctg	CRISPR spacer
cgggcggcttcttcggccgccgcgag	Protospacer
 ****.****************   *

63. spacer 1.8|1777441|26|NC_012587|CRT matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 5, identity: 0.808

ggggcagcttcttcggccgccggctg	CRISPR spacer
tcggcggcttcttcggcggccggctc	Protospacer
  ***.*********** *******

64. spacer 1.8|1777441|26|NC_012587|CRT matches to NC_015146 (Pseudarthrobacter phenanthrenivorans Sphe3 plasmid pASPHE301, complete sequence) position: , mismatch: 5, identity: 0.808

ggggcagcttcttcggccgccggctg	CRISPR spacer
tcagcagcgtcttcggccgccggccg	Protospacer
  .***** ***************.*

65. spacer 1.8|1777441|26|NC_012587|CRT matches to NZ_CP005190 (Sphingobium sp. MI1205 plasmid pMI1, complete sequence) position: , mismatch: 5, identity: 0.808

ggggcagcttcttcggccgccggctg	CRISPR spacer
cgggcggcttcttcggccgccgcgag	Protospacer
 ****.****************   *

66. spacer 1.10|1777528|26|NC_012587|CRT matches to MN234196 (Gordonia phage CloverMinnie, complete genome) position: , mismatch: 5, identity: 0.808

ggagcgctctcctcggcggcgggctg	CRISPR spacer
tgagcgatctcctcggcggcggtcac	Protospacer
 ***** *************** *

67. spacer 1.12|1777615|26|NC_012587|CRT matches to MG099948 (Mycobacterium phage Philonius, complete genome) position: , mismatch: 5, identity: 0.808

ggagcgctctcctcggcggcgggttg	CRISPR spacer
cgagcgctcttctcggcggcgggcaa	Protospacer
 *********.************. .

68. spacer 1.12|1777615|26|NC_012587|CRT matches to MH926055 (Mycobacterium phage Chewbacca, complete genome) position: , mismatch: 5, identity: 0.808

ggagcgctctcctcggcggcgggttg	CRISPR spacer
cgagcgctcttctcggcggcgggcaa	Protospacer
 *********.************. .

69. spacer 1.12|1777615|26|NC_012587|CRT matches to MT723932 (Mycobacterium phage Schnauzer, complete genome) position: , mismatch: 5, identity: 0.808

ggagcgctctcctcggcggcgggttg	CRISPR spacer
cgagcgctcttctcggcggcgggcaa	Protospacer
 *********.************. .

70. spacer 1.12|1777615|26|NC_012587|CRT matches to KU935726 (Mycobacterium phage Xerxes, complete genome) position: , mismatch: 5, identity: 0.808

ggagcgctctcctcggcggcgggttg	CRISPR spacer
cgagcgctcttctcggcggcgggcaa	Protospacer
 *********.************. .

71. spacer 1.12|1777615|26|NC_012587|CRT matches to KU935730 (Mycobacterium phage Pipsqueaks, complete genome) position: , mismatch: 5, identity: 0.808

ggagcgctctcctcggcggcgggttg	CRISPR spacer
cgagcgctcttctcggcggcgggcaa	Protospacer
 *********.************. .

72. spacer 1.12|1777615|26|NC_012587|CRT matches to MH316570 (Mycobacterium phage Silvafighter, complete genome) position: , mismatch: 5, identity: 0.808

ggagcgctctcctcggcggcgggttg	CRISPR spacer
cgagcgctcttctcggcggcgggcaa	Protospacer
 *********.************. .

73. spacer 1.12|1777615|26|NC_012587|CRT matches to MK524518 (Mycobacterium phage Smurph, complete genome) position: , mismatch: 5, identity: 0.808

ggagcgctctcctcggcggcgggttg	CRISPR spacer
cgagcgctcttctcggcggcgggcaa	Protospacer
 *********.************. .

74. spacer 1.12|1777615|26|NC_012587|CRT matches to MK977707 (Mycobacterium phage LilSpotty, complete genome) position: , mismatch: 5, identity: 0.808

ggagcgctctcctcggcggcgggttg	CRISPR spacer
cgagcgctcttctcggcggcgggcaa	Protospacer
 *********.************. .

75. spacer 1.12|1777615|26|NC_012587|CRT matches to MK524515 (Mycobacterium phage Parmesanjohn, complete genome) position: , mismatch: 5, identity: 0.808

ggagcgctctcctcggcggcgggttg	CRISPR spacer
cgagcgctcttctcggcggcgggcaa	Protospacer
 *********.************. .

76. spacer 1.12|1777615|26|NC_012587|CRT matches to MH697585 (Mycobacterium phage Gex, complete genome) position: , mismatch: 5, identity: 0.808

ggagcgctctcctcggcggcgggttg	CRISPR spacer
cgagcgctcttctcggcggcgggcaa	Protospacer
 *********.************. .

77. spacer 1.12|1777615|26|NC_012587|CRT matches to KM588359 (Mycobacterium phage Carcharodon, complete genome) position: , mismatch: 5, identity: 0.808

ggagcgctctcctcggcggcgggttg	CRISPR spacer
cgagcgctcttctcggcggcgggcaa	Protospacer
 *********.************. .

78. spacer 1.12|1777615|26|NC_012587|CRT matches to MH697576 (Mycobacterium phage Aggie, complete genome) position: , mismatch: 5, identity: 0.808

ggagcgctctcctcggcggcgggttg	CRISPR spacer
cgagcgctcttctcggcggcgggcaa	Protospacer
 *********.************. .

79. spacer 1.12|1777615|26|NC_012587|CRT matches to MH697593 (Mycobacterium phage Tapioca, complete genome) position: , mismatch: 5, identity: 0.808

ggagcgctctcctcggcggcgggttg	CRISPR spacer
cgagcgctcttctcggcggcgggcaa	Protospacer
 *********.************. .

80. spacer 1.12|1777615|26|NC_012587|CRT matches to JN256079 (Mycobacterium phage Charlie, complete genome) position: , mismatch: 5, identity: 0.808

ggagcgctctcctcggcggcgggttg	CRISPR spacer
cgagcgctcttctcggcggcgggcaa	Protospacer
 *********.************. .

81. spacer 1.12|1777615|26|NC_012587|CRT matches to NZ_CP032342 (Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence) position: , mismatch: 5, identity: 0.808

ggagcgctctcctcggcggcgggttg	CRISPR spacer
tgatggctctcctcggcggcgggtca	Protospacer
 **  *******************..

82. spacer 1.12|1777615|26|NC_012587|CRT matches to NZ_CP033321 (Azospirillum brasilense strain Cd plasmid p3, complete sequence) position: , mismatch: 5, identity: 0.808

ggagcgctctcctcggcggcgggttg	CRISPR spacer
tgatggctctcctcggcggcgggtca	Protospacer
 **  *******************..

83. spacer 1.12|1777615|26|NC_012587|CRT matches to NZ_CP031754 (Rhodobacter sphaeroides strain EBL0706 plasmid p.C, complete sequence) position: , mismatch: 5, identity: 0.808

ggagcgctctcctcggcggcgggttg	CRISPR spacer
ggagagctctccccggcggcgggcgc	Protospacer
**** *******.**********.

84. spacer 1.12|1777615|26|NC_012587|CRT matches to NZ_CP033315 (Azospirillum brasilense strain Sp 7 plasmid p3, complete sequence) position: , mismatch: 5, identity: 0.808

ggagcgctctcctcggcggcgggttg	CRISPR spacer
tgatggctctcctcggcggcgggtca	Protospacer
 **  *******************..

85. spacer 1.2|1777171|26|NC_012587|CRT matches to NZ_CP011298 (Rhodococcus erythropolis strain BG43 plasmid pRSLBG43, complete sequence) position: , mismatch: 6, identity: 0.769

ggagcgccctcttcggcggcgggctg	CRISPR spacer
atgccgcccgcttcggcggcgggctt	Protospacer
. . ***** ***************

86. spacer 1.10|1777528|26|NC_012587|CRT matches to NZ_CP015065 (Mesorhizobium ciceri biovar biserrulae strain WSM1284 plasmid pMc1284, complete sequence) position: , mismatch: 6, identity: 0.769

ggagcgctctcctcggcggcgggctg	CRISPR spacer
cagtcgctctcctcggcggcgcgctt	Protospacer
 .. ***************** ***

87. spacer 1.10|1777528|26|NC_012587|CRT matches to NZ_CP015063 (Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence) position: , mismatch: 6, identity: 0.769

ggagcgctctcctcggcggcgggctg	CRISPR spacer
cagtcgctctcctcggcggcgcgctt	Protospacer
 .. ***************** ***

88. spacer 1.12|1777615|26|NC_012587|CRT matches to NC_003903 (Streptomyces coelicolor A3(2) plasmid SCP1, complete sequence) position: , mismatch: 6, identity: 0.769

ggagcgctctcctcggcggcgggttg	CRISPR spacer
tcctcgctctcctcggcggcggattc	Protospacer
    ******************.**

89. spacer 1.12|1777615|26|NC_012587|CRT matches to MN234196 (Gordonia phage CloverMinnie, complete genome) position: , mismatch: 6, identity: 0.769

ggagcgctctcctcggcggcgggttg	CRISPR spacer
tgagcgatctcctcggcggcggtcac	Protospacer
 ***** *************** .

90. spacer 1.12|1777615|26|NC_012587|CRT matches to NZ_CP044991 (Deinococcus sp. AJ005 plasmid p115k, complete sequence) position: , mismatch: 7, identity: 0.731

ggagcgctctcctcggcggcgggttg	CRISPR spacer
ccagcgctctcctcggcggcgatggc	Protospacer
  *******************.

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1413164 : 1427269

uncultured_Mediterranean_phage(81.82%)

tRNA

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_164924297.1\|1413164_1414028_+	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	3.7e-33	35.7
WP_012707925.1\|1414020_1414749_+	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	4.4e-40	45.2
WP_012707926.1\|1414821_1415931_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.1e-29	37.6
WP_012707927.1\|1416023_1416230_+	twin-arginine translocase TatA/TatE family subunit	A0A1B1IVR9	uncultured_Mediterranean_phage	2.8e-08	69.8
WP_012707928.1\|1416308_1416998_+	twin-arginine translocase subunit TatB	NA	NA	NA	NA
WP_012707929.1\|1416994_1417837_+	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	3.8e-43	40.6
WP_012707930.1\|1417876_1419160_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	2.1e-101	46.5
WP_012707931.1\|1419186_1419957_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	1.9e-25	33.6
WP_012707932.1\|1419953_1420607_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	4.0e-16	34.6
WP_012707933.1\|1420766_1421417_+	biotin biosynthesis protein BioC	NA	NA	NA	NA
WP_012707934.1\|1421581_1423117_+	LysM peptidoglycan-binding domain-containing protein	Q8SBN9	Clostridium_phage	2.3e-14	35.0
WP_012707935.1\|1423148_1424024_-	ATP-binding protein	NA	NA	NA	NA
WP_012707936.1\|1424321_1424654_+	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	7.5e-11	38.8
WP_012707937.1\|1424701_1427269_+	protein translocase subunit SecDF	A0A1B1IVP7	uncultured_Mediterranean_phage	8.0e-52	43.3

DBSCAN-SWA_2

1943645 : 1954420

Sulfitobacter_phage(60.0%)

tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012708414.1\|1943645_1944140_-	hypothetical protein	Q8W6L2	Sinorhizobium_phage	3.9e-32	47.5
WP_012708415.1\|1944142_1945354_-	hypothetical protein	A0A1Y0SVH2	Sinorhizobium_phage	2.7e-58	50.6
WP_012708417.1\|1946199_1947021_-	hypothetical protein	NA	NA	NA	NA
WP_012708418.1\|1947137_1948499_-\|tail	tail fiber domain-containing protein	M4NM77	Sulfitobacter_phage	2.6e-41	34.0
WP_012708419.1\|1948506_1948953_-	GNAT family N-acetyltransferase	X2CY06	Brucella_phage	2.6e-35	52.2
WP_012708420.1\|1948949_1950560_-	hypothetical protein	A0A088F6U1	Sulfitobacter_phage	5.7e-80	37.7
WP_012708421.1\|1950559_1951162_-	hypothetical protein	A0A088FAT4	Sulfitobacter_phage	2.8e-16	33.0
WP_012708422.1\|1951158_1951755_-	hypothetical protein	A0A088F6W5	Sulfitobacter_phage	4.9e-21	35.4
WP_012708423.1\|1951751_1952075_-	hypothetical protein	F8TUS1	EBPR_podovirus	3.7e-23	49.5
WP_165447156.1\|1952071_1952248_-	hypothetical protein	NA	NA	NA	NA
WP_012708424.1\|1952312_1953308_-	DUF5309 domain-containing protein	A0A088FAT7	Sulfitobacter_phage	7.5e-131	71.6
WP_012708425.1\|1953466_1954420_-	hypothetical protein	A0A088F6W8	Sulfitobacter_phage	1.3e-31	36.8

DBSCAN-SWA_3

2350623 : 2360311

Vibrio_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012708784.1\|2350623_2352678_-	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	1.1e-35	33.6
WP_012708786.1\|2353149_2354187_-	L-threonine 3-dehydrogenase	R9TPW0	Vibrio_phage	7.8e-14	64.7
WP_012708787.1\|2354265_2355453_-	glycine C-acetyltransferase	D2TEZ5	Emiliania_huxleyi_virus	2.0e-34	27.8
WP_164924413.1\|2355626_2357492_-	DNA helicase RecQ	A0A1V0SBK0	Catovirus	2.1e-73	35.0
WP_012708789.1\|2357727_2359719_-	DNA primase	A0A0K1LMQ9	Caulobacter_phage	9.2e-88	41.6
WP_012708790.1\|2359861_2360311_-	GatB/YqeY domain-containing protein	A0A292GL36	Xanthomonas_phage	9.8e-14	37.7

DBSCAN-SWA_4

2403878 : 2462158

Bacillus_virus(28.57%)

transposase,protease,holin,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_164924418.1\|2403878_2405081_+\|transposase	transposase	NA	NA	NA	NA
WP_012708834.1\|2405183_2406140_-	sigma-54-dependent Fis family transcriptional regulator	NA	NA	NA	NA
WP_012708835.1\|2406384_2407566_+	benzoate/H(+) symporter BenE family transporter	NA	NA	NA	NA
WP_164924419.1\|2407722_2408334_+	50S ribosomal protein L25/general stress protein Ctc	NA	NA	NA	NA
WP_012708837.1\|2408586_2410953_+	EAL domain-containing protein	G3MA91	Bacillus_virus	2.8e-19	37.3
WP_012708838.1\|2410977_2411712_+	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_012708839.1\|2411922_2412642_+\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA
WP_012708840.1\|2412827_2413040_-	hypothetical protein	NA	NA	NA	NA
WP_164924420.1\|2413102_2416141_-	calcium-binding protein	NA	NA	NA	NA
WP_164924658.1\|2416540_2417644_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_012708843.1\|2417699_2418011_-\|protease	ATP-dependent Clp protease adapter ClpS	NA	NA	NA	NA
WP_012708844.1\|2418187_2419291_+	redox-regulated ATPase YchF	NA	NA	NA	NA
WP_164924421.1\|2419317_2419770_+	MaoC family dehydratase N-terminal domain-containing protein	NA	NA	NA	NA
WP_012708846.1\|2419766_2420237_+	MaoC family dehydratase	NA	NA	NA	NA
WP_164924422.1\|2420271_2420814_-	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	7.6e-37	45.4
WP_012708848.1\|2421112_2421298_+	DUF1059 domain-containing protein	NA	NA	NA	NA
WP_012708849.1\|2421313_2422573_-\|tRNA	CCA tRNA nucleotidyltransferase	A0A1B0V011	Roseobacter_phage	1.8e-52	43.8
WP_012708850.1\|2422569_2423202_-	CoA pyrophosphatase	NA	NA	NA	NA
WP_012708851.1\|2423198_2423822_-	DUF1285 domain-containing protein	NA	NA	NA	NA
WP_012708852.1\|2424090_2425104_+	MoxR family ATPase	NA	NA	NA	NA
WP_012708853.1\|2425107_2426028_+	DUF58 domain-containing protein	NA	NA	NA	NA
WP_012708854.1\|2426024_2428838_+	DUF4159 domain-containing protein	NA	NA	NA	NA
WP_012708855.1\|2428845_2430915_+	membrane protein	NA	NA	NA	NA
WP_012708856.1\|2431222_2431777_-	N-acetyltransferase	NA	NA	NA	NA
WP_012708857.1\|2432031_2433009_+	glutathione S-transferase family protein	NA	NA	NA	NA
WP_164924423.1\|2433010_2433499_-	NUDIX domain-containing protein	NA	NA	NA	NA
WP_012708859.1\|2433613_2434522_+	metallophosphoesterase	NA	NA	NA	NA
WP_012708860.1\|2434680_2435226_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_012708861.1\|2435403_2435922_+	RNA polymerase sigma factor	NA	NA	NA	NA
WP_012708862.1\|2435925_2436753_+	anti-sigma factor	NA	NA	NA	NA
WP_012708863.1\|2436985_2438695_-	2-isopropylmalate synthase	NA	NA	NA	NA
WP_164924659.1\|2439197_2439785_-\|protease	ATP-dependent Clp protease proteolytic subunit	A0A223W000	Agrobacterium_phage	3.1e-28	37.3
WP_012708865.1\|2440015_2440594_+	HupE/UreJ family protein	NA	NA	NA	NA
WP_012708866.1\|2440637_2441102_-	NADPH-dependent 7-cyano-7-deazaguanine reductase QueF	E7DN65	Pneumococcus_phage	6.5e-29	48.9
WP_012708867.1\|2441130_2442048_-	cation transporter	NA	NA	NA	NA
WP_012708868.1\|2442227_2444417_-	anthranilate synthase	NA	NA	NA	NA
WP_178385068.1\|2444531_2444576_-	trpE operon leader peptide TrpLE	NA	NA	NA	NA
WP_164924424.1\|2444703_2446809_-	TonB-dependent receptor	NA	NA	NA	NA
WP_012708870.1\|2447067_2447883_+	extensin family protein	NA	NA	NA	NA
WP_164924425.1\|2448041_2448503_-	YiiD C-terminal domain-containing protein	NA	NA	NA	NA
WP_164924426.1\|2448656_2449166_+	DUF1993 family protein	NA	NA	NA	NA
WP_012708873.1\|2449187_2450867_-	formate--tetrahydrofolate ligase	NA	NA	NA	NA
WP_012708874.1\|2450953_2452174_-	DUF2333 family protein	NA	NA	NA	NA
WP_012708875.1\|2452177_2453467_-	hypothetical protein	NA	NA	NA	NA
WP_012708876.1\|2453486_2455400_-	ATP-binding protein	NA	NA	NA	NA
WP_012708877.1\|2455401_2456550_-	hypothetical protein	NA	NA	NA	NA
WP_012708878.1\|2456611_2457700_-	hypothetical protein	NA	NA	NA	NA
WP_012708880.1\|2458256_2458841_-	thymidine kinase	A0A0K2FHC3	Enterobacter_phage	1.0e-50	55.8
WP_012708881.1\|2459124_2460081_+\|holin	choline ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_012708882.1\|2460266_2461112_+\|holin	choline ABC transporter permease subunit	NA	NA	NA	NA
WP_012708883.1\|2461108_2462158_+\|holin	choline ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	9.6e-20	32.6

DBSCAN-SWA_5

3293722 : 3343587

Streptococcus_phage(28.57%)

transposase,protease,integrase

attL 3320201:3320217|attR 3352537:3352553

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012709619.1\|3293722_3294262_-\|protease	AprI/Inh family metalloprotease inhibitor	NA	NA	NA	NA
WP_012709620.1\|3294447_3295044_-	peptide-methionine (S)-S-oxide reductase MsrA	NA	NA	NA	NA
WP_012709621.1\|3295461_3296241_-	succinate dehydrogenase iron-sulfur subunit	NA	NA	NA	NA
WP_012709622.1\|3296259_3298101_-	succinate dehydrogenase flavoprotein subunit	NA	NA	NA	NA
WP_012709623.1\|3298108_3298489_-	succinate dehydrogenase, hydrophobic membrane anchor protein	NA	NA	NA	NA
WP_012709624.1\|3298501_3298894_-	succinate dehydrogenase, cytochrome b556 subunit	NA	NA	NA	NA
WP_012709625.1\|3299198_3299846_+	hypothetical protein	NA	NA	NA	NA
WP_012709627.1\|3300194_3301604_+	3-isopropylmalate dehydratase large subunit	NA	NA	NA	NA
WP_012709628.1\|3301815_3302358_+	histidine phosphatase family protein	NA	NA	NA	NA
WP_012709629.1\|3302373_3302922_-	hypothetical protein	NA	NA	NA	NA
WP_012709630.1\|3303065_3303749_+	response regulator transcription factor	W8CYM9	Bacillus_phage	3.9e-22	30.4
WP_012709631.1\|3303824_3304280_+	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_012707828.1\|3304717_3305968_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_012709632.1\|3306032_3306839_-	exodeoxyribonuclease III	NA	NA	NA	NA
WP_193377889.1\|3307002_3307680_-	outer membrane lipoprotein carrier protein LolA	NA	NA	NA	NA
WP_164924511.1\|3307780_3310426_-	DNA translocase FtsK 4TM domain-containing protein	A0A218M9A2	Mycobacterium_phage	9.7e-77	44.1
WP_012709635.1\|3310766_3312194_-	ammonium transporter	H8ZJB2	Ostreococcus_tauri_virus	6.7e-32	31.6
WP_012709636.1\|3312221_3312560_-	P-II family nitrogen regulator	NA	NA	NA	NA
WP_012709637.1\|3312810_3313695_-	acyl-CoA thioesterase II	NA	NA	NA	NA
WP_012709638.1\|3313783_3314998_+	ubiquinone biosynthesis hydroxylase	NA	NA	NA	NA
WP_012709639.1\|3315406_3316657_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_012709640.1\|3316728_3316935_-	DUF1737 domain-containing protein	NA	NA	NA	NA
WP_164924512.1\|3316931_3317837_-	CoA ester lyase	NA	NA	NA	NA
WP_164924513.1\|3317939_3318182_+	hypothetical protein	NA	NA	NA	NA
WP_012709642.1\|3318281_3318887_+	3-isopropylmalate dehydratase small subunit	NA	NA	NA	NA
WP_012709643.1\|3318898_3319279_+	RidA family protein	NA	NA	NA	NA
WP_012709644.1\|3319284_3320142_+	MoxR family ATPase	NA	NA	NA	NA
3320201:3320217	attL	NA	NA	NA	NA
WP_164924685.1\|3320310_3321603_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_012709646.1\|3322028_3322952_+	homoserine O-succinyltransferase	NA	NA	NA	NA
WP_012709647.1\|3322951_3324136_+	VWA domain-containing protein	NA	NA	NA	NA
WP_012709648.1\|3324378_3325395_+	galactose mutarotase	NA	NA	NA	NA
WP_012709649.1\|3325446_3328275_-	trypsin-like peptidase domain-containing protein	NA	NA	NA	NA
WP_012709651.1\|3328865_3329237_+	50S ribosomal protein L21	NA	NA	NA	NA
WP_012709652.1\|3329269_3329539_+	50S ribosomal protein L27	NA	NA	NA	NA
WP_164924514.1\|3329670_3330303_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_012709654.1\|3330299_3330884_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_012709655.1\|3331062_3332073_+	GTPase ObgE	NA	NA	NA	NA
WP_012709656.1\|3332074_3333256_+	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	3.0e-54	38.0
WP_164924515.1\|3333248_3334532_+	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	2.3e-92	46.7
WP_012709658.1\|3334546_3335155_+	nicotinate-nucleotide adenylyltransferase	NA	NA	NA	NA
WP_012709659.1\|3335240_3335687_+	ribosome silencing factor	NA	NA	NA	NA
WP_012709660.1\|3335849_3336332_+	23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH	NA	NA	NA	NA
WP_164924516.1\|3336565_3337999_+	peptidoglycan DD-metalloendopeptidase family protein	NA	NA	NA	NA
WP_012709662.1\|3337988_3339311_+	S41 family peptidase	A0A0R6PIZ1	Moraxella_phage	2.4e-28	30.5
WP_012709663.1\|3339499_3340705_+	divergent polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_012709664.1\|3340757_3341285_+	RNA pyrophosphohydrolase	NA	NA	NA	NA
WP_012708196.1\|3341535_3342396_+\|integrase	tyrosine-type recombinase/integrase	S5W9T9	Leptospira_phage	3.6e-33	34.8
WP_015886711.1\|3342408_3343587_+\|transposase	IS91 family transposase	NA	NA	NA	NA
3352537:3352553	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NC_000914

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

160277 : 271800

Acidithiobacillus_phage(20.83%)

transposase,integrase

attL 212713:212772|attR 269949:272508

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_164924723.1\|160277_161801_+\|transposase	IS21 family transposase	K4I413	Acidithiobacillus_phage	3.1e-120	44.7
WP_010875170.1\|161812_162559_+	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	1.3e-50	45.4
WP_164924724.1\|162578_162887_+	hypothetical protein	NA	NA	NA	NA
WP_010875174.1\|166589_167087_-	UPF0262 family protein	NA	NA	NA	NA
WP_164924726.1\|167502_168912_-	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_010875176.1\|169065_170469_-	aspartate aminotransferase family protein	A0A1V0SKB7	Klosneuvirus	6.6e-16	27.0
WP_010875177.1\|170937_172323_-	CapA family protein	NA	NA	NA	NA
WP_010875178.1\|172358_173420_-	dipeptide ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.6e-22	33.8
WP_010875179.1\|173416_174424_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	6.6e-10	23.2
WP_010875180.1\|174425_175301_-	ABC transporter permease	NA	NA	NA	NA
WP_010875181.1\|175303_176245_-	ABC transporter permease	NA	NA	NA	NA
WP_010875182.1\|176249_177845_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_010875183.1\|177917_178442_-	hypothetical protein	NA	NA	NA	NA
WP_010875184.1\|178465_179644_-	M24 family metallopeptidase	NA	NA	NA	NA
WP_010875185.1\|179806_180979_-	aminopeptidase P family protein	NA	NA	NA	NA
WP_010875186.1\|181113_182109_-	ectoine utilization protein EutC	A2RQC3	Archaeal_BJ1_virus	2.8e-05	40.3
WP_010875187.1\|182108_183107_-	hydroxyectoine utilization dehydratase EutB	NA	NA	NA	NA
WP_010875188.1\|183143_184352_-	amidohydrolase	NA	NA	NA	NA
WP_010875189.1\|184801_185575_-	ectoine/hydroxyectoine ABC transporter ATP-binding protein EhuA	G9BWD6	Planktothrix_phage	1.4e-28	36.7
WP_010875190.1\|185571_186267_-	ectoine/hydroxyectoine ABC transporter permease subunit EhuD	NA	NA	NA	NA
WP_164924728.1\|186269_186941_-	ectoine/hydroxyectoine ABC transporter permease subunit EhuC	NA	NA	NA	NA
WP_010875192.1\|187037_187940_-	ectoine/hydroxyectoine ABC transporter substrate-binding protein EhuB	NA	NA	NA	NA
WP_010875193.1\|188405_188915_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_164924730.1\|189197_189845_-	ectoine/hydroxyectoine ABC transporter substrate-binding protein EhuB	NA	NA	NA	NA
WP_010875060.1\|190026_191577_+\|transposase	IS21-like element ISRsp2 family transposase	K4I413	Acidithiobacillus_phage	1.2e-114	46.3
WP_012708757.1\|191588_192365_+	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	9.5e-57	46.3
WP_164924731.1\|192411_192720_-	hypothetical protein	NA	NA	NA	NA
WP_010875194.1\|193371_195489_+	S9 family peptidase	F2Y2Z7	Organic_Lake_phycodnavirus	3.0e-12	28.3
WP_164923967.1\|195813_196574_-\|transposase	IS5-like element ISNGR9 family transposase	A0A0N9SHJ4	Paenibacillus_phage	4.8e-21	46.9
WP_010875196.1\|196778_197162_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_010875198.1\|197926_198307_+	RidA family protein	NA	NA	NA	NA
WP_010875199.1\|198419_199895_+	NAD-dependent succinate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_010875200.1\|199855_202126_-	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	7.0e-07	31.6
WP_164924732.1\|204199_204364_-\|transposase	transposase	NA	NA	NA	NA
WP_193377914.1\|204539_204959_+\|transposase	transposase	NA	NA	NA	NA
WP_010875201.1\|205206_206592_-	CapA family protein	NA	NA	NA	NA
WP_010875202.1\|207278_208289_-	ATP-grasp domain-containing protein	NA	NA	NA	NA
WP_164923822.1\|209786_211271_+\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_010875204.1\|211267_212164_+	ATP-binding protein	A0A059NT77	Lactococcus_phage	8.8e-30	34.3
212713:212772	attL	NA	NA	NA	NA
WP_010875205.1\|212796_213375_+	winged helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_076611292.1\|213529_214564_+\|transposase	IS110-like element ISRsp4 family transposase	NA	NA	NA	NA
WP_010875208.1\|215927_217784_-	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_010875209.1\|218301_219519_+	MFS transporter	NA	NA	NA	NA
WP_010875212.1\|222209_223400_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_164924733.1\|225269_225404_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_193377915.1\|227071_227821_+	hypothetical protein	NA	NA	NA	NA
WP_165447180.1\|227945_229202_+	ATP-grasp domain-containing protein	NA	NA	NA	NA
WP_164924734.1\|229423_229810_+\|transposase	transposase	NA	NA	NA	NA
WP_164924735.1\|230062_231301_+\|integrase	tyrosine-type recombinase/integrase	A0A1B1P7C7	Bacillus_phage	9.3e-06	30.3
WP_010875216.1\|231297_232230_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_010875217.1\|232226_233072_+\|integrase	site-specific integrase	S5M9V8	Brevibacillus_phage	5.4e-05	26.8
WP_010875218.1\|233128_234127_-\|integrase	site-specific integrase	A0A1P8DJ76	Virus_Rctr85	9.5e-09	33.7
WP_010875219.1\|234123_235068_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_010875220.1\|235064_236294_-\|integrase	site-specific integrase	A0A1B1IQT7	uncultured_Mediterranean_phage	8.1e-10	26.5
WP_164924736.1\|236460_236661_+	hypothetical protein	NA	NA	NA	NA
WP_164924737.1\|236874_237753_+\|integrase	tyrosine-type recombinase/integrase	S5W9T9	Leptospira_phage	5.9e-31	31.6
WP_010875222.1\|237760_238957_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_164924738.1\|239342_239564_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_010875223.1\|239640_241260_+\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	1.7e-76	36.1
WP_010875224.1\|241822_242803_+	LuxR family transcriptional regulator	NA	NA	NA	NA
WP_164924739.1\|243321_244596_+	diaminobutyrate--2-oxoglutarate transaminase	A0A1V0SKB7	Klosneuvirus	2.8e-21	23.7
WP_010875226.1\|244617_246882_+	S9 family peptidase	A0A1V0SHT0	Klosneuvirus	4.0e-23	21.6
WP_164924740.1\|247810_248887_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_010875228.1\|249146_249881_+	hypothetical protein	NA	NA	NA	NA
WP_164924741.1\|251416_251593_+	hypothetical protein	NA	NA	NA	NA
WP_010875229.1\|251810_253562_+	ThiF family adenylyltransferase	NA	NA	NA	NA
WP_010875230.1\|253549_254044_+	Mov34/MPN/PAD-1 family protein	NA	NA	NA	NA
WP_164924742.1\|256402_256840_+	trehalose-6-phosphate synthase	NA	NA	NA	NA
WP_010875231.1\|256832_258035_-\|transposase	IS256-like element ISNGR8 family transposase	A0A218MNI5	uncultured_virus	5.1e-41	42.8
WP_164924769.1\|258078_259110_+	trehalose-6-phosphate synthase	NA	NA	NA	NA
WP_010875232.1\|259574_260591_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_010875233.1\|263119_263938_-	DUF3800 domain-containing protein	NA	NA	NA	NA
WP_010875234.1\|264288_265026_-	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	4.5e-56	46.1
WP_010875067.1\|265858_266128_+	Y4bD/Y4pK family protein	NA	NA	NA	NA
WP_010875070.1\|267043_269128_+	recombinase family protein	A0A0H3UZF2	Geobacillus_virus	3.7e-07	20.4
WP_010875205.1\|270032_270611_+	winged helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_076611292.1\|270765_271800_+\|transposase	IS110-like element ISRsp4 family transposase	NA	NA	NA	NA
269949:272508	attR	NA	NA	NA	NA

DBSCAN-SWA_2

373088 : 427667

Vibrio_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010875060.1\|373088_374639_+\|transposase	IS21-like element ISRsp2 family transposase	K4I413	Acidithiobacillus_phage	1.2e-114	46.3
WP_012708757.1\|374650_375427_+	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	9.5e-57	46.3
WP_164924771.1\|375536_375992_+	RES domain-containing protein	NA	NA	NA	NA
WP_010875313.1\|376353_377658_+	hypothetical protein	NA	NA	NA	NA
WP_010875314.1\|377641_378685_+	caspase family protein	NA	NA	NA	NA
WP_010875315.1\|378697_380347_+	hypothetical protein	NA	NA	NA	NA
WP_010875316.1\|381008_381434_-	hypothetical protein	NA	NA	NA	NA
WP_010875317.1\|382211_383180_+	hypothetical protein	NA	NA	NA	NA
WP_010875318.1\|383209_384220_+	DUF1353 domain-containing protein	A0A2I7QRW7	Vibrio_phage	5.3e-07	40.3
WP_010875319.1\|384539_385781_-	response regulator	NA	NA	NA	NA
WP_010875320.1\|385781_386237_-	response regulator transcription factor	NA	NA	NA	NA
WP_010875321.1\|386248_389368_-	hypothetical protein	NA	NA	NA	NA
WP_164924755.1\|389902_390691_+	hypothetical protein	NA	NA	NA	NA
WP_010875322.1\|390617_391583_+\|transposase	transposase	NA	NA	NA	NA
WP_010875325.1\|394377_394800_-	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_010875326.1\|394796_395054_-	plasmid stability protein stbC	NA	NA	NA	NA
WP_165447176.1\|395372_395669_+	DUF2604 domain-containing protein	NA	NA	NA	NA
WP_010875328.1\|395661_396279_+	hypothetical protein	NA	NA	NA	NA
WP_010875329.1\|396275_396764_+	Mov34/MPN/PAD-1 family protein	NA	NA	NA	NA
WP_010875330.1\|396766_398326_+	E2 ligase fold family C protein	NA	NA	NA	NA
WP_164924756.1\|399043_399301_+	hypothetical protein	A0A2I7REY7	Vibrio_phage	2.2e-10	49.2
WP_010875331.1\|399638_400460_-	YecA family protein	NA	NA	NA	NA
WP_010875332.1\|400456_401992_-\|transposase	IS66-like element IS693 family transposase	A0A0P0ZEB3	Stx2-converting_phage	1.2e-74	35.4
WP_010875333.1\|402040_402394_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_010875334.1\|402390_402849_-\|transposase	transposase	NA	NA	NA	NA
WP_193377912.1\|402927_403185_-	hypothetical protein	NA	NA	NA	NA
WP_164923822.1\|403557_405042_+\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_010875204.1\|405038_405935_+	ATP-binding protein	A0A059NT77	Lactococcus_phage	8.8e-30	34.3
WP_010875335.1\|408161_408788_+	hypothetical protein	NA	NA	NA	NA
WP_010875336.1\|408762_410061_+	hypothetical protein	NA	NA	NA	NA
WP_010875337.1\|410106_411405_+	catalase	NA	NA	NA	NA
WP_010875338.1\|411458_412157_+	hypothetical protein	NA	NA	NA	NA
WP_010875339.1\|412209_414000_+	hypothetical protein	NA	NA	NA	NA
WP_010875340.1\|414048_416160_+	patatin-like phospholipase family protein	NA	NA	NA	NA
WP_010875341.1\|416332_417052_-	DUF1353 domain-containing protein	A0A2I7QXN9	Vibrio_phage	3.2e-06	35.6
WP_010875342.1\|417968_418886_+	L-histidine N(alpha)-methyltransferase	NA	NA	NA	NA
WP_010875343.1\|420545_422534_+	SidA/IucD/PvdA family monooxygenase	NA	NA	NA	NA
WP_010875344.1\|422475_423168_+	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_010875345.1\|423380_423866_+	hypothetical protein	NA	NA	NA	NA
WP_010875346.1\|425162_425387_+	hypothetical protein	NA	NA	NA	NA
WP_010875347.1\|425421_426006_-	plasmid pRiA4b ORF-3 family protein	A0A2H4PDG5	Mycobacterium_phage	8.0e-16	39.3
WP_010875348.1\|426008_427667_-\|transposase	IS66-like element ISRsp1 family transposase	A0A0P0ZEB3	Stx2-converting_phage	1.2e-88	40.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NC_012586

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

82919 : 139285

Acidithiobacillus_phage(18.18%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012706165.1\|82919_83684_+\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_012706166.1\|83674_84502_+\|protease	serine protease	A0A1V0SCZ1	Indivirus	1.1e-10	26.3
WP_012706167.1\|84652_85711_+\|protease	ATP-dependent Clp protease ATP-binding subunit	K4FB40	Cronobacter_phage	1.7e-16	52.7
WP_012708757.1\|85757_86534_-	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	9.5e-57	46.3
WP_010875060.1\|86545_88096_-\|transposase	IS21-like element ISRsp2 family transposase	K4I413	Acidithiobacillus_phage	1.2e-114	46.3
WP_012706170.1\|90669_91413_-	ETC complex I subunit	NA	NA	NA	NA
WP_012706171.1\|91904_92423_-	Hsp20 family protein	H6WG27	Cyanophage	3.1e-19	42.1
WP_012706174.1\|93780_94194_-	heme-binding protein	NA	NA	NA	NA
WP_012706175.1\|94521_95541_+	substrate-binding domain-containing protein	NA	NA	NA	NA
WP_164923778.1\|95706_97209_+	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	7.6e-18	28.6
WP_164924027.1\|97407_98379_+	ribose ABC transporter permease	NA	NA	NA	NA
WP_012706178.1\|98416_99475_+	ABC transporter permease	NA	NA	NA	NA
WP_012706179.1\|99511_101203_+	GMC family oxidoreductase	NA	NA	NA	NA
WP_012706180.1\|101204_101900_+	gluconate 2-dehydrogenase subunit 3 family protein	NA	NA	NA	NA
WP_164923779.1\|102010_102565_+	gluconate 2-dehydrogenase subunit 3 family protein	NA	NA	NA	NA
WP_164923780.1\|102497_104249_+	GMC family oxidoreductase N-terminal domain-containing protein	NA	NA	NA	NA
WP_012706183.1\|104278_105001_+	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_012706184.1\|105041_106007_+	sugar kinase	NA	NA	NA	NA
WP_012706185.1\|106003_107287_+	D-tagatose-bisphosphate aldolase, class II, non-catalytic subunit	NA	NA	NA	NA
WP_012706186.1\|107548_108634_+	hydrolase	NA	NA	NA	NA
WP_012706187.1\|108743_109787_+	NAD(P)-dependent alcohol dehydrogenase	A0A2K9L339	Tupanvirus	3.6e-83	46.2
WP_164923781.1\|109988_110933_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_164923782.1\|111205_111454_-\|transposase	transposase	NA	NA	NA	NA
WP_164923783.1\|111997_113029_-	SIS domain-containing protein	NA	NA	NA	NA
WP_012706191.1\|113079_113841_-	sugar ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	8.8e-15	28.1
WP_012706192.1\|113851_115048_-	alanine racemase	NA	NA	NA	NA
WP_012706194.1\|115522_117187_+	amidohydrolase family protein	NA	NA	NA	NA
WP_012706195.1\|117289_118366_+	TMAO reductase system periplasmic protein TorT	NA	NA	NA	NA
WP_012706196.1\|118369_119920_+	sugar ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.4e-11	29.0
WP_012706197.1\|119916_120954_+	ABC transporter permease	NA	NA	NA	NA
WP_012706198.1\|121053_122178_+	FAD-dependent monooxygenase	NA	NA	NA	NA
WP_164923784.1\|122275_123277_+	AsnC family transcriptional regulator	NA	NA	NA	NA
WP_012706200.1\|123958_126235_-	xanthine dehydrogenase family protein molybdopterin-binding subunit	NA	NA	NA	NA
WP_012706207.1\|129407_130121_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_012706208.1\|130353_131259_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_012706209.1\|131547_133332_+	adenylate/guanylate cyclase domain-containing protein	NA	NA	NA	NA
WP_164924028.1\|133315_133645_+	hypothetical protein	A0A076GD42	Sinorhizobium_phage	1.0e-36	71.6
WP_012706213.1\|134348_136811_-	EAL domain-containing protein	G3MA91	Bacillus_virus	4.7e-25	35.9
WP_012706215.1\|137228_137831_+	hypothetical protein	NA	NA	NA	NA
WP_012706216.1\|137987_138140_-	hypothetical protein	NA	NA	NA	NA
WP_012706218.1\|138808_139285_+\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_2

853092 : 902791

Leptospira_phage(40.0%)

integrase,protease,transposase

attL 872387:872402|attR 901840:901855

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012706579.1\|853092_854475_+\|transposase	IS1380-like element ISRsp7 family transposase	NA	NA	NA	NA
WP_015886978.1\|854880_855069_-	DUF1059 domain-containing protein	NA	NA	NA	NA
WP_015886711.1\|856661_857840_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_012708196.1\|857852_858713_-\|integrase	tyrosine-type recombinase/integrase	S5W9T9	Leptospira_phage	3.6e-33	34.8
WP_015886980.1\|858889_860158_-	beta-ketoacyl-ACP synthase II	NA	NA	NA	NA
WP_015886981.1\|860234_860822_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_164923863.1\|860920_862033_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_015886983.1\|862032_865146_+	efflux RND transporter permease subunit	NA	NA	NA	NA
WP_015886985.1\|866099_866912_+	oxidoreductase	NA	NA	NA	NA
WP_164923864.1\|867131_867365_-	hypothetical protein	NA	NA	NA	NA
WP_164923865.1\|869628_869838_-	hypothetical protein	NA	NA	NA	NA
WP_165447128.1\|870473_871550_+	diguanylate cyclase	NA	NA	NA	NA
WP_164924066.1\|871751_873593_+	EAL domain-containing protein	G3MA91	Bacillus_virus	2.8e-14	34.2
872387:872402	attL	NA	NA	NA	NA
WP_015886994.1\|873880_874189_+	PilZ domain-containing protein	NA	NA	NA	NA
WP_164924067.1\|874205_874346_+	CxxxxCH/CxxCH domain-containing protein	NA	NA	NA	NA
WP_164923867.1\|874932_875748_-	type IV toxin-antitoxin system AbiEi family antitoxin domain-containing protein	NA	NA	NA	NA
WP_193377872.1\|876032_876707_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_015887001.1\|876826_877846_-	TRAP transporter substrate-binding protein	NA	NA	NA	NA
WP_015887002.1\|877868_879152_-	TRAP transporter large permease subunit	NA	NA	NA	NA
WP_015887003.1\|879148_879679_-	TRAP transporter small permease	NA	NA	NA	NA
WP_015887004.1\|879675_881094_-	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_015887005.1\|881218_882112_+	dihydrodipicolinate synthase family protein	NA	NA	NA	NA
WP_015887006.1\|882124_882718_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_015887007.1\|882835_884059_+	MFS transporter	NA	NA	NA	NA
WP_015887008.1\|884216_884645_+	OsmC family protein	NA	NA	NA	NA
WP_015887009.1\|884965_886447_+	Do family serine endopeptidase	A0A1B1IT49	uncultured_Mediterranean_phage	6.3e-25	29.4
WP_015887010.1\|886483_886666_-	hypothetical protein	NA	NA	NA	NA
WP_015887011.1\|887020_887611_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_015887012.1\|887603_888833_+	type II toxin-antitoxin system HipA family toxin	NA	NA	NA	NA
WP_015887013.1\|889208_889490_+	type II toxin-antitoxin system RelB/DinJ family antitoxin	NA	NA	NA	NA
WP_015887014.1\|889479_889815_+	type II toxin-antitoxin system YafQ family toxin	NA	NA	NA	NA
WP_018237856.1\|890338_890521_-	hypothetical protein	NA	NA	NA	NA
WP_015887017.1\|890991_891246_-	type II toxin-antitoxin system ParD family antitoxin	NA	NA	NA	NA
WP_015887018.1\|891397_892192_-\|protease	ATP-dependent Clp protease proteolytic subunit	NA	NA	NA	NA
WP_015887019.1\|892178_893486_-	hypothetical protein	NA	NA	NA	NA
WP_015887020.1\|893588_893852_-	hypothetical protein	NA	NA	NA	NA
WP_015887021.1\|893844_895407_-	S8 family serine peptidase	A0A217EQY2	Bacillus_phage	7.3e-24	33.7
WP_164924068.1\|896846_897155_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_015887024.1\|897147_898404_+	HipA domain-containing protein	NA	NA	NA	NA
WP_164923869.1\|899756_899963_-	hypothetical protein	NA	NA	NA	NA
WP_012708196.1\|900739_901600_+\|integrase	tyrosine-type recombinase/integrase	S5W9T9	Leptospira_phage	3.6e-33	34.8
WP_015886711.1\|901612_902791_+\|transposase	IS91 family transposase	NA	NA	NA	NA
901840:901855	attR	NA	NA	NA	NA

DBSCAN-SWA_3

924389 : 988569

Acidithiobacillus_phage(28.57%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010875060.1\|924389_925940_-\|transposase	IS21-like element ISRsp2 family transposase	K4I413	Acidithiobacillus_phage	1.2e-114	46.3
WP_164923873.1\|927331_928411_-	capsular polysaccharide biosynthesis protein	NA	NA	NA	NA
WP_015887044.1\|928604_931625_-	hypothetical protein	NA	NA	NA	NA
WP_164923874.1\|931833_932601_-	hypothetical protein	NA	NA	NA	NA
WP_164923875.1\|932597_933641_-	GSCFA domain-containing protein	NA	NA	NA	NA
WP_015887047.1\|934128_934512_-	GNAT family N-acetyltransferase	B4UTR3	Rhizobium_phage	1.2e-49	74.0
WP_164924069.1\|934717_935302_+	methyltransferase domain-containing protein	B4UTR6	Rhizobium_phage	9.1e-44	69.0
WP_015887049.1\|935871_936648_+	ABC transporter permease	NA	NA	NA	NA
WP_015887050.1\|937008_938007_+	UDP-N-acetylglucosamine 4,6-dehydratase (inverting)	A0A1V0SAI8	Catovirus	5.9e-43	37.5
WP_015887051.1\|938010_939171_+	UDP-4-amino-4, 6-dideoxy-N-acetyl-beta-L-altrosamine transaminase	A0A2K9L470	Tupanvirus	5.1e-30	31.8
WP_015887052.1\|939167_939872_+	pseudaminic acid cytidylyltransferase	A0A1B1IVD3	uncultured_Mediterranean_phage	3.2e-11	29.9
WP_015887053.1\|939846_940980_+	UDP-2,4-diacetamido-2,4, 6-trideoxy-beta-L-altropyranose hydrolase	NA	NA	NA	NA
WP_015887054.1\|941146_942199_+	pseudaminic acid synthase	NA	NA	NA	NA
WP_015887055.1\|942318_943650_-	RkpR, polysaccharide export protein	NA	NA	NA	NA
WP_015887056.1\|943650_944310_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	4.5e-07	26.4
WP_015887057.1\|944306_945077_-	ABC transporter permease	NA	NA	NA	NA
WP_015887060.1\|946481_947396_-	HEPN domain-containing protein	NA	NA	NA	NA
WP_015887063.1\|948025_948457_+	DUF2384 domain-containing protein	NA	NA	NA	NA
WP_015887064.1\|948453_948936_+	RES family NAD+ phosphorylase	NA	NA	NA	NA
WP_164924070.1\|949738_951910_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_015887066.1\|951928_952438_-	hypothetical protein	NA	NA	NA	NA
WP_164923876.1\|952451_953045_-	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_193377873.1\|953271_953532_+	adenylate/guanylate cyclase domain-containing protein	NA	NA	NA	NA
WP_015887068.1\|953723_954221_+	hypothetical protein	NA	NA	NA	NA
WP_015887069.1\|954355_954649_+	hypothetical protein	NA	NA	NA	NA
WP_193377874.1\|955128_955602_+	hypothetical protein	NA	NA	NA	NA
WP_015887073.1\|956647_956809_-	hypothetical protein	NA	NA	NA	NA
WP_015887076.1\|958584_958860_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_015887077.1\|958856_959120_-	ribbon-helix-helix protein, CopG family	NA	NA	NA	NA
WP_164923877.1\|959571_959859_+\|transposase	transposase	NA	NA	NA	NA
WP_015887079.1\|959855_960203_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_015887080.1\|960281_961934_+\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	6.0e-109	43.8
WP_015887081.1\|961936_962521_+	plasmid pRiA4b ORF-3 family protein	NA	NA	NA	NA
WP_015887083.1\|963006_963318_+	hypothetical protein	NA	NA	NA	NA
WP_015887084.1\|963427_963706_-	BrnA antitoxin family protein	NA	NA	NA	NA
WP_164923878.1\|963689_963992_-	BrnT family toxin	NA	NA	NA	NA
WP_164923879.1\|964715_964919_-	type II toxin-antitoxin system PemK/MazF family toxin	NA	NA	NA	NA
WP_015887087.1\|965218_965464_+	type II toxin-antitoxin system VapB family antitoxin	NA	NA	NA	NA
WP_015887088.1\|965463_965901_+	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_164924072.1\|966999_967263_-	hypothetical protein	NA	NA	NA	NA
WP_164924073.1\|967353_967569_-	transcriptional regulator	NA	NA	NA	NA
WP_015887093.1\|968130_968445_+	succinoglycan biosynthesis protein exoi	NA	NA	NA	NA
WP_164923880.1\|968581_969574_+	adenosine kinase	NA	NA	NA	NA
WP_010875070.1\|971121_973206_-	recombinase family protein	NA	NA	NA	NA
WP_010875067.1\|974121_974391_-	Y4bD/Y4pK family protein	NA	NA	NA	NA
WP_015887098.1\|975224_975962_+	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	3.7e-58	47.9
WP_164923881.1\|976103_977164_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_015887101.1\|977470_977827_-	type II toxin-antitoxin system HicB family antitoxin	R4JJS9	Burkholderia_phage	2.0e-25	48.2
WP_015887102.1\|977823_978078_-	type II toxin-antitoxin system HicA family toxin	R4JMD3	Burkholderia_phage	2.2e-15	48.8
WP_164923882.1\|978718_979099_+	helix-turn-helix domain-containing protein	A0A223W054	Agrobacterium_phage	9.8e-15	43.5
WP_015887105.1\|979305_980163_-	Hint domain-containing protein	NA	NA	NA	NA
WP_015887109.1\|981970_982246_+	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_015887110.1\|982300_982687_-	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_015887111.1\|982686_982941_-	type II toxin-antitoxin system VapB family antitoxin	NA	NA	NA	NA
WP_015887113.1\|983450_983726_+	type II toxin-antitoxin system ParD family antitoxin	NA	NA	NA	NA
WP_193377875.1\|983706_984057_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_015887115.1\|984279_985638_+\|transposase	IS5-like element ISRsp18 family transposase	K4ICS3	Acidithiobacillus_phage	9.2e-47	44.0
WP_015887115.1\|987210_988569_-\|transposase	IS5-like element ISRsp18 family transposase	K4ICS3	Acidithiobacillus_phage	9.2e-47	44.0

DBSCAN-SWA_4

1338307 : 1402922

Leptospira_phage(15.38%)

integrase,transposase

attL 1337950:1338009|attR 1355808:1357356

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1337950:1338009	attL	NA	NA	NA	NA
WP_015886711.1\|1338307_1339486_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_012708196.1\|1339498_1340359_-\|integrase	tyrosine-type recombinase/integrase	S5W9T9	Leptospira_phage	3.6e-33	34.8
WP_015887442.1\|1340556_1341573_-	acyltransferase	NA	NA	NA	NA
WP_015887443.1\|1341672_1343055_-	glutamate-1-semialdehyde 2,1-aminomutase	NA	NA	NA	NA
WP_015887446.1\|1344655_1345687_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_015887447.1\|1345714_1346680_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_164923931.1\|1346712_1348272_-	oligosaccharide flippase family protein	NA	NA	NA	NA
WP_164923933.1\|1348423_1349899_+	DUF4038 domain-containing protein	NA	NA	NA	NA
WP_015887450.1\|1349895_1351197_+	polysaccharide pyruvyl transferase family protein	NA	NA	NA	NA
WP_015887451.1\|1351758_1353198_+	DUF4214 domain-containing protein	NA	NA	NA	NA
WP_012708196.1\|1353457_1354318_+\|integrase	tyrosine-type recombinase/integrase	S5W9T9	Leptospira_phage	3.6e-33	34.8
WP_015886711.1\|1354330_1355509_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_015887452.1\|1355909_1356644_+\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	1.9e-22	39.7
WP_015887453.1\|1356657_1358541_-	molecular chaperone HtpG	A0A1B1ISV4	uncultured_Mediterranean_phage	2.3e-104	35.5
1355808:1357356	attR	NA	NA	NA	NA
WP_015887454.1\|1358931_1361133_+	DUF3141 domain-containing protein	NA	NA	NA	NA
WP_015887455.1\|1361157_1362114_+	phosphate acetyltransferase	NA	NA	NA	NA
WP_015887456.1\|1362118_1363303_+	acetate kinase	NA	NA	NA	NA
WP_015887457.1\|1363321_1364107_+	enoyl-ACP reductase FabI	NA	NA	NA	NA
WP_015887458.1\|1364135_1365611_-	NAD-dependent succinate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_015887459.1\|1365738_1367007_-	4-aminobutyrate--2-oxoglutarate transaminase	NA	NA	NA	NA
WP_015887460.1\|1367232_1368060_+	MerR family transcriptional regulator	A0A7Q0	Microcystis_virus	1.1e-05	32.1
WP_015887461.1\|1368438_1369608_+	acyltransferase	W6MVL2	Pseudomonas_phage	1.4e-19	32.0
WP_164923934.1\|1369624_1370740_+	glycosyltransferase	A0A1V0SAH6	Catovirus	1.0e-11	34.3
WP_015887463.1\|1370729_1371752_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_015887464.1\|1371751_1373545_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	8.4e-40	29.8
WP_015887465.1\|1373613_1374660_-	fructose-bisphosphate aldolase class II	NA	NA	NA	NA
WP_164923935.1\|1374717_1374936_-	hypothetical protein	NA	NA	NA	NA
WP_015887466.1\|1375420_1377019_+	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_015887467.1\|1377072_1377996_+	oligopeptide ABC transporter permease OppB	NA	NA	NA	NA
WP_015887468.1\|1377988_1379119_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_015887469.1\|1379120_1380722_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.8e-18	31.4
WP_164923936.1\|1380825_1381023_+	hypothetical protein	NA	NA	NA	NA
WP_164924088.1\|1381443_1383330_+	P-loop NTPase	NA	NA	NA	NA
WP_015887475.1\|1386262_1387114_+	exopolysaccharide production protein ExoY	NA	NA	NA	NA
WP_164924089.1\|1388086_1389541_-	polysaccharide biosynthesis/export family protein	NA	NA	NA	NA
WP_015887479.1\|1389540_1390431_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_015887480.1\|1390734_1391970_+	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_015887481.1\|1391966_1393085_-	glycosyltransferase family 4 protein	J7Q7I8	Aeropyrum_coil-shaped_virus	5.5e-05	29.3
WP_015887483.1\|1393523_1394846_+	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_015887484.1\|1395336_1396137_+	response regulator transcription factor	NA	NA	NA	NA
WP_015887485.1\|1396164_1397721_+	phosphomannomutase/phosphoglucomutase	A0A127AWJ1	Bacillus_phage	1.1e-27	26.3
WP_015887486.1\|1397750_1400063_+	AGE family epimerase/isomerase	A0A1V0SH58	Hokovirus	1.5e-25	27.5
WP_015887487.1\|1400188_1401523_-	sigma-54-dependent Fis family transcriptional regulator	NA	NA	NA	NA
WP_012706504.1\|1401743_1402922_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	6.6e-09	27.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_012587

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NC_000914

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NC_012586

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection