CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number
NC_010183	Bacillus mycoides KBAB4 plasmid pBWB404, complete sequence	2 crisprs	NA	0	2	2
NC_010180	Bacillus mycoides KBAB4 plasmid pBWB401, complete sequence	1 crisprs	csa3	3	3	3
NC_010184	Bacillus mycoides KBAB4, complete sequence	3 crisprs	cas3,csa3,WYL,DinG,cas14j,c2c9_V-U4,DEDDh,Cas14u_CAS-V	9	17	6
NC_010182	Bacillus mycoides KBAB4 plasmid pBWB403, complete sequence	0 crisprs	DEDDh	0	0	2
NC_010181	Bacillus mycoides KBAB4 plasmid pBWB402, complete sequence	0 crisprs	NA	0	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_010183_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_010183_1

49851-49976

Orphan

Consensus_repeat	Method
AAGTATACATTTCTACTTTTGCGTAAGT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_010183_1

>merge|NC_010183|1|49851-49976|CRISPRCasFinder
GAGTAGAAATGTATACTTAAGCGTAAATTTTTTTGGTATACTTTTCTACTTTTCTACTTTTGCGTAAGTTACGGGATATGAATTTTTTCAGGTAGAAAAGTATACATTTCTACTTTTGCGTAGTTT

>NC_010183|1|1|49851-49976|CRISPRCasFinder
GAGTAGAAATGTATACTTAAGCGTAAAT	TTTTTTGGTATACTTTTCTACTTTTCTACTTTTGCGTAAGTTACGGGATATGAATTTTTTCAGGTAGAA
AAGTATACATTTCTACTTTTGCGTAGTTT

Protein	Signature genes	Signature genes Name	Protein_function
NC_010183.1\|WP_012260155.1\|51401_51608_+\|hypothetical-protein	unknown	unknown	unknown
NC_010183.1\|WP_040963246.1\|44023_44635_+\|replication-relaxation-family-protein	unknown	unknown	gnl\|CDD\|379384
NC_010183.1\|WP_012260150.1\|46890_47085_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224393
NC_010183.1\|WP_002069235.1\|51646_51763_-\|YjcZ-family-sporulation-protein	unknown	unknown	unknown
NC_010183.1\|WP_012260143.1\|42662_42857_+\|hypothetical-protein	unknown	unknown	unknown
NC_010183.1\|WP_012260153.1\|48896_49727_-\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|379293
NC_010183.1\|WP_049772881.1\|52248_52794_+\|hypothetical-protein	unknown	unknown	unknown
NC_010183.1\|WP_012260146.1\|44718_45309_+\|DUF3967-domain-containing-protein	unknown	unknown	gnl\|CDD\|379171
NC_010183.1\|WP_012260149.1\|46418_46889_-\|DUF3278-domain-containing-protein	unknown	unknown	unknown
NC_010183.1\|WP_012260147.1\|45592_46159_+\|hypothetical-protein	unknown	unknown	unknown
NC_010183.1\|WP_012260151.1\|47438_48404_-\|DUF91-domain-containing-protein	unknown	unknown	gnl\|CDD\|280172
NC_010183.1\|WP_012260152.1\|48480_48882_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|185746
NC_010183.1\|WP_012260144.1\|42867_44034_+\|DNA-translocase-FtsK	unknown	unknown	gnl\|CDD\|224588

Protein	Function_ID	Function_description	E-value
NC_010183.1\|WP_012260150.1\|46890_47085_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|224393	COG1476, COG1476, Predicted transcriptional regulators [Transcription].	1.73065e-23
NC_010183.1\|WP_012260151.1\|47438_48404_-\|DUF91-domain-containing-protein	gnl\|CDD\|280172	pfam01939, NucS, Endonuclease NucS. Endonuclease NucS cleaves both 3' and 5' ssDNA extremities of branched DNA structures and it binds to ssDNA.	7.87351e-11
NC_010183.1\|WP_012260152.1\|48480_48882_-\|hypothetical-protein	gnl\|CDD\|185746	cd08915, V_Alix_like, Protein-interacting V-domain of mammalian Alix and related domains. This superfamily contains the V-shaped (V) domain of mammalian Alix (apoptosis-linked gene-2 interacting protein X), His-Domain type N23 protein tyrosine phosphatase (HD-PTP, also known as PTPN23), Bro1 and Rim20 (also known as PalA) from Saccharomyces cerevisiae, and related domains. Alix, HD-PTP, Bro1, and Rim20 all interact with the ESCRT (Endosomal Sorting Complexes Required for Transport) system. Alix, also known as apoptosis-linked gene-2 interacting protein 1 (AIP1), participates in membrane remodeling processes during the budding of enveloped viruses, vesicle budding inside late endosomal multivesicular bodies (MVBs), and the abscission reactions of mammalian cell division. It also functions in apoptosis. HD-PTP functions in cell migration and endosomal trafficking, Bro1 in endosomal trafficking, and Rim20 in the response to the external pH via the Rim101 pathway. The Alix V-domain contains a binding site, partially conserved in this superfamily, for the retroviral late assembly (L) domain YPXnL motif. The Alix V-domain is also a dimerization domain. Members of this superfamily have an N-terminal Bro1-like domain, which binds components of the ESCRT-III complex. The Bro1-like domains of Alix and HD-PTP can also bind human immunodeficiency virus type 1 (HIV-1) nucleocapsid. Many members, including Alix, HD-PTP, and Bro1, also have a proline-rich region (PRR), which binds multiple partners in Alix, including Tsg101 (tumor susceptibility gene 101, a component of ESCRT-1) and the apoptotic protein ALG-2. The C-terminal portion (V-domain and PRR) of Bro1 interacts with Doa4, a ubiquitin thiolesterase needed to remove ubiquitin from MVB cargoes; it interacts with a YPxL motif in Doa4s catalytic domain to stimulate its deubiquitination activity. Rim20 may bind the ESCRT-III subunit Snf7, bringing the protease Rim13 (a YPxL-containing transcription factor) into proximity with Rim101, and promoting the proteolytic activation of Rim101. HD-PTP is encoded by the PTPN23 gene, a tumor suppressor gene candidate often absent in human kidney, breast, lung, and cervical tumors. HD-PTP has a C-terminal catalytically inactive tyrosine phosphatase domain.	0.00279086
NC_010183.1\|WP_012260144.1\|42867_44034_+\|DNA-translocase-FtsK	gnl\|CDD\|224588	COG1674, FtsK, DNA segregation ATPase FtsK/SpoIIIE and related proteins [Cell division and chromosome partitioning].	1.39624e-36
NC_010183.1\|WP_040963246.1\|44023_44635_+\|replication-relaxation-family-protein	gnl\|CDD\|379384	pfam13814, Replic_Relax, Replication-relaxation. This family includes proteins which are essential for plasmid replication and plasmid DNA relaxation.	2.07698e-08
NC_010183.1\|WP_012260153.1\|48896_49727_-\|AAA-family-ATPase	gnl\|CDD\|379293	pfam13614, AAA_31, AAA domain. This family includes a wide variety of AAA domains including some that have lost essential nucleotide binding residues in the P-loop.	2.44928e-44
NC_010183.1\|WP_012260146.1\|44718_45309_+\|DUF3967-domain-containing-protein	gnl\|CDD\|379171	pfam13411, MerR_1, MerR HTH family regulatory protein.	7.63679e-08

>NC_010183.1|WP_012260153.1|48896_49727_-|AAA-family-ATPase
MKRQATTYVIGNFKGGVGKTKTATMLAYEAATVFNEKCLLVDMDPQGNATRVLAKTGDVEQIDKSITDAFLNQNLENEIIPVIENLDIVPSNTSFRKLSKILFDMFPENELAQITYLKKLLEPLKDKYDRIYIDVPPTISDYSDNAMIAADYCIIVLQTQELSLEGAQTYIAYMQFLAETYDADLQVLGIIPMMLHQGKRVDNKVLKQAQEMYGGNVLDTIVRYQERLKVYDVEGIHKTINVSGNVDMWDEKAHQLFIDVLSELNEHENYFATINA
>NC_010183.1|WP_012260152.1|48480_48882_-|hypothetical-protein
MSKAPFQPIPTKPGNTLNDKGVEIKGTNDFGRNSEPVKKKVMTPIINKAKVPAPEKADHRLVPSKTAKLSPAVLLKLSTLKPFIKEAESMDKVSNNNIIDMLIESYVNTKLTTRQSEGYKGMYKHLYEMLDKK
>NC_010183.1|WP_012260151.1|47438_48404_-|DUF91-domain-containing-protein
MGVITRNGDSLIDFDLFVTKYGCIKVDFKQQEGERYYLYAFRNDLAEWDFNKGELILVTHNEDKVKEIASKVLTLSVGEFFCKECFRKKDIEKLSNKDNTKYWCHNFWEKTPNRTKKSLQDEILYSIDAMDWSMVKSITNNDKPFVFFGICSDFCMTREEFKTNDVIQEKIKLMDDIWEELITEELMDGPESLLEDILCDHIFTIEEDMHFIERQYRVENGIIDIIAKDKNGTKCIIELKTVEDDKSLVWQSAYYPSCFNEDVRMITIAPNYSNRIYNALKNINNVEMKVFGKALNEKFHIKDFDGDSSVLEITEESPIIV
>NC_010183.1|WP_012260150.1|46890_47085_-|helix-turn-helix-transcriptional-regulator
MKNKIKLSRIEKSLTQEQLAFQVKVARQTIGLIEKGKYNPSLQLCLAIAKALDKTLNDLFWEVE
>NC_010183.1|WP_012260149.1|46418_46889_-|DUF3278-domain-containing-protein
MIKSWLSILLPKDEYKKQKTLYFLAEASIILFITLIILFSIHRIFPNLEPNPEISIGMSISIFVIYIFTRYILSGIEYTNITTEQEFKKEKNRISLNSLKFILVFFIAYSLIIGIPKTQSQWIDLVILILLSGIFMFSLGYVSLRRSYKKNKDLLD
>NC_010183.1|WP_012260147.1|45592_46159_+|hypothetical-protein
MKKTKKILSGALATMLLVGGISSTSFAAESINPVEVNQESAEMKQLTADIQFVFEEASTIENGKYVVDEKKIADKFGEENVLAITTFVNFANGEEVSTNNLRGLPDSPTGKIDKGGIQYSWSSCVGNKIIDATGIGFISGGMWKLIERQAWQQLAIELAKVVGKNAIKGGIVGFAASLAWYGTSCIGK
>NC_010183.1|WP_012260146.1|44718_45309_+|DUF3967-domain-containing-protein
MTDEIVYSASEVYKRLGISDSTLRKYMEVLSREGFAVKKDKRGRREYTDGDIMVIERLIELSKHDGMTLEKAAKMIAQQIEKVNPDMIQEEPEETDIVPFHIQQQLQQQYSVMAQEMNQSIVSMEKRLSEQAKQSNEEIKASIESHNERVEKRLEARDETLMKTLREMQESKRLMQEFRDEVAAAKEKKKPWWKFW
>NC_010183.1|WP_040963246.1|44023_44635_+|replication-relaxation-family-protein
MMNRDKTILKDLKRFRCMSRDDIIDLHFQGLKNAVTCCNTVMKRLRRDGHVDANISQQPFIYFPQPSTLRKTSQKIPHFLGIVDVYKQLIHYEKPKLFKVEPKYGKDYMEPDAFTIWRRSPFFIEVQKSVYSKKIMQDKINRYELYFHSQEWHNESWQPKGSKFFPSILIITDKHYDINSSSVRIFQFSSISNFMDSLAVKVE
>NC_010183.1|WP_012260144.1|42867_44034_+|DNA-translocase-FtsK
MGIIKEWLHKQSLKNRLIEVFGKAGLYVDHQTRGGKVPIYPKIHDVSSTKENVRYVFTIPNGLDPKTIEKKWFCFQQILGRNAAIEGDIKKFVLNVFHSDAGLQAYNYSYKKWQSLLEKHRLPVVVGRDQFGNTIVYDMVDSNTPHLLIAGETGSGKSSMVRVVLSTLIQHMSPDKLHLYLGDLKNSEFHFLRRVKHVKEVCMEEIEMKIMLQKVWKEIRERRKLMEEYEVDHIDEYNKLNPDNQKPYILLAIDEVAMLQDEKECMKTIEKISAVGRALGVFLMLSMQRPDAKVLDGKLKLNMTVRMGFKCDSTINSNIMGTPGSEHLERSGQMILKLNGLKKVQAPYLELNKAKQIVEPYRIPKEDMTLQNPPQEENQLFGVLDYDE
>NC_010183.1|WP_012260143.1|42662_42857_+|hypothetical-protein
MLTTFISLGALGVTTIGGAILEKHLVKNDHVAAAKFVSEGLYHGMRIGGVCFIGYVFIKILIMF
>NC_010183.1|WP_012260155.1|51401_51608_+|hypothetical-protein
MLPSREECCEKCNGYGIEWNDVFDRAVDTVMDTQGLSFYDAVNQVKGNSSYNEDYTDCKTCKGTGKNK
>NC_010183.1|WP_002069235.1|51646_51763_-|YjcZ-family-sporulation-protein
MGFGGSCGSCGGGGFAGGFALLVVLFILLIIVGASCFC
>NC_010183.1|WP_049772881.1|52248_52794_+|hypothetical-protein
MNFKRKKSSLKVLTVAALSSLLMFTGGNSKSYAEETDVAAEKFNMPAFEQLMNEIEQGIIKNETQGLERFEELEKTVPNENNKNDIVLYSWNVETALKNAKEAAACSKVIGTYKCGVAGVSSRTALSTARSYYAGESLSDGLGDAFRHSYWNALMSREIGVAMQVCGDLPEYLTGWSNDMI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_010183_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_010183_2

50057-50148

Orphan

Consensus_repeat	Method
AAGTATACATTTCTACTTTTGCGTAAGT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_010183_2

>merge|NC_010183|2|50057-50148|CRISPRCasFinder
AAGTATACATTTCTACTTTTGCGTAAGTTTGAAAGAGTATACTTATTTTAAAAGTTAGGTAGAAAAGTATACATTTCTACTTTTGCGTAAGT

>NC_010183|2|2|50057-50148|CRISPRCasFinder
AAGTATACATTTCTACTTTTGCGTAAGT	TTGAAAGAGTATACTTATTTTAAAAGTTAGGTAGAA
AAGTATACATTTCTACTTTTGCGTAAGT

Protein	Signature genes	Signature genes Name	Protein_function
NC_010183.1\|WP_012260155.1\|51401_51608_+\|hypothetical-protein	unknown	unknown	unknown
NC_010183.1\|WP_040963246.1\|44023_44635_+\|replication-relaxation-family-protein	unknown	unknown	gnl\|CDD\|379384
NC_010183.1\|WP_012260150.1\|46890_47085_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224393
NC_010183.1\|WP_002069235.1\|51646_51763_-\|YjcZ-family-sporulation-protein	unknown	unknown	unknown
NC_010183.1\|WP_012260143.1\|42662_42857_+\|hypothetical-protein	unknown	unknown	unknown
NC_010183.1\|WP_012260153.1\|48896_49727_-\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|379293
NC_010183.1\|WP_049772881.1\|52248_52794_+\|hypothetical-protein	unknown	unknown	unknown
NC_010183.1\|WP_012260146.1\|44718_45309_+\|DUF3967-domain-containing-protein	unknown	unknown	gnl\|CDD\|379171
NC_010183.1\|WP_012260149.1\|46418_46889_-\|DUF3278-domain-containing-protein	unknown	unknown	unknown
NC_010183.1\|WP_012260147.1\|45592_46159_+\|hypothetical-protein	unknown	unknown	unknown
NC_010183.1\|WP_012260151.1\|47438_48404_-\|DUF91-domain-containing-protein	unknown	unknown	gnl\|CDD\|280172
NC_010183.1\|WP_012260152.1\|48480_48882_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|185746
NC_010183.1\|WP_012260144.1\|42867_44034_+\|DNA-translocase-FtsK	unknown	unknown	gnl\|CDD\|224588

Protein	Function_ID	Function_description	E-value
NC_010183.1\|WP_012260150.1\|46890_47085_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|224393	COG1476, COG1476, Predicted transcriptional regulators [Transcription].	1.73065e-23
NC_010183.1\|WP_012260151.1\|47438_48404_-\|DUF91-domain-containing-protein	gnl\|CDD\|280172	pfam01939, NucS, Endonuclease NucS. Endonuclease NucS cleaves both 3' and 5' ssDNA extremities of branched DNA structures and it binds to ssDNA.	7.87351e-11
NC_010183.1\|WP_012260152.1\|48480_48882_-\|hypothetical-protein	gnl\|CDD\|185746	cd08915, V_Alix_like, Protein-interacting V-domain of mammalian Alix and related domains. This superfamily contains the V-shaped (V) domain of mammalian Alix (apoptosis-linked gene-2 interacting protein X), His-Domain type N23 protein tyrosine phosphatase (HD-PTP, also known as PTPN23), Bro1 and Rim20 (also known as PalA) from Saccharomyces cerevisiae, and related domains. Alix, HD-PTP, Bro1, and Rim20 all interact with the ESCRT (Endosomal Sorting Complexes Required for Transport) system. Alix, also known as apoptosis-linked gene-2 interacting protein 1 (AIP1), participates in membrane remodeling processes during the budding of enveloped viruses, vesicle budding inside late endosomal multivesicular bodies (MVBs), and the abscission reactions of mammalian cell division. It also functions in apoptosis. HD-PTP functions in cell migration and endosomal trafficking, Bro1 in endosomal trafficking, and Rim20 in the response to the external pH via the Rim101 pathway. The Alix V-domain contains a binding site, partially conserved in this superfamily, for the retroviral late assembly (L) domain YPXnL motif. The Alix V-domain is also a dimerization domain. Members of this superfamily have an N-terminal Bro1-like domain, which binds components of the ESCRT-III complex. The Bro1-like domains of Alix and HD-PTP can also bind human immunodeficiency virus type 1 (HIV-1) nucleocapsid. Many members, including Alix, HD-PTP, and Bro1, also have a proline-rich region (PRR), which binds multiple partners in Alix, including Tsg101 (tumor susceptibility gene 101, a component of ESCRT-1) and the apoptotic protein ALG-2. The C-terminal portion (V-domain and PRR) of Bro1 interacts with Doa4, a ubiquitin thiolesterase needed to remove ubiquitin from MVB cargoes; it interacts with a YPxL motif in Doa4s catalytic domain to stimulate its deubiquitination activity. Rim20 may bind the ESCRT-III subunit Snf7, bringing the protease Rim13 (a YPxL-containing transcription factor) into proximity with Rim101, and promoting the proteolytic activation of Rim101. HD-PTP is encoded by the PTPN23 gene, a tumor suppressor gene candidate often absent in human kidney, breast, lung, and cervical tumors. HD-PTP has a C-terminal catalytically inactive tyrosine phosphatase domain.	0.00279086
NC_010183.1\|WP_012260144.1\|42867_44034_+\|DNA-translocase-FtsK	gnl\|CDD\|224588	COG1674, FtsK, DNA segregation ATPase FtsK/SpoIIIE and related proteins [Cell division and chromosome partitioning].	1.39624e-36
NC_010183.1\|WP_040963246.1\|44023_44635_+\|replication-relaxation-family-protein	gnl\|CDD\|379384	pfam13814, Replic_Relax, Replication-relaxation. This family includes proteins which are essential for plasmid replication and plasmid DNA relaxation.	2.07698e-08
NC_010183.1\|WP_012260153.1\|48896_49727_-\|AAA-family-ATPase	gnl\|CDD\|379293	pfam13614, AAA_31, AAA domain. This family includes a wide variety of AAA domains including some that have lost essential nucleotide binding residues in the P-loop.	2.44928e-44
NC_010183.1\|WP_012260146.1\|44718_45309_+\|DUF3967-domain-containing-protein	gnl\|CDD\|379171	pfam13411, MerR_1, MerR HTH family regulatory protein.	7.63679e-08

>NC_010183.1|WP_012260153.1|48896_49727_-|AAA-family-ATPase
MKRQATTYVIGNFKGGVGKTKTATMLAYEAATVFNEKCLLVDMDPQGNATRVLAKTGDVEQIDKSITDAFLNQNLENEIIPVIENLDIVPSNTSFRKLSKILFDMFPENELAQITYLKKLLEPLKDKYDRIYIDVPPTISDYSDNAMIAADYCIIVLQTQELSLEGAQTYIAYMQFLAETYDADLQVLGIIPMMLHQGKRVDNKVLKQAQEMYGGNVLDTIVRYQERLKVYDVEGIHKTINVSGNVDMWDEKAHQLFIDVLSELNEHENYFATINA
>NC_010183.1|WP_012260152.1|48480_48882_-|hypothetical-protein
MSKAPFQPIPTKPGNTLNDKGVEIKGTNDFGRNSEPVKKKVMTPIINKAKVPAPEKADHRLVPSKTAKLSPAVLLKLSTLKPFIKEAESMDKVSNNNIIDMLIESYVNTKLTTRQSEGYKGMYKHLYEMLDKK
>NC_010183.1|WP_012260151.1|47438_48404_-|DUF91-domain-containing-protein
MGVITRNGDSLIDFDLFVTKYGCIKVDFKQQEGERYYLYAFRNDLAEWDFNKGELILVTHNEDKVKEIASKVLTLSVGEFFCKECFRKKDIEKLSNKDNTKYWCHNFWEKTPNRTKKSLQDEILYSIDAMDWSMVKSITNNDKPFVFFGICSDFCMTREEFKTNDVIQEKIKLMDDIWEELITEELMDGPESLLEDILCDHIFTIEEDMHFIERQYRVENGIIDIIAKDKNGTKCIIELKTVEDDKSLVWQSAYYPSCFNEDVRMITIAPNYSNRIYNALKNINNVEMKVFGKALNEKFHIKDFDGDSSVLEITEESPIIV
>NC_010183.1|WP_012260150.1|46890_47085_-|helix-turn-helix-transcriptional-regulator
MKNKIKLSRIEKSLTQEQLAFQVKVARQTIGLIEKGKYNPSLQLCLAIAKALDKTLNDLFWEVE
>NC_010183.1|WP_012260149.1|46418_46889_-|DUF3278-domain-containing-protein
MIKSWLSILLPKDEYKKQKTLYFLAEASIILFITLIILFSIHRIFPNLEPNPEISIGMSISIFVIYIFTRYILSGIEYTNITTEQEFKKEKNRISLNSLKFILVFFIAYSLIIGIPKTQSQWIDLVILILLSGIFMFSLGYVSLRRSYKKNKDLLD
>NC_010183.1|WP_012260147.1|45592_46159_+|hypothetical-protein
MKKTKKILSGALATMLLVGGISSTSFAAESINPVEVNQESAEMKQLTADIQFVFEEASTIENGKYVVDEKKIADKFGEENVLAITTFVNFANGEEVSTNNLRGLPDSPTGKIDKGGIQYSWSSCVGNKIIDATGIGFISGGMWKLIERQAWQQLAIELAKVVGKNAIKGGIVGFAASLAWYGTSCIGK
>NC_010183.1|WP_012260146.1|44718_45309_+|DUF3967-domain-containing-protein
MTDEIVYSASEVYKRLGISDSTLRKYMEVLSREGFAVKKDKRGRREYTDGDIMVIERLIELSKHDGMTLEKAAKMIAQQIEKVNPDMIQEEPEETDIVPFHIQQQLQQQYSVMAQEMNQSIVSMEKRLSEQAKQSNEEIKASIESHNERVEKRLEARDETLMKTLREMQESKRLMQEFRDEVAAAKEKKKPWWKFW
>NC_010183.1|WP_040963246.1|44023_44635_+|replication-relaxation-family-protein
MMNRDKTILKDLKRFRCMSRDDIIDLHFQGLKNAVTCCNTVMKRLRRDGHVDANISQQPFIYFPQPSTLRKTSQKIPHFLGIVDVYKQLIHYEKPKLFKVEPKYGKDYMEPDAFTIWRRSPFFIEVQKSVYSKKIMQDKINRYELYFHSQEWHNESWQPKGSKFFPSILIITDKHYDINSSSVRIFQFSSISNFMDSLAVKVE
>NC_010183.1|WP_012260144.1|42867_44034_+|DNA-translocase-FtsK
MGIIKEWLHKQSLKNRLIEVFGKAGLYVDHQTRGGKVPIYPKIHDVSSTKENVRYVFTIPNGLDPKTIEKKWFCFQQILGRNAAIEGDIKKFVLNVFHSDAGLQAYNYSYKKWQSLLEKHRLPVVVGRDQFGNTIVYDMVDSNTPHLLIAGETGSGKSSMVRVVLSTLIQHMSPDKLHLYLGDLKNSEFHFLRRVKHVKEVCMEEIEMKIMLQKVWKEIRERRKLMEEYEVDHIDEYNKLNPDNQKPYILLAIDEVAMLQDEKECMKTIEKISAVGRALGVFLMLSMQRPDAKVLDGKLKLNMTVRMGFKCDSTINSNIMGTPGSEHLERSGQMILKLNGLKKVQAPYLELNKAKQIVEPYRIPKEDMTLQNPPQEENQLFGVLDYDE
>NC_010183.1|WP_012260143.1|42662_42857_+|hypothetical-protein
MLTTFISLGALGVTTIGGAILEKHLVKNDHVAAAKFVSEGLYHGMRIGGVCFIGYVFIKILIMF
>NC_010183.1|WP_012260155.1|51401_51608_+|hypothetical-protein
MLPSREECCEKCNGYGIEWNDVFDRAVDTVMDTQGLSFYDAVNQVKGNSSYNEDYTDCKTCKGTGKNK
>NC_010183.1|WP_002069235.1|51646_51763_-|YjcZ-family-sporulation-protein
MGFGGSCGSCGGGGFAGGFALLVVLFILLIIVGASCFC
>NC_010183.1|WP_049772881.1|52248_52794_+|hypothetical-protein
MNFKRKKSSLKVLTVAALSSLLMFTGGNSKSYAEETDVAAEKFNMPAFEQLMNEIEQGIIKNETQGLERFEELEKTVPNENNKNDIVLYSWNVETALKNAKEAAACSKVIGTYKCGVAGVSSRTALSTARSYYAGESLSDGLGDAFRHSYWNALMSREIGVAMQVCGDLPEYLTGWSNDMI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_010183_2	2.1\|50085\|36\|NC_010183\|CRISPRCasFinder	50085-50120	36	NC_010183	Bacillus mycoides KBAB4 plasmid pBWB404, complete sequence	50085-50120	0	1.0
NC_010183_1	1.1\|49879\|69\|NC_010183\|CRISPRCasFinder	49879-49947	69	NC_010183	Bacillus mycoides KBAB4 plasmid pBWB404, complete sequence	49879-49947	9	0.87

1. spacer 2.1|50085|36|NC_010183|CRISPRCasFinder matches to NC_010183 (Bacillus mycoides KBAB4 plasmid pBWB404, complete sequence) position: , mismatch: 0, identity: 1.0

ttgaaagagtatacttattttaaaagttaggtagaa	CRISPR spacer
ttgaaagagtatacttattttaaaagttaggtagaa	Protospacer
************************************

2. spacer 1.1|49879|69|NC_010183|CRISPRCasFinder matches to NC_010183 (Bacillus mycoides KBAB4 plasmid pBWB404, complete sequence) position: , mismatch: 9, identity: 0.87

ttttttggtatacttttctacttttctacttttgcgtaagttacgggatatgaatttttt	CRISPR spacer
ttttttggtatacttttctacttttctacttttgcgtaagttacgggatatgaatttttt	Protospacer
************************************************************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

3343 : 14470

Bacillus_phage(73.33%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012260093.1\|3343_3814_-	hypothetical protein	A0A0K2CZD8	Paenibacillus_phage	2.2e-24	41.2
WP_012260094.1\|3839_4322_-	PH domain-containing protein	O64019	Bacillus_phage	1.5e-36	47.8
WP_012260095.1\|4438_5140_-	class D sortase	NA	NA	NA	NA
WP_012260096.1\|5197_5716_-	excalibur calcium-binding domain-containing protein	NA	NA	NA	NA
WP_012260097.1\|6204_6627_-	ImmA/IrrE family metallo-endopeptidase	A0A0M4RD70	Bacillus_phage	4.2e-51	70.2
WP_012260098.1\|6642_7068_-	helix-turn-helix transcriptional regulator	A0A0M4QX29	Bacillus_phage	4.3e-51	74.1
WP_012260099.1\|7342_7528_+	helix-turn-helix transcriptional regulator	A0A0M3ULF9	Bacillus_phage	9.2e-11	60.7
WP_012260100.1\|7529_8300_+	phage antirepressor Ant	Q6J1W3	Lactobacillus_phage	4.4e-46	43.6
WP_012260103.1\|8980_9157_+	hypothetical protein	A0A1B1P897	Bacillus_phage	1.9e-21	82.1
WP_012260104.1\|9157_10006_+	hypothetical protein	A0A0U3TZZ4	Bacillus_phage	1.9e-71	83.1
WP_040963245.1\|9989_10748_+	ATP-binding protein	U5PWH5	Bacillus_phage	4.1e-36	39.1
WP_012260106.1\|10762_11236_+	hypothetical protein	D2XQ18	Bacillus_virus	6.0e-62	75.8
WP_012260107.1\|11222_11414_+	hypothetical protein	A0A1B1P8D7	Bacillus_phage	5.2e-25	85.7
WP_012260108.1\|11410_11692_+	hypothetical protein	A0A1B1P8A9	Bacillus_phage	2.0e-36	81.7
WP_000141885.1\|12097_12346_-	hypothetical protein	A0A288WFY7	Bacillus_phage	4.5e-37	96.3
WP_012260110.1\|13661_13838_+	hypothetical protein	A0A1B1P875	Bacillus_phage	3.6e-20	84.2
WP_012260111.1\|13840_14470_+	Holliday junction resolvase RecU	A0A2H4J3A4	uncultured_Caudovirales_phage	1.3e-48	60.8

DBSCAN-SWA_2

18201 : 47085

Bacillus_phage(53.85%)

head,tail,capsid,protease,holin,terminase,portal

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_040963247.1\|18201_18417_+	hypothetical protein	B5LPQ8	Bacillus_virus	5.0e-24	78.9
WP_040963248.1\|18495_18795_+	HNH endonuclease	R9TNN2	Paenibacillus_phage	2.1e-28	61.9
WP_012260119.1\|18797_19244_+	hypothetical protein	NA	NA	NA	NA
WP_012260120.1\|19345_19720_+	hypothetical protein	R9TQ46	Paenibacillus_phage	4.6e-25	55.6
WP_012260121.1\|19712_21398_+\|terminase	terminase large subunit	A0A290GJW3	Caldibacillus_phage	8.2e-263	76.8
WP_012260122.1\|21413_22640_+\|portal	phage portal protein	A0A0A8WJ25	Clostridium_phage	3.9e-137	61.2
WP_012260123.1\|22590_23175_+\|head,protease	HK97 family phage prohead protease	A0A2I7SBY1	Paenibacillus_phage	1.9e-33	46.0
WP_012260124.1\|23188_24355_+\|capsid	phage major capsid protein	H7BUQ0	unidentified_phage	4.1e-80	53.7
WP_012260125.1\|24391_24682_+	hypothetical protein	A6XMJ7	Bacillus_virus	3.7e-06	41.0
WP_012260126.1\|24684_24957_+	DNA-packaging protein	R9TMB7	Paenibacillus_phage	3.8e-21	57.3
WP_012260127.1\|24953_25253_+\|head	phage head closure protein	A0A0S2SXM4	Bacillus_phage	4.5e-07	44.1
WP_012260128.1\|25245_25602_+	HK97 gp10 family phage protein	D2XR21	Bacillus_phage	3.5e-30	59.5
WP_012260129.1\|25598_25928_+	hypothetical protein	A0A2H4JAG4	uncultured_Caudovirales_phage	5.1e-52	91.7
WP_012260130.1\|25928_26522_+\|tail	phage tail protein	A0A2H4JDV4	uncultured_Caudovirales_phage	3.3e-102	93.3
WP_012260131.1\|26526_26871_+	hypothetical protein	D2XR24	Bacillus_phage	3.6e-56	93.9
WP_012260133.1\|27106_28570_+	hypothetical protein	D2XR25	Bacillus_phage	3.5e-209	95.8
WP_012260134.1\|28794_31155_+	hypothetical protein	D2XR26	Bacillus_phage	1.3e-173	91.6
WP_012260135.1\|31196_32669_+\|tail	phage tail family protein	D2XPZ5	Bacillus_virus	2.3e-213	70.5
WP_012260136.1\|32665_38626_+\|tail	phage tail protein	D2XR28	Bacillus_phage	1.5e-247	34.7
WP_012260137.1\|38662_39088_+\|holin	phage holin family protein	A0A0S2MVC4	Bacillus_phage	3.6e-66	89.4
WP_012260138.1\|39087_40023_+	N-acetylmuramoyl-L-alanine amidase	A0A0S2MVR5	Bacillus_phage	1.0e-166	89.1
WP_012260139.1\|40074_40566_-	hypothetical protein	NA	NA	NA	NA
WP_157861639.1\|40728_41220_-	protein phosphatase 2C	NA	NA	NA	NA
WP_157861640.1\|41496_41985_-	protein phosphatase 2C	NA	NA	NA	NA
WP_012260142.1\|42195_42420_-	helix-turn-helix transcriptional regulator	A0A0S2MVM0	Bacillus_phage	2.8e-17	55.2
WP_012260143.1\|42662_42857_+	hypothetical protein	A0A1B1P7T1	Bacillus_phage	3.9e-12	53.1
WP_012260144.1\|42867_44034_+	DNA translocase FtsK	A0A0S2GLG9	Bacillus_phage	7.3e-194	85.8
WP_040963246.1\|44023_44635_+	replication-relaxation family protein	W8CZ47	Bacillus_phage	6.9e-87	75.1
WP_012260146.1\|44718_45309_+	DUF3967 domain-containing protein	A0A1Z1LZN4	Bacillus_phage	1.9e-09	34.5
WP_012260147.1\|45592_46159_+	hypothetical protein	NA	NA	NA	NA
WP_012260149.1\|46418_46889_-	DUF3278 domain-containing protein	NA	NA	NA	NA
WP_012260150.1\|46890_47085_-	helix-turn-helix transcriptional regulator	A0A0U4B0B5	Bacillus_phage	6.1e-05	48.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NC_010180

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_010180_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_010180_1

309273-309576

Orphan

Consensus_repeat	Method
ATAGGGAAAAGAAAGAGCAAACGTGTTGCAAGTTGTAGAGTTAAGGAAAGAAAAGCGCAAAA	PILER-CR

3 spacers

The CRISPR arrays of NC_010180_1

>merge|NC_010180|1|309273-309576|PILER-CR
TAGGGTAAGGATACCGCAAACGTGTTGCAAGTTGTAGAGTTAAGGAAAGAAAAGCGCAAAAGGAATGCAAGTAAAGAGGAATAGGGAAAAGAAAGAGCAAACGTGTTGCAAGTTGTAGAGTTAAGGAAAGAAAAGCGCAAAAGGAATGTAAGTAAAGAGGAATAGGGAAAAGAAAGAGCAAACGTGTTGCAAGTTGTAGAGTTAAGGAAAGAAAAGCGCAAAAGGAATGCAAGTAAAGAGGAATAGGGAAAAGAAAGAGCAAACGTGTTGCAAGTTGTAGAGTTAAGGAAAGAAAAGCGCAAAA

>NC_010180|1|1|309273-309576|PILER-CR
TAGGGTAAGGATACCGCAAACGTGTTGCAAGTTGTAGAGTTAAGGAAAGAAAAGCGCAAAAG	GAATGCAAGTAAAGAGGAA
TAGGGAAAAGAAAGAGCAAACGTGTTGCAAGTTGTAGAGTTAAGGAAAGAAAAGCGCAAAAG	GAATGTAAGTAAAGAGGAA
TAGGGAAAAGAAAGAGCAAACGTGTTGCAAGTTGTAGAGTTAAGGAAAGAAAAGCGCAAAAG	GAATGCAAGTAAAGAGGAA
TAGGGAAAAGAAAGAGCAAACGTGTTGCAAGTTGTAGAGTTAAGGAAAGAAAAGCGCAAAA

Protein	Signature genes	Signature genes Name	Protein_function
NC_010180.1\|WP_012259908.1\|315421_316345_+\|NAD-dependent-epimerase/dehydratase-family-protein	unknown	unknown	gnl\|CDD\|187566
NC_010180.1\|WP_012259900.1\|302200_303367_+\|DNA-translocase-FtsK	unknown	unknown	gnl\|CDD\|224588
NC_010180.1\|WP_012259905.1\|311717_312194_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NC_010180.1\|WP_012259906.1\|312920_314249_+\|nucleotide-sugar-dehydrogenase	unknown	unknown	gnl\|CDD\|223749
NC_010180.1\|WP_012259907.1\|314257_315415_+\|DegT/DnrJ/EryC1/StrS-family-aminotransferase	unknown	unknown	gnl\|CDD\|99740
NC_010180.1\|WP_012259911.1\|318457_319147_+\|WbqC-family-protein	unknown	unknown	gnl\|CDD\|378083
NC_010180.1\|WP_193339773.1\|305755_305908_-\|hypothetical-protein	unknown	unknown	unknown
NC_010180.1\|WP_001202663.1\|301864_302185_+\|hypothetical-protein	unknown	unknown	unknown
NC_010180.1\|WP_080515480.1\|303936_304140_-\|hypothetical-protein	unknown	unknown	unknown
NC_010180.1\|WP_012259903.1\|306852_308562_-\|hypothetical-protein	unknown	unknown	unknown
NC_010180.1\|WP_040963222.1\|303389_303965_+\|replication-relaxation-family-protein	unknown	unknown	gnl\|CDD\|379384
NC_010180.1\|WP_002150963.1\|301342_301573_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|143331
NC_010180.1\|WP_012259904.1\|309839_311537_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224651
NC_010180.1\|WP_012259909.1\|316319_317561_+\|DegT/DnrJ/EryC1/StrS-aminotransferase-family-protein	unknown	unknown	gnl\|CDD\|223476
NC_010180.1\|WP_002144315.1\|304361_305009_+\|lysozyme-family-protein	unknown	unknown	gnl\|CDD\|381612
NC_010180.1\|WP_012259913.1\|319842_320778_+\|endonuclease	unknown	unknown	gnl\|CDD\|366542
NC_010180.1\|WP_012259910.1\|317572_318454_+\|peptidoglycan-bridge-formation-glycyltransferase-FemA/FemB-family-protein	unknown	unknown	gnl\|CDD\|377314
NC_010180.1\|WP_012259912.1\|319153_319831_+\|PIG-L-family-deacetylase	unknown	unknown	gnl\|CDD\|376836
NC_010180.1\|WP_012259902.1\|305091_305799_-\|IS6-family-transposase	unknown	unknown	gnl\|CDD\|225853
NC_010180.1\|WP_012259899.1\|300540_301248_+\|IS6-like-element-ISBwe3-family-transposase	unknown	unknown	gnl\|CDD\|225853

Protein	Function_ID	Function_description	E-value
NC_010180.1\|WP_012259908.1\|315421_316345_+\|NAD-dependent-epimerase/dehydratase-family-protein	gnl\|CDD\|187566	cd05256, UDP_AE_SDR_e, UDP-N-acetylglucosamine 4-epimerase, extended (e) SDRs. This subgroup contains UDP-N-acetylglucosamine 4-epimerase of Pseudomonas aeruginosa, WbpP, an extended SDR, that catalyzes the NAD+ dependent conversion of UDP-GlcNAc and UDPGalNA to UDP-Glc and UDP-Gal. This subgroup has the characteristic active site tetrad and NAD-binding motif of the extended SDRs. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	7.60326e-66
NC_010180.1\|WP_012259900.1\|302200_303367_+\|DNA-translocase-FtsK	gnl\|CDD\|224588	COG1674, FtsK, DNA segregation ATPase FtsK/SpoIIIE and related proteins [Cell division and chromosome partitioning].	1.59134e-39
NC_010180.1\|WP_012259905.1\|311717_312194_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	6.70433e-14
NC_010180.1\|WP_012259906.1\|312920_314249_+\|nucleotide-sugar-dehydrogenase	gnl\|CDD\|223749	COG0677, WecC, UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Cell envelope biogenesis, outer membrane].	3.09942e-153
NC_010180.1\|WP_012259907.1\|314257_315415_+\|DegT/DnrJ/EryC1/StrS-family-aminotransferase	gnl\|CDD\|99740	cd00616, AHBA_syn, 3-amino-5-hydroxybenzoic acid synthase family (AHBA_syn). AHBA_syn family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The members of this CD are involved in various biosynthetic pathways for secondary metabolites. Some well studied proteins in this CD are AHBA_synthase, protein product of pleiotropic regulatory gene degT, Arnb aminotransferase and pilin glycosylation protein. The prototype of this family, the AHBA_synthase, is a dimeric PLP dependent enzyme. AHBA_syn is the terminal enzyme of 3-amino-5-hydroxybenzoic acid (AHBA) formation which is involved in the biosynthesis of ansamycin antibiotics, including rifamycin B. Some members of this CD are involved in 4-amino-6-deoxy-monosaccharide D-perosamine synthesis. Perosamine is an important element in the glycosylation of several cell products, such as antibiotics and lipopolysaccharides of gram-positive and gram-negative bacteria. The pilin glycosylation protein encoded by gene pglA, is a galactosyltransferase involved in pilin glycosylation. Additionally, this CD consists of ArnB (PmrH) aminotransferase, a 4-amino-4-deoxy-L-arabinose lipopolysaccharide-modifying enzyme. This CD also consists of several predicted pyridoxal phosphate-dependent enzymes apparently involved in regulation of cell wall biogenesis. The catalytic lysine which is present in all characterized PLP dependent enzymes is replaced by histidine in some members of this CD.	4.82866e-169
NC_010180.1\|WP_012259911.1\|318457_319147_+\|WbqC-family-protein	gnl\|CDD\|378083	pfam08889, WbqC, WbqC-like protein family. This family of proteins are functionally uncharacterized. However it is found in an O-antigen gene cluster in E. coli and other bacteria suggesting a role in O-antigen production. Feng et al. suggest that wbnG may code for a glycine transferase.	2.6785e-89
NC_010180.1\|WP_012259913.1\|319842_320778_+\|endonuclease	gnl\|CDD\|366542	pfam01261, AP_endonuc_2, Xylose isomerase-like TIM barrel. This TIM alpha/beta barrel structure is found in xylose isomerase and in endonuclease IV (EC:3.1.21.2). This domain is also found in the N termini of bacterial myo-inositol catabolism proteins. These are involved in the myo-inositol catabolism pathway, and is required for growth on myo-inositol in Rhizobium leguminosarum bv. viciae.	0.00179124
NC_010180.1\|WP_040963222.1\|303389_303965_+\|replication-relaxation-family-protein	gnl\|CDD\|379384	pfam13814, Replic_Relax, Replication-relaxation. This family includes proteins which are essential for plasmid replication and plasmid DNA relaxation.	4.36616e-08
NC_010180.1\|WP_002150963.1\|301342_301573_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|143331	cd01392, HTH_LacI, Helix-turn-helix (HTH) DNA binding domain of the LacI family of transcriptional regulators. HTH-DNA binding domain of the LacI (lactose operon repressor) family of bacterial transcriptional regulators and their putative homologs found in plants. The LacI family has more than 500 members distributed among almost all bacterial species. The monomeric proteins of the LacI family contain common structural features that include a small DNA-binding domain with a helix-turn-helix motif in the N-terminus, a regulatory ligand-binding domain which exhibits the type I periplasmic binding protein fold in the C-terminus for oligomerization and for effector binding, and an approximately 18-amino acid linker connecting these two functional domains. In LacI-like transcriptional regulators, the ligands are monosaccharides including lactose, ribose, fructose, xylose, arabinose, galactose/glucose, and other sugars, with a few exceptions. When the C-terminal domain of the LacI family repressor binds its ligand, it undergoes a conformational change which affects the DNA-binding affinity of the repressor. In Escherichia coli, LacI represses transcription by binding with high affinity to the lac operon at a specific operator DNA sequence until it interacts with the physiological inducer allolactose or a non-degradable analog IPTG (isopropyl-beta-D-thiogalactopyranoside). Induction of the repressor lowers its affinity for the operator sequence, thereby allowing transcription of the lac operon structural genes (lacZ, lacY, and LacA). The lac repressor occurs as a tetramer made up of two functional dimers. Thus, two DNA binding domains of a dimer are required to bind the inverted repeat sequences of the operator DNA binding sites.	3.51326e-05
NC_010180.1\|WP_012259904.1\|309839_311537_+\|hypothetical-protein	gnl\|CDD\|224651	COG1737, RpiR, Transcriptional regulators [Transcription].	0.00228007
NC_010180.1\|WP_012259909.1\|316319_317561_+\|DegT/DnrJ/EryC1/StrS-aminotransferase-family-protein	gnl\|CDD\|223476	COG0399, WecE, Predicted pyridoxal phosphate-dependent enzyme apparently involved in regulation of cell wall biogenesis [Cell envelope biogenesis, outer membrane].	1.50312e-42
NC_010180.1\|WP_002144315.1\|304361_305009_+\|lysozyme-family-protein	gnl\|CDD\|381612	cd16891, CwlT-like, CwlT-like N-terminal lysozyme domain and similar domains. CwlT is a bifunctional cell wall hydrolase containing an N-terminal lysozyme domain and a C-terminal NlpC/P60 endopeptidase domain (gamma-d-D-glutamyl-L-diamino acid endopeptidase), and has been implicated in the spread of transposons. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).	4.04298e-61
NC_010180.1\|WP_012259910.1\|317572_318454_+\|peptidoglycan-bridge-formation-glycyltransferase-FemA/FemB-family-protein	gnl\|CDD\|377314	pfam04339, FemAB_like, Peptidogalycan biosysnthesis/recognition. FemAB_like is a family of both baterial and Viridiplantae proteins with responsibility for building interpeptide bridges in peptidoglycan. Such a function is feasible for bacteria but less likely for the plant members of this family. Perhaps the plant-members are using homologous proteins to recognize bacterial peptidoglcans as part of their innate immune system.	3.7732e-07
NC_010180.1\|WP_012259912.1\|319153_319831_+\|PIG-L-family-deacetylase	gnl\|CDD\|376836	pfam02585, PIG-L, GlcNAc-PI de-N-acetylase. Members of this family are related to PIG-L an N-acetylglucosaminylphosphatidylinositol de-N-acetylase (EC:3.5.1.89) that catalyzes the second step in GPI biosynthesis.	2.81981e-32
NC_010180.1\|WP_012259902.1\|305091_305799_-\|IS6-family-transposase	gnl\|CDD\|225853	COG3316, COG3316, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	8.1255e-72
NC_010180.1\|WP_012259899.1\|300540_301248_+\|IS6-like-element-ISBwe3-family-transposase	gnl\|CDD\|225853	COG3316, COG3316, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	1.18426e-69

>NC_010180.1|WP_012259903.1|306852_308562_-|hypothetical-protein
MGKSFIIQNQRSLNGETTNAVLVTLKSWQKFVEAFEKKYYSYKDTYLEDILQHMTYEERIADVEGFVEQAKPSFSRRAMSALAEKTGRKHKLYGITNADLEVFLYLHKKCYTNGVIPNVTIHMMWEDYKQYKEEFAHIQHSQFYIALKKLSIHNIIAIENGVDGRYTIKLTHFMNEETEKTNPYVYISPVVFTKAFFKLSVAAKKLFLDIAMQQHTETTLKRSLDKQDERGNKTHFGGMYRFLHKKYPHQIRAVIEELTTALPCTENPLFKICKMQKGVKHTKRYTTLYLSIHSDFLCTKESGEEQHRDPFTPKATYARKAKFIESVLQEMNIGELSSDMNKFIHVLKHTCHRQIRGVIRGLRDMVDRKEGYPTKIVYTLKKLLHQTSQYQILDTAAKEGIYPLIAQHIPKERNSDREQAVFNFGLHYSMYSLHSIKKMFKNVHALLKQKFAVPVTEESYHRNYLKYQEETLFRKYAYDQGVNLHAYIALEIEMREKLKVRGHKERTIPSDVREWFIEAIDKLPQEKLRVIELPKQFNLLEFMRTFEHLIRAGATITAPDQVLSAMEIK
>NC_010180.1|WP_193339773.1|305755_305908_-|hypothetical-protein
MAALKEVLVQKLQDNCNKSTNLGHTDTTNLKKVRDWYGKGICIQMETLSA
>NC_010180.1|WP_012259902.1|305091_305799_-|IS6-family-transposase
MEKEYVFKWKHYQPDIILLTVRWYLRYNLSFRDLVEMMEERGLSISHTTIMRWVHQYGPELDKRIRSHLKQTNDSWRVDETYIKVKGQWMYLYRAVDSKGNTIDFYLSKTRDQKAAKHFFKKALQSFHVSKPPVITVDKNPAYPIAIEQLKKEKSIPGGMRLRQQKYLNNIVEQDHRFIKKRIRSMLGFKCFDTATSILSGVEVMHMIKKEQVDLRDQSVQNQKEFIHQLFGLAA
>NC_010180.1|WP_002144315.1|304361_305009_+|lysozyme-family-protein
MKNTSKKQIIILFFISILGLGTMLGILYFNHKTNIQQNKALATEKRVLQYEPTLKKELEKYNLGGKTAVLLGIMYQESRGEGNDPMQSSESLGLKPNEIQETSLSIKQGVKHFAKMYKYGTEKDVSMDTIIQSYNMGPGYIDFIASQEVKQHSEDSAKKFSKMKVNQNPAMYTCGGNKNNFRYPYCYGDFTYATKVNEKTILIEELLRNVHDSSK
>NC_010180.1|WP_080515480.1|303936_304140_-|hypothetical-protein
MGQLVDMNGYSDNGEVIVQIINYGDIIPEEDLPPSNNQHHTRLNRLSKRKKLCTMQAFFMISLLNYS
>NC_010180.1|WP_040963222.1|303389_303965_+|replication-relaxation-family-protein
MNRFRCMSRDDIIDLHFQGLKNAVTCCNTVMKRLRRDGYVDANVLQHPYIYFPQPSSIRKTSQKIPHFLGIVDVYKQLVHYENPKLFEVEPKYRKEYMEPDAFTIWRRSPFFIEVQKSVYSKKLMQDKINRYELYFHNQEWHNEYWQPKASKFFPSILIITDKHYDVQSPYFRIFQANSIESFMNNLTVKS
>NC_010180.1|WP_012259900.1|302200_303367_+|DNA-translocase-FtsK
MGIIKEWVRTQRLRNQLMEVFGKAGLYTEHQTRGGKVPIYPKVHNVSSSAESVRYVFTIPNGLDPQKIEKKWFCFQQILGPNITIEGDVKKFVLHVFRSDAGLKPYNYCYKEWQPLLKGYRLPVVVGRDQFGKTITYDMVDSNTPHLLIAGETGSGKSSMVRVVLSTLIQYMSPDTLHLYLGDLKNSEFHFLRRVKHVKEVCMEEIEMKIMLQKMWKEIRERRKLMEEYEVDHIDAYNKLNPDHQKPYILLAIDEVAMLKDEKECMTTIEKISAVGRSLGVFLMLSMQRPDAKVLDGKLKLNMTVRIGFKCDSAINSNIMGTPGSEHLEQSGQMILKRNGLKKVQAPYLELSKAKQIVEPYRMSKGERILHNSLQEEMPLFGVLDDEE
>NC_010180.1|WP_001202663.1|301864_302185_+|hypothetical-protein
MRARKETIPFREFMDRSYKDKEQKIRKYNSLSPFAFLHMSDQVLHTYIALGVMGTILIGAVMLEKYLVRHDYISAAKFVSEGIYHGTRIGGVCLIGYVFVRIVIMF
>NC_010180.1|WP_002150963.1|301342_301573_-|helix-turn-helix-transcriptional-regulator
MFWKFGGKNRTKLGDFLDRNGFTQNDLEKTAKLSRPTVSKACNDKEYIPSPTVMKKILKVIRQIKPNVKSTDFWDM
>NC_010180.1|WP_012259899.1|300540_301248_+|IS6-like-element-ISBwe3-family-transposase
MEKENLFKWKHYQPELILLTVRWYLRYNLSFRNLVEMMEERGLSIAHTTIMRWVHQYGPQLEEKVRHHLKSTNDSWRVDETYIKVKGQWMYLYRAVDSKGNTIDFHLSKSRDKQAAKCFFKKALAFSYVSKPRVITVDKNPAYPVAIQALKEEKHMPEGIKLRQVRYLNNIVEQDHRFIKKRVRSMLGFKSFGTATSILAGVEAMHMIKKEQIDLRDQSVQNQKEFIHQLFGLTA
>NC_010180.1|WP_012259904.1|309839_311537_+|hypothetical-protein
MDNLLQMFRDALLISEPIYKKNEPLWNKWNAYFKDVKNNNNKVLTSPYASPSFTALVSWLEKKQESGVTLVQIYAKIDSYKEEIYKEIEGFIEKEFQDVAPSNSIILENDQNADKLNTVNHEDYYEVNNSAVYYKLRDGIAKNQFEEDEKSKVLQYPIETKSSNGVAQLSSHKDEDLRLTNTEESARWNTLVDDVMSNMDDLTADCLDAITIQWINEAKSPDEFIDFSYEQVLEMCNIPKTVVKNKEYYRAEDKIKIAKRIAALASIFIYLNDDNEVVVLNDRDDEGERVELKREVIKRLFVLDSVVLWRHSVTNEYMGIESCRIKPGSFLTNYLYGSNNTTALLSKKALEYNSYRHKYHKRLIRYLTWQWRIRQMYSSLKKPYSIGGDKGLLAVMDIPKDWKPNRIREQLENVLMDLENEKVISHWEYSDPLDEQQIWKRNWFKNYYANLGITILPPEEMLQSMDSGIGKKFIEEPQEQLPVVTVVEEVRETVEPVEQREKKIRDQILKVHNEKNVSIREIADEVSISPSTLSRFCNYKTKRLSKKALEKLTKWCERQEILEKM
>NC_010180.1|WP_012259905.1|311717_312194_+|GNAT-family-N-acetyltransferase
MKLNNWDEISIEKSTNIGKEEMELLLLADPSPEVVNGYLKQGDCFVLKKDAITVGIMILIPTRPETIEIINIAVSEKEQGKGYGKYLLGFAIDYAKKEKYKTIEIGTGNSSLMQLGLYQKCGFRITNVDRDFFLRNYEEEIYENGIQCIDMIRLTQYL
>NC_010180.1|WP_012259906.1|312920_314249_+|nucleotide-sugar-dehydrogenase
MVTVLNNEIKKTLVEKIVNKSACIGYIGLGYVGLPSALKCLEVGYTVRGFDKNLTKIEKLECGTSYISDIQDTEIQDALHTNRFFISTEMNYINECDVVVICVPTPLEKDSKQPDLTYIHSAVNELVKYIRKGTLIILESTTYPGTTREEILYKLEHETNFEIGTDIFVAYSPERIDPANKSFSIQDIIKIVGGVTPNCTDCAAAFYSHLIKGIHKVSSPEVAETAKLLENTYRFINIAFINEMTQICNELNINIWEVIDASGTKPFGFQKFYPGPGVGGHCIPIDPIYFKWIANNKDLATKMIDVAQEINENMPNYIIKRALQLLQDEDGKNVLMIGVAYKKNVNDARESSALDIMNGLMLEGYNVDYHDPFIEELIVDNHKVKKSINLTTNALNKYHLIIVHTDHDCINFNLLNGVNCLILDTRNILKDQSIYKKNIICL
>NC_010180.1|WP_012259907.1|314257_315415_+|DegT/DnrJ/EryC1/StrS-family-aminotransferase
MVEFIPFYRPEINDEDVEGVIRALKSGWLSKGPKVIEFEESLKEYLNTGHVVSCNSGTAALHLALLSLGIGVEDEVIVPSFTFCSSVNVIMHVGAKPVFVDIDEEDLCLDLHDVKRKITKKTKAIIAVHFAGYPAKLQELQKLCKEHGLFLIEDAAHALGTKYDNTLIGTHGDIICFSFYATKNITTGEGGALVTKNEEIAEKARLYGWHGITKNAWNRYGEKGSWRYDVLLPGFKYNMMDLQASLGISQLKRADEMIEKRRRIAEIYQKELKEIQEYITLPNYVNNPSIKHAWHLFVIKINPNSPISRDQMIQEMKKRNIGLSVHFIPVHMHPYYQERFNVHLPKTEEVFDQIISLPLYSALTENEVEHIVTSLKSLYQLKVGR
>NC_010180.1|WP_012259908.1|315421_316345_+|NAD-dependent-epimerase/dehydratase-family-protein
MKIGVIGGGGFIGKHVTKELIARGYEVIIFDKFKPSMDVPFEEIDILDIATLREKLINVDGVIHLAALVGVDNCRSNEEDVVRVNFEGTKNIVEVCIENGIGKLLFSSSSEVYGDGVSVPFKENDVKIPKSAYGKAKLMSEDFLKEYANNSFKVRVVRYFNVYGSQQNENFVISKFLKQAHNGENMTIYGDGQQIRCFSYISDIVNGTILAFEYERENFADFNIGNNKPISMEELAGKINELMGNKSEIEFLNLGDEGVRDSNIEIFRRIPSIEKAQLLLNYQPVISLNRGLEKIIEEKYGNTVSIS
>NC_010180.1|WP_012259909.1|316319_317561_+|DegT/DnrJ/EryC1/StrS-aminotransferase-family-protein
METQYLYPKNPKKIKYPIYPSFWSVFDHIYFLKSIYRSNHSNLKESLQTLYPNSEIILTNSGSSALVAGLKYLNIKKEDEVILSNFNCPNVIEAVLTVGAKPVLIDLTTDYSLSLNKIKKYSNENTRAIILTHVYGCHEDLEVINWARDNDIYIIDDAAQAMFSYQNEKSIGSLGDIGILSFGGTKPIPSIGGGALLLNRTVNDLCDMDEEKKAEVFLDYKNHLKTQLALRIKKNRLLSLFTDYWEKLGILPSYNDSKLDSLPEETEVIYPKTMSTLRSLLIDRHLKRMKKILEINIYNASLCYTMLQSIEEKYGVKIIFSAQNVYLNYFTIIFKEPSDRYECSVYLAGKGIQTCWNYLPLSEIPIFSKYATESENIEFLWSRVLSIPFKYPLRKKDLKYICSQILIYLEKKK
>NC_010180.1|WP_012259910.1|317572_318454_+|peptidoglycan-bridge-formation-glycyltransferase-FemA/FemB-family-protein
MEIEICTDAQYWDACMEEYNGSVFHCYEWGKLMELLPGVQFFPVLIKTRDTVVLSPIYVQDGRVLGSLIGYGGPVIIGQDKIDFAFYESIINRKFENKIQKLLLPITINPFQSYSDEKWEYKETYMLDLPNNFEDLWTSCSGKARTSVRYARKQNVEIRPIALEELDEFYNLYQEHNNSIGASYSFSREFFYYLFINLKERILFLGAFLEEELISSSIFIMDKQVLYYWININNIKGKNTQSSYLLLNVAFELAIHNKLKYADLGYSHNKGIARPKIYWGAVLKKCFCLKERI
>NC_010180.1|WP_012259911.1|318457_319147_+|WbqC-family-protein
MIISGHQPSYLPWYGFFEKIHKSDVFVFHDIAQFEKKGFLNRNRIKTSQGVSWLTVPMQMKNYKEIPLNKLKIDNTQDWERKHWKTIRINYSNAPYFNVYKDYLENFYSEKWDNLNSMNMNFIHFIIQELNIDTELYYASELEGITGKKSDFVLELCQKFNANTYYSGSLGQDYLIESDFEHENIEIIYQRIREYSYPQLFGEFIPHLSMLDVLLNCGPEETEKLIKGV
>NC_010180.1|WP_012259912.1|319153_319831_+|PIG-L-family-deacetylase
MNVLVFAAHPDDEIIGVGGTIAKHVEQGDDVHVVILAEGKSSRSKEYRELDLEVKSLSYKETEGACTTLGVTSFARLDFPDNRLDTLPLLDVVKEIEEHINKINPTIIYTQYGGDINIDHTVVYRAVMTATRPLPNSNIKWVFAYETLSSTEWNYNEKDKFLPNYFVNIEEHLETKLNAMKHYESELREFPHPRSIEAMKHNAFVWGAKSGYKAAEAFMLVRGTW
>NC_010180.1|WP_012259913.1|319842_320778_+|endonuclease
MLIPQVPFFGLDSKQIDLKWVEQGYGLEANIFDGESLHDKSYTTKFSDVLSFVQTLNPSLLTLHFPTDNADYLNSEFIKKQLYEFINLAIKYNAAGITVHANQFMNIAEFQTYNLIDNRKRIIEFFKMIDEEIKGTNIWIGVENLPIIGNLGDDFDPIFVYPEDFNDLVNLDLSNVGITWDICHWSITYLTRLGISKLLRQEEIEYKDFHKYINLMNHIKHLHFSSFKHLTIPYSEVRCFEGESPTNGSINEHLLHETLLKVKNQVSSRNIGIVFEVQETDYTNRVKSWETLNWFQKNITGIQANSNFLKI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NC_010180_1	1.1\|309335\|19\|NC_010180\|PILER-CR	309335-309353	19	NC_010180.1	309577-309595	0	1.0
NC_010180_1	1.1\|309335\|19\|NC_010180\|PILER-CR	309335-309353	19	NC_010180.1	309658-309676	0	1.0
NC_010180_1	1.2\|309416\|19\|NC_010180\|PILER-CR	309416-309434	19	NC_010180.1	309577-309595	1	0.947
NC_010180_1	1.2\|309416\|19\|NC_010180\|PILER-CR	309416-309434	19	NC_010180.1	309658-309676	1	0.947
NC_010180_1	1.3\|309497\|19\|NC_010180\|PILER-CR	309497-309515	19	NC_010180.1	309577-309595	0	1.0
NC_010180_1	1.3\|309497\|19\|NC_010180\|PILER-CR	309497-309515	19	NC_010180.1	309658-309676	0	1.0

1. spacer 1.1|309335|19|NC_010180|PILER-CR matches to position: 309577-309595, mismatch: 0, identity: 1.0

ggaatgcaagtaaagagga	CRISPR spacer
ggaatgcaagtaaagagga	Protospacer
*******************

2. spacer 1.1|309335|19|NC_010180|PILER-CR matches to position: 309658-309676, mismatch: 0, identity: 1.0

ggaatgcaagtaaagagga	CRISPR spacer
ggaatgcaagtaaagagga	Protospacer
*******************

3. spacer 1.2|309416|19|NC_010180|PILER-CR matches to position: 309577-309595, mismatch: 1, identity: 0.947

ggaatgtaagtaaagagga	CRISPR spacer
ggaatgcaagtaaagagga	Protospacer
******.************

4. spacer 1.2|309416|19|NC_010180|PILER-CR matches to position: 309658-309676, mismatch: 1, identity: 0.947

ggaatgtaagtaaagagga	CRISPR spacer
ggaatgcaagtaaagagga	Protospacer
******.************

5. spacer 1.3|309497|19|NC_010180|PILER-CR matches to position: 309577-309595, mismatch: 0, identity: 1.0

ggaatgcaagtaaagagga	CRISPR spacer
ggaatgcaagtaaagagga	Protospacer
*******************

6. spacer 1.3|309497|19|NC_010180|PILER-CR matches to position: 309658-309676, mismatch: 0, identity: 1.0

ggaatgcaagtaaagagga	CRISPR spacer
ggaatgcaagtaaagagga	Protospacer
*******************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Identity
NC_010180_1	1.1\|309335\|19\|NC_010180\|PILER-CR	309335-309353	19	NC_010180	Bacillus mycoides KBAB4 plasmid pBWB401, complete sequence	309334-309352	1.0
NC_010180_1	1.1\|309335\|19\|NC_010180\|PILER-CR	309335-309353	19	NC_010180	Bacillus mycoides KBAB4 plasmid pBWB401, complete sequence	309496-309514	1.0
NC_010180_1	1.1\|309335\|19\|NC_010180\|PILER-CR	309335-309353	19	NC_010180	Bacillus mycoides KBAB4 plasmid pBWB401, complete sequence	309577-309595	1.0
NC_010180_1	1.1\|309335\|19\|NC_010180\|PILER-CR	309335-309353	19	NC_010180	Bacillus mycoides KBAB4 plasmid pBWB401, complete sequence	309658-309676	1.0
NC_010180_1	1.1\|309335\|19\|NC_010180\|PILER-CR	309335-309353	19	NZ_CP020744	Bacillus mycoides strain Gnyt1 plasmid unnamed1, complete sequence	348425-348443	1.0
NC_010180_1	1.1\|309335\|19\|NC_010180\|PILER-CR	309335-309353	19	NZ_CP020744	Bacillus mycoides strain Gnyt1 plasmid unnamed1, complete sequence	348747-348765	1.0
NC_010180_1	1.1\|309335\|19\|NC_010180\|PILER-CR	309335-309353	19	NZ_CP020744	Bacillus mycoides strain Gnyt1 plasmid unnamed1, complete sequence	348908-348926	1.0
NC_010180_1	1.1\|309335\|19\|NC_010180\|PILER-CR	309335-309353	19	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	261857-261875	1.0
NC_010180_1	1.1\|309335\|19\|NC_010180\|PILER-CR	309335-309353	19	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	261938-261956	1.0
NC_010180_1	1.1\|309335\|19\|NC_010180\|PILER-CR	309335-309353	19	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	262099-262117	1.0
NC_010180_1	1.2\|309416\|19\|NC_010180\|PILER-CR	309416-309434	19	NC_010180	Bacillus mycoides KBAB4 plasmid pBWB401, complete sequence	309415-309433	1.0
NC_010180_1	1.3\|309497\|19\|NC_010180\|PILER-CR	309497-309515	19	NC_010180	Bacillus mycoides KBAB4 plasmid pBWB401, complete sequence	309334-309352	1.0
NC_010180_1	1.3\|309497\|19\|NC_010180\|PILER-CR	309497-309515	19	NC_010180	Bacillus mycoides KBAB4 plasmid pBWB401, complete sequence	309496-309514	1.0
NC_010180_1	1.3\|309497\|19\|NC_010180\|PILER-CR	309497-309515	19	NC_010180	Bacillus mycoides KBAB4 plasmid pBWB401, complete sequence	309577-309595	1.0
NC_010180_1	1.3\|309497\|19\|NC_010180\|PILER-CR	309497-309515	19	NC_010180	Bacillus mycoides KBAB4 plasmid pBWB401, complete sequence	309658-309676	1.0
NC_010180_1	1.3\|309497\|19\|NC_010180\|PILER-CR	309497-309515	19	NZ_CP020744	Bacillus mycoides strain Gnyt1 plasmid unnamed1, complete sequence	348425-348443	1.0
NC_010180_1	1.3\|309497\|19\|NC_010180\|PILER-CR	309497-309515	19	NZ_CP020744	Bacillus mycoides strain Gnyt1 plasmid unnamed1, complete sequence	348747-348765	1.0
NC_010180_1	1.3\|309497\|19\|NC_010180\|PILER-CR	309497-309515	19	NZ_CP020744	Bacillus mycoides strain Gnyt1 plasmid unnamed1, complete sequence	348908-348926	1.0
NC_010180_1	1.3\|309497\|19\|NC_010180\|PILER-CR	309497-309515	19	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	261857-261875	1.0
NC_010180_1	1.3\|309497\|19\|NC_010180\|PILER-CR	309497-309515	19	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	261938-261956	1.0
NC_010180_1	1.3\|309497\|19\|NC_010180\|PILER-CR	309497-309515	19	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	262099-262117	1.0

1. spacer 1.1|309335|19|NC_010180|PILER-CR matches to NC_010180 (Bacillus mycoides KBAB4 plasmid pBWB401, complete sequence) position: , mismatch: 0, identity: 1.0

ggaatgcaagtaaagagga	CRISPR spacer
ggaatgcaagtaaagagga	Protospacer
*******************

2. spacer 1.1|309335|19|NC_010180|PILER-CR matches to NC_010180 (Bacillus mycoides KBAB4 plasmid pBWB401, complete sequence) position: , mismatch: 0, identity: 1.0

ggaatgcaagtaaagagga	CRISPR spacer
ggaatgcaagtaaagagga	Protospacer
*******************

3. spacer 1.1|309335|19|NC_010180|PILER-CR matches to NC_010180 (Bacillus mycoides KBAB4 plasmid pBWB401, complete sequence) position: , mismatch: 0, identity: 1.0

ggaatgcaagtaaagagga	CRISPR spacer
ggaatgcaagtaaagagga	Protospacer
*******************

4. spacer 1.1|309335|19|NC_010180|PILER-CR matches to NC_010180 (Bacillus mycoides KBAB4 plasmid pBWB401, complete sequence) position: , mismatch: 0, identity: 1.0

ggaatgcaagtaaagagga	CRISPR spacer
ggaatgcaagtaaagagga	Protospacer
*******************

5. spacer 1.1|309335|19|NC_010180|PILER-CR matches to NZ_CP020744 (Bacillus mycoides strain Gnyt1 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

ggaatgcaagtaaagagga	CRISPR spacer
ggaatgcaagtaaagagga	Protospacer
*******************

6. spacer 1.1|309335|19|NC_010180|PILER-CR matches to NZ_CP020744 (Bacillus mycoides strain Gnyt1 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

ggaatgcaagtaaagagga	CRISPR spacer
ggaatgcaagtaaagagga	Protospacer
*******************

7. spacer 1.1|309335|19|NC_010180|PILER-CR matches to NZ_CP020744 (Bacillus mycoides strain Gnyt1 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

ggaatgcaagtaaagagga	CRISPR spacer
ggaatgcaagtaaagagga	Protospacer
*******************

8. spacer 1.1|309335|19|NC_010180|PILER-CR matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

ggaatgcaagtaaagagga	CRISPR spacer
ggaatgcaagtaaagagga	Protospacer
*******************

9. spacer 1.1|309335|19|NC_010180|PILER-CR matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

ggaatgcaagtaaagagga	CRISPR spacer
ggaatgcaagtaaagagga	Protospacer
*******************

10. spacer 1.1|309335|19|NC_010180|PILER-CR matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

ggaatgcaagtaaagagga	CRISPR spacer
ggaatgcaagtaaagagga	Protospacer
*******************

11. spacer 1.2|309416|19|NC_010180|PILER-CR matches to NC_010180 (Bacillus mycoides KBAB4 plasmid pBWB401, complete sequence) position: , mismatch: 0, identity: 1.0

ggaatgtaagtaaagagga	CRISPR spacer
ggaatgtaagtaaagagga	Protospacer
*******************

12. spacer 1.3|309497|19|NC_010180|PILER-CR matches to NC_010180 (Bacillus mycoides KBAB4 plasmid pBWB401, complete sequence) position: , mismatch: 0, identity: 1.0

ggaatgcaagtaaagagga	CRISPR spacer
ggaatgcaagtaaagagga	Protospacer
*******************

13. spacer 1.3|309497|19|NC_010180|PILER-CR matches to NC_010180 (Bacillus mycoides KBAB4 plasmid pBWB401, complete sequence) position: , mismatch: 0, identity: 1.0

ggaatgcaagtaaagagga	CRISPR spacer
ggaatgcaagtaaagagga	Protospacer
*******************

14. spacer 1.3|309497|19|NC_010180|PILER-CR matches to NC_010180 (Bacillus mycoides KBAB4 plasmid pBWB401, complete sequence) position: , mismatch: 0, identity: 1.0

ggaatgcaagtaaagagga	CRISPR spacer
ggaatgcaagtaaagagga	Protospacer
*******************

15. spacer 1.3|309497|19|NC_010180|PILER-CR matches to NC_010180 (Bacillus mycoides KBAB4 plasmid pBWB401, complete sequence) position: , mismatch: 0, identity: 1.0

ggaatgcaagtaaagagga	CRISPR spacer
ggaatgcaagtaaagagga	Protospacer
*******************

16. spacer 1.3|309497|19|NC_010180|PILER-CR matches to NZ_CP020744 (Bacillus mycoides strain Gnyt1 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

ggaatgcaagtaaagagga	CRISPR spacer
ggaatgcaagtaaagagga	Protospacer
*******************

17. spacer 1.3|309497|19|NC_010180|PILER-CR matches to NZ_CP020744 (Bacillus mycoides strain Gnyt1 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

ggaatgcaagtaaagagga	CRISPR spacer
ggaatgcaagtaaagagga	Protospacer
*******************

18. spacer 1.3|309497|19|NC_010180|PILER-CR matches to NZ_CP020744 (Bacillus mycoides strain Gnyt1 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

ggaatgcaagtaaagagga	CRISPR spacer
ggaatgcaagtaaagagga	Protospacer
*******************

19. spacer 1.3|309497|19|NC_010180|PILER-CR matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

ggaatgcaagtaaagagga	CRISPR spacer
ggaatgcaagtaaagagga	Protospacer
*******************

20. spacer 1.3|309497|19|NC_010180|PILER-CR matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

ggaatgcaagtaaagagga	CRISPR spacer
ggaatgcaagtaaagagga	Protospacer
*******************

21. spacer 1.3|309497|19|NC_010180|PILER-CR matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

ggaatgcaagtaaagagga	CRISPR spacer
ggaatgcaagtaaagagga	Protospacer
*******************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

204319 : 294845

Tupanvirus(33.33%)

protease,integrase,transposase

attL 197019:197036|attR 275182:275199

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
197019:197036	attL	NA	NA	NA	NA
WP_137058453.1\|204319_204457_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_002144064.1\|204805_206035_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_040963203.1\|206683_206905_+	prealbumin-like fold domain-containing protein	NA	NA	NA	NA
WP_085960939.1\|207601_207700_-	small, acid-soluble spore protein, alpha/beta type	NA	NA	NA	NA
WP_002144062.1\|207858_209031_-\|integrase	site-specific integrase	A0A142F1N9	Bacillus_phage	1.4e-06	25.0
WP_002144061.1\|209434_210436_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002144060.1\|210858_211053_+	hypothetical protein	NA	NA	NA	NA
WP_012259869.1\|211683_211911_-	hypothetical protein	NA	NA	NA	NA
WP_002144058.1\|212313_213072_-	DUF975 family protein	NA	NA	NA	NA
WP_000995769.1\|213824_214136_+	winged helix-turn-helix transcriptional regulator	A0A218MNF3	uncultured_virus	2.1e-07	43.1
WP_012259870.1\|214256_215345_+	saccharopine dehydrogenase	NA	NA	NA	NA
WP_012259871.1\|215956_217294_+	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_012259872.1\|217529_218237_+\|transposase	IS6-like element ISBwe2 family transposase	A0A1X9I6C6	Streptococcus_phage	6.0e-42	42.0
WP_002035038.1\|218355_219078_-	thioesterase	NA	NA	NA	NA
WP_002144020.1\|219094_219691_-	4'-phosphopantetheinyl transferase superfamily protein	NA	NA	NA	NA
WP_012259873.1\|220191_235098_-	non-ribosomal peptide synthetase	A0A2K9KZV5	Tupanvirus	2.7e-184	28.7
WP_012259874.1\|235094_241565_-	non-ribosomal peptide synthetase	A0A2K9KZV5	Tupanvirus	5.5e-190	28.8
WP_012259875.1\|241567_246124_-	non-ribosomal peptide synthetase	A0A2K9KZV5	Tupanvirus	1.8e-94	27.5
WP_002144016.1\|246138_247401_-	MFS transporter	NA	NA	NA	NA
WP_157380021.1\|247423_247549_-	hypothetical protein	NA	NA	NA	NA
WP_012259876.1\|247804_248512_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	7.9e-42	42.0
WP_012259877.1\|248759_250742_-	DUF3472 domain-containing protein	G1FGA4	Mycobacterium_phage	2.0e-10	44.0
WP_012259878.1\|250882_253132_-	fibronectin type III domain-containing protein	G1FGA4	Mycobacterium_phage	6.7e-10	44.0
WP_080515479.1\|253545_254115_+	recombinase family protein	M9Q1K0	Clostridium_phage	7.5e-11	26.7
WP_002144450.1\|254699_254888_-	RNA chaperone Hfq	NA	NA	NA	NA
WP_012259880.1\|255201_255945_+	type I methionyl aminopeptidase	NA	NA	NA	NA
WP_002144454.1\|256479_257343_-	hypothetical protein	NA	NA	NA	NA
WP_002144455.1\|257390_259715_-	hypothetical protein	NA	NA	NA	NA
WP_002144456.1\|259942_261004_-	alpha-xenorhabdolysin family binary toxin subunit A	NA	NA	NA	NA
WP_012259881.1\|262207_263032_-	hypothetical protein	NA	NA	NA	NA
WP_012259882.1\|263502_264936_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_002144461.1\|265010_265385_-	hypothetical protein	NA	NA	NA	NA
WP_002144462.1\|265484_265943_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002144463.1\|266141_266501_-	hypothetical protein	NA	NA	NA	NA
WP_002144465.1\|266942_267311_+	hypothetical protein	NA	NA	NA	NA
WP_012259885.1\|267691_270076_-	PBP1A family penicillin-binding protein	NA	NA	NA	NA
WP_040963204.1\|271597_272296_-	TetR family transcriptional regulator	NA	NA	NA	NA
WP_012259887.1\|272426_273779_+	MATE family efflux transporter	NA	NA	NA	NA
WP_012259888.1\|274388_274583_+	helix-turn-helix transcriptional regulator	A0A1V0E021	Clostridioides_phage	6.1e-05	41.9
WP_002146677.1\|274600_274987_+	hypothetical protein	NA	NA	NA	NA
WP_012259891.1\|277902_279594_-	hypothetical protein	NA	NA	NA	NA
275182:275199	attR	NA	NA	NA	NA
WP_012259892.1\|281470_283168_+	hypothetical protein	NA	NA	NA	NA
WP_002144339.1\|283309_283993_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_002191655.1\|284014_284647_+	sterol desaturase family protein	NA	NA	NA	NA
WP_002144332.1\|285906_286323_+	hypothetical protein	NA	NA	NA	NA
WP_012259893.1\|286343_287798_+	cell division protein FtsZ	NA	NA	NA	NA
WP_012259894.1\|287833_288571_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_012259895.1\|290655_293061_+	PAS domain S-box protein	A0A2K9L0Z8	Tupanvirus	3.0e-08	24.8
WP_040963205.1\|293954_294845_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA

DBSCAN-SWA_2

300540 : 305799

Bacillus_phage(66.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012259899.1\|300540_301248_+\|transposase	IS6-like element ISBwe3 family transposase	A0A1X9I6C6	Streptococcus_phage	1.3e-41	42.0
WP_002150963.1\|301342_301573_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_001202663.1\|301864_302185_+	hypothetical protein	A0A0S2GLK1	Bacillus_phage	2.1e-34	69.8
WP_012259900.1\|302200_303367_+	DNA translocase FtsK	A0A0S2GLG9	Bacillus_phage	9.5e-186	82.2
WP_040963222.1\|303389_303965_+	replication-relaxation family protein	W8CZ47	Bacillus_phage	1.7e-82	76.2
WP_080515480.1\|303936_304140_-	hypothetical protein	NA	NA	NA	NA
WP_002144315.1\|304361_305009_+	lysozyme family protein	A0A1W6JSC2	Bacillus_phage	2.6e-15	35.6
WP_012259902.1\|305091_305799_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.3e-41	42.4

DBSCAN-SWA_3

387715 : 397577

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012259965.1\|387715_389431_+	hypothetical protein	A7KUR3	Bacillus_phage	5.8e-22	29.4
WP_000108095.1\|389501_389684_+	hypothetical protein	A7KUR4	Bacillus_phage	8.5e-09	47.2
WP_040963215.1\|390439_390730_+	hypothetical protein	A7KUR4	Bacillus_phage	6.1e-09	42.2
WP_012259966.1\|390835_391333_+	hypothetical protein	A7KUR5	Bacillus_phage	4.0e-24	38.1
WP_012259967.1\|391338_392055_+	hypothetical protein	A7KUR6	Bacillus_phage	2.6e-16	44.8
WP_012259968.1\|392134_392578_+	hypothetical protein	NA	NA	NA	NA
WP_012259969.1\|392631_393201_+	hypothetical protein	NA	NA	NA	NA
WP_012259970.1\|393224_397577_+	hypothetical protein	A7KUR9	Bacillus_phage	5.5e-53	26.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NC_010184

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_010184_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_010184_1

1282147-1282274

Orphan

Consensus_repeat	Method
TCAGCAGGTTTTTGAGCTTCTGG	CRISPRCasFinder

2 spacers

The CRISPR arrays of NC_010184_1

>merge|NC_010184|1|1282147-1282274|CRISPRCasFinder
TCAGCAGGCTTTTGCTCAGCAGGTTTTTGTGTTTCGTTTTGAGTATTGTTGTTTTCAGCAGGTTTTTGAGCTTCTGGTTTAGCAACTTCTTCAGCAGGCTTTTGTTCAGCTGGTTTTTGAGTTTCCTC

>NC_010184|1|1|1282147-1282274|CRISPRCasFinder
TCAGCAGGCTTTTGCTCAGCAGG	TTTTTGTGTTTCGTTTTGAGTATTGTTGTTT
TCAGCAGGTTTTTGAGCTTCTGG	TTTAGCAACTTCTTCAGCAGGCTTTTGT
TCAGCTGGTTTTTGAGTTTCCTC

Protein	Signature genes	Signature genes Name	Protein_function
NC_010184.1\|WP_002011485.1\|1275422_1276472_+\|spermidine/putrescine-ABC-transporter-substrate-binding-protein-PotD	unknown	unknown	gnl\|CDD\|270308
NC_010184.1\|WP_002140905.1\|1271143_1272511_+\|aldehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143454
NC_010184.1\|WP_012260583.1\|1279582_1279999_+\|hypothetical-protein	unknown	unknown	unknown
NC_010184.1\|WP_002086860.1\|1283051_1284380_-\|(Fe-S)-binding-protein	unknown	unknown	gnl\|CDD\|223325
NC_010184.1\|WP_002011483.1\|1274583_1275384_+\|spermidine/putrescine-ABC-transporter-permease-PotC	unknown	unknown	gnl\|CDD\|224098
NC_010184.1\|WP_012260582.1\|1277289_1279482_+\|MMPL-family-transporter	unknown	unknown	gnl\|CDD\|225272
NC_010184.1\|WP_002140913.1\|1284376_1285789_-\|glycolate-oxidase-subunit-GlcD	unknown	unknown	gnl\|CDD\|273050
NC_010184.1\|WP_078175571.1\|1290553_1291273_+\|FadR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225097
NC_010184.1\|WP_002140912.1\|1281114_1281720_+\|DUF1648-domain-containing-protein	unknown	unknown	gnl\|CDD\|377929
NC_010184.1\|WP_002030528.1\|1287310_1288282_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|274824
NC_010184.1\|WP_012260584.1\|1280099_1281023_+\|RluA-family-pseudouridine-synthase	unknown	unknown	gnl\|CDD\|223638
NC_010184.1\|WP_002126137.1\|1288278_1288950_+\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|223816
NC_010184.1\|WP_002140916.1\|1288953_1290354_+\|HAMP-domain-containing-protein	unknown	unknown	gnl\|CDD\|274368
NC_010184.1\|WP_002140915.1\|1285906_1287022_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|226355
NC_010184.1\|WP_002030425.1\|1272748_1273732_+\|spermidine/putrescine-ABC-transporter-ATP-binding-protein-PotA	unknown	unknown	gnl\|CDD\|226361
NC_010184.1\|WP_012260581.1\|1276531_1277179_+\|phosphatase-PAP2-family-protein	unknown	unknown	gnl\|CDD\|239486
NC_010184.1\|WP_002030525.1\|1293598_1294309_+\|lactate-utilization-protein-C	unknown	unknown	gnl\|CDD\|224473
NC_010184.1\|WP_012260585.1\|1292177_1293599_+\|iron-sulfur-cluster-binding-protein	unknown	unknown	gnl\|CDD\|224062
NC_010184.1\|WP_002126118.1\|1273728_1274577_+\|spermidine/putrescine-ABC-transporter-permease-PotB	unknown	unknown	gnl\|CDD\|224097
NC_010184.1\|WP_002011587.1\|1291441_1292161_+\|(Fe-S)-binding-protein	unknown	unknown	gnl\|CDD\|223325

Protein	Function_ID	Function_description	E-value
NC_010184.1\|WP_002011485.1\|1275422_1276472_+\|spermidine/putrescine-ABC-transporter-substrate-binding-protein-PotD	gnl\|CDD\|270308	cd13590, PBP2_PotD_PotF_like, The periplasmic-binding component of ABC transporters involved in uptake of polyamines; possess the type 2 periplasmic binding fold. This family represents the periplasmic substrate-binding domain that functions as the primary high-affinity receptors of ABC-type polyamine transport systems. Polyamine transport plays an essential role in the regulation of intracellular polyamine levels which are known to be elevated in rapidly proliferating cells and tumors. Natural polyamines are putrescine, spermindine, and spermine. They are polycations that play multiple roles in cell growth, survival and proliferation, and plant stress and disease resistance. They can interact with negatively charged molecules, such as nucleic acids, to modulate their functions. Members of this family belong to the type 2 periplasmic-binding fold superfamily. PBP2 is comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	1.51611e-143
NC_010184.1\|WP_002140905.1\|1271143_1272511_+\|aldehyde-dehydrogenase	gnl\|CDD\|143454	cd07136, ALDH_YwdH-P39616, Bacillus subtilis aldehyde dehydrogenase ywdH-like. Uncharacterized Bacillus subtilis ywdH aldehyde dehydrogenase (locus P39616) most closely related to the ALDHs and fatty ALDHs of families 3 and 14, and similar sequences, are included in this CD.	0
NC_010184.1\|WP_002140912.1\|1281114_1281720_+\|DUF1648-domain-containing-protein	gnl\|CDD\|377929	pfam07853, DUF1648, Protein of unknown function (DUF1648). Members of this family are hypothetical proteins expressed by either bacterial or archaeal species. Some of these are annotated as being transmembrane proteins, and in fact many of these sequences contain a high proportion of hydrophobic residues.	8.30687e-10
NC_010184.1\|WP_002086860.1\|1283051_1284380_-\|(Fe-S)-binding-protein	gnl\|CDD\|223325	COG0247, GlpC, Fe-S oxidoreductase [Energy production and conversion].	5.55911e-92
NC_010184.1\|WP_002011483.1\|1274583_1275384_+\|spermidine/putrescine-ABC-transporter-permease-PotC	gnl\|CDD\|224098	COG1177, PotC, ABC-type spermidine/putrescine transport system, permease component II [Amino acid transport and metabolism].	3.7536e-96
NC_010184.1\|WP_012260582.1\|1277289_1279482_+\|MMPL-family-transporter	gnl\|CDD\|225272	COG2409, COG2409, Predicted drug exporters of the RND superfamily [General function prediction only].	1.5835e-92
NC_010184.1\|WP_078175571.1\|1290553_1291273_+\|FadR-family-transcriptional-regulator	gnl\|CDD\|225097	COG2186, FadR, Transcriptional regulators [Transcription].	4.24381e-67
NC_010184.1\|WP_002140913.1\|1284376_1285789_-\|glycolate-oxidase-subunit-GlcD	gnl\|CDD\|273050	TIGR00387, Glycolate_oxidase_subunit_glcD., glycolate oxidase, subunit GlcD. This protein, the glycolate oxidase GlcD subunit, is similar in sequence to that of several D-lactate dehydrogenases, including that of E. coli. The glycolate oxidase has been found to have some D-lactate dehydrogenase activity. [Energy metabolism, Other].	0
NC_010184.1\|WP_002030528.1\|1287310_1288282_+\|hypothetical-protein	gnl\|CDD\|274824	TIGR03866, PQQ_ABC_repeats, PQQ-dependent catabolism-associated beta-propeller protein. Members of this protein family consist of seven repeats each of the YVTN family beta-propeller repeat (see TIGR02276). Members occur invariably as part of a transport operon that is associated with PQQ-dependent catabolism of alcohols such as phenylethanol.	2.03566e-10
NC_010184.1\|WP_012260584.1\|1280099_1281023_+\|RluA-family-pseudouridine-synthase	gnl\|CDD\|223638	COG0564, RluA, Pseudouridylate synthases, 23S RNA-specific [Translation, ribosomal structure and biogenesis].	5.44719e-91
NC_010184.1\|WP_002126137.1\|1288278_1288950_+\|response-regulator-transcription-factor	gnl\|CDD\|223816	COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription].	1.97385e-92
NC_010184.1\|WP_002140916.1\|1288953_1290354_+\|HAMP-domain-containing-protein	gnl\|CDD\|274368	TIGR02966, Phosphate_regulon_sensor_protein_PhoR, phosphate regulon sensor kinase PhoR. Members of this protein family are the regulatory histidine kinase PhoR associated with the phosphate ABC transporter in most Proteobacteria. Related proteins from Gram-positive organisms are not included in this model. The phoR gene usually is adjacent to the response regulator phoB gene (TIGR02154). [Signal transduction, Two-component systems].	2.72466e-71
NC_010184.1\|WP_002140915.1\|1285906_1287022_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|226355	COG3835, CdaR, Sugar diacid utilization regulator [Transcription / Signal transduction mechanisms].	4.40622e-113
NC_010184.1\|WP_002030425.1\|1272748_1273732_+\|spermidine/putrescine-ABC-transporter-ATP-binding-protein-PotA	gnl\|CDD\|226361	COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism].	3.11644e-157
NC_010184.1\|WP_012260581.1\|1276531_1277179_+\|phosphatase-PAP2-family-protein	gnl\|CDD\|239486	cd03392, PAP2_like_2, PAP2_like_2 proteins. PAP2 is a super-family of phosphatases and haloperoxidases. This subgroup, which is specific to bacteria, lacks functional characterization and may act as a membrane-associated lipid phosphatase.	4.41771e-49
NC_010184.1\|WP_002030525.1\|1293598_1294309_+\|lactate-utilization-protein-C	gnl\|CDD\|224473	COG1556, COG1556, Uncharacterized conserved protein [Function unknown].	3.21978e-67
NC_010184.1\|WP_012260585.1\|1292177_1293599_+\|iron-sulfur-cluster-binding-protein	gnl\|CDD\|224062	COG1139, COG1139, Uncharacterized conserved protein containing a ferredoxin-like domain [Energy production and conversion].	0
NC_010184.1\|WP_002126118.1\|1273728_1274577_+\|spermidine/putrescine-ABC-transporter-permease-PotB	gnl\|CDD\|224097	COG1176, PotB, ABC-type spermidine/putrescine transport system, permease component I [Amino acid transport and metabolism].	1.79646e-95
NC_010184.1\|WP_002011587.1\|1291441_1292161_+\|(Fe-S)-binding-protein	gnl\|CDD\|223325	COG0247, GlpC, Fe-S oxidoreductase [Energy production and conversion].	6.72713e-62

>NC_010184.1|WP_002140912.1|1281114_1281720_+|DUF1648-domain-containing-protein
MIKYKYMLGIFFACLLLTLCIYPYLPTRMAVHWNENGGANEFMSKQVVVLFIPVLIIILHGLVYVILHNIYKFNEGEYFIINGFIKSITLFMMFVHLLILFINLGSIISFQTGLTIGISMFLFMFSKVFKKVKDREKEPIKLQKIRLVSRRIFQVMACSILFSLLLSLKWGFYLLISVISCGSILFMFYILYAYILESYET
>NC_010184.1|WP_012260584.1|1280099_1281023_+|RluA-family-pseudouridine-synthase
METKKKGEWCEITVPATWNGISIESLLKMEWEVPKKLLHQLRMEKGVTVNGEQRRWNELLKEGDKLQVHMFMEEEYGVEPEYGELNVVFEDDHVLIVNKQGQMDTHPSEKNGTGTLANLVAFHFQMQGLETKVRHIHRLDKDTTGGVVFAKHRIAGAIMDRLLMERKIKRTYAALVEGKVKKKQGTIDAAIGRDRHHATRRRVSPKGDQAITYYKVEKYFKKQNATLVTLQLETGRTHQIRVHMSYNGNPLVGDVLYGGQTTYMSGQALHAMKINFLHPITKEEIVVDVPFPTNLNDTMKKFERENR
>NC_010184.1|WP_012260583.1|1279582_1279999_+|hypothetical-protein
MFRYFKFKLNDTVQFAENDGHMYRIVGYRLEKGFYPKDEWTHIIYELLRDFDGYTMDAEEEEIVKVIQVEDEYYKIQEVSGYRYPVKMKQKQQVMKGEKIDDLLDTYNDYKRLADFFKDLLYEQKAEEVLQEMKRLRA
>NC_010184.1|WP_012260582.1|1277289_1279482_+|MMPL-family-transporter
MKTNVHKIDKWGKLGTFLYQFRYTVIVVLLLFAIVLGIFAPKLPGVLGGDGFQTEGDYQKTKEILDKDFKQSQDTLLLVFEKEKDTSHEDFQKRIEGIINQIEEKEKYESFHHPMQNKEMLQDGIGYATILFSGKTNKERMEKTLQFAGKIEKESNSVLKVTPTGYPKINQEINERTQNDLKVAEMIGLPIAFLVLLFSFGSLIASILPIVNGALSVISTMGILYFIGSDKELSIFVLNVAPMIGLALSIDFALLFVNRFREEVAKRTVKEAIAITYQTAGRAIVFSGLCVFVGLSGLFFFKIDYIQSVAISGMIVVIMSILFSLTLLPALLSLIGKRILKKNQAAPTPSNVWRKFAQFVMKHPIVMIIVVTTFIVICLLPLRTANLQFPGVEALPEKSDTRVAFEKYEEAFNKTVQTHADVTLVVETKKDITEKESLQKIEAVVQKLKDDKQVYKVKSVYDGLNGMKADQVAGMLQSPEAAKIAPVFEAYTKGNKTTMEVFLDTKPSTETAKQWIRDFKKNYKENDVTYYLGGMTTFQQELEDEIKDKVAIGMSVIFGSTFVILLFAFRSILIPIKAIIMNVLSLSATIGIVIWLFEGGHFGLEESSVLFVLPIFIFGLVFGLSMDYEVFLISRIHELYEETGDNDQATLEGLVSTSRIITSAALIMIVVTGAFAFTDILPVKQMGLGVALAIFLDATIIRLMLVPSLMKLFGDWNWWLPFRKKREKSS
>NC_010184.1|WP_012260581.1|1276531_1277179_+|phosphatase-PAP2-family-protein
MKKKLHQYELMCIILLFVLFSIIAWRVHVGGVTMMDTYVRDMVKGLQTESLVTFFTYFTKLGSAIGVITTLIISLLVFWKKRYYAAMIVYPMAILTTHLVNKGIKEIVKRDRPSLNEALDALGYSFPSGHAMLSIITFGFLAYIIAANLKSIAGKCGITISMGILIILIGLSRVILNVHYPTDILAGYCAGGILLIIAIYCHRLLTERLGLNNER
>NC_010184.1|WP_002011485.1|1275422_1276472_+|spermidine/putrescine-ABC-transporter-substrate-binding-protein-PotD
MKLVKRLAGIAISFSLAAGVLAGCGEKKEELNIYSWADNFDEQVLKDFEKKYNVKINYDKYASNEEMLAKLQAGGATYDLIQPSDYMVKTMAKMDLLAPLDKKNIPNIENLVSNFKTPAFDPENKYSLVYTWGVTGIAYNKKYVKETPTSWNDLWNEKYKGHVTLLNDSREVLGMGLKKNGFSNSTKEDAQLKTASADLQKLLPNLLAFDTDNIKQKFITEDAWIGTVWSGDAAFIAKDNKDVGYVVPKEGGTIWADTLAIPKGAKNKELAEKFMNYLLDEKVSVKNYESIGYSNPNEKAHPLHSKEYRDNHMIFLTKEELDRTEWLVDVDDKLKDYDRYWTELKTKGK
>NC_010184.1|WP_002011483.1|1274583_1275384_+|spermidine/putrescine-ABC-transporter-permease-PotC
MKKFLVSYSWLILLFLYFPMMVLMVYSFNDSRINAEWEGFTLHWYTDLFQKQDVIDAFVNSMTIAVITTIVTTVLGVIFAIALHRYKYRFEGAINGLVYLPILIPDILMGLSLLILFSQLGMELGKTTIIIAHITFSISFVVVILAARLSGMGRDLEEAANDLGATPWQTFRYVTFPAIAPGVISAALLTFTLSIDDFVISFFVSGPGSTTLPLYIYSMVKRGVSPEINALSTILIVVIVGLMVLSEIFRNKGADGEENSGGHLPL
>NC_010184.1|WP_002126118.1|1273728_1274577_+|spermidine/putrescine-ABC-transporter-permease-PotB
MKKGKLLALPTVVWLLLFFLIPLLFVLAFAFMQRGAYGTVEMKFTLDNIARVFDPLYMGTLWETVKIAVITTVLCLLIGYPFAYTITIVDRKYRSILLLLATIPFWINFLVRSYAWIVILRSQGLVNTLLLKLGIISEPLNLLYNTPSVILGMVYSLLPFMILPVYAAIEQLDKRKLEAAYDLGATPVKAFWNVTVPMTMSGITTGSILVFVSSIGMFVVSDVMGGSKVALIGNVIQNQFLGSRDWPFGSALSMIVVLFSVLLIYLYYRATKVYKYDGNGGE
>NC_010184.1|WP_002030425.1|1272748_1273732_+|spermidine/putrescine-ABC-transporter-ATP-binding-protein-PotA
MKKIIKVEAVEKHFGNQVIIPPLSLDIKEGEFLTILGPSGCGKTTLLRMIAGFETPTKGNLLLDDEKINDLPPYKRHMNLVFQHYALFPHMNVEKNICFGMKMQKVSAAEQKERAEEAMRLTQLLEFRNRKPSKLSGGQQQRVAIARAIVNNPRVLLLDEPLGALDFKLRKDLQRELKNLQRNLGITFIYVTHDQEEAMSMSDRIVVMNKGHIEQVGTPKEIYNKPKTLFVATFIGENNIVKNGENYVAVRPENVKVRSVEEPILKEYHLGHIEDIEFVGNMEKLYVREEKTAELLMAYQTAEEATQWSIGDNVYVGWEQEDEVTLN
>NC_010184.1|WP_002140905.1|1271143_1272511_+|aldehyde-dehydrogenase
MSISSIVNKQKEYFYKGHTRSLETRKNNLKKLYEGIQRFEDEIFQALKLDLNKSVHESFTTEIGYVLKEISFQMKHISSWSKPKRVRTALTHFGSKGKVVPEPYGVTLIIAPWNYPFQLAIAPLVGALAAGNTVVLKPSELTPNVSKVLTRMLGELFPEELVSVVEGGAEESTALLKEPFDYIFFTGSVGVGKVVMEAAAKKLTPLTLELGGKSPCIVHKDAKLDVTARRIVWGKFLNAGQTCVAPDYMYVHSSVKEQLIEALRHEIAEQYGKDALQNDNYVRIVSERHFERLCTFLQDGKPVIGGNYTKETLHIEPTVLTNVTWQSAVMEDEIFGPILPIIEYDKIEEVIETIQHHPKPLALYVFSEDRKVQKKVTSNISYGGGCINDVVYHLATPYLPFGGVGSSGLGSYHGEQSFRTFSHYKSILSQSTAFDMKIRYSSTKSALKFIRKLLK
>NC_010184.1|WP_002086860.1|1283051_1284380_-|(Fe-S)-binding-protein
MTTLNKENIQKEFKERLSEDELLNCMRCGFCLPTCPTYIQSGYKESHSPRGRIALMKAVVDGLIEPDEDVEDTLNVCLGCRACEPVCPSGVNYGHLLEEARDIINQNKKFSMPVRAVRKVVFEGLFPHQNRMRTLTGLIGFYQRSGLQTLTHKTGIMKLFPETLATMDLVLPKVPKMKAMKDRPEFLPAEVAKKKQVAFFTGCLMDTMFLETNNATMKLLQLAGCDIVIPKTQSCCGALHGHAGEKSGAKELAKRNIEAFEDLNIDYIITNAGGCGAYLVDYDYLLKDDPKWAERAKQFVSKIKDITAILVELDFHKRNDLRLTPQIITYQDSCHLRNVMRTSSEPRMLLEAIQGATYREMKDADRCCGSAGIYNIVHSELSMEFLDYKMDRVHETDAATIVTANPGCLLQMKLGIEREGLSHKMRGIHIVDLLLEAIETNS
>NC_010184.1|WP_002140913.1|1284376_1285789_-|glycolate-oxidase-subunit-GlcD
MLEKQIIDSFVSIVGEDNVDTSNMGRLTYSYDATPNFQAMPDAVIAPRNTNEIADVLKVCNTHKIPVYVRGSGTNLCAGTCPLEGGIVLIFRHMNNILEIDEENLTITVQAGVITLDIIKAVEEKSLFYPPDPSSMKISTIGGNINENSGGLRGLKYGVTRDYVMGLELVLPNGDIIRTGGKLAKDVAGYDLTRLFIGSEGTLGVVTEAILKLVPMPETKKTMLALYEDINEAARAVSAIIANKIIPATLEFLDQPTIEVVEEFAQIGLPTDVKAILLIEQDGPPEVVNRDIEKMANVCRAMNAVDVRVAKDEAEADALRTARRSALSALARLKPTTILEDATVPRSQIAPMVEAINAIAKKYNIPICTFGHAGDGNLHPTCMTDARNEEEMHRAEQAFAEIFAKAIELGGTITGEHGVGAMKAPYLEMKLGKEGIAAMQGIKQAFDPNNIMNPGKMFAKDSRKRVVVER
>NC_010184.1|WP_002140915.1|1285906_1287022_-|helix-turn-helix-domain-containing-protein
MLFPDLANKIVREVRRLITENIIIINIQGVIIASTDAERIGQFHEGALRCAKQKKTVIITKDDERRLQGVKAGMNLPLLFHDEVIGVIGITGEPENISQYGEILRKMTELLIHENYFLEQLELEHRSYEAFVFDWLQNTDWSPSFLDRAKTLGIDLYKKKQLILLSIAQDNTMLQRKIWQHMRNILAKENLFVRWGNDRFILFTTIQSKEQTFQFLKRLKQDCETLFSITLYIGIGQTVTPSNMNLSYEQALRALSVSLETKKIVFNEDLRLEMCLQDISTETREQFLERTIENLVSSPELMHTLRLFIDYNQSYKQTAEQLHIHINTLHYRLKKIEEHTGLDPKQFKDLNVLYFALLLLDNHTKNNDKID
>NC_010184.1|WP_002030528.1|1287310_1288282_+|hypothetical-protein
MRKYVFLLCFLFLLVGCQGSSYTPIAKDKSVIITTNIKEGSISFIDKKTKKLLTTWELNEPIAGVTLLPNGEEILVYGKQLEYMYVYSLAEGRQVDKYKTGKGIANVIASDDGTQLFAADQNEQKVRFFAIKGKETGSVSTGKGPITMVEHHNQLSVLNFYDTKLTTIDTKKKEVIQSFMIPPASTGATVSADGKEIWIGGHGDGSQVNEKVLVYSLQSGEMMRSLHAPFMPVNITKDDKYVYALSHGSNTLRKFDASTYQEVGFVEVGSNPFAFLKSGAEGYVASYDSDEVCVMDMKNMKIKQTIKVGKGPFQLIEREGEGQ
>NC_010184.1|WP_002126137.1|1288278_1288950_+|response-regulator-transcription-factor
MSKYNVLVVDDESDMRQLVGMYLDNFGYEWGEAENGKEALRKLETDHYDFVVLDIMMPEMDGLSVCKEIRKTSDVPIIFLTAKGEEWNRVNGLRMGADDYIVKPFSPGELIARMEAVLRRYTKQEQQEEIQFGPILINEKSRRVETNGETIPLTVKEFDLLYFLCQHNGQVFSREQLLEKVWGYDYAGSTRTVDTHVKTMRLKLGESGNYIQTVWGVGYKFEV
>NC_010184.1|WP_002140916.1|1288953_1290354_+|HAMP-domain-containing-protein
MFTMVQKLWLTVVCAVCVTVSFLYFVSLYSYEKLYVDNLKDSLVMEGKRLATQYDKREGVSTFEEKVRAYDQISSSDVLFVYNPRDLSACLPFDIHHHSLISEGDRQALLDGKTVTKIGYEEHFDRNIMGVVIPVLDNKKLVGIVYSYIPLKSIKDLIFDMGLILAPLALAMILITIWIGRKIIIAITRPLSQMERVANHLATGDFSERITISSEDEIGRLGKAFNKMANSLETEDVKRKEFLANVSHELRTPLSYIKGYSEAILDGVAKGPQQEKVTQLIHKEAGRMQRLVHDLLDLAQLEGEHFPLKKQPIVFSQLIEDVLNTYELQFVEKNLRISTNLNPEIIVMIDEDRMQQVLHNVLDNAIRYTNQNGDIIITLKQIDDYCELHIKDTGIGIDREHLENLGERFYRVDKARSRQHGGTGLGLAIVRQIVHIHDGEWRIESEKGKGTTVSIKLKAQDEESIF
>NC_010184.1|WP_078175571.1|1290553_1291273_+|FadR-family-transcriptional-regulator
MEYKSIKPKKIYEEVSEAILTMIKNGTLKPGDKLLPVHQLAEQFQVGRSAVREALSALRAMGLIEMKQGEGTYVRNFDPSSLTKSLNNKLLMKKEDILNLLEVRKVLEVGAVRAAAAKRTEANLQNMKQWLDEMAKSIGDEKAGEKADFHFHMGIAESSHNNILLELMNHVSEMIAETIGESRRIILYGEQTTSERLLEEHQSIYDAVLKQDVELAQQAMLDHLTNVEHIVTGKSDINS
>NC_010184.1|WP_002011587.1|1291441_1292161_+|(Fe-S)-binding-protein
MKVTLFVTCLVDMFETNVGKATVEVLERLGCEIEFPEAQVCCGQPAYNSGHVEAAKEAMKHMIETFEDAEYIVTPSGSCATMFHEYPHVFKDDPKWAKRAQKVADKTYEFTQFIVDVLKVTDVGASLPGIATIHKSCHMTRLLGVKEAPGILLSSVKGLIVRELPNVQNCCGFGGTFSVKMTPISEQMVDEKVDSVMETGADYLIGADCGCLLNIGGRIERLGKEVKVMHIAEVLNSRS
>NC_010184.1|WP_012260585.1|1292177_1293599_+|iron-sulfur-cluster-binding-protein
MSMKISEKKFNDRVGDGIQDSFMRGAVSSAQTRLYTNRLKAADELGNWEEWRELGEQIRQHTLENLDYYLMQLSENVSKRGGHVYFAKTKEDAAKYIQDVAKKKQAKKVVKSKSMVTEEISMNHALEEIGCEVLESDLGEYILQVDNDPPSHIIAPALHKNRTQIRDVFKEKLGYENSDDPYEMTKFVRKQLREKFMDAEIGVTGCNFAVANTGSLCLVTNEGNADLVMSIPKTQIAVMGMERMVPTMEELDVLVGLLCRSAVGQKLTSYVTVAGPIQEEEVDGPEEFHLVVVDNGRSQILGSEFRSILQCIRCAACVNVCPVYRHVGGHSYGSIYSGPIGAVLTPLLGGYDDYKELPYASSLCGACTEACPVKIPLHDLLLKHRQVIVEQEGRAPLAEKLAMKMFSMGASSAALYKMGSKMAPAAMSPFTSGNRVSKGVGPLKNWTDIREFPAPSKERFRDWYKNHKKGGDK
>NC_010184.1|WP_002030525.1|1293598_1294309_+|lactate-utilization-protein-C
MTGLIQNRESFLDNIAKELGRARKTEGVERPAWKSNVNVETLKDYSQEELLEVFKKQCTNIHTTVVETTNDRLREDIQKVIVENGGGPIILSADERFDSYGLTSLFKEELPKQNVEVNVWDPEKKEENMRIAEKANIGIAFSDYTLAESGTIVVQSHKGQGRSLHFLPTVYFAIIPRETLVPRITQAVQDMNSRVEKGEAVASCINFITGPSNSADIEMNLVVGVHGPLKAVYFIV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_010184_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_010184_2

2320602-2321230

Orphan

Consensus_repeat	Method
AACNGGAGAAACAGGNGNAACNGGAGNAACAGGNGNAACNGGAG	CRT

8 spacers

The CRISPR arrays of NC_010184_2

>merge|NC_010184|2|2320602-2321230|CRT
AACAGGAGAAACAGGGGCAACCGGAGCAACAGGAGCAACAGGAGTAACAGGAGAAACAGGGGCAACCGGAGCAACAGGAGAAACAGGGGCAACCGGAGCAACAGGAGTAACAGGAGAAACAGGGGCAACCGGAGTAACAGGAGAAACAGGGGCAACCGGAGCAACAGGAGTAACAGGAGAAACAGGGGCAACCCGAGCAACAGGAGTAACAGGAGAAACAGGGGCAACCGGAGCAACAGGAGTAACAGGAATAACAGGAGAAACAGGAATAACGGGAGAAACAGGGGCAACCGGAGTAACAGGAGAAACAGGGGCAACCGGAGCAACCGGAGCAACAGGAGTAACAGGAGAAACAGGGGCAACCGGAGCAACAGGAGTAACAGGAGAAACAGGGGCAACCGGAGCAACAGGAGTAACAGGAATAACAGGAATAACAGGAGAAACAGGAATAACGGGAGAAACAGGGGCAACCGGAGCAACCGGAGAAACAGGAATAACCGGAGAAACAGGAATAACGGGAGTAACAGGGGCAACCGGAGCAACAGGAGCAACCGGAGAAACAGGAATAACGGGAGTAACAGGGGCAACCGGAGAAACAGGAGAAACAGGAATAACCGGCCCAACGGGAA

>NC_010184|2|1|2320602-2321230|CRT
AACAGGAGAAACAGGGGCAACCGGAGCAACAGGAGCAACAGGAG	TAACAGGAGAAACAGGGGCAACCGGAGC
AACAGGAGAAACAGGGGCAACCGGAGCAACAGGAGTAACAGGAG	AAACAGGGGCAACCGGAGT
AACAGGAGAAACAGGGGCAACCGGAGCAACAGGAGTAACAGGAG	AAACAGGGGCAACCCGAGCAACAGGAGT
AACAGGAGAAACAGGGGCAACCGGAGCAACAGGAGTAACAGGAA	TAACAGGAGAAACAGGAAT
AACGGGAGAAACAGGGGCAACCGGAGTAACAGGAGAAACAGGGG	CAACCGGAGCAACCGGAGCAACAGGAGT
AACAGGAGAAACAGGGGCAACCGGAGCAACAGGAGTAACAGGAG	AAACAGGGGCAACCGGAGCAACAGGAGTAACAGGAATAACAGGAAT
AACAGGAGAAACAGGAATAACGGGAGAAACAGGGGCAACCGGAG	CAACCGGAGAAACAGGAAT
AACCGGAGAAACAGGAATAACGGGAGTAACAGGGGCAACCGGAG	CAACAGGAGCAACCGGAGAAACAGGAATAACGGGAGTAACAGGGGC
AACCGGAGAAACAGGAGAAACAGGAATAACCGGCCCAACGGGAA

Protein	Signature genes	Signature genes Name	Protein_function
NC_010184.1\|WP_002141760.1\|2328470_2329340_+\|sigma-70-family-RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|236600
NC_010184.1\|WP_002141757.1\|2324262_2324895_-\|cupin-domain-containing-protein	unknown	unknown	gnl\|CDD\|380440
NC_010184.1\|WP_012260929.1\|2312475_2314230_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224055
NC_010184.1\|WP_002012883.1\|2321561_2321852_-\|DUF4183-domain-containing-protein	unknown	unknown	gnl\|CDD\|372730
NC_010184.1\|WP_012260933.1\|2318122_2318707_-\|LysE-family-transporter	unknown	unknown	gnl\|CDD\|182377
NC_010184.1\|WP_002085565.1\|2329839_2330433_+\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|226607
NC_010184.1\|WP_012260931.1\|2316176_2317037_-\|hypothetical-protein	unknown	unknown	unknown
NC_010184.1\|WP_002035104.1\|2326782_2327088_+\|DUF5519-family-protein	unknown	unknown	gnl\|CDD\|375228
NC_010184.1\|WP_012260928.1\|2309746_2310436_+\|MOSC-domain-containing-protein	unknown	unknown	gnl\|CDD\|225167
NC_010184.1\|WP_002127357.1\|2311616_2312213_+\|DUF1349-domain-containing-protein	unknown	unknown	gnl\|CDD\|377771
NC_010184.1\|WP_012260934.1\|2319704_2320154_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|375999
NC_010184.1\|WP_012260937.1\|2327182_2328493_+\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|366721
NC_010184.1\|WP_012260930.1\|2314222_2316019_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224055
NC_010184.1\|WP_002035103.1\|2325188_2326577_-\|HD-domain-containing-protein	unknown	unknown	gnl\|CDD\|213552
NC_010184.1\|WP_002031966.1\|2310698_2311583_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|379240
NC_010184.1\|WP_012260936.1\|2322341_2323643_+\|collagen-like-repeat-preface-domain-containing-protein	unknown	unknown	gnl\|CDD\|274746
NC_010184.1\|WP_002085567.1\|2329375_2329534_-\|hypothetical-protein	unknown	unknown	unknown
NC_010184.1\|WP_002085564.1\|2330781_2331894_+\|toxic-anion-resistance-protein	unknown	unknown	gnl\|CDD\|377557
NC_010184.1\|WP_002012881.1\|2318824_2319382_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|380339
NC_010184.1\|WP_012260932.1\|2317218_2317980_-\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|372681

Protein	Function_ID	Function_description	E-value
NC_010184.1\|WP_002141760.1\|2328470_2329340_+\|sigma-70-family-RNA-polymerase-sigma-factor	gnl\|CDD\|236600	PRK09636, PRK09636, RNA polymerase sigma factor SigJ; Provisional.	1.59406e-160
NC_010184.1\|WP_002141757.1\|2324262_2324895_-\|cupin-domain-containing-protein	gnl\|CDD\|380440	cd20306, cupin_OxDC-like, Oxalate decarboxylase (OxDC)-like cupin domain. This subfamily contains bacterial and eukaryotic cupin domains of proteins homologous to oxalate decarboxylase (OxDC; EC 4.1.1.2) such as MSMEG_2254, a putative OxDC from Mycobacterium smegmatis. OxDC is a manganese-dependent bicupin that catalyzes the conversion of oxalate to formate and carbon dioxide, utilizing dioxygen as a cofactor. It is evolutionarily related to oxalate oxidase (OxOx or germin; EC 1.2.3.4) which, in contrast, converts oxalate and dioxygen to carbon dioxide and hydrogen peroxide. OxDC is classified as a bicupin because it contains two cupin folds with each domain containing one manganese binding site, with four manganese binding residues (three histidines and one glutamate) conserved as well as a number of hydrophobic residues.	5.4497e-56
NC_010184.1\|WP_012260929.1\|2312475_2314230_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	8.80424e-165
NC_010184.1\|WP_002012883.1\|2321561_2321852_-\|DUF4183-domain-containing-protein	gnl\|CDD\|372730	pfam13799, DUF4183, Domain of unknown function (DUF4183). This domain of unknown function contains a highly conserved ING motif.	6.07625e-13
NC_010184.1\|WP_012260933.1\|2318122_2318707_-\|LysE-family-transporter	gnl\|CDD\|182377	PRK10323, PRK10323, cysteine/O-acetylserine transporter.	8.88321e-34
NC_010184.1\|WP_002085565.1\|2329839_2330433_+\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|226607	COG4122, COG4122, Predicted O-methyltransferase [General function prediction only].	1.21303e-34
NC_010184.1\|WP_002035104.1\|2326782_2327088_+\|DUF5519-family-protein	gnl\|CDD\|375228	pfam17648, DUF5519, Family of unknown function (DUF5519). This is a family of unknown function.	2.25537e-32
NC_010184.1\|WP_012260928.1\|2309746_2310436_+\|MOSC-domain-containing-protein	gnl\|CDD\|225167	COG2258, COG2258, Uncharacterized protein conserved in bacteria [Function unknown].	1.59313e-86
NC_010184.1\|WP_002127357.1\|2311616_2312213_+\|DUF1349-domain-containing-protein	gnl\|CDD\|377771	pfam07081, DUF1349, Protein of unknown function (DUF1349). This family consists of several hypothetical bacterial proteins but contains one sequence from Saccharomyces cerevisiae. Members of this family are typically around 200 residues in length. The function of this family is unknown.	3.83901e-60
NC_010184.1\|WP_012260934.1\|2319704_2320154_-\|hypothetical-protein	gnl\|CDD\|375999	pfam18573, BclA_C, BclA C-terminal domain. This is the C-terminal domain of BclA (Bacillus collagen-like protein of anthracis) which is expressed on spores of Bacillus species. Trimers of the C-terminal domain (CTD) form the tips of the spore's hair-like nap and are the immunodominant target of vertebrate antibodies and drive trimerization. Structure analysis indicate the C-terminal region of the peptide folding into an all-beta structure with a jelly-fold topology, similar to the first human complement C1q, a member of the tumor necrosis factor (TNF)-like family. The C-terminal globular domain has been shown to be located on the exterior of the exosporium, and therefore is critical in determining the immunogenicity of the spore in a mammalian host.	2.51458e-30
NC_010184.1\|WP_012260937.1\|2327182_2328493_+\|FAD-dependent-oxidoreductase	gnl\|CDD\|366721	pfam01593, Amino_oxidase, Flavin containing amine oxidoreductase. This family consists of various amine oxidases, including maze polyamine oxidase (PAO) and various flavin containing monoamine oxidases (MAO). The aligned region includes the flavin binding site of these enzymes. The family also contains phytoene dehydrogenases and related enzymes. In vertebrates MAO plays an important role regulating the intracellular levels of amines via there oxidation; these include various neurotransmitters, neurotoxins and trace amines. In lower eukaryotes such as aspergillus and in bacteria the main role of amine oxidases is to provide a source of ammonium. PAOs in plants, bacteria and protozoa oxidase spermidine and spermine to an aminobutyral, diaminopropane and hydrogen peroxide and are involved in the catabolism of polyamines. Other members of this family include tryptophan 2-monooxygenase, putrescine oxidase, corticosteroid binding proteins and antibacterial glycoproteins.	4.95209e-27
NC_010184.1\|WP_012260930.1\|2314222_2316019_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	0
NC_010184.1\|WP_002035103.1\|2325188_2326577_-\|HD-domain-containing-protein	gnl\|CDD\|213552	TIGR00691, PppGpp_synthetase., (p)ppGpp synthetase, RelA/SpoT family. The functions of E. coli RelA and SpoT differ somewhat. RelA (EC 2.7.6.5) produces pppGpp (or ppGpp) from ATP and GTP (or GDP). SpoT (EC 3.1.7.2) degrades ppGpp, but may also act as a secondary ppGpp synthetase. The two proteins are strongly similar. In many species, a single homolog to SpoT and RelA appears reponsible for both ppGpp synthesis and ppGpp degradation. (p)ppGpp is a regulatory metabolite of the stringent response, but appears also to be involved in antibiotic biosynthesis in some species. [Cellular processes, Adaptations to atypical conditions].	3.37237e-88
NC_010184.1\|WP_002031966.1\|2310698_2311583_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|379240	pfam13527, Acetyltransf_9, Acetyltransferase (GNAT) domain. This domain catalyzes N-acetyltransferase reactions.	3.03145e-15
NC_010184.1\|WP_012260936.1\|2322341_2323643_+\|collagen-like-repeat-preface-domain-containing-protein	gnl\|CDD\|274746	TIGR03721, exospore_TM, BclB C-terminal domain. This domain occurs as the C-terminal region in a number of proteins that have extensive collagen-like triple helix repeat regions. Member domains are predicted by TmHMM to have four or five transmembrane helices. Members are found mostly in the Firmicutes, but also in Acanthamoeba polyphaga mimivirus. Members include spore surface glycoprotein BclB from Bacillus anthracis, a protein of the exosporium. The exosporium is an additional outermost spore layer, lacking in B. subtilis and most other spore formers, consisting of a basal layer and, above it, a nap of fine filaments.	2.74872e-36
NC_010184.1\|WP_002085564.1\|2330781_2331894_+\|toxic-anion-resistance-protein	gnl\|CDD\|377557	pfam05816, TelA, Toxic anion resistance protein (TelA). This family consists of several prokaryotic TelA like proteins. TelA and KlA are associated with tellurite resistance and plasmid fertility inhibition.	1.39618e-48
NC_010184.1\|WP_002012881.1\|2318824_2319382_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|380339	cd02209, cupin_XRE_C, XRE (Xenobiotic Response Element) family transcriptional regulators, C-terminal cupin domain. This family contains transcriptional regulators containing an N-terminal XRE (Xenobiotic Response Element) family helix-turn-helix (HTH) DNA-binding domain and a C-terminal cupin domain. Included in this family is Escherichia coli transcription factor SutR (YdcN) that plays a regulatory role in sulfur utilization; it regulates a set of genes involved in the generation of sulfate and its reduction, the synthesis of cysteine, the synthesis of enzymes containing Fe-S as cofactors, and the modification of tRNA with use of sulfur-containing substrates. This family belongs to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold capable of homodimerization.	4.04056e-20
NC_010184.1\|WP_012260932.1\|2317218_2317980_-\|glycosyltransferase-family-2-protein	gnl\|CDD\|372681	pfam13704, Glyco_tranf_2_4, Glycosyl transferase family 2. Members of this family of prokaryotic proteins include putative glucosyltransferases,.	2.30888e-10

>NC_010184.1|WP_012260934.1|2319704_2320154_-|hypothetical-protein
MSNTGPTGSTGINVTTNSMFANNTVGGTVSVVLGGTNILLSNNQSLDSFAVNSANDLFTVPVTGRYYLSYQINTTTVLLAGSRLILNGSTSLLSSILSPALSTSSYNNNLITILNAGNTISLQLFGLLSIVNLVGGGSTGASLTIIRVD
>NC_010184.1|WP_002012881.1|2318824_2319382_+|helix-turn-helix-domain-containing-protein
MEEIQLILAKNIKAIREKEKLSLEKVSQLTGVSKTMIGQIERGDSSPTLTTIWKIANGLKVSFTSLINNPQPDTKVVLRNDVQVLSEDNGRYKVYPSFPFQDDRNFEIYTVEIETEGKLSSEGHKEGTEEFITVFEGELTIEINDCQYTLNSGDSIRFKADRPHSYHNSGRTLTRLSMTIYYPAS
>NC_010184.1|WP_012260933.1|2318122_2318707_-|LysE-family-transporter
MPLFSFLLFVFISSFTPGPNNFLAMTYANQLGLKRSMQFCFGVAFGFFLLTSLCSFFNIVLINILPKIELPLKILGVAYMLYLAIKILTSKGSTDPDEKDNKNLFTVGIFLQFVNPKGILFGLTVVSTFILPYYNSYSSYLLFSLFLGVVGLMSTFSWSLFGSMFQKLLLKHNQFFNIIMAVLLIFSAISIVIN
>NC_010184.1|WP_012260932.1|2317218_2317980_-|glycosyltransferase-family-2-protein
MLYKEEVFIKTTLSSHFYNEEYLLPWWLMHHTKLFDHGILINRGSTDRSVEICKLFAPHWEIRNSKVVEFDAYLVDQEVMEIEKEVTGWKMVLNTTEFLWCFNKEQFFTSPNSNGGNRFSIRVIKMIDERYHGILIHPSPNLLYPNGRLLHNIFHGDYRVGRHGSHYPYSIYMQPAFVFKFFYSPWNKAMKKRKLQIGPTLSKHSVQRGLGSHHLTTLEKLEKNYTHYVTLTTDLRLIPEYQTVFPDLCFPNY
>NC_010184.1|WP_012260931.1|2316176_2317037_-|hypothetical-protein
MADYFYKHGKKYYKNYSYSHHKKENCFIETHTIAGSNIPLDIVVPANTSRIVFEDSTNNHNKTLLQFHVPGTSAPIVITIRTRNARRPITATIATGETRIFQVENFESLTVTNNTNTSSDIGIFIQKTFCICCDDQNDYYAEQSHSLNQKSNCFIETHTIAGSGTSSTGNVPLDIIVPPNSSRVVFEDLTINHNKTLLQISVPNDSGPIEVTIRTRISNTPIIATIVPNETRIFQVEDFQELTLTNNSDSFDFIDIFINKTFCICCDDQNNPCDECCNEYDNDYDC
>NC_010184.1|WP_012260930.1|2314222_2316019_+|ABC-transporter-ATP-binding-protein
MRNFQGQFGNKGGRNNLKTGKTKNTKGTIMRVWNYMGYQKASLMFVIILVFITTLLGLLGPYYMGVIIDEYIVPKDLSGTARMCMLLIAIYGITVLLTWLQTFVMINVALKTIQKIRQDIFEKIQTLSLRFFDVRSQGDLMSRVTNDIDNLNQALTQSVVQIISSALTFIGVTIAMFSLDWILAIVTLITVPIMFFVTKKLVAYSGKNFAKRQKDLGELNGFIEEAITGADVTTLYGKEKETVHNFNEINEQLRISATKAETFSAFIFPSMNFINNLGMGLVIGTGSVMVLNGMTTVGVIAAFINYSRQFSRPLSQFATLMNTIQAAVAGGERVFEIMDEVPEIQNKKDAVLVQNLQGHVRLEKVSFGYAQDNMILKDVSLEANPGETIALVGPTGSGKTTIINLLTRFYDIQKGQISIDEKDIKDYDINSLRSKIGVVLQDTYLFAGTIMENIRYGRLDASDEEVVAAAKAASAHSFIKHLPNQYETEIASEGSNLSQGQKQLLAIARAILADADILILDEATSNIDTRTELQIQSGLNNLMRGRTSFVIAHRLKTIEKADQILVIKDGSIFERGNHESLMEEKGFYFDLYTSQFKI
>NC_010184.1|WP_012260929.1|2312475_2314230_+|ABC-transporter-ATP-binding-protein
MKSFRKLLQYLKPYMFFAIIGPLFMVLEVAMDLIQPTIMQHIIDVGIANRDLNYVIKMGLLMIGAAAIGLVGGLGCMMYSTKAAVNFATDIRKDVFAKIETFSSKNRDSFGTGKLLTIVTNDITSIQSAMTMTLRVLVRGPLLFIGSIIIVFVTARDLFPILLVVVPVLLVAIVLIAGQSSGSFKRVQEALDKVNTKLQENLSGVRVIKAYVRQKYEIAQFEKVNTSLTEINIRAIQIISLMMPIIMLVVNSGIVATLWIGGEKVFNGTLQVGAILAFINYLNIILMSLMSISMVFIQIARAFPSADRVQQVLHTEVDITTEGDVYEPKQVGGNVEFKNVSYSYTKNNEYVLKDISFTVRKGEKIGIIGSTGSGKSTLAKLLPRLYDVDQGEICIDDVNVKAYDLQKLRASIGFVPQKALLFSGSIEENLRYGKEDATYDELELASSSACATEFINKLEDSYEYNLTQGATNLSGGQKQRISIARALVRKPSILVLDDSTSAVDAKSEAVIQEALRTRYSGTTTFLIASKISSIIDADKILVLNNGELVGNGTHEALLATCEVYQEIYLSQGGSLQQEGGEERA
>NC_010184.1|WP_002127357.1|2311616_2312213_+|DUF1349-domain-containing-protein
MKTSYIPNHIEQLTVMNAPKFYKLEDNDTFIVHSKEETDFWLKTHYGFEVMNGHVFYDEIMTDFQAEVQLRMNPNATYDQAGLFVMISEKCWLKTSLEYIPEGPSHLGAVVTNNGYSDWSTQDYPNEFAKQQLRFRIIRKLGDYTIYVKTSQRWEQIRIAHLMEDIGNEPVKIGFYTCSPSENNGFETEVFDFKIEQI
>NC_010184.1|WP_002031966.1|2310698_2311583_+|GNAT-family-N-acetyltransferase
MGNVEKMANFLLEEPRREQLFPLFEEVFGITSQTLQDFSEKGYWDYTYKALSFLQDDNAIANVAAFSLPLLINGEKINATGIQSVMTHPNYRRRGLMKQLFSKMIEEIDEQCECAVLFTENPELYKPFGFQIVQEYLMTVSYENKGYKDSQLKKLDFYNEEDRQLIHEIIENGQRLSNKFSTLNYRSSFYLNMYDSTWNENLYYSEKLDALIVFTVENQKLKLFGVFAPVIPILDELCEEISGEFTEIEFYFYPDQLGIDDVQYTELQTSKYLMVRSNKELDFKGYKFPVLTEF
>NC_010184.1|WP_012260928.1|2309746_2310436_+|MOSC-domain-containing-protein
MTKVYEILSLNIGLPKEVMYGGKLIQTGINKKQVKEPVFLSFLKLNGDGQADLVHHGGVDKAVCVYTGDHYPYWEKELNQELVYGAFGENITVSGMCEEDVCIGDTFHLGEAIVQVTQPRQPCFKLAKKYNIPKLPLYFQDTGYTGFYFRVLKEGWILPVDTLKLLKPDPKGVSVSFANRIMHKEKQNSEGLKRILEVNALSTSWRKTFEKRVKGEEISTKERLVGTKE
>NC_010184.1|WP_002012883.1|2321561_2321852_-|DUF4183-domain-containing-protein
MPIIQPFMASRRFTSTLGAGTGTGAAFAIAATACLNDAGTTATAFPTFTYYNLYINGILQPSVNSSVTTGPTGAITIPGGDVLDGGIPITIEFIVT
>NC_010184.1|WP_012260936.1|2322341_2323643_+|collagen-like-repeat-preface-domain-containing-protein
MSNNNCFGHNNCNPIVFSADCCKNPQSVPITSQQLSQLITLLNSLISAISAFFANPSNANRLALLDLFNQFLIFLNSLLPSPEVNFLKQLTQSIIVLLQSPAPNLGQLSTLLQQFYSALAQFFFALDLIPISCNSNIDPATLQVLFGLLIQLINATPGATGPTGPTGPTGPTGPTGATGGGATGATGATGATGATGATGATGATGATGGGATGATGATGATGATGATGATGATGATGATGATGATGATGATGATGATGATGATGATGVTGGGAIIPFASGTTPSALVNALIANTGTLLGFGFSQPGVALTGGTSITLALGIGSYAFVAPRAGTITSLAGFFSATAALAPLSPVQVQIQILTAPAASNTFTVQGAPLLLAPAFAVIAIGATASGIIPEAIPVAAGDKVLLYVSLTAASPIAAVAGFVSAGINIV
>NC_010184.1|WP_002141757.1|2324262_2324895_-|cupin-domain-containing-protein
MTSNIDYTSPSTNFTHDLSKSNFFKKDAQNYINVLGIKQLNTLENTSLLDIYLSTGNVVEPHIHQNAAELVYCISGSAVVSLLNPFTNQILNLPIKPGQVANIPQAWWHYEIASADNTHLLAIFDAPTPEVIFGSDILRLTPANMMAHTYCLNEQQWKQAVSPIQSTTVIGPPGNCNQNRDMINQSTQPPTQQQNLYYQDSYYFPLYWGY
>NC_010184.1|WP_002035103.1|2325188_2326577_-|HD-domain-containing-protein
MSKVLLQKANYLRSDELKLLKKAIHFAEQAHDGQYRQTGEPYIIHPFAITEILLNYKADITTLIAALLHDVVEDTEYSLEEIESHFGATIQYIVNGLTKGKKLQDQNKVLYEAINFKKLLVSSQQDIRVGIIKVIDRLHNIKTLSVKKPAKQVAYANETLTLFAPLAKRLGLYTIQHELENLAFQYLHKERYTEVHKFLTEYVPHLQKNITHLRKGIHSFSNTNLSFEINYEFPPVYTAYSQLQEIQNVSGISQICITTTSVLDCYKILGIIHQLYKPTINYFEDNIALENSHFNNNLKTKVNMNDAEQTIIIQTQIAKTLKDNGIFSLLNDRTANIQAISYKIMDDTIVNNNLLTTDPITFRSLVSYELFENTITAYTTDLQPVYLPDGATIIDFSFSAFPKIAHSMKKVKVNGMPVPLKTKISHLDVIEIHFDLKQNLAIEWLNYANTAKAQLMIHQKLS
>NC_010184.1|WP_002035104.1|2326782_2327088_+|DUF5519-family-protein
MSFSEMIRNEVLGWAGVSEKPHRFGGIEINYGKKELGHLHGDKLVDLPFPKVKRDELVSQGLVKPHHVLPESGWISYYIKSEEDIPFAIELFRMQYDRIKK
>NC_010184.1|WP_012260937.1|2327182_2328493_+|FAD-dependent-oxidoreductase
MKHFDVAIVGGGLAGLTASIYLAKAGRKVIVLEKSSHFGGRGMTINKNGICMNLGAHALYRGGEAFITFNELGVNLPGGIPSTKAHGIWKGDIYTIPTDFRSILSTPLLSWSAKVQFARLMIHLGNLDLEKVPKISLTTWAENEIKDPMVRNIFYALCRTTTYTYAPTIQLASSVLKQIQLSMKEGVLYVDGGWETIITNLRGIANTSGVQFLAKKHVLKIEHCEGKQRIHCFDDEVFEAGAVIVTTPPKEVCKIIKGTEGTSLQKWSEQSIQVTVAALDIGLKQLPNPLHHFALGLDQPIFFTNQSRAAKLSEDGSIVVSLIKYHNPVLELNHIQEEKEQLENMMELLHPNWKREVVAQQYLPKITVVHDFPHIDRVEKPGPNIPEMPGVYVAGDWAGHDEILADAAVASGKRAALHILKKFESEAVHHGNGAVI
>NC_010184.1|WP_002141760.1|2328470_2329340_+|sigma-70-family-RNA-polymerase-sigma-factor
METEQLYEAYQPLLFSLAYRILGSVMDAEDIVHDVFISFNNMEDVQSIENMRAYLCKMVTNRSIDKLRSAAHKRNVYVGMWLPEPFVEEIDDPSESFVMKESISTAYLLLLQQLTEVERVVFILREVFSYDYEEIASIVEKSSVNCRKIFQRARKSILDKPKQSTLSTKKMAAYVEKFVSSLQCGDTQGMLEVLKTDAIFKADGGGKVTTAINPIYSADKIIRLFFGIAKRLPEKYSVDFKIVNGAPGVIVTINNKVTYVLSFIFEDEKISNIYMMVNPEKLMHLNVIV
>NC_010184.1|WP_002085567.1|2329375_2329534_-|hypothetical-protein
MNVINLDAARRRKQHKKLMITIPIIKRIYEEDGEIKFEVAGEKDVPLEMLEK
>NC_010184.1|WP_002085565.1|2329839_2330433_+|class-I-SAM-dependent-methyltransferase
MEKMNTLDSLLLQLEQYGEEHDRHKEKREEKLRNISREMGQFLSVLVKGCNAKKILEIGTSNGYSTLWLANAVEETNGNVITVELSSERVGEALGNFERANLTQRIDIHNQEAGAFLDSQVDRSFDFIFLDSERTQYMWWWEHIKRILEPKGFLVIDNATSHAGELAGFIKMIEEDVTFETVLLAFQKGAFVARKNN
>NC_010184.1|WP_002085564.1|2330781_2331894_+|toxic-anion-resistance-protein
MTELEKKEPVSIVKDNNVEVVVDTVIKDAELEELNKEADLYVQKLNSEQNTDLSKVLSQLGDLGDKEQQAAGQTLSALKRPVTAMMNGKNEEIPNTLLELRKVVSELDPNSLKATGMKKLMFKVFKKNPLENYVHKYQSIDKQIEEIIRSLLIGRDNLQEDTVGLEMLKEQSHDKIHALDKQVYLGRKLAGMLEAEKQNPERQRDIPLINDALEKILVRTRNMQQAKSVLLQSIASVDIIKKNNEKLSEAIRNAITMTQNVITVSAAIQLALTNQRKTIDAVNATNEAIESMVLSNSQALKQNTEETTKLLENPAISMDKLRESFQNVFAAIEASEKSSERIIESSKKFVIELDTFNDEMKQKLIQRPRK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_010184_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_010184_3

3527331-3528911

Orphan

Consensus_repeat	Method
TNCNACNGGACCTCAAGG	CRT

33 spacers

The CRISPR arrays of NC_010184_3

>merge|NC_010184|3|3527331-3528911|CRT
ACCTACTGGACCTACTGGACCTAGAGGTAACACGGGCGCTACTGGCGCTACCGGACCTAGAGGTAACACGGGCGCTACTGGTGCGACCGGACCTAGAGGTAACACGGGCGCTACTGGTGCGACCGGACCTAGAGGTAACACAGGTGCTACTGGTGCGACCGGACCTAGAGGTAACACGGGCGCTACTGGTGCGACCGGACCTAGAGGTAACACAGGTGCTACTGGTGCGACCGGACCTAGAGGTAACACGGGCGCTACTGGTGCGACCGGACCTAGAGGTAACACGGGCGCTACTGGTGCGACCGGACCTAGAGGTAACACGGGCGCTACTGGTGCGACCGGACCTAGAGGTAACACAGGTGCTACTGGTGCGATCGGACCTAGAGGTAACACGGGCGCTACTGGTGCGACCGGACCTAGAGGTAACACAGGTGCTACTGGTGCGACCGGACCTAGAGGTAACACAGGTGCTACTGGTGCGACCGGACCTAGAGGTAACACAGGTGCTACTGGTTCCACTGGACCTCAAGGTGCGCAAGGTAACACGGGTGCTACTGGACCTCAAGGCGTTCAAGGTAACACAGGTGCTACTGGACCTCAAGGTGCGCAAGGTAACACGGGTGCTACTGGACCTCAAGGCGTTCAAGGTAACACAGGTGCTACCGGTTCCACTGGACCTCAAGGTCTTCAAGGTAACACAGGTGCTACCGGTTCCACCGGACCTCAAGGTGCGCAAGGTAACACAGGTGCTACTGGACCTCAAGGCGTTCAAGGTAACACAGGTGCGACTGGTTCCACTGGACCTCAAGGTCTTCAAGGTAACACAGGTGCTACTGGTTCCACTGGACCTCAAGGTCTTCAAGGTAACACAGGTGCTACCGGTTCCACTGGACCTCAAGGTGCGCAAGGTAACACAGGTGCTACTGGACCTCAAGGCGTTCAAGGTAACACAGGTGCTACCGGTTCCACTGGACCTCAAGGCGTTCAAGGTAACACGGGTGCTACCGGTTCCACTGGACCCCAAGGCGTTCAAGGTAACACGGGTGCTACTGGACCTCAAGGCGTTCAAGGTAACACAGGTGCTACTGGTTCCACTGGACCTCAAGGCGTTCAAGGTAACACAGGTGCTACTGGACCTCAAGGTGCTCAAGGTAACACGGGTGCTACTGGACCTCAAGGCGTTCAAGGTAACACAGGTGCTACCGGTTCCACTGGACCTCAAGGCGTTCAAGGTAACACAGGTGCTACTGGACCTCAAGGCGTTCAAGGTAACACAGGTGCTACTGGTTCCACTGGACCTCAAGGCGTTCAAGGTAACACAGGTGCTACTGGACCTCAAGGTGCGCAAGGTAACACGGGTGCTACTGGACCTCAAGGCGTTCAAGGTAACACAGGTGCTACTGGTTCCACTGGACCTCAAGGCGTTCAAGGTAACACAGGTGCTACCGGACCTCAAGGCACTCAAGGTAATACGGGTGCTACCGGACCTCAAGGTGCTCAAGGTAACACGGGTGCTACCGGACCTCAAGGTGCTCAAGGTAACACAGGTGCGACTGGTATAGGAGTTACCGGACCTACCGG

>NC_010184|3|2|3527331-3528911|CRT
ACCTACTGGACCTACTGG	ACCTAGAGGTAACACGGGCGCTACTGG
CGCTACCGGACCTAGAGG	TAACACGGGCGCTACTGGTGCGACCGGACCTAGAGGTAACACGGGCGCTACTGG
TGCGACCGGACCTAGAGG	TAACACAGGTGCTACTGGTGCGACCGGACCTAGAGGTAACACGGGCGCTACTGG
TGCGACCGGACCTAGAGG	TAACACAGGTGCTACTGGTGCGACCGGACCTAGAGGTAACACGGGCGCTACTGG
TGCGACCGGACCTAGAGG	TAACACGGGCGCTACTGGTGCGACCGGACCTAGAGGTAACACGGGCGCTACTGG
TGCGACCGGACCTAGAGG	TAACACAGGTGCTACTGGTGCGATCGGACCTAGAGGTAACACGGGCGCTACTGG
TGCGACCGGACCTAGAGG	TAACACAGGTGCTACTGG
TGCGACCGGACCTAGAGG	TAACACAGGTGCTACTGGTGCGACCGGACCTAGAGGTAACACAGGTGCTACTGG
TTCCACTGGACCTCAAGG	TGCGCAAGGTAACACGGG
TGCTACTGGACCTCAAGG	CGTTCAAGGTAACACAGGTGCTACTGGACCTCAAGGTGCGCAAGGTAACACGGG
TGCTACTGGACCTCAAGG	CGTTCAAGGTAACACAGGTGCTACCGG
TTCCACTGGACCTCAAGG	TCTTCAAGGTAACACAGGTGCTACCGG
TTCCACCGGACCTCAAGG	TGCGCAAGGTAACACAGG
TGCTACTGGACCTCAAGG	CGTTCAAGGTAACACAGGTGCGACTGG
TTCCACTGGACCTCAAGG	TCTTCAAGGTAACACAGGTGCTACTGG
TTCCACTGGACCTCAAGG	TCTTCAAGGTAACACAGGTGCTACCGG
TTCCACTGGACCTCAAGG	TGCGCAAGGTAACACAGG
TGCTACTGGACCTCAAGG	CGTTCAAGGTAACACAGGTGCTACCGG
TTCCACTGGACCTCAAGG	CGTTCAAGGTAACACGGGTGCTACCGG
TTCCACTGGACCCCAAGG	CGTTCAAGGTAACACGGG
TGCTACTGGACCTCAAGG	CGTTCAAGGTAACACAGGTGCTACTGG
TTCCACTGGACCTCAAGG	CGTTCAAGGTAACACAGG
TGCTACTGGACCTCAAGG	TGCTCAAGGTAACACGGG
TGCTACTGGACCTCAAGG	CGTTCAAGGTAACACAGGTGCTACCGG
TTCCACTGGACCTCAAGG	CGTTCAAGGTAACACAGG
TGCTACTGGACCTCAAGG	CGTTCAAGGTAACACAGGTGCTACTGG
TTCCACTGGACCTCAAGG	CGTTCAAGGTAACACAGG
TGCTACTGGACCTCAAGG	TGCGCAAGGTAACACGGG
TGCTACTGGACCTCAAGG	CGTTCAAGGTAACACAGGTGCTACTGG
TTCCACTGGACCTCAAGG	CGTTCAAGGTAACACAGG
TGCTACCGGACCTCAAGG	CACTCAAGGTAATACGGG
TGCTACCGGACCTCAAGG	TGCTCAAGGTAACACGGG
TGCTACCGGACCTCAAGG	TGCTCAAGGTAACACAGGTGCGACTGGTATAGG
AGTTACCGGACCTACCGG

Protein	Signature genes	Signature genes Name	Protein_function
NC_010184.1\|WP_002014481.1\|3524708_3525665_-\|stage-V-sporulation-protein-K	unknown	unknown	gnl\|CDD\|163057
NC_010184.1\|WP_002014475.1\|3520625_3521015_-\|transcriptional-repressor-GlnR	unknown	unknown	gnl\|CDD\|133380
NC_010184.1\|WP_012261517.1\|3532752_3534612_-\|PTS-sugar-transporter-subunit-IIA	unknown	unknown	gnl\|CDD\|236740
NC_010184.1\|WP_078175321.1\|3538583_3538922_-\|hypothetical-protein	unknown	unknown	unknown
NC_010184.1\|WP_002087943.1\|3524539_3524677_+\|hypothetical-protein	unknown	unknown	unknown
NC_010184.1\|WP_002069969.1\|3522452_3523724_-\|GTPase-HflX	unknown	unknown	gnl\|CDD\|274455
NC_010184.1\|WP_002014478.1\|3523816_3524440_+\|trimeric-intracellular-cation-channel-family-protein	unknown	unknown	gnl\|CDD\|225415
NC_010184.1\|WP_002128630.1\|3536442_3537606_-\|iron-containing-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|341466
NC_010184.1\|WP_003190889.1\|3535533_3536343_-\|DeoR/GlpR-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224268
NC_010184.1\|WP_012261516.1\|3531438_3532404_-\|SH3-domain-containing-protein	unknown	unknown	gnl\|CDD\|226112
NC_010184.1\|WP_002014472.1\|3519242_3520577_-\|type-I-glutamate--ammonia-ligase	unknown	unknown	gnl\|CDD\|273198
NC_010184.1\|WP_002033671.1\|3531130_3531376_+\|hypothetical-protein	unknown	unknown	unknown
NC_010184.1\|WP_012261510.1\|3517773_3517941_+\|hypothetical-protein	unknown	unknown	unknown
NC_010184.1\|WP_002128611.1\|3521188_3522460_-\|methionine-gamma-lyase-family-protein	unknown	unknown	gnl\|CDD\|311036
NC_010184.1\|WP_000228316.1\|3537724_3538267_-\|DUF420-domain-containing-protein	unknown	unknown	gnl\|CDD\|225204
NC_010184.1\|WP_012261514.1\|3529995_3530949_-\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	unknown	unknown	gnl\|CDD\|234626
NC_010184.1\|WP_012261518.1\|3534625_3535537_-\|1-phosphofructokinase	unknown	unknown	gnl\|CDD\|238570
NC_010184.1\|WP_012261511.1\|3517982_3519128_+\|site-specific-integrase	unknown	unknown	gnl\|CDD\|271189
NC_010184.1\|WP_000813896.1\|3529749_3529974_-\|RNA-chaperone-Hfq	unknown	unknown	gnl\|CDD\|179001
NC_010184.1\|WP_012261512.1\|3525778_3526741_+\|tyrosine-type-recombinase/integrase	unknown	unknown	gnl\|CDD\|227308

Protein	Function_ID	Function_description	E-value
NC_010184.1\|WP_002014481.1\|3524708_3525665_-\|stage-V-sporulation-protein-K	gnl\|CDD\|163057	TIGR02881, Stage_V_sporulation_protein_K, stage V sporulation protein K. Members of this protein family are the stage V sporulation protein K (SpoVK), a close homolog of the Rubisco expression protein CbbX (TIGR02880) and a members of the ATPase family associated with various cellular activities (pfam00004). Members are strictly limited to bacterial endospore-forming species, but are not universal in this group and are missing from the Clostridium group. [Cellular processes, Sporulation and germination].	3.41639e-155
NC_010184.1\|WP_002014475.1\|3520625_3521015_-\|transcriptional-repressor-GlnR	gnl\|CDD\|133380	cd01105, HTH_GlnR-like, Helix-Turn-Helix DNA binding domain of GlnR-like transcription regulators. Helix-turn-helix (HTH) transcription regulator GlnR and related proteins, N-terminal domain. The GlnR and TnrA (also known as ScgR) proteins have been shown to regulate expression of glutamine synthetase as well as several genes involved in nitrogen metabolism. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules.	4.11746e-25
NC_010184.1\|WP_002069969.1\|3522452_3523724_-\|GTPase-HflX	gnl\|CDD\|274455	TIGR03156, GTP_HflX, GTP-binding protein HflX. This protein family is one of a number of homologous small, well-conserved GTP-binding proteins with pleiotropic effects. Bacterial members are designated HflX, following the naming convention in Escherichia coli where HflX is encoded immediately downstream of the RNA chaperone Hfq, and immediately upstream of HflKC, a membrane-associated protease pair with an important housekeeping function. Over large numbers of other bacterial genomes, the pairing with hfq is more significant than with hflK and hlfC. The gene from Homo sapiens in this family has been named PGPL (pseudoautosomal GTP-binding protein-like). [Unknown function, General].	0
NC_010184.1\|WP_002014478.1\|3523816_3524440_+\|trimeric-intracellular-cation-channel-family-protein	gnl\|CDD\|225415	COG2860, COG2860, Predicted membrane protein [Function unknown].	3.93806e-59
NC_010184.1\|WP_002128630.1\|3536442_3537606_-\|iron-containing-alcohol-dehydrogenase	gnl\|CDD\|341466	cd08187, BDH, Butanol dehydrogenase catalyzes the conversion of butyraldehyde to butanol with the cofactor NAD(P)H being oxidized in the process. The butanol dehydrogenase (BDH) is involved in the final step of the butanol formation pathway in anaerobic micro-organism. Butanol dehydrogenase catalyzes the conversion of butyraldehyde to butanol with the cofactor NAD(P)H being oxidized in the process. Activity in the reverse direction is 50-fold lower than that in the forward direction. The NADH-BDH has higher activity with longer chained aldehydes and is inhibited by metabolites containing an adenine moiety. This protein family belongs to the so-called iron-containing alcohol dehydrogenase superfamily. Since members of this superfamily use different divalent ions, preferentially iron or zinc, it has been suggested to be renamed to family III metal-dependent polyol dehydrogenases. This family also includes E. coli YqhD enzyme, an NADP-dependent dehydrogenase whose activity measurements with several alcohols demonstrate preference for alcohols longer than C3. The active site of YqhD contains a Zn metal, and a modified NADPH cofactor bearing OH groups on the saturated C5 and C6 atoms, possibly due to oxygen stress on the enzyme, which would functionally work under anaerobic conditions.	0
NC_010184.1\|WP_003190889.1\|3535533_3536343_-\|DeoR/GlpR-transcriptional-regulator	gnl\|CDD\|224268	COG1349, GlpR, Transcriptional regulators of sugar metabolism [Transcription / Carbohydrate transport and metabolism].	1.09793e-81
NC_010184.1\|WP_012261516.1\|3531438_3532404_-\|SH3-domain-containing-protein	gnl\|CDD\|226112	COG3584, COG3584, Uncharacterized protein conserved in bacteria [Function unknown].	8.6032e-38
NC_010184.1\|WP_002014472.1\|3519242_3520577_-\|type-I-glutamate--ammonia-ligase	gnl\|CDD\|273198	TIGR00653, Glutamine_synthetase, glutamine synthetase, type I. Alternate name: glutamate--ammonia ligase. This model represents the dodecameric form, which can be subdivided into 1-alpha and 1-beta forms. The phylogeny of the 1-alpha and 1-beta forms appears polyphyletic. E. coli, Synechocystis PCC6803, Aquifex aeolicus, and the crenarcheon Sulfolobus acidocaldarius have form 1-beta, while Bacillus subtilis, Thermotoga maritima, and various euryarchaea has form 1-alpha. The 1-beta dodecamer from the crenarcheon Sulfolobus acidocaldarius differs from that in E. coli in that it is not regulated by adenylylation. [Amino acid biosynthesis, Glutamate family].	0
NC_010184.1\|WP_012261517.1\|3532752_3534612_-\|PTS-sugar-transporter-subunit-IIA	gnl\|CDD\|236740	PRK10712, PRK10712, PTS system fructose-specific transporter subunits IIBC; Provisional.	1.09969e-143
NC_010184.1\|WP_002128611.1\|3521188_3522460_-\|methionine-gamma-lyase-family-protein	gnl\|CDD\|311036	pfam06838, Met_gamma_lyase, Methionine gamma-lyase. This is a putative pyridoxal 5'-phosphate-dependent methionine gamma-lyase enzyme involved in methionine catabolism.	0
NC_010184.1\|WP_000228316.1\|3537724_3538267_-\|DUF420-domain-containing-protein	gnl\|CDD\|225204	COG2322, COG2322, Predicted membrane protein [Function unknown].	1.75148e-56
NC_010184.1\|WP_012261514.1\|3529995_3530949_-\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	gnl\|CDD\|234626	PRK00091, miaA, tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed.	3.87242e-166
NC_010184.1\|WP_012261518.1\|3534625_3535537_-\|1-phosphofructokinase	gnl\|CDD\|238570	cd01164, FruK_PfkB_like, 1-phosphofructokinase (FruK), minor 6-phosphofructokinase (pfkB) and related sugar kinases. FruK plays an important role in the predominant pathway for fructose utilisation.This group also contains tagatose-6-phophate kinase, an enzyme of the tagatose 6-phosphate pathway, which responsible for breakdown of the galactose moiety during lactose metabolism by bacteria such as L. lactis.	3.08864e-141
NC_010184.1\|WP_012261511.1\|3517982_3519128_+\|site-specific-integrase	gnl\|CDD\|271189	cd01189, INT_ICEBs1_C_like, C-terminal catalytic domain of integrases from bacterial phages and conjugate transposons. This family of tyrosine based site-specific integrases is has origins in bacterial phages and conjugate transposons. One member is the integrase from Bacillus subtilis conjugative transposon ICEBs1. ICEBs1 can be excised and transfered to various recipients in response to DNA damage or high concentrations of potential mating partners. The family belongs to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	1.0285e-47
NC_010184.1\|WP_000813896.1\|3529749_3529974_-\|RNA-chaperone-Hfq	gnl\|CDD\|179001	PRK00395, hfq, RNA-binding protein Hfq; Provisional.	3.4363e-41
NC_010184.1\|WP_012261512.1\|3525778_3526741_+\|tyrosine-type-recombinase/integrase	gnl\|CDD\|227308	COG4974, XerD, Site-specific recombinase XerD [DNA replication, recombination, and repair].	8.81527e-12

>NC_010184.1|WP_012261512.1|3525778_3526741_+|tyrosine-type-recombinase/integrase
METTEFHDTIQAFSIFLLNKGRKSSTIKRYVYDIEDFGHWLEKNKKLPSSNIWATLCTKDYEDYFSDLKKNRHYSEKTMHRVFIVLNRMHHFLNIPNPLNDMEITIQPNRALRNEDFISSDEEKRLKHIVTSLEGLSEKQRPVRPLLMDRNIAILSILIDYGLSLQELTALTMHHVHFETNTLSIPATAGVERKITLAIEDKKQLYTYYKSIPEPVRPKYHSNDPLFVAFDFNRGTYRWVYENDAPKALTEIAIQKMIRLEVARANLRKGISGQHFRNTFILRLIKKQTPEPEIIKLVGFKSKISLKRYYQYAENKKNAL
>NC_010184.1|WP_002014481.1|3524708_3525665_-|stage-V-sporulation-protein-K
MEQSMRKKNNNQINIVLNHRKKISLPASENKTVISSETTTKHEMLQRIEEEMGKLVGMDEIKKIIKEIYAWIYVNKKRQEMGLKSEKQVLHMLFRGNPGTGKTTVARMIGKLLFEMNILSKGHLVEAERADLVGEYIGHTAQKTRDLIKKAMGGILFIDEAYSLARGGEKDFGKEAIDTLVKHMEDKQHGFVLILAGYSREMNHFLSLNPGLQSRFPFIIEFADYSVNQLLEIGKRMYEEREYQLSKEAEWKFRDHLHAVKYSSQITSFSNGRYVRNIVEKSIRTQAMRLLQEDTYDKYDLIGISSMDLMLEEETHST
>NC_010184.1|WP_002087943.1|3524539_3524677_+|hypothetical-protein
MTNHVNKGAQKSSVNQFGHDPNSAHEKSAKMERLHKTHQEKAKKE
>NC_010184.1|WP_002014478.1|3523816_3524440_+|trimeric-intracellular-cation-channel-family-protein
MAWEIFSIIGTIAFALSGAIVAMEEDYDIFGVYILGMATAFGGGALRNLLIGYPIVAFWQQDMLFQIALLSMTIIFLFPNKLIKHWKKWENITDAIGLSAFAVQGALYAQKLNLPISATIVAAVLTGIGGGIIRDLLARRKPLVLRADVYAFWTILAGFLIGAKVIVSDWALYTLFILIVCFRMVSIHYKWHLPHRRIDTKERSMHK
>NC_010184.1|WP_002069969.1|3522452_3523724_-|GTPase-HflX
MEEKEKIILVGCQLPQDDDEKFMHSMKELASLAKTARAEVLVSTTQKRPKFHPATYIGKGKLEELAALTEELEPAVIVFNNELTPSQIRNLSSVLDARVIDRTQLILDIFAQRAKSREGKLQVELAQLQYTMPRLMGQGLALSRLGGGIGTRGPGETKLETDRRHIRSRIDEIKRQLAVVVEHRKRYRERRKDNKVFQVALIGYTNAGKSTLFNRLTEADTFEENLLFATLDPTTRKMPLPSGYTVLLTDTVGFIQDLPTSLIAAFRSTLEEAGEADVILHVVDSADPNYVGHEQTVKQLLSDLEINRIPIITLYNKKDKLHQNFIPFPKSDFLMTSAFEESDLLRIKEALETKMKEEMDDYQVEIPPSEGRLLTLLKTETILTKMEFLEDKFVYDCTGYIFAHSSLKGQLKRFLVEEGENNV
>NC_010184.1|WP_002128611.1|3521188_3522460_-|methionine-gamma-lyase-family-protein
MFDRLKNGEKIAPIVKEVESQIIEVHKHVDEVIESNQFRVLESFRKHKISDSHFIPTTGYGYDDIGRDTLEKVYADVFGAEAGLVRPQIISGTHAISTALFGILRPGDELLYITGKPYDTLEEIVGVRGKGVGSFKEYNIGYNAVPLTEEGFVDFEAVAAAIHSNTKMIGIQRSKGYATRPSFTVSQIKEMIAFVKEIKPDVVVFVDNCYGEFIEEEEPCHVGADLMAGSLIKNPGGGIVKTGGYIVGKEQYVEACAYRLTSPGIGAEAGASLYSLQEMYQGFFLAPHVAGQALKGAIFTAAFLGKLGMNTSPAWNAPRTDLIQSVQFDDKDRMIAFCQAIQYASPINSHFTPYANYMPGYEDDVIMAAGTFIQGASIELSADGPIRPPYVAYVQGGLTYSHVKIAICSAIDALIEKKLLTIS
>NC_010184.1|WP_002014475.1|3520625_3521015_-|transcriptional-repressor-GlnR
MKEDRRSAPLFPIGIVMDLTQLSARQIRYYEEHNLIFPTRTKGNRRLFSFNDVDKLLEIKDLLDQGLNMAGIKQVLQMKENQTEAVKVKEETKEISKSELRKILRDELQHTGRFNRTSLRQGDISRFFH
>NC_010184.1|WP_002014472.1|3519242_3520577_-|type-I-glutamate--ammonia-ligase
MARYTKEDIFRLAKEENVKYIRLQFTDLLGVIKNVEIPVSQLTKALDNKMMFDGSSIEGFVRIEESDMYLYPDLDTWVIFPWTAEKGKVARLICDIYNADGTPFDGDPRNNLKRVLKEMEALGFSDFNLGPEPEFFLFKVDEKGNPTLELNDNGGYFDLAPMDLGENCRRDIVLELEEMGFEIEASHHEVAPGQHEIDFKYANAIRSCDDIQTFKLVVRTIARKHGLHATFMPKPLYGVNGSGMHCNLSLFKNGENVFFDQNGDLQLSDDARHFIAGILKHAPAFTAVANPTVNSYKRLVPGYEAPCYVAWSAQNRSPLVRIPASRGISTRVEVRSVDPAANPYLVMATLLAAGLDGIKNKLTPPAAVDRNIYVMTKEEREEAGIVDLPATLAQALVTLQSNEIVCGALGDHLLEHFIEAKEIEWDIFRTQVHQWERDQYMSLY
>NC_010184.1|WP_012261511.1|3517982_3519128_+|site-specific-integrase
MASFRKFGDVWEFRVRFKDPYTQKYKEKSKRGFKTKKEAQLAAAEEEKKLLNGLEVEITPTSLKHYLRDWLKLFKQDNVRKNTFILHERNIEKHIIPYFQNMNLKELKPMMYQKFINSLTDQGYSKRTVQIIHGTMNNAMKKAVNLKKIENNPCEEVVISNKNNKEREGLKYMRSEDITLFLKTSYKYNYIYYIFFKALLNTGMRKGEAAALQWKDINLKEHTITISKTLDFTAKTKEELFGDTKTFTSKRTIMIPKSLVDELLEHKKWQNANKLVLQDAYEHELDLVFSRVDGNFLPKSTLFNAFSRILKKANLPRLEIHSLRHTHAVLLLESGASMKYIQDRLGHKSIEITANVYSHISDKINKDSISGFEAYMNNVLG
>NC_010184.1|WP_012261510.1|3517773_3517941_+|hypothetical-protein
MIIDLNAEREKRKKRTIQQEEFKKVPIVEKIHIVDGEIKFEVSSYKETPVKWLDD
>NC_010184.1|WP_000813896.1|3529749_3529974_-|RNA-chaperone-Hfq
MKQSINIQDQFLNQLRKENTFVTLYLLNGFQLRGLIKGFDNFTVLLETEGKQQLIYKHAISTFVPQKNVSIELE
>NC_010184.1|WP_012261514.1|3529995_3530949_-|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA
MGEVQREKVAVIIGPTAVGKTKLSIDLAKALNGEIVSGDSMQIYRTMDIGTAKVTTDEMDGIPHYMIDIKDPEDSFSVAEFQESVRKCIREITERGKLPIIVGGTGLYIQSVLFDYQFTDEAGDATYREQMEKLALEHGVEYVHKKLQEVDPESAERIHANNVRRVIRALEIFHTTGEKMSNQLEKQENELLYDVSLIGLTMDREMLYDRINLRVNLMIEQGLLEEVKGLHERGVRDCQSIQAIGYKEIYDYFENRVSLEEAVSQLKTNSRRYAKRQLTWFRNKMDVGWFDVTDGEKTSEILRYIEGKLQLKSNNSK
>NC_010184.1|WP_002033671.1|3531130_3531376_+|hypothetical-protein
MKQATIDFPLLIKDLILATATKEQNCSQEELYFALNCLLRSFHSTLQETTLHPENKNTEYIQTQFCTAYKIITGKTIYPFQ
>NC_010184.1|WP_012261516.1|3531438_3532404_-|SH3-domain-containing-protein
MKKLLGIATAAVFGLGIFVGSAKAETIVTTDVLNVRENPTVESKLVGKMLSGNKLDVINTENGWSKIKLDGKEAFVSAEFTKSSYYVTANVLNIRAGANTDSEILGTLKKDDLIETTNQVQNEWLQFEYGGKAAYVHIPFLTGTAPVIERKEVPAQDEAPTKVKTAVKNDTSVKVKAPAKNDTAVNGKESVKSGASSKPVAQAKPATKPVAKSTETSEPAGREITVEATAYTAHPSENGTYGGRVLTAMGHDLTANPNMKVIAVDPKVIPLGSKVWVEGYGEAIAGDTGGAIKGNRIDVLVGSDSTADSWGRKSVKVKVIK
>NC_010184.1|WP_012261517.1|3532752_3534612_-|PTS-sugar-transporter-subunit-IIA
MKITELLKRDTVIMNLTASNKEAVIDELVEKLDGANRLNSKAEFKEAILKRESQSTTGIGEGIAIPHAKTNAVKQPSICFGRSVSGINYESLDGQPAHLFFMIAASEGANNTHLETLSRLSTLLMDEGFRKQLLEAKDEDELLRLFDEKENEKEDEEVEVAKPEGNEPYVLAVTACPTGIAHTYMAADSLKAKAAELGIAIKVETNGSTGVKNDLTKEDIERATAIIVAADKQVEMNRFAGKHVIQVPVADGIRKTEILLNRAIKQDAPIFKGVKEDGKAENVEKEKGLGIYKHLMSGVSNMLPFVVGGGILIALAFSFGGIKAEGPLAELFMSIGGGKTGAFLFLVPILAGFIASSIADRPGFMPGVVGGFLAAQANAGFLGGLIAGFLAGYVVLGLKRLFSGLPLQLEGIKPVLLYPVFGLLITGVVMQKVVNPPVVALNEMLTGWLNGLSGTNAILLGLILGGMMAIDMGGPINKAAFTFGIAAIEAQNFGVHSAVMAGGMVPPLAIAFATTFFKTKFTEAERKSGLTNYIMGASFITEGAIPFAAADPVRVIVSCVVGSSIAGALSMLFQITLPAPHGGLFVIALVNKPLLYIFSILIGTIVSAIMIGVWKKKVK
>NC_010184.1|WP_012261518.1|3534625_3535537_-|1-phosphofructokinase
MIYTVTLNPSIDYVVQVNSFDLGAVNRAEKDMKFPGGKGINVSRVLHRLGVENVALGFTGGFTGRFIKDVLQAEGVTTNFVQVDGDSRINVKIKGQEETELNGQGPNVTNEQFEQLMKQIESMRQGECVVLAGSVPASISTTFYESIAALGAEKGIRVVVDASGSALQHVIKNKPFLIKPNHHELGELFGVEISTVEDVLPFGRKLVEQGVEHVIVSMAGDGALLFTAQGIYEATVPKGVVINSVGAGDSLVAGFVGKYEQTKDIEKAFQYGVATGSATAFSADLCEKEKVEELLSQVIVTKR
>NC_010184.1|WP_003190889.1|3535533_3536343_-|DeoR/GlpR-transcriptional-regulator
MVDFCDRFHYTVIKEEVNKMLTPERHQMILQLVKEQKVVKLQQLVERTESSESTIRRDLAQLEKQRLLKRVHGGASVLTGKGQEPTMIEKSSKNIQIKQQIAKYAASIVEQGDCVYLDAGSTTFEMIPFLINKDVTVVTNGLMHIEALVENNIRAYLLGGMMKSRTKALIGAMAQESMQKYRFDKCFLGANGVHEQLGFTTPDPEEALLKQMALTFANEGYFLIDESKFSEVAFAKIANVEEANIITNHLEIDLEKYKRQTNVIEADKQ
>NC_010184.1|WP_002128630.1|3536442_3537606_-|iron-containing-alcohol-dehydrogenase
MQNFVFRNPTKLIFGKGQLEQLKTEIPQFGKKVLLVYGGGSIKRNGIYDNVISILKDINAEVFELTGVEPNPRLSTVKKGIQICKDNGVEFILAVGGGSVIDCTKAIAAGSKYDGDVWDIVTKKSFASEALPFGTVLTLAATGSEMNAGSVITNWETNEKYGWGSPVTFPQFSILDPLHTSSVPRDQTIYGMVDIMSHVLEQYFHHGMNTELQDRYCESVLRTVIETAPKLLSDLENYEHRETILYCGTMALNGILAMGVKGDWATHNIEHAVSAVHDIPHGGGLAILFPNWMKHVIDENVSRFKQFAIRVFDVETDGKTDKEVALEGIEALRQFWTSIEAPVTLADYAIRESEIDLMADKAMAYGEFGNFKKLNKDDVLAIYKASL
>NC_010184.1|WP_000228316.1|3537724_3538267_-|DUF420-domain-containing-protein
MVDQSTNQKSYAPIVITLSVIVNAIILFLFFGPVGYEGEVHFDVTILPMLNAIFNSFTFVFLLAALYSIIKKNVKMHRGFILAAFTTTLLFCVSYLSYHYLAPATHFGGEGFIKYVYFIILITHIILAAIIVPLALFALVFGFTNQLTRHRKIVRWTMPIWLYVSLSGVIVYLMISPYYQ
>NC_010184.1|WP_078175321.1|3538583_3538922_-|hypothetical-protein
MVKKEGGMTMEEYVLELYNFLYTTEWQDIVSFLGIMFCMKIVIVYMEEQGMFYSFSSPFDVQREPLPNYAKVNYEQFPFVIFFMIRFITAIVKKKESDDEECHSTCNIATAF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NC_010184_2	2.7\|2321078\|19\|NC_010184\|CRT	2321078-2321096	19	NC_010180.1	116621-116639	2	0.895
NC_010184_3	3.7\|3527754\|18\|NC_010184\|CRT	3527754-3527771	18	NC_010184.1	3528960-3528977	1	0.944
NC_010184_3	3.7\|3527754\|18\|NC_010184\|CRT	3527754-3527771	18	NC_010184.1	3529104-3529121	1	0.944
NC_010184_3	3.7\|3527754\|18\|NC_010184\|CRT	3527754-3527771	18	NC_010184.1	3529140-3529157	1	0.944
NC_010184_3	3.9\|3527862\|18\|NC_010184\|CRT	3527862-3527879	18	NC_010184.1	3529023-3529040	1	0.944
NC_010184_3	3.9\|3527862\|18\|NC_010184\|CRT	3527862-3527879	18	NC_010184.1	3529059-3529076	1	0.944
NC_010184_3	3.13\|3528060\|18\|NC_010184\|CRT	3528060-3528077	18	NC_010184.1	3529095-3529112	1	0.944
NC_010184_3	3.13\|3528060\|18\|NC_010184\|CRT	3528060-3528077	18	NC_010184.1	3529131-3529148	1	0.944
NC_010184_3	3.17\|3528231\|18\|NC_010184\|CRT	3528231-3528248	18	NC_010184.1	3529095-3529112	1	0.944
NC_010184_3	3.17\|3528231\|18\|NC_010184\|CRT	3528231-3528248	18	NC_010184.1	3529131-3529148	1	0.944
NC_010184_3	3.23\|3528474\|18\|NC_010184\|CRT	3528474-3528491	18	NC_010184.1	3529023-3529040	0	1.0
NC_010184_3	3.23\|3528474\|18\|NC_010184\|CRT	3528474-3528491	18	NC_010184.1	3529059-3529076	0	1.0
NC_010184_3	3.23\|3528474\|18\|NC_010184\|CRT	3528474-3528491	18	NC_010184.1	3528987-3529004	1	0.944
NC_010184_3	3.23\|3528474\|18\|NC_010184\|CRT	3528474-3528491	18	NC_010184.1	3529095-3529112	1	0.944
NC_010184_3	3.23\|3528474\|18\|NC_010184\|CRT	3528474-3528491	18	NC_010184.1	3529131-3529148	1	0.944
NC_010184_3	3.28\|3528672\|18\|NC_010184\|CRT	3528672-3528689	18	NC_010184.1	3529023-3529040	1	0.944
NC_010184_3	3.28\|3528672\|18\|NC_010184\|CRT	3528672-3528689	18	NC_010184.1	3529059-3529076	1	0.944
NC_010184_3	3.32\|3528825\|18\|NC_010184\|CRT	3528825-3528842	18	NC_010184.1	3529023-3529040	0	1.0
NC_010184_3	3.32\|3528825\|18\|NC_010184\|CRT	3528825-3528842	18	NC_010184.1	3529059-3529076	0	1.0
NC_010184_3	3.32\|3528825\|18\|NC_010184\|CRT	3528825-3528842	18	NC_010184.1	3528987-3529004	1	0.944
NC_010184_3	3.32\|3528825\|18\|NC_010184\|CRT	3528825-3528842	18	NC_010184.1	3529095-3529112	1	0.944
NC_010184_3	3.32\|3528825\|18\|NC_010184\|CRT	3528825-3528842	18	NC_010184.1	3529131-3529148	1	0.944
NC_010184_3	3.33\|3528861\|33\|NC_010184\|CRT	3528861-3528893	33	NC_010184.1	3529131-3529163	0	1.0

1. spacer 2.7|2321078|19|NC_010184|CRT matches to position: 116621-116639, mismatch: 2, identity: 0.895

caaccggagaaacaggaat	CRISPR spacer
caacgggagaaacaggtat	Protospacer
**** *********** **

2. spacer 3.7|3527754|18|NC_010184|CRT matches to position: 3528960-3528977, mismatch: 1, identity: 0.944

taacacaggtgctactgg	CRISPR spacer
taacacaggtgctaccgg	Protospacer
***************.**

3. spacer 3.7|3527754|18|NC_010184|CRT matches to position: 3529104-3529121, mismatch: 1, identity: 0.944

taacacaggtgctactgg	CRISPR spacer
taacacaggtgctaccgg	Protospacer
***************.**

4. spacer 3.7|3527754|18|NC_010184|CRT matches to position: 3529140-3529157, mismatch: 1, identity: 0.944

taacacaggtgctactgg	CRISPR spacer
taacacaggtgcgactgg	Protospacer
************ *****

5. spacer 3.9|3527862|18|NC_010184|CRT matches to position: 3529023-3529040, mismatch: 1, identity: 0.944

tgcgcaaggtaacacggg	CRISPR spacer
tgctcaaggtaacacggg	Protospacer
*** **************

6. spacer 3.9|3527862|18|NC_010184|CRT matches to position: 3529059-3529076, mismatch: 1, identity: 0.944

tgcgcaaggtaacacggg	CRISPR spacer
tgctcaaggtaacacggg	Protospacer
*** **************

7. spacer 3.13|3528060|18|NC_010184|CRT matches to position: 3529095-3529112, mismatch: 1, identity: 0.944

tgcgcaaggtaacacagg	CRISPR spacer
tgctcaaggtaacacagg	Protospacer
*** **************

8. spacer 3.13|3528060|18|NC_010184|CRT matches to position: 3529131-3529148, mismatch: 1, identity: 0.944

tgcgcaaggtaacacagg	CRISPR spacer
tgctcaaggtaacacagg	Protospacer
*** **************

9. spacer 3.17|3528231|18|NC_010184|CRT matches to position: 3529095-3529112, mismatch: 1, identity: 0.944

tgcgcaaggtaacacagg	CRISPR spacer
tgctcaaggtaacacagg	Protospacer
*** **************

10. spacer 3.17|3528231|18|NC_010184|CRT matches to position: 3529131-3529148, mismatch: 1, identity: 0.944

tgcgcaaggtaacacagg	CRISPR spacer
tgctcaaggtaacacagg	Protospacer
*** **************

11. spacer 3.23|3528474|18|NC_010184|CRT matches to position: 3529023-3529040, mismatch: 0, identity: 1.0

tgctcaaggtaacacggg	CRISPR spacer
tgctcaaggtaacacggg	Protospacer
******************

12. spacer 3.23|3528474|18|NC_010184|CRT matches to position: 3529059-3529076, mismatch: 0, identity: 1.0

tgctcaaggtaacacggg	CRISPR spacer
tgctcaaggtaacacggg	Protospacer
******************

13. spacer 3.23|3528474|18|NC_010184|CRT matches to position: 3528987-3529004, mismatch: 1, identity: 0.944

tgctcaaggtaacacggg	CRISPR spacer
tgttcaaggtaacacggg	Protospacer
**.***************

14. spacer 3.23|3528474|18|NC_010184|CRT matches to position: 3529095-3529112, mismatch: 1, identity: 0.944

tgctcaaggtaacacggg	CRISPR spacer
tgctcaaggtaacacagg	Protospacer
***************.**

15. spacer 3.23|3528474|18|NC_010184|CRT matches to position: 3529131-3529148, mismatch: 1, identity: 0.944

tgctcaaggtaacacggg	CRISPR spacer
tgctcaaggtaacacagg	Protospacer
***************.**

16. spacer 3.28|3528672|18|NC_010184|CRT matches to position: 3529023-3529040, mismatch: 1, identity: 0.944

tgcgcaaggtaacacggg	CRISPR spacer
tgctcaaggtaacacggg	Protospacer
*** **************

17. spacer 3.28|3528672|18|NC_010184|CRT matches to position: 3529059-3529076, mismatch: 1, identity: 0.944

tgcgcaaggtaacacggg	CRISPR spacer
tgctcaaggtaacacggg	Protospacer
*** **************

18. spacer 3.32|3528825|18|NC_010184|CRT matches to position: 3529023-3529040, mismatch: 0, identity: 1.0

tgctcaaggtaacacggg	CRISPR spacer
tgctcaaggtaacacggg	Protospacer
******************

19. spacer 3.32|3528825|18|NC_010184|CRT matches to position: 3529059-3529076, mismatch: 0, identity: 1.0

tgctcaaggtaacacggg	CRISPR spacer
tgctcaaggtaacacggg	Protospacer
******************

20. spacer 3.32|3528825|18|NC_010184|CRT matches to position: 3528987-3529004, mismatch: 1, identity: 0.944

tgctcaaggtaacacggg	CRISPR spacer
tgttcaaggtaacacggg	Protospacer
**.***************

21. spacer 3.32|3528825|18|NC_010184|CRT matches to position: 3529095-3529112, mismatch: 1, identity: 0.944

tgctcaaggtaacacggg	CRISPR spacer
tgctcaaggtaacacagg	Protospacer
***************.**

22. spacer 3.32|3528825|18|NC_010184|CRT matches to position: 3529131-3529148, mismatch: 1, identity: 0.944

tgctcaaggtaacacggg	CRISPR spacer
tgctcaaggtaacacagg	Protospacer
***************.**

23. spacer 3.33|3528861|33|NC_010184|CRT matches to position: 3529131-3529163, mismatch: 0, identity: 1.0

tgctcaaggtaacacaggtgcgactggtatagg	CRISPR spacer
tgctcaaggtaacacaggtgcgactggtatagg	Protospacer
*********************************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	251930-251957	2	0.929
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	251966-251993	2	0.929
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	138-165	2	0.929
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	237-264	2	0.929
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	363-390	2	0.929
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	408-435	2	0.929
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90275-90302	2	0.929
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321738-321765	2	0.929
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321783-321810	2	0.929
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321882-321909	2	0.929
NC_010184_3	3.12\|3528015\|27\|NC_010184\|CRT	3528015-3528041	27	JQ691611	Cronobacter phage CR9, complete genome	9702-9728	2	0.926
NC_010184_3	3.16\|3528186\|27\|NC_010184\|CRT	3528186-3528212	27	JQ691611	Cronobacter phage CR9, complete genome	9702-9728	2	0.926
NC_010184_2	2.1\|2320646\|28\|NC_010184\|CRT	2320646-2320673	28	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	251912-251939	3	0.893
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	251894-251921	3	0.893
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	251921-251948	3	0.893
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	251984-252011	3	0.893
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	165-192	3	0.893
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	192-219	3	0.893
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	264-291	3	0.893
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	291-318	3	0.893
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	318-345	3	0.893
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	93-120	3	0.893
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68781-68808	3	0.893
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68790-68817	3	0.893
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68799-68826	3	0.893
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68808-68835	3	0.893
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68817-68844	3	0.893
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68826-68853	3	0.893
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68835-68862	3	0.893
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68844-68871	3	0.893
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68853-68880	3	0.893
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68862-68889	3	0.893
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68916-68943	3	0.893
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68925-68952	3	0.893
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71211-71238	3	0.893
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73749-73776	3	0.893
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73974-74001	3	0.893
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90221-90248	3	0.893
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90230-90257	3	0.893
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90239-90266	3	0.893
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90248-90275	3	0.893
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90257-90284	3	0.893
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90266-90293	3	0.893
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130574-130601	3	0.893
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130583-130610	3	0.893
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130592-130619	3	0.893
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130601-130628	3	0.893
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130664-130691	3	0.893
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130673-130700	3	0.893
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130682-130709	3	0.893
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130691-130718	3	0.893
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130700-130727	3	0.893
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130709-130736	3	0.893
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130718-130745	3	0.893
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130727-130754	3	0.893
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130745-130772	3	0.893
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130754-130781	3	0.893
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321828-321855	3	0.893
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321855-321882	3	0.893
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321927-321954	3	0.893
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	MN693798	Marine virus AFVG_250M119, complete genome	11468-11495	3	0.893
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	131083-131110	3	0.893
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	KY421186	Flavobacterium phage FL-1, complete genome	26630-26657	3	0.893
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	KY421186	Flavobacterium phage FL-1, complete genome	26729-26756	3	0.893
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	KY421186	Flavobacterium phage FL-1, complete genome	26756-26783	3	0.893
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	KY421186	Flavobacterium phage FL-1, complete genome	26792-26819	3	0.893
NC_010184_3	3.15\|3528141\|27\|NC_010184\|CRT	3528141-3528167	27	MN163280	Klebsiella phage KpGranit, complete genome	83373-83399	3	0.889
NC_010184_3	3.15\|3528141\|27\|NC_010184\|CRT	3528141-3528167	27	MN163280	Klebsiella phage KpGranit, complete genome	84576-84602	3	0.889
NC_010184_2	2.3\|2320781\|28\|NC_010184\|CRT	2320781-2320808	28	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	252020-252047	4	0.857
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	251885-251912	4	0.857
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	252002-252029	4	0.857
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	120-147	4	0.857
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	219-246	4	0.857
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	354-381	4	0.857
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	453-480	4	0.857
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71538-71565	4	0.857
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71556-71583	4	0.857
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	72752-72779	4	0.857
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73911-73938	4	0.857
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321792-321819	4	0.857
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321900-321927	4	0.857
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321693-321720	4	0.857
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	131074-131101	4	0.857
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	KY421186	Flavobacterium phage FL-1, complete genome	26882-26909	4	0.857
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	MK962638	Achromobacter phage vB_AxyP_19-32_Axy21, complete genome	14666-14693	4	0.857
NC_010184_3	3.11\|3527970\|27\|NC_010184\|CRT	3527970-3527996	27	JQ691611	Cronobacter phage CR9, complete genome	9702-9728	4	0.852
NC_010184_3	3.12\|3528015\|27\|NC_010184\|CRT	3528015-3528041	27	MN163280	Klebsiella phage KpGranit, complete genome	83373-83399	4	0.852
NC_010184_3	3.12\|3528015\|27\|NC_010184\|CRT	3528015-3528041	27	MN163280	Klebsiella phage KpGranit, complete genome	84576-84602	4	0.852
NC_010184_3	3.15\|3528141\|27\|NC_010184\|CRT	3528141-3528167	27	MN163280	Klebsiella phage KpGranit, complete genome	81270-81296	4	0.852
NC_010184_3	3.15\|3528141\|27\|NC_010184\|CRT	3528141-3528167	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	81955-81981	4	0.852
NC_010184_3	3.15\|3528141\|27\|NC_010184\|CRT	3528141-3528167	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	85222-85248	4	0.852
NC_010184_3	3.15\|3528141\|27\|NC_010184\|CRT	3528141-3528167	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	76467-76493	4	0.852
NC_010184_3	3.15\|3528141\|27\|NC_010184\|CRT	3528141-3528167	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	78603-78629	4	0.852
NC_010184_3	3.15\|3528141\|27\|NC_010184\|CRT	3528141-3528167	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	79815-79841	4	0.852
NC_010184_3	3.15\|3528141\|27\|NC_010184\|CRT	3528141-3528167	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	80972-80998	4	0.852
NC_010184_3	3.15\|3528141\|27\|NC_010184\|CRT	3528141-3528167	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	83108-83134	4	0.852
NC_010184_3	3.15\|3528141\|27\|NC_010184\|CRT	3528141-3528167	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	84320-84346	4	0.852
NC_010184_3	3.16\|3528186\|27\|NC_010184\|CRT	3528186-3528212	27	MN163280	Klebsiella phage KpGranit, complete genome	83373-83399	4	0.852
NC_010184_3	3.16\|3528186\|27\|NC_010184\|CRT	3528186-3528212	27	MN163280	Klebsiella phage KpGranit, complete genome	84576-84602	4	0.852
NC_010184_3	3.18\|3528267\|27\|NC_010184\|CRT	3528267-3528293	27	JQ691611	Cronobacter phage CR9, complete genome	9702-9728	4	0.852
NC_010184_3	3.21\|3528393\|27\|NC_010184\|CRT	3528393-3528419	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	81955-81981	4	0.852
NC_010184_3	3.24\|3528510\|27\|NC_010184\|CRT	3528510-3528536	27	JQ691611	Cronobacter phage CR9, complete genome	9702-9728	4	0.852
NC_010184_3	3.26\|3528591\|27\|NC_010184\|CRT	3528591-3528617	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	81955-81981	4	0.852
NC_010184_3	3.29\|3528708\|27\|NC_010184\|CRT	3528708-3528734	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	81955-81981	4	0.852
NC_010184_2	2.1\|2320646\|28\|NC_010184\|CRT	2320646-2320673	28	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	235999-236026	5	0.821
NC_010184_2	2.3\|2320781\|28\|NC_010184\|CRT	2320781-2320808	28	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	132553-132580	5	0.821
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68871-68898	5	0.821
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68934-68961	5	0.821
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73632-73659	5	0.821
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73794-73821	5	0.821
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68772-68799	5	0.821
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130628-130655	5	0.821
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130655-130682	5	0.821
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	MN693968	Marine virus AFVG_250M909, complete genome	17701-17728	5	0.821
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	AP017924	Ralstonia phage RP12 DNA, complete genome	192652-192679	5	0.821
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	AP017925	Ralstonia phage RP31 DNA, complete genome	189398-189425	5	0.821
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	906900-906927	5	0.821
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NC_047890	Escherichia phage PGT2, complete genome	23171-23198	5	0.821
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	JN882298	Escherichia phage phiKT, complete genome	18563-18590	5	0.821
NC_010184_3	3.15\|3528141\|27\|NC_010184\|CRT	3528141-3528167	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29528-29554	5	0.815
NC_010184_3	3.15\|3528141\|27\|NC_010184\|CRT	3528141-3528167	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3951-3977	5	0.815
NC_010184_3	3.19\|3528312\|27\|NC_010184\|CRT	3528312-3528338	27	JQ691611	Cronobacter phage CR9, complete genome	9702-9728	5	0.815
NC_010184_3	3.21\|3528393\|27\|NC_010184\|CRT	3528393-3528419	27	MN163280	Klebsiella phage KpGranit, complete genome	83373-83399	5	0.815
NC_010184_3	3.21\|3528393\|27\|NC_010184\|CRT	3528393-3528419	27	MN163280	Klebsiella phage KpGranit, complete genome	84576-84602	5	0.815
NC_010184_3	3.21\|3528393\|27\|NC_010184\|CRT	3528393-3528419	27	JQ691611	Cronobacter phage CR9, complete genome	9702-9728	5	0.815
NC_010184_3	3.21\|3528393\|27\|NC_010184\|CRT	3528393-3528419	27	MN101228	Klebsiella phage KPN4, complete genome	27720-27746	5	0.815
NC_010184_3	3.26\|3528591\|27\|NC_010184\|CRT	3528591-3528617	27	MN163280	Klebsiella phage KpGranit, complete genome	83373-83399	5	0.815
NC_010184_3	3.26\|3528591\|27\|NC_010184\|CRT	3528591-3528617	27	MN163280	Klebsiella phage KpGranit, complete genome	84576-84602	5	0.815
NC_010184_3	3.26\|3528591\|27\|NC_010184\|CRT	3528591-3528617	27	JQ691611	Cronobacter phage CR9, complete genome	9702-9728	5	0.815
NC_010184_3	3.26\|3528591\|27\|NC_010184\|CRT	3528591-3528617	27	MN101228	Klebsiella phage KPN4, complete genome	27720-27746	5	0.815
NC_010184_3	3.29\|3528708\|27\|NC_010184\|CRT	3528708-3528734	27	MN163280	Klebsiella phage KpGranit, complete genome	83373-83399	5	0.815
NC_010184_3	3.29\|3528708\|27\|NC_010184\|CRT	3528708-3528734	27	MN163280	Klebsiella phage KpGranit, complete genome	84576-84602	5	0.815
NC_010184_3	3.29\|3528708\|27\|NC_010184\|CRT	3528708-3528734	27	JQ691611	Cronobacter phage CR9, complete genome	9702-9728	5	0.815
NC_010184_3	3.29\|3528708\|27\|NC_010184\|CRT	3528708-3528734	27	MN101228	Klebsiella phage KPN4, complete genome	27720-27746	5	0.815
NC_010184_1	1.2\|1282224\|28\|NC_010184\|CRISPRCasFinder	1282224-1282251	28	NC_041916	Vibrio phage pTD1 DNA, complete genome	91132-91159	6	0.786
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90212-90239	6	0.786
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	MN693798	Marine virus AFVG_250M119, complete genome	11459-11486	6	0.786
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NZ_CP014284	Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence	178871-178898	6	0.786
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NZ_CP032609	Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence	270772-270799	6	0.786
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NZ_CP040345	Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence	416114-416141	6	0.786
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NC_028998	Phormidium phage MIS-PhV1B, complete genome	7519-7546	6	0.786
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	MN855854	Siphoviridae sp. isolate 269, complete genome	2180-2207	6	0.786
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NZ_CP053689	Arthrobacter citreus strain NEB 577 plasmid unnamed1, complete sequence	173149-173176	6	0.786
NC_010184_3	3.11\|3527970\|27\|NC_010184\|CRT	3527970-3527996	27	MN163280	Klebsiella phage KpGranit, complete genome	83373-83399	6	0.778
NC_010184_3	3.11\|3527970\|27\|NC_010184\|CRT	3527970-3527996	27	MN163280	Klebsiella phage KpGranit, complete genome	84576-84602	6	0.778
NC_010184_3	3.14\|3528096\|27\|NC_010184\|CRT	3528096-3528122	27	MN163280	Klebsiella phage KpGranit, complete genome	83373-83399	6	0.778
NC_010184_3	3.14\|3528096\|27\|NC_010184\|CRT	3528096-3528122	27	MN163280	Klebsiella phage KpGranit, complete genome	84576-84602	6	0.778
NC_010184_3	3.18\|3528267\|27\|NC_010184\|CRT	3528267-3528293	27	MN163280	Klebsiella phage KpGranit, complete genome	83373-83399	6	0.778
NC_010184_3	3.18\|3528267\|27\|NC_010184\|CRT	3528267-3528293	27	MN163280	Klebsiella phage KpGranit, complete genome	84576-84602	6	0.778
NC_010184_3	3.21\|3528393\|27\|NC_010184\|CRT	3528393-3528419	27	MN163280	Klebsiella phage KpGranit, complete genome	81270-81296	6	0.778
NC_010184_3	3.21\|3528393\|27\|NC_010184\|CRT	3528393-3528419	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	85222-85248	6	0.778
NC_010184_3	3.21\|3528393\|27\|NC_010184\|CRT	3528393-3528419	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3951-3977	6	0.778
NC_010184_3	3.21\|3528393\|27\|NC_010184\|CRT	3528393-3528419	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29528-29554	6	0.778
NC_010184_3	3.21\|3528393\|27\|NC_010184\|CRT	3528393-3528419	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	76467-76493	6	0.778
NC_010184_3	3.21\|3528393\|27\|NC_010184\|CRT	3528393-3528419	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	78603-78629	6	0.778
NC_010184_3	3.21\|3528393\|27\|NC_010184\|CRT	3528393-3528419	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	79815-79841	6	0.778
NC_010184_3	3.21\|3528393\|27\|NC_010184\|CRT	3528393-3528419	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	80972-80998	6	0.778
NC_010184_3	3.21\|3528393\|27\|NC_010184\|CRT	3528393-3528419	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	83108-83134	6	0.778
NC_010184_3	3.21\|3528393\|27\|NC_010184\|CRT	3528393-3528419	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	84320-84346	6	0.778
NC_010184_3	3.24\|3528510\|27\|NC_010184\|CRT	3528510-3528536	27	MN163280	Klebsiella phage KpGranit, complete genome	83373-83399	6	0.778
NC_010184_3	3.24\|3528510\|27\|NC_010184\|CRT	3528510-3528536	27	MN163280	Klebsiella phage KpGranit, complete genome	84576-84602	6	0.778
NC_010184_3	3.26\|3528591\|27\|NC_010184\|CRT	3528591-3528617	27	MN163280	Klebsiella phage KpGranit, complete genome	81270-81296	6	0.778
NC_010184_3	3.26\|3528591\|27\|NC_010184\|CRT	3528591-3528617	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	85222-85248	6	0.778
NC_010184_3	3.26\|3528591\|27\|NC_010184\|CRT	3528591-3528617	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3951-3977	6	0.778
NC_010184_3	3.26\|3528591\|27\|NC_010184\|CRT	3528591-3528617	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29528-29554	6	0.778
NC_010184_3	3.26\|3528591\|27\|NC_010184\|CRT	3528591-3528617	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	76467-76493	6	0.778
NC_010184_3	3.26\|3528591\|27\|NC_010184\|CRT	3528591-3528617	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	78603-78629	6	0.778
NC_010184_3	3.26\|3528591\|27\|NC_010184\|CRT	3528591-3528617	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	79815-79841	6	0.778
NC_010184_3	3.26\|3528591\|27\|NC_010184\|CRT	3528591-3528617	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	80972-80998	6	0.778
NC_010184_3	3.26\|3528591\|27\|NC_010184\|CRT	3528591-3528617	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	83108-83134	6	0.778
NC_010184_3	3.26\|3528591\|27\|NC_010184\|CRT	3528591-3528617	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	84320-84346	6	0.778
NC_010184_3	3.29\|3528708\|27\|NC_010184\|CRT	3528708-3528734	27	MN163280	Klebsiella phage KpGranit, complete genome	81270-81296	6	0.778
NC_010184_3	3.29\|3528708\|27\|NC_010184\|CRT	3528708-3528734	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	85222-85248	6	0.778
NC_010184_3	3.29\|3528708\|27\|NC_010184\|CRT	3528708-3528734	27	AP013669	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, * SEQUENCING IN PROGRESS *	3951-3977	6	0.778
NC_010184_3	3.29\|3528708\|27\|NC_010184\|CRT	3528708-3528734	27	AP013411	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43	29528-29554	6	0.778
NC_010184_3	3.29\|3528708\|27\|NC_010184\|CRT	3528708-3528734	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	76467-76493	6	0.778
NC_010184_3	3.29\|3528708\|27\|NC_010184\|CRT	3528708-3528734	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	78603-78629	6	0.778
NC_010184_3	3.29\|3528708\|27\|NC_010184\|CRT	3528708-3528734	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	79815-79841	6	0.778
NC_010184_3	3.29\|3528708\|27\|NC_010184\|CRT	3528708-3528734	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	80972-80998	6	0.778
NC_010184_3	3.29\|3528708\|27\|NC_010184\|CRT	3528708-3528734	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	83108-83134	6	0.778
NC_010184_3	3.29\|3528708\|27\|NC_010184\|CRT	3528708-3528734	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	84320-84346	6	0.778
NC_010184_1	1.2\|1282224\|28\|NC_010184\|CRISPRCasFinder	1282224-1282251	28	NZ_CP023280	Nostoc sp. CENA543 plasmid pCENA543a, complete sequence	43896-43923	7	0.75
NC_010184_1	1.2\|1282224\|28\|NC_010184\|CRISPRCasFinder	1282224-1282251	28	MT230534	Pantoea phage vB_PagM_SSEM1, complete genome	53432-53459	7	0.75
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130565-130592	7	0.75
NC_010184_2	2.5\|2320916\|28\|NC_010184\|CRT	2320916-2320943	28	GU943063	Uncultured phage MedDCM-OCT-S05-C139 genomic sequence	12524-12551	7	0.75
NC_010184_1	1.1\|1282170\|31\|NC_010184\|CRISPRCasFinder	1282170-1282200	31	JN022534	Xanthomonas phage vB_XveM_DIBBI, complete genome	1058-1088	9	0.71
NC_010184_1	1.1\|1282170\|31\|NC_010184\|CRISPRCasFinder	1282170-1282200	31	NC_048766	Pantoea phage vB_PagM_AAM37, complete genome	1655-1685	9	0.71
NC_010184_1	1.1\|1282170\|31\|NC_010184\|CRISPRCasFinder	1282170-1282200	31	NC_048767	Pantoea phage vB_PagM_PSKM, complete genome	1655-1685	9	0.71
NC_010184_3	3.33\|3528861\|33\|NC_010184\|CRT	3528861-3528893	33	MN163280	Klebsiella phage KpGranit, complete genome	83367-83399	9	0.727
NC_010184_3	3.33\|3528861\|33\|NC_010184\|CRT	3528861-3528893	33	MN163280	Klebsiella phage KpGranit, complete genome	84570-84602	9	0.727

1. spacer 2.5|2320916|28|NC_010184|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.929

caaccggagcaaccggagcaacaggagt	CRISPR spacer
caaccggagcaaccggagcaactggagg	Protospacer
********************** ****

2. spacer 2.5|2320916|28|NC_010184|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.929

caaccggagcaaccggagcaacaggagt	CRISPR spacer
caaccggagcaaccggggcaacaggagc	Protospacer
****************.**********.

3. spacer 2.5|2320916|28|NC_010184|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 2, identity: 0.929

caaccggagcaaccggagcaacaggagt	CRISPR spacer
caacaggagcaacgggagcaacaggagt	Protospacer
**** ******** **************

4. spacer 2.5|2320916|28|NC_010184|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 2, identity: 0.929

caaccggagcaaccggagcaacaggagt	CRISPR spacer
caacaggagcaacgggagcaacaggagt	Protospacer
**** ******** **************

5. spacer 2.5|2320916|28|NC_010184|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 2, identity: 0.929

caaccggagcaaccggagcaacaggagt	CRISPR spacer
caacaggagcaacaggagcaacaggagt	Protospacer
**** ******** **************

6. spacer 2.5|2320916|28|NC_010184|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 2, identity: 0.929

caaccggagcaaccggagcaacaggagt	CRISPR spacer
caacaggagcaacgggagcaacaggagt	Protospacer
**** ******** **************

7. spacer 2.5|2320916|28|NC_010184|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.929

caaccggagcaaccggagcaacaggagt	CRISPR spacer
caacaggagcaacaggagcaacaggagt	Protospacer
**** ******** **************

8. spacer 2.5|2320916|28|NC_010184|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 2, identity: 0.929

caaccggagcaaccggagcaacaggagt	CRISPR spacer
caacaggagcaacgggagcaacaggagt	Protospacer
**** ******** **************

9. spacer 2.5|2320916|28|NC_010184|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 2, identity: 0.929

caaccggagcaaccggagcaacaggagt	CRISPR spacer
caacaggagcaacaggagcaacaggagt	Protospacer
**** ******** **************

10. spacer 2.5|2320916|28|NC_010184|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 2, identity: 0.929

caaccggagcaaccggagcaacaggagt	CRISPR spacer
caacaggagcaacgggagcaacaggagt	Protospacer
**** ******** **************

11. spacer 3.12|3528015|27|NC_010184|CRT matches to JQ691611 (Cronobacter phage CR9, complete genome) position: , mismatch: 2, identity: 0.926

tcttcaaggtaacacaggtgctaccgg	CRISPR spacer
tcctcaaggtaacacaggtcctaccgg	Protospacer
**.**************** *******

12. spacer 3.16|3528186|27|NC_010184|CRT matches to JQ691611 (Cronobacter phage CR9, complete genome) position: , mismatch: 2, identity: 0.926

tcttcaaggtaacacaggtgctaccgg	CRISPR spacer
tcctcaaggtaacacaggtcctaccgg	Protospacer
**.**************** *******

13. spacer 2.1|2320646|28|NC_010184|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.893

taacaggagaaacaggggcaaccggagc	CRISPR spacer
caacaggagcaaccggggcaaccggagc	Protospacer
.******** *** **************

14. spacer 2.5|2320916|28|NC_010184|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.893

caaccggagcaaccggagcaacaggagt	CRISPR spacer
caacgggagcaaccggggcaacaggagc	Protospacer
**** ***********.**********.

15. spacer 2.5|2320916|28|NC_010184|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.893

caaccggagcaaccggagcaacaggagt	CRISPR spacer
caaccggggcaaccggagcaaccggagc	Protospacer
*******.************** ****.

16. spacer 2.5|2320916|28|NC_010184|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.893

caaccggagcaaccggagcaacaggagt	CRISPR spacer
caacaggagcaaccggggcaacaggagc	Protospacer
**** ***********.**********.

17. spacer 2.5|2320916|28|NC_010184|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 3, identity: 0.893

caaccggagcaaccggagcaacaggagt	CRISPR spacer
taacgggagcaacaggagcaacaggagt	Protospacer
.*** ******** **************

18. spacer 2.5|2320916|28|NC_010184|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 3, identity: 0.893

caaccggagcaaccggagcaacaggagt	CRISPR spacer
taacgggagcaacaggagcaacaggagt	Protospacer
.*** ******** **************

19. spacer 2.5|2320916|28|NC_010184|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 3, identity: 0.893

caaccggagcaaccggagcaacaggagt	CRISPR spacer
taacgggagcaacaggagcaacaggagt	Protospacer
.*** ******** **************

20. spacer 2.5|2320916|28|NC_010184|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 3, identity: 0.893

caaccggagcaaccggagcaacaggagt	CRISPR spacer
taacgggagcaacaggagcaacaggagt	Protospacer
.*** ******** **************

21. spacer 2.5|2320916|28|NC_010184|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 3, identity: 0.893

caaccggagcaaccggagcaacaggagt	CRISPR spacer
taacgggagcaacaggagcaacaggagt	Protospacer
.*** ******** **************

22. spacer 2.5|2320916|28|NC_010184|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 3, identity: 0.893

caaccggagcaaccggagcaacaggagt	CRISPR spacer
cgacgggagcaacaggagcaacaggagt	Protospacer
*.** ******** **************

23. spacer 2.5|2320916|28|NC_010184|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.893

caaccggagcaaccggagcaacaggagt	CRISPR spacer
caacaggagcaacaggagcaacaggagc	Protospacer
**** ******** *************.

24. spacer 2.5|2320916|28|NC_010184|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.893

caaccggagcaaccggagcaacaggagt	CRISPR spacer
caacaggagcaacaggagcaacaggagc	Protospacer
**** ******** *************.

25. spacer 2.5|2320916|28|NC_010184|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.893

caaccggagcaaccggagcaacaggagt	CRISPR spacer
caacaggagcaacaggagcaacaggagc	Protospacer
**** ******** *************.

26. spacer 2.5|2320916|28|NC_010184|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.893

caaccggagcaaccggagcaacaggagt	CRISPR spacer
caacaggagcaacaggagcaacaggagc	Protospacer
**** ******** *************.

27. spacer 2.5|2320916|28|NC_010184|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.893

caaccggagcaaccggagcaacaggagt	CRISPR spacer
caacaggagcaacaggagcaacaggagc	Protospacer
**** ******** *************.

28. spacer 2.5|2320916|28|NC_010184|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.893

caaccggagcaaccggagcaacaggagt	CRISPR spacer
caacaggagcaacaggagcaacaggagc	Protospacer
**** ******** *************.

29. spacer 2.5|2320916|28|NC_010184|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.893

caaccggagcaaccggagcaacaggagt	CRISPR spacer
caacaggagcaacaggagcaacaggagc	Protospacer
**** ******** *************.

30. spacer 2.5|2320916|28|NC_010184|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.893

caaccggagcaaccggagcaacaggagt	CRISPR spacer
caacaggagcaacaggagcaacaggagc	Protospacer
**** ******** *************.

31. spacer 2.5|2320916|28|NC_010184|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.893

caaccggagcaaccggagcaacaggagt	CRISPR spacer
caacaggagcaacaggagcaacaggagc	Protospacer
**** ******** *************.

32. spacer 2.5|2320916|28|NC_010184|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.893

caaccggagcaaccggagcaacaggagt	CRISPR spacer
caacaggagcaacaggagcaacaggagc	Protospacer
**** ******** *************.

33. spacer 2.5|2320916|28|NC_010184|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.893

caaccggagcaaccggagcaacaggagt	CRISPR spacer
caacaggagcaacgggagcaacaggagc	Protospacer
**** ******** *************.

34. spacer 2.5|2320916|28|NC_010184|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.893

caaccggagcaaccggagcaacaggagt	CRISPR spacer
caacgggagcaacaggagcaacaggagc	Protospacer
**** ******** *************.

35. spacer 2.5|2320916|28|NC_010184|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.893

caaccggagcaaccggagcaacaggagt	CRISPR spacer
caaccggagcgaccggagcaacaggtat	Protospacer
**********.************** .*

36. spacer 2.5|2320916|28|NC_010184|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.893

caaccggagcaaccggagcaacaggagt	CRISPR spacer
taaccggagcaacgggagcaacaggaat	Protospacer
.************ ************.*

37. spacer 2.5|2320916|28|NC_010184|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.893

caaccggagcaaccggagcaacaggagt	CRISPR spacer
caacaggagcaacgggagcaacaggaga	Protospacer
**** ******** *************

38. spacer 2.5|2320916|28|NC_010184|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.893

caaccggagcaaccggagcaacaggagt	CRISPR spacer
caacaggagcaacaggagcaacaggagc	Protospacer
**** ******** *************.

39. spacer 2.5|2320916|28|NC_010184|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.893

caaccggagcaaccggagcaacaggagt	CRISPR spacer
caacaggagcaacaggagcaacaggagc	Protospacer
**** ******** *************.

40. spacer 2.5|2320916|28|NC_010184|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.893

caaccggagcaaccggagcaacaggagt	CRISPR spacer
caacaggagcaacaggagcaacaggagc	Protospacer
**** ******** *************.

41. spacer 2.5|2320916|28|NC_010184|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.893

caaccggagcaaccggagcaacaggagt	CRISPR spacer
caacaggagcaacaggagcaacaggagc	Protospacer
**** ******** *************.

42. spacer 2.5|2320916|28|NC_010184|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.893

caaccggagcaaccggagcaacaggagt	CRISPR spacer
caacaggagcaacaggagcaacaggagc	Protospacer
**** ******** *************.

43. spacer 2.5|2320916|28|NC_010184|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.893

caaccggagcaaccggagcaacaggagt	CRISPR spacer
caacaggagcaacaggagcaacaggagc	Protospacer
**** ******** *************.

44. spacer 2.5|2320916|28|NC_010184|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.893

caaccggagcaaccggagcaacaggagt	CRISPR spacer
caacgggagcaacaggagcaacaggagc	Protospacer
**** ******** *************.

45. spacer 2.5|2320916|28|NC_010184|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.893

caaccggagcaaccggagcaacaggagt	CRISPR spacer
caacaggagcaacaggagcaacaggagc	Protospacer
**** ******** *************.

46. spacer 2.5|2320916|28|NC_010184|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.893

caaccggagcaaccggagcaacaggagt	CRISPR spacer
caacaggagcaacaggagcaacaggagc	Protospacer
**** ******** *************.

47. spacer 2.5|2320916|28|NC_010184|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.893

caaccggagcaaccggagcaacaggagt	CRISPR spacer
caacaggagcaacaggagcaacaggaga	Protospacer
**** ******** *************

48. spacer 2.5|2320916|28|NC_010184|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.893

caaccggagcaaccggagcaacaggagt	CRISPR spacer
caacaggagcaacaggagcaacaggagc	Protospacer
**** ******** *************.

49. spacer 2.5|2320916|28|NC_010184|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.893

caaccggagcaaccggagcaacaggagt	CRISPR spacer
caacaggagcaacaggagcaacaggagc	Protospacer
**** ******** *************.

50. spacer 2.5|2320916|28|NC_010184|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.893

caaccggagcaaccggagcaacaggagt	CRISPR spacer
caacaggagcaacaggagcaacaggagc	Protospacer
**** ******** *************.

51. spacer 2.5|2320916|28|NC_010184|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.893

caaccggagcaaccggagcaacaggagt	CRISPR spacer
caacaggagcaacaggagcaacaggagc	Protospacer
**** ******** *************.

52. spacer 2.5|2320916|28|NC_010184|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.893

caaccggagcaaccggagcaacaggagt	CRISPR spacer
caacaggagcaacaggagcaacaggagc	Protospacer
**** ******** *************.

53. spacer 2.5|2320916|28|NC_010184|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.893

caaccggagcaaccggagcaacaggagt	CRISPR spacer
caacaggagcaacaggagcaacaggagc	Protospacer
**** ******** *************.

54. spacer 2.5|2320916|28|NC_010184|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.893

caaccggagcaaccggagcaacaggagt	CRISPR spacer
caacaggagcaacaggagcaacaggagc	Protospacer
**** ******** *************.

55. spacer 2.5|2320916|28|NC_010184|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.893

caaccggagcaaccggagcaacaggagt	CRISPR spacer
caacaggagcaacaggagcaacaggagc	Protospacer
**** ******** *************.

56. spacer 2.5|2320916|28|NC_010184|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.893

caaccggagcaaccggagcaacaggagt	CRISPR spacer
caacaggagcaacgggagcaacaggagc	Protospacer
**** ******** *************.

57. spacer 2.5|2320916|28|NC_010184|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.893

caaccggagcaaccggagcaacaggagt	CRISPR spacer
caacgggagcaacaggagcaacaggagc	Protospacer
**** ******** *************.

58. spacer 2.5|2320916|28|NC_010184|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 3, identity: 0.893

caaccggagcaaccggagcaacaggagt	CRISPR spacer
taacgggagcaacaggagcaacaggagt	Protospacer
.*** ******** **************

59. spacer 2.5|2320916|28|NC_010184|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 3, identity: 0.893

caaccggagcaaccggagcaacaggagt	CRISPR spacer
taacgggagcaacaggagcaacaggagt	Protospacer
.*** ******** **************

60. spacer 2.5|2320916|28|NC_010184|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 3, identity: 0.893

caaccggagcaaccggagcaacaggagt	CRISPR spacer
cgacgggagcaacaggagcaacaggagt	Protospacer
*.** ******** **************

61. spacer 2.5|2320916|28|NC_010184|CRT matches to MN693798 (Marine virus AFVG_250M119, complete genome) position: , mismatch: 3, identity: 0.893

caaccggagcaaccggagcaacaggagt	CRISPR spacer
caacaggagcaacaggagcaacaggagg	Protospacer
**** ******** *************

62. spacer 2.5|2320916|28|NC_010184|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 3, identity: 0.893

caaccggagcaaccggagcaacaggagt	CRISPR spacer
caacaggagcaacaggagcaacaggagc	Protospacer
**** ******** *************.

63. spacer 2.5|2320916|28|NC_010184|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 3, identity: 0.893

caaccggagcaaccggagcaacaggagt	CRISPR spacer
caatcggagcaaccggagcaataggagc	Protospacer
***.*****************.*****.

64. spacer 2.5|2320916|28|NC_010184|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 3, identity: 0.893

caaccggagcaaccggagcaacaggagt	CRISPR spacer
caaccggagcaatcggagcaaccggagc	Protospacer
************.********* ****.

65. spacer 2.5|2320916|28|NC_010184|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 3, identity: 0.893

caaccggagcaaccggagcaacaggagt	CRISPR spacer
caatcggagcaaccggagcaataggagc	Protospacer
***.*****************.*****.

66. spacer 2.5|2320916|28|NC_010184|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 3, identity: 0.893

caaccggagcaaccggagcaacaggagt	CRISPR spacer
caaccggagcaatcggagcaaccggagc	Protospacer
************.********* ****.

67. spacer 3.15|3528141|27|NC_010184|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 3, identity: 0.889

tcttcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacacaggtgctactgg	Protospacer
**. **.********************

68. spacer 3.15|3528141|27|NC_010184|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 3, identity: 0.889

tcttcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacacaggtgctactgg	Protospacer
**. **.********************

69. spacer 2.3|2320781|28|NC_010184|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.857

aaacaggggcaacccgagcaacaggagt	CRISPR spacer
caacaggggcaaccggagcaaccggagg	Protospacer
 ************* ******* ****

70. spacer 2.5|2320916|28|NC_010184|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.857

caaccggagcaaccggagcaacaggagt	CRISPR spacer
caaccggagcaacgggagcaaccggggc	Protospacer
************* ******** **.*.

71. spacer 2.5|2320916|28|NC_010184|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.857

caaccggagcaaccggagcaacaggagt	CRISPR spacer
caacaggagcaaccggggcaacaggggc	Protospacer
**** ***********.********.*.

72. spacer 2.5|2320916|28|NC_010184|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 4, identity: 0.857

caaccggagcaaccggagcaacaggagt	CRISPR spacer
taacgggagcaacaggagcaacaggagc	Protospacer
.*** ******** *************.

73. spacer 2.5|2320916|28|NC_010184|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 4, identity: 0.857

caaccggagcaaccggagcaacaggagt	CRISPR spacer
taacgggagcaacaggagcaacaggagc	Protospacer
.*** ******** *************.

74. spacer 2.5|2320916|28|NC_010184|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 4, identity: 0.857

caaccggagcaaccggagcaacaggagt	CRISPR spacer
taacgggagcaacaggagcaacaggagc	Protospacer
.*** ******** *************.

75. spacer 2.5|2320916|28|NC_010184|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 4, identity: 0.857

caaccggagcaaccggagcaacaggagt	CRISPR spacer
caacgggagcaacgggagcaacaggggg	Protospacer
**** ******** ***********.*

76. spacer 2.5|2320916|28|NC_010184|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.857

caaccggagcaaccggagcaacaggagt	CRISPR spacer
taaccggagcaaccggagtgacaggagc	Protospacer
.*****************..*******.

77. spacer 2.5|2320916|28|NC_010184|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.857

caaccggagcaaccggagcaacaggagt	CRISPR spacer
tgacaggagcaactggagcaacaggagt	Protospacer
..** ********.**************

78. spacer 2.5|2320916|28|NC_010184|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.857

caaccggagcaaccggagcaacaggagt	CRISPR spacer
taaccggagcaacgggtgcaacaggagc	Protospacer
.************ ** **********.

79. spacer 2.5|2320916|28|NC_010184|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.857

caaccggagcaaccggagcaacaggagt	CRISPR spacer
taaccggagcaacgggagaaacaggagc	Protospacer
.************ **** ********.

80. spacer 2.5|2320916|28|NC_010184|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 4, identity: 0.857

caaccggagcaaccggagcaacaggagt	CRISPR spacer
taacgggagcaacaggagcaacaggagc	Protospacer
.*** ******** *************.

81. spacer 2.5|2320916|28|NC_010184|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 4, identity: 0.857

caaccggagcaaccggagcaacaggagt	CRISPR spacer
taacgggagcaacaggagcaacaggagc	Protospacer
.*** ******** *************.

82. spacer 2.5|2320916|28|NC_010184|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 4, identity: 0.857

caaccggagcaaccggagcaacaggagt	CRISPR spacer
caacgggagcaacgggagcaacaggggg	Protospacer
**** ******** ***********.*

83. spacer 2.5|2320916|28|NC_010184|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 4, identity: 0.857

caaccggagcaaccggagcaacaggagt	CRISPR spacer
caacaggagcaacaggagcaacaggacc	Protospacer
**** ******** ************ .

84. spacer 2.5|2320916|28|NC_010184|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 4, identity: 0.857

caaccggagcaaccggagcaacaggagt	CRISPR spacer
aaaccggagcaacgggagcaacgggagc	Protospacer
 ************ ********.****.

85. spacer 2.5|2320916|28|NC_010184|CRT matches to MK962638 (Achromobacter phage vB_AxyP_19-32_Axy21, complete genome) position: , mismatch: 4, identity: 0.857

caaccggagcaaccggagcaacaggagt	CRISPR spacer
ccaccggagcaaccggagcaacagccgg	Protospacer
* **********************  *

86. spacer 3.11|3527970|27|NC_010184|CRT matches to JQ691611 (Cronobacter phage CR9, complete genome) position: , mismatch: 4, identity: 0.852

cgttcaaggtaacacaggtgctaccgg	CRISPR spacer
tcctcaaggtaacacaggtcctaccgg	Protospacer
. .**************** *******

87. spacer 3.12|3528015|27|NC_010184|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 4, identity: 0.852

tcttcaaggtaacacaggtgctaccgg	CRISPR spacer
tccacagggtaacacaggtgctactgg	Protospacer
**. **.*****************.**

88. spacer 3.12|3528015|27|NC_010184|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 4, identity: 0.852

tcttcaaggtaacacaggtgctaccgg	CRISPR spacer
tccacagggtaacacaggtgctactgg	Protospacer
**. **.*****************.**

89. spacer 3.15|3528141|27|NC_010184|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 4, identity: 0.852

tcttcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacaccggtgctactgg	Protospacer
**. **.******** ***********

90. spacer 3.15|3528141|27|NC_010184|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 4, identity: 0.852

tcttcaaggtaacacaggtgctactgg	CRISPR spacer
ccctcagggtaacactggtgctactgg	Protospacer
.*.***.******** ***********

91. spacer 3.15|3528141|27|NC_010184|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 4, identity: 0.852

tcttcaaggtaacacaggtgctactgg	CRISPR spacer
tccacaaggtaacaaaggtgatactgg	Protospacer
**. ********** ***** ******

92. spacer 3.15|3528141|27|NC_010184|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 4, identity: 0.852

tcttcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
**. **.******** ***********

93. spacer 3.15|3528141|27|NC_010184|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 4, identity: 0.852

tcttcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
**. **.******** ***********

94. spacer 3.15|3528141|27|NC_010184|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 4, identity: 0.852

tcttcaaggtaacacaggtgctactgg	CRISPR spacer
tccgcagggtaacactggtgctactgg	Protospacer
**. **.******** ***********

95. spacer 3.15|3528141|27|NC_010184|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 4, identity: 0.852

tcttcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
**. **.******** ***********

96. spacer 3.15|3528141|27|NC_010184|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 4, identity: 0.852

tcttcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
**. **.******** ***********

97. spacer 3.15|3528141|27|NC_010184|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 4, identity: 0.852

tcttcaaggtaacacaggtgctactgg	CRISPR spacer
tccgcagggtaacactggtgctactgg	Protospacer
**. **.******** ***********

98. spacer 3.16|3528186|27|NC_010184|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 4, identity: 0.852

tcttcaaggtaacacaggtgctaccgg	CRISPR spacer
tccacagggtaacacaggtgctactgg	Protospacer
**. **.*****************.**

99. spacer 3.16|3528186|27|NC_010184|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 4, identity: 0.852

tcttcaaggtaacacaggtgctaccgg	CRISPR spacer
tccacagggtaacacaggtgctactgg	Protospacer
**. **.*****************.**

100. spacer 3.18|3528267|27|NC_010184|CRT matches to JQ691611 (Cronobacter phage CR9, complete genome) position: , mismatch: 4, identity: 0.852

cgttcaaggtaacacaggtgctaccgg	CRISPR spacer
tcctcaaggtaacacaggtcctaccgg	Protospacer
. .**************** *******

101. spacer 3.21|3528393|27|NC_010184|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 4, identity: 0.852

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
ccctcagggtaacactggtgctactgg	Protospacer
* .***.******** ***********

102. spacer 3.24|3528510|27|NC_010184|CRT matches to JQ691611 (Cronobacter phage CR9, complete genome) position: , mismatch: 4, identity: 0.852

cgttcaaggtaacacaggtgctaccgg	CRISPR spacer
tcctcaaggtaacacaggtcctaccgg	Protospacer
. .**************** *******

103. spacer 3.26|3528591|27|NC_010184|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 4, identity: 0.852

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
ccctcagggtaacactggtgctactgg	Protospacer
* .***.******** ***********

104. spacer 3.29|3528708|27|NC_010184|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 4, identity: 0.852

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
ccctcagggtaacactggtgctactgg	Protospacer
* .***.******** ***********

105. spacer 2.1|2320646|28|NC_010184|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 5, identity: 0.821

taacaggagaaacaggggcaaccggagc	CRISPR spacer
caacaggaccaacaggggcaaccggact	Protospacer
.*******  **************** .

106. spacer 2.3|2320781|28|NC_010184|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 5, identity: 0.821

aaacaggggcaacccgagcaacaggagt	CRISPR spacer
gaacaggggcaacaggagcaacaggacc	Protospacer
.************  *********** .

107. spacer 2.5|2320916|28|NC_010184|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.821

caaccggagcaaccggagcaacaggagt	CRISPR spacer
caacaggagcaacaggagcaacagggcc	Protospacer
**** ******** ***********. .

108. spacer 2.5|2320916|28|NC_010184|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.821

caaccggagcaaccggagcaacaggagt	CRISPR spacer
caacaggagcaacaggagcaacagggcc	Protospacer
**** ******** ***********. .

109. spacer 2.5|2320916|28|NC_010184|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.821

caaccggagcaaccggagcaacaggagt	CRISPR spacer
tgaccggagcaacgggagcaacgggagc	Protospacer
..*********** ********.****.

110. spacer 2.5|2320916|28|NC_010184|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.821

caaccggagcaaccggagcaacaggagt	CRISPR spacer
taacgggagtaaccggagcaacaggaac	Protospacer
.*** ****.****************..

111. spacer 2.5|2320916|28|NC_010184|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.821

caaccggagcaaccggagcaacaggagt	CRISPR spacer
caggaggagcaacaggagcaacaggagc	Protospacer
**.  ******** *************.

112. spacer 2.5|2320916|28|NC_010184|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.821

caaccggagcaaccggagcaacaggagt	CRISPR spacer
aagcaggagcaacaggagcaacaggaga	Protospacer
 *.* ******** *************

113. spacer 2.5|2320916|28|NC_010184|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.821

caaccggagcaaccggagcaacaggagt	CRISPR spacer
aagcaggagcaacaggagcaacaggagc	Protospacer
 *.* ******** *************.

114. spacer 2.5|2320916|28|NC_010184|CRT matches to MN693968 (Marine virus AFVG_250M909, complete genome) position: , mismatch: 5, identity: 0.821

caaccggagcaaccggagcaacaggagt	CRISPR spacer
caactggagcaactggagcaacaggttc	Protospacer
****.********.***********  .

115. spacer 2.5|2320916|28|NC_010184|CRT matches to AP017924 (Ralstonia phage RP12 DNA, complete genome) position: , mismatch: 5, identity: 0.821

caaccggagcaaccggagcaacaggagt	CRISPR spacer
caaccggagcaaccggcgcatcagcggc	Protospacer
**************** *** *** .*.

116. spacer 2.5|2320916|28|NC_010184|CRT matches to AP017925 (Ralstonia phage RP31 DNA, complete genome) position: , mismatch: 5, identity: 0.821

caaccggagcaaccggagcaacaggagt	CRISPR spacer
caaccggagcaaccggcgcatcagcggc	Protospacer
**************** *** *** .*.

117. spacer 2.5|2320916|28|NC_010184|CRT matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 5, identity: 0.821

caaccggagcaaccggagcaacaggagt	CRISPR spacer
caaccggagcaaccggaacaatcggtgc	Protospacer
*****************.***. ** *.

118. spacer 2.5|2320916|28|NC_010184|CRT matches to NC_047890 (Escherichia phage PGT2, complete genome) position: , mismatch: 5, identity: 0.821

caaccggagcaaccggagcaacaggagt	CRISPR spacer
ccaccggagcagccggagctacaggggc	Protospacer
* *********.******* *****.*.

119. spacer 2.5|2320916|28|NC_010184|CRT matches to JN882298 (Escherichia phage phiKT, complete genome) position: , mismatch: 5, identity: 0.821

caaccggagcaaccggagcaacaggagt	CRISPR spacer
ccaccggagcagccggagctacaggggc	Protospacer
* *********.******* *****.*.

120. spacer 3.15|3528141|27|NC_010184|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 5, identity: 0.815

tcttcaaggtaacacaggtgctactgg	CRISPR spacer
accacaaggtaatacaggagctactgg	Protospacer
 *. ********.***** ********

121. spacer 3.15|3528141|27|NC_010184|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

tcttcaaggtaacacaggtgctactgg	CRISPR spacer
accacaaggtaatacaggagctactgg	Protospacer
 *. ********.***** ********

122. spacer 3.19|3528312|27|NC_010184|CRT matches to JQ691611 (Cronobacter phage CR9, complete genome) position: , mismatch: 5, identity: 0.815

cgttcaaggtaacacgggtgctaccgg	CRISPR spacer
tcctcaaggtaacacaggtcctaccgg	Protospacer
. .************.*** *******

123. spacer 3.21|3528393|27|NC_010184|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 5, identity: 0.815

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacacaggtgctactgg	Protospacer
. . **.********************

124. spacer 3.21|3528393|27|NC_010184|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 5, identity: 0.815

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacacaggtgctactgg	Protospacer
. . **.********************

125. spacer 3.21|3528393|27|NC_010184|CRT matches to JQ691611 (Cronobacter phage CR9, complete genome) position: , mismatch: 5, identity: 0.815

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
tcctcaaggtaacacaggtcctaccgg	Protospacer
. .**************** ****.**

126. spacer 3.21|3528393|27|NC_010184|CRT matches to MN101228 (Klebsiella phage KPN4, complete genome) position: , mismatch: 5, identity: 0.815

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
tcctcagggtaacactggtgctactgg	Protospacer
. .***.******** ***********

127. spacer 3.26|3528591|27|NC_010184|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 5, identity: 0.815

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacacaggtgctactgg	Protospacer
. . **.********************

128. spacer 3.26|3528591|27|NC_010184|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 5, identity: 0.815

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacacaggtgctactgg	Protospacer
. . **.********************

129. spacer 3.26|3528591|27|NC_010184|CRT matches to JQ691611 (Cronobacter phage CR9, complete genome) position: , mismatch: 5, identity: 0.815

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
tcctcaaggtaacacaggtcctaccgg	Protospacer
. .**************** ****.**

130. spacer 3.26|3528591|27|NC_010184|CRT matches to MN101228 (Klebsiella phage KPN4, complete genome) position: , mismatch: 5, identity: 0.815

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
tcctcagggtaacactggtgctactgg	Protospacer
. .***.******** ***********

131. spacer 3.29|3528708|27|NC_010184|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 5, identity: 0.815

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacacaggtgctactgg	Protospacer
. . **.********************

132. spacer 3.29|3528708|27|NC_010184|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 5, identity: 0.815

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacacaggtgctactgg	Protospacer
. . **.********************

133. spacer 3.29|3528708|27|NC_010184|CRT matches to JQ691611 (Cronobacter phage CR9, complete genome) position: , mismatch: 5, identity: 0.815

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
tcctcaaggtaacacaggtcctaccgg	Protospacer
. .**************** ****.**

134. spacer 3.29|3528708|27|NC_010184|CRT matches to MN101228 (Klebsiella phage KPN4, complete genome) position: , mismatch: 5, identity: 0.815

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
tcctcagggtaacactggtgctactgg	Protospacer
. .***.******** ***********

135. spacer 1.2|1282224|28|NC_010184|CRISPRCasFinder matches to NC_041916 (Vibrio phage pTD1 DNA, complete genome) position: , mismatch: 6, identity: 0.786

tttagcaacttcttcagcaggcttttgt	CRISPR spacer
ctcagccacttcttcagcagtcttttca	Protospacer
.*.*** ************* *****

136. spacer 2.5|2320916|28|NC_010184|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.786

caaccggagcaaccggagcaacaggagt	CRISPR spacer
ctggaggagcaacaggagcaacaggagc	Protospacer
* .  ******** *************.

137. spacer 2.5|2320916|28|NC_010184|CRT matches to MN693798 (Marine virus AFVG_250M119, complete genome) position: , mismatch: 6, identity: 0.786

caaccggagcaaccggagcaacaggagt	CRISPR spacer
atgccgtagcaacaggagcaacaggagc	Protospacer
  .*** ****** *************.

138. spacer 2.5|2320916|28|NC_010184|CRT matches to NZ_CP014284 (Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence) position: , mismatch: 6, identity: 0.786

caaccggagcaaccggagcaacaggagt	CRISPR spacer
ataccggaccaaccggatcaacaggatc	Protospacer
  ****** ******** ******** .

139. spacer 2.5|2320916|28|NC_010184|CRT matches to NZ_CP032609 (Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence) position: , mismatch: 6, identity: 0.786

caaccggagcaaccggagcaacaggagt	CRISPR spacer
ataccggaccaaccggatcaacaggatc	Protospacer
  ****** ******** ******** .

140. spacer 2.5|2320916|28|NC_010184|CRT matches to NZ_CP040345 (Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

caaccggagcaaccggagcaacaggagt	CRISPR spacer
taaccggaccaacgggagcaacaggttc	Protospacer
.******* **** ***********  .

141. spacer 2.5|2320916|28|NC_010184|CRT matches to NC_028998 (Phormidium phage MIS-PhV1B, complete genome) position: , mismatch: 6, identity: 0.786

caaccggagcaaccggagcaacaggagt	CRISPR spacer
ctgttggagcaactggagcaacaggagc	Protospacer
* ...********.*************.

142. spacer 2.5|2320916|28|NC_010184|CRT matches to MN855854 (Siphoviridae sp. isolate 269, complete genome) position: , mismatch: 6, identity: 0.786

caaccggagcaaccggagcaacaggagt	CRISPR spacer
tcacaggagccaccggagcaacaggtgc	Protospacer
. ** ***** ************** *.

143. spacer 2.5|2320916|28|NC_010184|CRT matches to NZ_CP053689 (Arthrobacter citreus strain NEB 577 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

caaccggagcaaccggagcaacaggagt	CRISPR spacer
cgacgggagcaacaggagcaacaggccc	Protospacer
*.** ******** ***********  .

144. spacer 3.11|3527970|27|NC_010184|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 6, identity: 0.778

cgttcaaggtaacacaggtgctaccgg	CRISPR spacer
tccacagggtaacacaggtgctactgg	Protospacer
. . **.*****************.**

145. spacer 3.11|3527970|27|NC_010184|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 6, identity: 0.778

cgttcaaggtaacacaggtgctaccgg	CRISPR spacer
tccacagggtaacacaggtgctactgg	Protospacer
. . **.*****************.**

146. spacer 3.14|3528096|27|NC_010184|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 6, identity: 0.778

cgttcaaggtaacacaggtgcgactgg	CRISPR spacer
tccacagggtaacacaggtgctactgg	Protospacer
. . **.************** *****

147. spacer 3.14|3528096|27|NC_010184|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 6, identity: 0.778

cgttcaaggtaacacaggtgcgactgg	CRISPR spacer
tccacagggtaacacaggtgctactgg	Protospacer
. . **.************** *****

148. spacer 3.18|3528267|27|NC_010184|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 6, identity: 0.778

cgttcaaggtaacacaggtgctaccgg	CRISPR spacer
tccacagggtaacacaggtgctactgg	Protospacer
. . **.*****************.**

149. spacer 3.18|3528267|27|NC_010184|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 6, identity: 0.778

cgttcaaggtaacacaggtgctaccgg	CRISPR spacer
tccacagggtaacacaggtgctactgg	Protospacer
. . **.*****************.**

150. spacer 3.21|3528393|27|NC_010184|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 6, identity: 0.778

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacaccggtgctactgg	Protospacer
. . **.******** ***********

151. spacer 3.21|3528393|27|NC_010184|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 6, identity: 0.778

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
tccacaaggtaacaaaggtgatactgg	Protospacer
. . ********** ***** ******

152. spacer 3.21|3528393|27|NC_010184|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.778

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
accacaaggtaatacaggagctactgg	Protospacer
  . ********.***** ********

153. spacer 3.21|3528393|27|NC_010184|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 6, identity: 0.778

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
accacaaggtaatacaggagctactgg	Protospacer
  . ********.***** ********

154. spacer 3.21|3528393|27|NC_010184|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 6, identity: 0.778

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
. . **.******** ***********

155. spacer 3.21|3528393|27|NC_010184|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 6, identity: 0.778

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
. . **.******** ***********

156. spacer 3.21|3528393|27|NC_010184|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 6, identity: 0.778

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
tccgcagggtaacactggtgctactgg	Protospacer
. . **.******** ***********

157. spacer 3.21|3528393|27|NC_010184|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 6, identity: 0.778

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
. . **.******** ***********

158. spacer 3.21|3528393|27|NC_010184|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 6, identity: 0.778

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
. . **.******** ***********

159. spacer 3.21|3528393|27|NC_010184|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 6, identity: 0.778

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
tccgcagggtaacactggtgctactgg	Protospacer
. . **.******** ***********

160. spacer 3.24|3528510|27|NC_010184|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 6, identity: 0.778

cgttcaaggtaacacaggtgctaccgg	CRISPR spacer
tccacagggtaacacaggtgctactgg	Protospacer
. . **.*****************.**

161. spacer 3.24|3528510|27|NC_010184|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 6, identity: 0.778

cgttcaaggtaacacaggtgctaccgg	CRISPR spacer
tccacagggtaacacaggtgctactgg	Protospacer
. . **.*****************.**

162. spacer 3.26|3528591|27|NC_010184|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 6, identity: 0.778

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacaccggtgctactgg	Protospacer
. . **.******** ***********

163. spacer 3.26|3528591|27|NC_010184|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 6, identity: 0.778

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
tccacaaggtaacaaaggtgatactgg	Protospacer
. . ********** ***** ******

164. spacer 3.26|3528591|27|NC_010184|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.778

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
accacaaggtaatacaggagctactgg	Protospacer
  . ********.***** ********

165. spacer 3.26|3528591|27|NC_010184|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 6, identity: 0.778

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
accacaaggtaatacaggagctactgg	Protospacer
  . ********.***** ********

166. spacer 3.26|3528591|27|NC_010184|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 6, identity: 0.778

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
. . **.******** ***********

167. spacer 3.26|3528591|27|NC_010184|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 6, identity: 0.778

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
. . **.******** ***********

168. spacer 3.26|3528591|27|NC_010184|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 6, identity: 0.778

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
tccgcagggtaacactggtgctactgg	Protospacer
. . **.******** ***********

169. spacer 3.26|3528591|27|NC_010184|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 6, identity: 0.778

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
. . **.******** ***********

170. spacer 3.26|3528591|27|NC_010184|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 6, identity: 0.778

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
. . **.******** ***********

171. spacer 3.26|3528591|27|NC_010184|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 6, identity: 0.778

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
tccgcagggtaacactggtgctactgg	Protospacer
. . **.******** ***********

172. spacer 3.29|3528708|27|NC_010184|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 6, identity: 0.778

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacaccggtgctactgg	Protospacer
. . **.******** ***********

173. spacer 3.29|3528708|27|NC_010184|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 6, identity: 0.778

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
tccacaaggtaacaaaggtgatactgg	Protospacer
. . ********** ***** ******

174. spacer 3.29|3528708|27|NC_010184|CRT matches to AP013669 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C108A-MedDCM-OCT-S25-C43, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.778

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
accacaaggtaatacaggagctactgg	Protospacer
  . ********.***** ********

175. spacer 3.29|3528708|27|NC_010184|CRT matches to AP013411 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C108A-MedDCM-OCT-S29-C43) position: , mismatch: 6, identity: 0.778

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
accacaaggtaatacaggagctactgg	Protospacer
  . ********.***** ********

176. spacer 3.29|3528708|27|NC_010184|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 6, identity: 0.778

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
. . **.******** ***********

177. spacer 3.29|3528708|27|NC_010184|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 6, identity: 0.778

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
. . **.******** ***********

178. spacer 3.29|3528708|27|NC_010184|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 6, identity: 0.778

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
tccgcagggtaacactggtgctactgg	Protospacer
. . **.******** ***********

179. spacer 3.29|3528708|27|NC_010184|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 6, identity: 0.778

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
. . **.******** ***********

180. spacer 3.29|3528708|27|NC_010184|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 6, identity: 0.778

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
tccacagggtaacactggtgctactgg	Protospacer
. . **.******** ***********

181. spacer 3.29|3528708|27|NC_010184|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 6, identity: 0.778

cgttcaaggtaacacaggtgctactgg	CRISPR spacer
tccgcagggtaacactggtgctactgg	Protospacer
. . **.******** ***********

182. spacer 1.2|1282224|28|NC_010184|CRISPRCasFinder matches to NZ_CP023280 (Nostoc sp. CENA543 plasmid pCENA543a, complete sequence) position: , mismatch: 7, identity: 0.75

tttagcaacttcttcagcaggcttttgt	CRISPR spacer
tttagcaacttcttcaggaggaagtaac	Protospacer
***************** ***   * ..

183. spacer 1.2|1282224|28|NC_010184|CRISPRCasFinder matches to MT230534 (Pantoea phage vB_PagM_SSEM1, complete genome) position: , mismatch: 7, identity: 0.75

tttagcaacttcttcagcaggcttttgt	CRISPR spacer
gagagcaacttcttcagcattcttttca	Protospacer
   ****************  *****

184. spacer 2.5|2320916|28|NC_010184|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.75

caaccggagcaaccggagcaacaggagt	CRISPR spacer
ttttaggagcaacgggagcaacaggagc	Protospacer
.  . ******** *************.

185. spacer 2.5|2320916|28|NC_010184|CRT matches to GU943063 (Uncultured phage MedDCM-OCT-S05-C139 genomic sequence) position: , mismatch: 7, identity: 0.75

caaccggagcaaccggagcaacaggagt	CRISPR spacer
ttactggagcaactggagcaacaggtag	Protospacer
. **.********.*********** .

186. spacer 1.1|1282170|31|NC_010184|CRISPRCasFinder matches to JN022534 (Xanthomonas phage vB_XveM_DIBBI, complete genome) position: , mismatch: 9, identity: 0.71

tttttgtgtttcgttttgagtattgttgttt	CRISPR spacer
gttttatgtttcgttttgagtgtttgcggaa	Protospacer
 ****.***************.**  .*

187. spacer 1.1|1282170|31|NC_010184|CRISPRCasFinder matches to NC_048766 (Pantoea phage vB_PagM_AAM37, complete genome) position: , mismatch: 9, identity: 0.71

tttttgtgtttcgttttgagtattgttgttt	CRISPR spacer
gttttatgtttcgttttgagtgtttgcggaa	Protospacer
 ****.***************.**  .*

188. spacer 1.1|1282170|31|NC_010184|CRISPRCasFinder matches to NC_048767 (Pantoea phage vB_PagM_PSKM, complete genome) position: , mismatch: 9, identity: 0.71

tttttgtgtttcgttttgagtattgttgttt	CRISPR spacer
gttttatgtttcgttttgagtgtttgcggaa	Protospacer
 ****.***************.**  .*

189. spacer 3.33|3528861|33|NC_010184|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 9, identity: 0.727

tgctcaaggtaacacaggtgcgactggtatagg	CRISPR spacer
tccacagggtaacacaggtgctactggtcctca	Protospacer
* * **.************** ****** .  .

190. spacer 3.33|3528861|33|NC_010184|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 9, identity: 0.727

tgctcaaggtaacacaggtgcgactggtatagg	CRISPR spacer
tccacagggtaacacaggtgctactggtcctca	Protospacer
* * **.************** ****** .  .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1889956 : 1898771

Bacillus_phage(71.43%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002012346.1\|1889956_1891249_+	C40 family peptidase	A0A1V0DZX6	Clostridioides_phage	8.5e-10	28.7
WP_002141349.1\|1891415_1892180_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_002031356.1\|1892455_1894216_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.8e-265	94.5
WP_002031358.1\|1894302_1894980_+	response regulator transcription factor	W8CYM9	Bacillus_phage	1.6e-116	91.1
WP_012260763.1\|1894976_1896050_+	HAMP domain-containing sensor histidine kinase	W8CYF6	Bacillus_phage	6.1e-171	87.4
WP_002012353.1\|1896218_1896938_+	3-ketoacyl-ACP reductase	W8CYX9	Bacillus_phage	5.9e-61	100.0
WP_016103188.1\|1897087_1897759_+	O-methyltransferase	W8CYT3	Bacillus_phage	6.3e-65	92.0
WP_012260764.1\|1897892_1898771_+	aminoglycoside 6-adenylyltransferase	A0A1X9I6F2	Streptococcus_phage	8.2e-65	44.4

DBSCAN-SWA_2

3462571 : 3494223

Bacillus_phage(26.92%)

head,tail,holin,portal,terminase,protease,capsid

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012261457.1\|3462571_3464401_-	polysaccharide biosynthesis protein	A0A1V0SAI8	Catovirus	3.5e-25	29.4
WP_002128609.1\|3464706_3465369_-	CpsD/CapB family tyrosine-protein kinase	NA	NA	NA	NA
WP_012261458.1\|3465317_3466058_-	LPS biosynthesis protein	NA	NA	NA	NA
WP_012261459.1\|3466557_3466770_-	hypothetical protein	A0A1Z1LZP5	Bacillus_phage	1.4e-18	68.6
WP_000383887.1\|3467005_3467158_-	hypothetical protein	NA	NA	NA	NA
WP_012261460.1\|3467317_3467986_+	hypothetical protein	NA	NA	NA	NA
WP_012261461.1\|3468341_3468674_+	hypothetical protein	A0A1C8E989	Bacillus_phage	2.4e-25	60.0
WP_033690498.1\|3468842_3469082_-	DNA-binding protein	A0A2H4JBQ8	uncultured_Caudovirales_phage	2.6e-34	97.5
WP_000383710.1\|3469346_3469517_-	hypothetical protein	A0A2H4J852	uncultured_Caudovirales_phage	1.9e-10	89.3
WP_012261463.1\|3469632_3470565_-	N-acetylmuramoyl-L-alanine amidase	A0A0S2MVR5	Bacillus_phage	8.8e-158	84.6
WP_000373884.1\|3470564_3470990_-\|holin	phage holin family protein	A0A1B1P787	Bacillus_phage	2.2e-71	99.3
WP_040963174.1\|3471029_3473174_-\|tail	tail fiber domain-containing protein	D2XR28	Bacillus_phage	4.0e-129	39.8
WP_012261465.1\|3478225_3479698_-\|tail	phage tail family protein	D2XPZ5	Bacillus_virus	1.3e-216	71.3
WP_012261466.1\|3479739_3481917_-	membrane protein	A0A2I7SCT8	Paenibacillus_phage	1.1e-22	69.7
WP_157861616.1\|3482129_3482900_-	HNH endonuclease	A0A1B1P765	Bacillus_phage	3.9e-87	57.4
WP_012261469.1\|3483556_3484804_-	hypothetical protein	A0A2H4JAI2	uncultured_Caudovirales_phage	2.0e-181	83.8
WP_000415944.1\|3485034_3485397_-	hypothetical protein	A0A2H4JAG8	uncultured_Caudovirales_phage	9.2e-47	74.8
WP_012261470.1\|3485401_3485995_-\|tail	phage tail protein	A0A2H4JDV4	uncultured_Caudovirales_phage	5.9e-91	82.6
WP_012261471.1\|3485995_3486325_-	hypothetical protein	A0A2H4JAG4	uncultured_Caudovirales_phage	6.4e-47	82.6
WP_012261472.1\|3486321_3486678_-	HK97 gp10 family phage protein	D2XR21	Bacillus_phage	5.9e-30	59.5
WP_012261473.1\|3486670_3486970_-\|head	phage head closure protein	R9TPZ2	Paenibacillus_phage	1.7e-09	38.3
WP_012261474.1\|3486966_3487239_-	DNA-packaging protein	R9TMB7	Paenibacillus_phage	5.5e-20	55.1
WP_012261475.1\|3487241_3487532_-	hypothetical protein	A6XMJ7	Bacillus_virus	1.4e-05	35.8
WP_012261476.1\|3487568_3488732_-\|capsid	phage major capsid protein	H7BUQ0	unidentified_phage	5.4e-80	54.7
WP_012261477.1\|3488745_3489330_-\|head,protease	HK97 family phage prohead protease	A0A2I7SBY1	Paenibacillus_phage	2.7e-40	50.5
WP_012261478.1\|3489295_3490510_-\|portal	phage portal protein	J9QE83	Clostridium_phage	4.1e-139	60.7
WP_012261479.1\|3490525_3492214_-\|terminase	terminase large subunit	A0A290GJW3	Caldibacillus_phage	3.8e-252	73.2
WP_000985229.1\|3492210_3492582_-	hypothetical protein	A0A2H4JA84	uncultured_Caudovirales_phage	5.6e-15	50.5
WP_012261480.1\|3492748_3493045_-	HNH endonuclease	R9TNN2	Paenibacillus_phage	1.2e-28	61.5
WP_000353140.1\|3493377_3493539_+	hypothetical protein	NA	NA	NA	NA
WP_012261481.1\|3493809_3494223_+	type II toxin-antitoxin system HicB family antitoxin	A0A1L2JY34	Aeribacillus_phage	1.0e-41	59.4

DBSCAN-SWA_3

3503606 : 3519128

Bacillus_phage(66.67%)

integrase

attL 3500659:3500673|attR 3520915:3520929

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3500659:3500673	attL	NA	NA	NA	NA
WP_012261491.1\|3503606_3504110_-	sigma-70 family RNA polymerase sigma factor	A0A1L2JY33	Aeribacillus_phage	2.3e-56	64.1
WP_012261492.1\|3504689_3506576_-	ATP-binding protein	E5E3R2	Burkholderia_phage	2.3e-08	22.0
WP_040963113.1\|3506741_3507029_+	hypothetical protein	NA	NA	NA	NA
WP_012261493.1\|3507094_3507481_-	ArpU family transcriptional regulator	A0A0M4R397	Bacillus_phage	1.9e-42	69.1
WP_000520472.1\|3507485_3507773_-	hypothetical protein	A6M999	Geobacillus_virus	1.9e-34	71.3
WP_000132659.1\|3507873_3508038_+	hypothetical protein	A0A288WGN0	Bacillus_phage	1.5e-09	55.6
WP_012261494.1\|3508161_3508908_-	FAD-dependent thymidylate synthase	A0A2P1JUN2	Bacillus_phage	6.9e-81	63.3
WP_012261495.1\|3509083_3509839_-	DNA cytosine methyltransferase	A0A0K2CYZ1	Paenibacillus_phage	1.3e-63	49.4
WP_012261496.1\|3510222_3510795_-	dUTP diphosphatase	A0A0A7AQI4	Bacillus_phage	9.1e-81	74.3
WP_000553935.1\|3510889_3511012_-	Fur-regulated basic protein FbpA	NA	NA	NA	NA
WP_012261497.1\|3511014_3511644_-	hypothetical protein	A0A0M4RU33	Bacillus_phage	8.3e-27	41.4
WP_012261498.1\|3511640_3511811_-	hypothetical protein	NA	NA	NA	NA
WP_012261499.1\|3511828_3512659_-	ATP-binding protein	U5PWH5	Bacillus_phage	4.4e-36	38.4
WP_012261500.1\|3512594_3513353_-	conserved phage C-terminal domain-containing protein	A0A1W6JNI1	Staphylococcus_phage	4.8e-61	52.8
WP_012261501.1\|3513349_3513622_-	hypothetical protein	A0A0M4S680	Bacillus_phage	5.5e-36	78.7
WP_012261502.1\|3513635_3514307_-	DUF1071 domain-containing protein	A0A1B1P7F0	Bacillus_phage	3.4e-26	40.0
WP_012261503.1\|3514303_3514786_-	siphovirus Gp157 family protein	E5DV79	Deep-sea_thermophilic_phage	4.9e-35	48.8
WP_012261504.1\|3514800_3515064_-	hypothetical protein	A0A0M5M3T1	Bacillus_phage	1.6e-11	63.0
WP_012261505.1\|3515035_3515353_-	hypothetical protein	NA	NA	NA	NA
WP_080118620.1\|3515342_3515528_-	hypothetical protein	NA	NA	NA	NA
WP_000483547.1\|3515503_3515770_-	hypothetical protein	S5MC08	Brevibacillus_phage	6.6e-26	57.0
WP_012261507.1\|3515789_3516491_-	Rha family transcriptional regulator	A0A288WFT2	Bacillus_phage	1.4e-51	47.5
WP_012261508.1\|3516490_3516739_-	helix-turn-helix transcriptional regulator	W8CYU0	Bacillus_phage	1.7e-12	60.3
WP_012261509.1\|3516877_3517306_+	helix-turn-helix transcriptional regulator	Q786F1	Bacillus_phage	1.5e-27	47.9
WP_000673775.1\|3517328_3517757_+	ImmA/IrrE family metallo-endopeptidase	Q9T201	Bacillus_phage	1.8e-33	54.4
WP_012261510.1\|3517773_3517941_+	hypothetical protein	NA	NA	NA	NA
WP_012261511.1\|3517982_3519128_+\|integrase	site-specific integrase	A0A0M5M609	Bacillus_phage	1.8e-67	39.0
3520915:3520929	attR	NA	NA	NA	NA

DBSCAN-SWA_4

3574462 : 3695641

115

Bacillus_phage(43.14%)

head,tail,tRNA,holin,portal,coat,terminase,protease,integrase,capsid

attL 3598880:3598897|attR 3694888:3694905

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002014630.1\|3574462_3574819_-\|holin	CidA/LrgA family holin-like protein	NA	NA	NA	NA
WP_002142827.1\|3574852_3576286_-	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_002142829.1\|3576353_3577151_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_002033712.1\|3577150_3577831_-	bacillithiol biosynthesis deacetylase BshB2	NA	NA	NA	NA
WP_002033711.1\|3577863_3578058_-	hypothetical protein	NA	NA	NA	NA
WP_002088023.1\|3578251_3578959_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_012261529.1\|3578989_3580399_-	glycoside hydrolase family 1 protein	A0A0B5JD41	Pandoravirus	2.1e-54	29.6
WP_002014622.1\|3580604_3581594_-	phosphatidylinositol-specific phospholipase C domain-containing protein	NA	NA	NA	NA
WP_002142834.1\|3581975_3582773_+	LysM peptidoglycan-binding domain-containing protein	A0A172JHR8	Bacillus_phage	2.1e-35	40.0
WP_002142835.1\|3583076_3584414_+	hypothetical protein	NA	NA	NA	NA
WP_002142836.1\|3584963_3586883_+	LTA synthase family protein	W6LM83	Streptococcus_phage	9.4e-98	37.1
WP_002142837.1\|3586982_3589766_-	dynamin family protein	NA	NA	NA	NA
WP_012261530.1\|3590252_3590441_+	hypothetical protein	NA	NA	NA	NA
WP_012261531.1\|3590894_3591881_-	choloylglycine hydrolase family protein	M1HS66	Paramecium_bursaria_Chlorella_virus	2.7e-32	33.5
WP_002142841.1\|3592234_3594169_-	DNA mismatch repair endonuclease MutL	A0A1B2LRQ5	Wolbachia_phage	1.8e-64	30.2
WP_012261532.1\|3594177_3596850_-	DNA mismatch repair protein MutS	A0A1V0SGG8	Hokovirus	3.5e-34	24.4
WP_002014610.1\|3597030_3597573_-\|coat	outer spore coat protein CotE	NA	NA	NA	NA
WP_002033698.1\|3597701_3598133_-	YlbF family regulator	NA	NA	NA	NA
WP_012261533.1\|3598136_3599666_-\|tRNA	tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB	NA	NA	NA	NA
3598880:3598897	attL	NA	NA	NA	NA
WP_002088040.1\|3600099_3600966_-	2-oxoacid:ferredoxin oxidoreductase subunit beta	NA	NA	NA	NA
WP_002014603.1\|3600952_3602710_-	2-oxoacid:acceptor oxidoreductase subunit alpha	NA	NA	NA	NA
WP_012261534.1\|3602937_3603861_-	membrane dipeptidase	NA	NA	NA	NA
WP_000404341.1\|3603920_3604181_-	stage V sporulation protein SpoVS	J9PTX7	Bacillus_phage	8.4e-10	43.8
WP_002014601.1\|3604330_3605125_-	TIGR00282 family metallophosphoesterase	NA	NA	NA	NA
WP_002014600.1\|3605304_3606870_-	ribonuclease Y	NA	NA	NA	NA
WP_002014599.1\|3607353_3608385_-	recombinase RecA	A0A0S2MVG1	Bacillus_phage	1.2e-136	73.1
WP_012261535.1\|3608528_3609767_-	competence/damage-inducible protein A	NA	NA	NA	NA
WP_002014596.1\|3609787_3610366_-	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase	NA	NA	NA	NA
WP_002165210.1\|3610429_3611356_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_000574107.1\|3611377_3612163_-	DUF3388 domain-containing protein	NA	NA	NA	NA
WP_000114449.1\|3612302_3612551_-	DUF3243 domain-containing protein	NA	NA	NA	NA
WP_002014593.1\|3612627_3613341_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_002014592.1\|3613458_3614745_-	insulinase family protein	A0A2H4UVM3	Bodo_saltans_virus	1.3e-10	28.9
WP_002033691.1\|3614745_3616020_-	insulinase family protein	A0A1X9I714	Streptococcus_phage	5.9e-56	30.5
WP_002033690.1\|3616230_3617190_-	ABC transporter permease	NA	NA	NA	NA
WP_002190491.1\|3617190_3618249_-	ABC transporter permease	NA	NA	NA	NA
WP_012261536.1\|3618241_3619774_-	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	4.8e-12	28.1
WP_002033687.1\|3619894_3620971_-	BMP family protein	NA	NA	NA	NA
WP_002088063.1\|3621061_3621787_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_012261538.1\|3622325_3624710_-	DNA translocase FtsK	A0A218M9A2	Mycobacterium_phage	1.7e-88	51.7
WP_002088064.1\|3624924_3625128_-	YlzJ-like family protein	NA	NA	NA	NA
WP_002014582.1\|3625124_3625874_-	translocation-enhancing protein TepA	NA	NA	NA	NA
WP_012261539.1\|3625976_3627647_-	ribonuclease J	NA	NA	NA	NA
WP_002014579.1\|3628255_3629134_-	4-hydroxy-tetrahydrodipicolinate synthase	NA	NA	NA	NA
WP_002088068.1\|3629145_3630378_-	aspartate kinase	NA	NA	NA	NA
WP_002014577.1\|3630401_3631448_-	aspartate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_033708013.1\|3631597_3631774_-	dipicolinate synthase	NA	NA	NA	NA
WP_012261540.1\|3631890_3632760_-	hypothetical protein	NA	NA	NA	NA
WP_012261541.1\|3633166_3633949_+	hypothetical protein	NA	NA	NA	NA
WP_012261542.1\|3634113_3634437_+	hypothetical protein	A0A2H4J846	uncultured_Caudovirales_phage	9.2e-22	54.5
WP_012261543.1\|3634780_3635587_-	N-acetylmuramoyl-L-alanine amidase	D2XR33	Bacillus_phage	3.4e-150	89.9
WP_012261544.1\|3635586_3636012_-\|holin	phage holin family protein	D2XPZ9	Bacillus_virus	4.0e-65	90.1
WP_012261545.1\|3636050_3636404_-	hypothetical protein	A0A2H4JGF7	uncultured_Caudovirales_phage	4.3e-25	52.1
WP_012261546.1\|3636422_3641117_-\|tail	phage tail protein	A0A0S2MVB4	Bacillus_phage	4.3e-245	37.4
WP_012261547.1\|3641113_3642571_-\|tail	phage tail family protein	A0A1B1P7W7	Bacillus_phage	1.1e-151	52.6
WP_012261548.1\|3642612_3646233_-	hypothetical protein	A0A2H4JAI2	uncultured_Caudovirales_phage	2.6e-205	95.5
WP_012261549.1\|3646464_3646827_-	hypothetical protein	A0A2H4JAG8	uncultured_Caudovirales_phage	3.4e-57	91.7
WP_012261550.1\|3646833_3647430_-\|tail	phage tail protein	A0A2H4JDV4	uncultured_Caudovirales_phage	1.9e-105	94.4
WP_012261551.1\|3647430_3647766_-	hypothetical protein	D2XR22	Bacillus_phage	2.3e-52	92.7
WP_012261552.1\|3647762_3648107_-	HK97 gp10 family phage protein	A0A2H4JAH8	uncultured_Caudovirales_phage	7.9e-48	85.0
WP_012261553.1\|3648108_3648459_-\|head	phage head closure protein	D2XR20	Bacillus_phage	9.8e-54	90.5
WP_002066670.1\|3648460_3648754_-	hypothetical protein	A0A2H4JG04	uncultured_Caudovirales_phage	3.5e-44	92.8
WP_012261554.1\|3648766_3649918_-\|capsid	phage major capsid protein	A0A2H4JHU0	uncultured_Caudovirales_phage	8.8e-200	91.4
WP_012261555.1\|3649921_3650665_-\|protease	Clp protease ClpP	D2XR17	Bacillus_phage	6.0e-109	82.6
WP_012261556.1\|3650664_3651810_-\|portal	phage portal protein	D2XR16	Bacillus_phage	2.2e-182	87.0
WP_012261557.1\|3651818_3653486_-\|terminase	terminase large subunit	D2XR15	Bacillus_phage	3.2e-304	90.8
WP_012261558.1\|3653482_3653794_-\|terminase	P27 family phage terminase small subunit	D2XR14	Bacillus_phage	2.7e-39	85.3
WP_012261559.1\|3653919_3654255_-	HNH endonuclease	D2XR61	Bacillus_phage	4.0e-52	88.3
WP_012261560.1\|3654220_3654475_-	hypothetical protein	NA	NA	NA	NA
WP_040963114.1\|3654530_3654995_-	hypothetical protein	NA	NA	NA	NA
WP_012261562.1\|3655623_3656298_-	hypothetical protein	NA	NA	NA	NA
WP_012261563.1\|3657116_3657317_+	cold-shock protein	Q9AZD3	Lactococcus_phage	1.8e-20	72.7
WP_033714597.1\|3657418_3657601_+	hypothetical protein	NA	NA	NA	NA
WP_012261564.1\|3657876_3658419_-\|integrase	site-specific integrase	W8CYP1	Bacillus_phage	4.9e-92	95.6
WP_002142886.1\|3658418_3658901_-	ArpU family transcriptional regulator	H0USV3	Bacillus_phage	1.7e-72	83.8
WP_002066658.1\|3658928_3659099_-	hypothetical protein	NA	NA	NA	NA
WP_002066657.1\|3659212_3659374_-	DUF3983 domain-containing protein	NA	NA	NA	NA
WP_002066656.1\|3659588_3659804_+	spore germination protein	A0A2H4J3A3	uncultured_Caudovirales_phage	1.9e-23	79.4
WP_012261565.1\|3660212_3661370_+	hypothetical protein	A0A285PWR0	Cedratvirus	8.6e-38	63.4
WP_001065784.1\|3661887_3662043_+	DUF4021 domain-containing protein	NA	NA	NA	NA
WP_012261567.1\|3662487_3662652_+	hypothetical protein	NA	NA	NA	NA
WP_000512853.1\|3663215_3663407_-	DUF3954 domain-containing protein	D2XR48	Bacillus_phage	1.4e-14	65.1
WP_157861621.1\|3663478_3663823_-	cell division protein SepF	D2XR47	Bacillus_phage	9.1e-52	86.0
WP_012261569.1\|3663815_3664004_-	hypothetical protein	D2XR45	Bacillus_phage	1.3e-15	90.4
WP_012261570.1\|3664006_3665329_-	replicative DNA helicase	D2XR44	Bacillus_phage	4.8e-234	94.5
WP_012261571.1\|3665325_3666282_-	DnaD domain protein	D2XR43	Bacillus_phage	2.0e-88	61.8
WP_012261572.1\|3666560_3666845_-	hypothetical protein	D2XR42	Bacillus_phage	1.5e-23	55.3
WP_012261573.1\|3667024_3667246_-	hypothetical protein	NA	NA	NA	NA
WP_012261574.1\|3667259_3667847_-	hypothetical protein	D2XR41	Bacillus_phage	2.2e-74	69.2
WP_012261575.1\|3667937_3668186_-	hypothetical protein	NA	NA	NA	NA
WP_040963115.1\|3668251_3668467_-	helix-turn-helix transcriptional regulator	Q0H243	Geobacillus_phage	6.8e-05	47.2
WP_012261577.1\|3668629_3669001_+	helix-turn-helix transcriptional regulator	D2XQ11	Bacillus_virus	1.3e-11	38.6
WP_012261578.1\|3669243_3670191_+	hypothetical protein	NA	NA	NA	NA
WP_012261579.1\|3670227_3670869_+	hypothetical protein	NA	NA	NA	NA
WP_012261580.1\|3670967_3671474_+	ImmA/IrrE family metallo-endopeptidase	A0A2H4JA43	uncultured_Caudovirales_phage	3.0e-27	37.7
WP_012261581.1\|3671622_3672234_+	hypothetical protein	NA	NA	NA	NA
WP_012261582.1\|3672346_3673894_+	recombinase family protein	I3VYZ3	Thermoanaerobacterium_phage	1.8e-144	53.2
WP_002088148.1\|3674348_3675251_-	dipicolinic acid synthetase subunit A	NA	NA	NA	NA
WP_012261583.1\|3675423_3675672_-	YlmC/YmxH family sporulation protein	NA	NA	NA	NA
WP_002088150.1\|3675807_3677049_-	insulinase family protein	G3MBJ8	Bacillus_virus	1.7e-55	33.7
WP_002033683.1\|3677135_3678035_-	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_002033682.1\|3678189_3680343_-	polyribonucleotide nucleotidyltransferase	NA	NA	NA	NA
WP_001229392.1\|3680504_3680774_-	30S ribosomal protein S15	NA	NA	NA	NA
WP_002128800.1\|3680874_3681846_-	bifunctional riboflavin kinase/FAD synthetase	A0A1V0SD03	Indivirus	5.6e-06	31.6
WP_002033681.1\|3681889_3682813_-\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA
WP_000776437.1\|3682903_3683260_-	30S ribosome-binding factor RbfA	NA	NA	NA	NA
WP_002088157.1\|3683275_3683557_-	DUF503 family protein	NA	NA	NA	NA
WP_012261584.1\|3683553_3685620_-	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	1.5e-19	24.6
WP_002033679.1\|3685624_3685936_-	YlxQ family RNA-binding protein	NA	NA	NA	NA
WP_002088161.1\|3685936_3686209_-	YlxR family protein	NA	NA	NA	NA
WP_002014554.1\|3686220_3687327_-	transcription termination/antitermination protein NusA	NA	NA	NA	NA
WP_002088165.1\|3687344_3687815_-	ribosome maturation factor RimP	NA	NA	NA	NA
WP_012261585.1\|3688148_3692450_-	PolC-type DNA polymerase III	A0A0A8WJ41	Clostridium_phage	7.0e-24	39.6
WP_002142912.1\|3692574_3694275_-\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
WP_002088169.1\|3694384_3695641_-\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
3694888:3694905	attR	NA	NA	NA	NA

DBSCAN-SWA_5

4261321 : 4318421

Bacillus_phage(20.0%)

coat,tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000125368.1\|4261321_4262461_-\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	4.3e-82	41.5
WP_012261748.1\|4262473_4263526_-\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
WP_000138161.1\|4263545_4263746_-	DUF2905 domain-containing protein	NA	NA	NA	NA
WP_000344470.1\|4263742_4264744_-	Holliday junction branch migration DNA helicase RuvB	A0A127AWE7	Bacillus_phage	4.0e-07	26.3
WP_002088786.1\|4264749_4265367_-	Holliday junction DNA helicase RuvA	NA	NA	NA	NA
WP_012261749.1\|4265556_4266501_+	iron-hydroxamate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002015325.1\|4266511_4267027_-	BofC C-terminal domain-containing protein	NA	NA	NA	NA
WP_012261750.1\|4267460_4267895_+	hypothetical protein	NA	NA	NA	NA
WP_012261751.1\|4267927_4268572_-	YhcN/YlaJ family sporulation lipoprotein	NA	NA	NA	NA
WP_012261752.1\|4268752_4270918_-\|coat	SafA/ExsA family spore coat assembly protein	NA	NA	NA	NA
WP_002192476.1\|4271142_4272249_-	quinolinate synthase NadA	NA	NA	NA	NA
WP_012261753.1\|4272279_4273113_-	carboxylating nicotinate-nucleotide diphosphorylase	NA	NA	NA	NA
WP_002067402.1\|4273132_4274662_-	L-aspartate oxidase	NA	NA	NA	NA
WP_012261755.1\|4274815_4275958_+	IscS subfamily cysteine desulfurase	A0A1X7QGF3	Faustovirus	7.5e-34	27.2
WP_002034157.1\|4275957_4276500_+	transcription repressor NadR	NA	NA	NA	NA
WP_012261756.1\|4276584_4277232_+	MOSC domain-containing protein	NA	NA	NA	NA
WP_002192473.1\|4277344_4278196_-	prephenate dehydratase	NA	NA	NA	NA
WP_012261757.1\|4278293_4280207_-	ABC transporter permease	NA	NA	NA	NA
WP_012261758.1\|4280256_4282179_-	ABC transporter permease	NA	NA	NA	NA
WP_000114530.1\|4282153_4282930_-	ABC transporter ATP-binding protein	W5SAS9	Pithovirus	1.6e-19	31.0
WP_012261759.1\|4283023_4284106_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_002034150.1\|4284095_4284803_-	response regulator transcription factor	W8CYM9	Bacillus_phage	1.3e-23	34.4
WP_002015378.1\|4284974_4286258_-	GTPase ObgE	NA	NA	NA	NA
WP_002015377.1\|4286257_4286806_-	Spo0B domain-containing protein	NA	NA	NA	NA
WP_000944957.1\|4286869_4287160_-	50S ribosomal protein L27	NA	NA	NA	NA
WP_002138477.1\|4287163_4287508_-\|protease	ribosomal-processing cysteine protease Prp	NA	NA	NA	NA
WP_000270907.1\|4287519_4287828_-	50S ribosomal protein L21	NA	NA	NA	NA
WP_012261760.1\|4287998_4289408_-	Rne/Rng family ribonuclease	NA	NA	NA	NA
WP_002088816.1\|4289450_4290311_-\|protease	site-2 protease family protein	NA	NA	NA	NA
WP_002034147.1\|4290303_4291050_-	M23 family metallopeptidase	NA	NA	NA	NA
WP_000503308.1\|4291183_4291981_-	septum site-determining protein MinD	NA	NA	NA	NA
WP_002015372.1\|4291983_4292670_-	septum site-determining protein MinC	NA	NA	NA	NA
WP_002015371.1\|4292705_4293251_-	rod shape-determining protein MreD	NA	NA	NA	NA
WP_002129256.1\|4293265_4294117_-	rod shape-determining protein MreC	NA	NA	NA	NA
WP_002015369.1\|4294158_4295178_-	rod shape-determining protein MreB	NA	NA	NA	NA
WP_002015368.1\|4295336_4296014_-	DNA repair protein RadC	NA	NA	NA	NA
WP_012261761.1\|4296064_4296640_-	septum formation inhibitor Maf	NA	NA	NA	NA
WP_002129259.1\|4296859_4297822_-	hypothetical protein	NA	NA	NA	NA
WP_012261762.1\|4297986_4299288_-	bifunctional folylpolyglutamate synthase/dihydrofolate synthase	NA	NA	NA	NA
WP_012261763.1\|4299382_4302028_-\|tRNA	valine--tRNA ligase	A0A1V0SK04	Klosneuvirus	3.6e-164	43.0
WP_012261764.1\|4302432_4303458_-\|coat	spore coat protein YsxE	NA	NA	NA	NA
WP_193339755.1\|4303530_4304538_-	stage VI sporulation protein D	NA	NA	NA	NA
WP_002034163.1\|4304617_4305907_-	glutamate-1-semialdehyde 2,1-aminomutase	A0A1V0SKB7	Klosneuvirus	1.3e-05	35.2
WP_002015358.1\|4305906_4306896_-	porphobilinogen synthase	NA	NA	NA	NA
WP_002015357.1\|4307069_4307822_-	uroporphyrinogen-III synthase	NA	NA	NA	NA
WP_012261766.1\|4307824_4308754_-	hydroxymethylbilane synthase	NA	NA	NA	NA
WP_002015354.1\|4308769_4309603_-	cytochrome c biogenesis protein CcsA	NA	NA	NA	NA
WP_002143275.1\|4309620_4310952_-\|tRNA	glutamyl-tRNA reductase	NA	NA	NA	NA
WP_002034199.1\|4311369_4311822_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_002015349.1\|4311824_4312241_+	organic hydroperoxide resistance protein	NA	NA	NA	NA
WP_002088829.1\|4312276_4312873_-	YihA family ribosome biogenesis GTP-binding protein	NA	NA	NA	NA
WP_002034201.1\|4312869_4315200_-	endopeptidase La	A0A0R6PGP8	Moraxella_phage	1.9e-177	43.4
WP_002034202.1\|4315384_4317055_-\|protease	ATP-dependent protease LonB	E3T4F6	Cafeteria_roenbergensis_virus	6.7e-15	33.5
WP_000472285.1\|4317161_4318421_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	7.7e-149	66.3

DBSCAN-SWA_6

4745437 : 4792463

Bacillus_virus(22.22%)

transposase,coat,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012261923.1\|4745437_4746115_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_040963184.1\|4746213_4747008_-	DUF4111 domain-containing protein	NA	NA	NA	NA
WP_000248598.1\|4747060_4747369_-	YuzD family protein	NA	NA	NA	NA
WP_000431159.1\|4747575_4747812_+	NifU family protein	Q58MC7	Prochlorococcus_phage	2.0e-10	46.6
WP_001137788.1\|4748127_4748343_+	hypothetical protein	NA	NA	NA	NA
WP_002089339.1\|4748402_4749404_-\|coat	spore coat protein YutH	NA	NA	NA	NA
WP_002015902.1\|4749524_4750016_+	phosphatidylglycerophosphatase A	G3MBC5	Bacillus_virus	5.1e-40	52.5
WP_003192160.1\|4750035_4750515_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_012261925.1\|4751036_4753610_-	ABC transporter permease	NA	NA	NA	NA
WP_012261926.1\|4753593_4754382_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.1e-33	39.5
WP_012261927.1\|4754669_4755251_+	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_012261928.1\|4755283_4755814_-	hypothetical protein	NA	NA	NA	NA
WP_002089349.1\|4755928_4756693_-	TIGR01457 family HAD-type hydrolase	NA	NA	NA	NA
WP_012261929.1\|4756800_4757433_-	ArsR family transcriptional regulator	NA	NA	NA	NA
WP_012261930.1\|4757511_4757952_-	DUF86 domain-containing protein	NA	NA	NA	NA
WP_002015911.1\|4758099_4759071_+	class II fructose-bisphosphatase	NA	NA	NA	NA
WP_002015912.1\|4759087_4759354_+	DUF3055 domain-containing protein	NA	NA	NA	NA
WP_012261932.1\|4759720_4760800_+\|transposase	transposase	A0A0H3V0V2	Geobacillus_virus	5.3e-13	32.7
WP_002143621.1\|4760989_4761487_+	hypothetical protein	NA	NA	NA	NA
WP_002143622.1\|4761498_4762020_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002015914.1\|4762030_4762333_-	DUF1027 domain-containing protein	NA	NA	NA	NA
WP_002015915.1\|4762451_4763030_+	YhcN/YlaJ family sporulation lipoprotein	NA	NA	NA	NA
WP_002143625.1\|4763058_4763790_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_040963132.1\|4763889_4764705_+\|protease	YhfC family intramembrane metalloprotease	NA	NA	NA	NA
WP_080515464.1\|4764946_4765318_-	hypothetical protein	NA	NA	NA	NA
WP_002034582.1\|4765451_4766006_+	histidine phosphatase family protein	NA	NA	NA	NA
WP_012261935.1\|4766088_4766568_+	YbaK/EbsC family protein	NA	NA	NA	NA
WP_002034580.1\|4766588_4767485_-	lipoyl synthase	NA	NA	NA	NA
WP_002034579.1\|4767674_4768658_+	M23 family metallopeptidase	NA	NA	NA	NA
WP_002129745.1\|4768715_4769447_-	sporulation protein YunB	NA	NA	NA	NA
WP_002015926.1\|4769502_4769805_-	DUF1805 domain-containing protein	NA	NA	NA	NA
WP_080019788.1\|4769870_4771262_-	bifunctional metallophosphatase/5'-nucleotidase	NA	NA	NA	NA
WP_002015928.1\|4772022_4773420_-	Fe-S cluster assembly protein SufB	NA	NA	NA	NA
WP_002089369.1\|4773468_4773900_-	iron-sulfur cluster assembly scaffold protein SufU	A0A0K1LS29	Mycobacterium_phage	1.5e-14	37.6
WP_002015930.1\|4773889_4775110_-	cysteine desulfurase SufS	Q2XUY6	environmental_halophage	1.1e-118	47.6
WP_002089372.1\|4775109_4776402_-	Fe-S cluster assembly protein SufD	NA	NA	NA	NA
WP_002034576.1\|4776417_4777203_-	Fe-S cluster assembly ATPase SufC	A0A2R8FG22	Brazilian_cedratvirus	2.4e-07	27.6
WP_002089377.1\|4777440_4778247_-	methionine ABC transporter substrate-binding lipoprotein MetQ	NA	NA	NA	NA
WP_002015935.1\|4778318_4779131_-	methionine ABC transporter substrate-binding lipoprotein MetQ	NA	NA	NA	NA
WP_002129754.1\|4779153_4779819_-	ABC transporter permease	NA	NA	NA	NA
WP_002015938.1\|4779811_4780837_-	methionine ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_002015939.1\|4781378_4781723_-	hypothetical protein	NA	NA	NA	NA
WP_002015940.1\|4781875_4782184_-	thioredoxin family protein	NA	NA	NA	NA
WP_000640865.1\|4782187_4782532_-	hypothetical protein	NA	NA	NA	NA
WP_012261936.1\|4782599_4782749_+	hypothetical protein	NA	NA	NA	NA
WP_000026895.1\|4782907_4783291_-	glycine cleavage system protein GcvH	NA	NA	NA	NA
WP_002129756.1\|4783332_4783698_-	arsenate reductase family protein	M1PLC0	Streptococcus_phage	5.1e-21	48.6
WP_002143630.1\|4784305_4784548_-	DUF3937 family protein	NA	NA	NA	NA
WP_000478362.1\|4784966_4785140_-	hypothetical protein	NA	NA	NA	NA
WP_012261937.1\|4785168_4785558_-	hypothetical protein	NA	NA	NA	NA
WP_012261938.1\|4785674_4785938_-	DUF4176 domain-containing protein	NA	NA	NA	NA
WP_002143637.1\|4785952_4786144_-	hypothetical protein	NA	NA	NA	NA
WP_002143638.1\|4786159_4786993_-	WXG100 family type VII secretion target	NA	NA	NA	NA
WP_002034624.1\|4787343_4787496_-	hypothetical protein	D2XPZ4	Bacillus_virus	4.9e-10	64.0
WP_012261939.1\|4787551_4788079_-	hypothetical protein	NA	NA	NA	NA
WP_002143641.1\|4788223_4788871_+	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_002143642.1\|4788924_4789938_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002034620.1\|4791158_4791407_-\|coat	spore coat protein	NA	NA	NA	NA
WP_001180552.1\|4791420_4791606_-	hypothetical protein	NA	NA	NA	NA
WP_002143644.1\|4791749_4792463_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NC_010182

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1856 : 7404

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012260017.1\|1856_2276_-	hypothetical protein	A0A142F1S1	Bacillus_phage	5.2e-09	43.6
WP_012260018.1\|2287_2578_-	hypothetical protein	NA	NA	NA	NA
WP_012260019.1\|2577_3138_-	hypothetical protein	NA	NA	NA	NA
WP_012260020.1\|3150_3507_-	sigma-70 family RNA polymerase sigma factor	A0A0N9RZI0	Paenibacillus_phage	4.9e-08	31.4
WP_157861636.1\|3493_4048_-	AAA family ATPase	A0A076G817	Bacillus_phage	2.1e-18	35.6
WP_012260022.1\|4058_4244_-	hypothetical protein	NA	NA	NA	NA
WP_157861626.1\|4322_5090_-	hypothetical protein	A0A0A0RMW1	Bacillus_phage	7.3e-09	37.4
WP_040963233.1\|5086_5323_-	hypothetical protein	NA	NA	NA	NA
WP_012260024.1\|5325_5901_-	thymidine kinase	E0YIP8	Lactococcus_phage	3.0e-39	45.3
WP_012260025.1\|5966_6200_-	hypothetical protein	NA	NA	NA	NA
WP_012260026.1\|6274_6541_-	hypothetical protein	NA	NA	NA	NA
WP_012260027.1\|6694_7081_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_040963234.1\|7077_7404_-	hypothetical protein	E7DN80	Pneumococcus_phage	3.5e-13	41.3

DBSCAN-SWA_2

21660 : 56565

uncultured_Caudovirales_phage(40.91%)

tail,terminase,integrase,capsid,portal

attL 33009:33023|attR 57063:57077

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012260044.1\|21660_22638_-	toprim domain-containing protein	A0A2H4J6E6	uncultured_Caudovirales_phage	2.6e-51	40.3
WP_012260045.1\|22825_23323_-	hypothetical protein	NA	NA	NA	NA
WP_012260046.1\|23379_24738_-	hypothetical protein	A0A2H4IZL9	uncultured_Caudovirales_phage	5.7e-97	43.7
WP_162014399.1\|24749_25763_-	phosphoadenosine phosphosulfate reductase family protein	A0A193GZ89	Enterobacter_phage	6.7e-18	27.4
WP_040963236.1\|25777_25987_-	hypothetical protein	NA	NA	NA	NA
WP_012260048.1\|25983_26748_-	DNA replication protein	A0A0N7GFF0	Paenibacillus_phage	1.2e-59	46.1
WP_012260049.1\|26759_27134_-	hypothetical protein	NA	NA	NA	NA
WP_157861629.1\|27299_27653_-	helix-turn-helix domain-containing protein	A0A142F1P0	Bacillus_phage	2.0e-17	40.4
WP_012260051.1\|27749_28019_-	hypothetical protein	NA	NA	NA	NA
WP_012260052.1\|28030_29065_-	ParM/StbA family protein	A0A068EQ96	Bacillus_phage	3.5e-06	25.9
WP_012260053.1\|29209_30190_-	helix-turn-helix domain-containing protein	A0A2H4J969	uncultured_Caudovirales_phage	9.6e-06	30.7
WP_040963237.1\|30586_30781_-	hypothetical protein	NA	NA	NA	NA
WP_012260054.1\|31029_31302_-	hypothetical protein	NA	NA	NA	NA
WP_012260055.1\|31301_31559_-	DUF2829 domain-containing protein	S5MAK7	Bacillus_phage	1.4e-20	58.5
WP_012260056.1\|31577_32576_-	N-acetylmuramoyl-L-alanine amidase	A0A0N9SGH1	Paenibacillus_phage	5.2e-31	44.6
WP_157861630.1\|32644_32848_-	hypothetical protein	NA	NA	NA	NA
33009:33023	attL	NA	NA	NA	NA
WP_012260057.1\|33064_33301_-	hypothetical protein	NA	NA	NA	NA
WP_012260058.1\|33290_33797_-	hypothetical protein	A0A1B1P7E8	Bacillus_phage	5.3e-08	41.0
WP_012260059.1\|33872_40463_-\|tail	phage tail protein	A0A0N9SIL8	Paenibacillus_phage	1.1e-97	45.4
WP_012260060.1\|40547_41999_-\|tail	phage tail family protein	NA	NA	NA	NA
WP_012260061.1\|42000_45384_-\|tail	phage tail tape measure protein	A0A0N9SJR9	Paenibacillus_phage	4.7e-07	53.2
WP_162014400.1\|45398_45620_-	hypothetical protein	NA	NA	NA	NA
WP_012260063.1\|45703_46108_-	hypothetical protein	NA	NA	NA	NA
WP_012260064.1\|46217_46784_-	hypothetical protein	A0A0N9SHI3	Paenibacillus_phage	1.5e-51	59.3
WP_012260065.1\|46796_47168_-	hypothetical protein	A0A0N7GFE5	Paenibacillus_phage	8.6e-16	36.6
WP_012260066.1\|47169_47580_-	hypothetical protein	NA	NA	NA	NA
WP_012260067.1\|47576_47909_-	hypothetical protein	A0A0N9RTI3	Paenibacillus_phage	6.1e-21	46.3
WP_012260068.1\|47910_48312_-	hypothetical protein	NA	NA	NA	NA
WP_012260069.1\|48374_49550_-	DUF5309 family protein	A0A2H4J2M3	uncultured_Caudovirales_phage	9.2e-104	55.2
WP_012260070.1\|49631_50303_-	hypothetical protein	A0A2H4IZP8	uncultured_Caudovirales_phage	5.4e-08	29.3
WP_157861631.1\|50457_51390_-\|capsid	minor capsid protein	A0A2H4IZM1	uncultured_Caudovirales_phage	2.0e-45	40.7
WP_012260072.1\|51403_53029_-\|portal	phage portal protein	A0A2H4J180	uncultured_Caudovirales_phage	1.4e-129	48.9
WP_157861632.1\|53077_53629_-	nucleoside 2-deoxyribosyltransferase	A0A1D3SPR3	Enterococcus_phage	1.2e-13	36.0
WP_012260074.1\|53709_55470_-\|terminase	phage terminase large subunit	A0A2H4J484	uncultured_Caudovirales_phage	4.8e-181	56.3
WP_012260075.1\|55481_55904_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_012260076.1\|56016_56565_+\|integrase	tyrosine-type recombinase/integrase	A0A2H4J6I5	uncultured_Caudovirales_phage	4.5e-37	47.0
57063:57077	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_010183

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NC_010180

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NC_010184

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. NC_010182

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection