CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NC_010725	Methylorubrum populi BJ001, complete sequence	1 crisprs	DEDDh,csa3,cas14i,c2c9_V-U4,WYL,cas3,Cas9_archaeal	2	5
NC_010721	Methylorubrum populi BJ001 plasmid pMPOP02, complete sequence	0 crisprs	NA	0	0
NC_010727	Methylorubrum populi BJ001 plasmid pMPOP01, complete sequence	0 crisprs	NA	0	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_010725_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_010725_1

5435221-5435352

Orphan

Consensus_repeat	Method
GGGCAACGACACGCTCAGCGGCGG	CRISPRCasFinder

2 spacers

The CRISPR arrays of NC_010725_1

>merge|NC_010725|1|5435221-5435352|CRISPRCasFinder
CGGCGACGACTGGATCGACGGCGGCCGGGGCGACGACAAGCTCTTCGGCGGCCTGGGCAACGACACGCTCAGCGGCGGGGATGGGAACGACGCGCTGGACGGGGGCGAGGGCAACGACACGCTCAGCGGCGG

>NC_010725|1|1|5435221-5435352|CRISPRCasFinder
CGGCGACGACTGGATCGACGGCGG	CCGGGGCGACGACAAGCTCTTCGGCGGCCT
GGGCAACGACACGCTCAGCGGCGG	GGATGGGAACGACGCGCTGGACGGGGGCGA
GGGCAACGACACGCTCAGCGGCGG

Protein	Signature genes	Signature genes Name	Protein_function
NC_010725.1\|WP_012456772.1\|5442821_5443325_-\|pyridoxamine-5'-phosphate-oxidase-family-protein	unknown	unknown	gnl\|CDD\|379804
NC_010725.1\|WP_041372193.1\|5443463_5443736_+\|hypothetical-protein	unknown	unknown	unknown
NC_010725.1\|WP_012456776.1\|5445983_5448710_+\|DNA-gyrase-subunit-A	unknown	unknown	gnl\|CDD\|235502
NC_010725.1\|WP_012456757.1\|5427016_5428096_+\|AI-2E-family-transporter	unknown	unknown	gnl\|CDD\|223701
NC_010725.1\|WP_012456763.1\|5432035_5432506_-\|Hsp20-family-protein	unknown	unknown	gnl\|CDD\|182691
NC_010725.1\|WP_131801332.1\|5433733_5433943_+\|hypothetical-protein	unknown	unknown	unknown
NC_010725.1\|WP_012456764.1\|5432688_5433678_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|225176
NC_010725.1\|WP_012456769.1\|5440141_5440909_-\|5-oxoprolinase-subunit-PxpA	unknown	unknown	gnl\|CDD\|212099
NC_010725.1\|WP_041372194.1\|5445065_5445668_+\|molybdenum-cofactor-guanylyltransferase-MobA	unknown	unknown	gnl\|CDD\|234725
NC_010725.1\|WP_012456771.1\|5441366_5442665_-\|nicotinate-phosphoribosyltransferase	unknown	unknown	gnl\|CDD\|235406
NC_010725.1\|WP_012456762.1\|5431586_5431898_+\|hypothetical-protein	unknown	unknown	unknown
NC_010725.1\|WP_012456774.1\|5443839_5444961_+\|Mrp/NBP35-family-ATP-binding-protein	unknown	unknown	gnl\|CDD\|378455
NC_010725.1\|WP_012456758.1\|5428100_5428970_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|371337
NC_010725.1\|WP_012456755.1\|5424972_5425461_-\|hypothetical-protein	unknown	unknown	unknown
NC_010725.1\|WP_012456761.1\|5431127_5431541_+\|cupin-domain-containing-protein	unknown	unknown	gnl\|CDD\|226586
NC_010725.1\|WP_012456770.1\|5440905_5441223_-\|hypothetical-protein	unknown	unknown	unknown
NC_010725.1\|WP_012456767.1\|5437055_5437847_-\|histidinol-phosphatase	unknown	unknown	gnl\|CDD\|238819
NC_010725.1\|WP_012456756.1\|5425836_5426940_+\|GGDEF-domain-containing-protein	unknown	unknown	gnl\|CDD\|143635
NC_010725.1\|WP_003596089.1\|5429549_5430758_-\|IS256-like-element-ISMex14-family-transposase	unknown	unknown	gnl\|CDD\|307151
NC_010725.1\|WP_041371771.1\|5437901_5439938_-\|AI-2E-family-transporter	unknown	unknown	gnl\|CDD\|223701

Protein	Function_ID	Function_description	E-value
NC_010725.1\|WP_012456757.1\|5427016_5428096_+\|AI-2E-family-transporter	gnl\|CDD\|223701	COG0628, yhhT, Predicted permease, member of the PurR regulon [General function prediction only].	4.83595e-36
NC_010725.1\|WP_012456763.1\|5432035_5432506_-\|Hsp20-family-protein	gnl\|CDD\|182691	PRK10743, PRK10743, heat shock chaperone IbpA.	9.96798e-57
NC_010725.1\|WP_012456764.1\|5432688_5433678_+\|alpha/beta-hydrolase	gnl\|CDD\|225176	COG2267, PldB, Lysophospholipase [Lipid metabolism].	4.50594e-56
NC_010725.1\|WP_012456769.1\|5440141_5440909_-\|5-oxoprolinase-subunit-PxpA	gnl\|CDD\|212099	cd10787, LamB_YcsF_like, LamB/YcsF family of lactam utilization protein. The LamB/YbgL family includes the Aspergillus nidulans protein LamB, and its homologs from all three kingdoms of life. The lamb gene locates at the lam locus of Aspergillus nidulans, consisting of two divergently transcribed genes, lamA and lamB, needed for the utilization of lactams such as 2-pyrrolidinone. Both genes are under the control of the positive regulatory gene amdR and are subject to carbon and nitrogen metabolite repression. Although the exact molecular function of LamB is unknown, it might be required for conversion of exogenous 2-pyrrolidinone to endogenous GABA.	1.33876e-126
NC_010725.1\|WP_041372194.1\|5445065_5445668_+\|molybdenum-cofactor-guanylyltransferase-MobA	gnl\|CDD\|234725	PRK00317, mobA, molybdopterin-guanine dinucleotide biosynthesis protein MobA; Reviewed.	1.55861e-74
NC_010725.1\|WP_012456771.1\|5441366_5442665_-\|nicotinate-phosphoribosyltransferase	gnl\|CDD\|235406	PRK05321, PRK05321, nicotinate phosphoribosyltransferase; Provisional.	0
NC_010725.1\|WP_012456761.1\|5431127_5431541_+\|cupin-domain-containing-protein	gnl\|CDD\|226586	COG4101, COG4101, Predicted mannose-6-phosphate isomerase [Carbohydrate transport and metabolism].	1.21001e-59
NC_010725.1\|WP_012456774.1\|5443839_5444961_+\|Mrp/NBP35-family-ATP-binding-protein	gnl\|CDD\|378455	pfam10609, ParA, NUBPL iron-transfer P-loop NTPase. This family contains ATPases involved in plasmid partitioning. It also contains the cytosolic Fe-S cluster assembling factor NBP35 which is required for biogenesis and export of both ribosomal subunits.	4.27497e-150
NC_010725.1\|WP_012456758.1\|5428100_5428970_-\|hypothetical-protein	gnl\|CDD\|371337	pfam11004, Kdo_hydroxy, 3-deoxy-D-manno-oct-2-ulosonic acid (Kdo) hydroxylase. This is a family of 3-deoxy-D-manno-oct-2-ulosonic acid 3-hydroxylases, which catalyze the conversion of 3-deoxy-D-manno-oct-2-ulosonic acid (Kdo) to D-glycero-D-talo-oct-2-ulosonic acid (Ko). It contains a potential iron-binding motif, HXDX(n)H (n>40). Hydroxylation activity is iron-dependent.	4.86755e-118
NC_010725.1\|WP_012456772.1\|5442821_5443325_-\|pyridoxamine-5'-phosphate-oxidase-family-protein	gnl\|CDD\|379804	pfam16242, Pyrid_ox_like, Pyridoxamine 5'-phosphate oxidase like. This domain, approximately 140 residues in length, is mainly found in general stress proteins in various Xanthomonas species. It is composed of a six-stranded antiparallel beta-barrel flanked by five alpha-helices and can bind to FMN and FAD, suggesting that it may help the bacteria to react against the oxidative stress induced by the defense mechanisms of the plant.	3.95915e-61
NC_010725.1\|WP_012456756.1\|5425836_5426940_+\|GGDEF-domain-containing-protein	gnl\|CDD\|143635	cd01949, GGDEF, Diguanylate-cyclase (DGC) or GGDEF domain. Diguanylate-cyclase (DGC) or GGDEF domain: Originally named after a conserved residue pattern, and initially described as a domain of unknown function 1 (DUF1). This domain is widely present in bacteria, linked to a wide range of non-homologous domains in a variety of cell signaling proteins. The domain shows homology to the adenylyl cyclase catalytic domain. This correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate. Together with the EAL domain, GGDEF might be involved in regulating cell surface adhesion in bacteria.	7.36041e-43
NC_010725.1\|WP_012456776.1\|5445983_5448710_+\|DNA-gyrase-subunit-A	gnl\|CDD\|235502	PRK05560, PRK05560, DNA gyrase subunit A; Validated.	0
NC_010725.1\|WP_012456767.1\|5437055_5437847_-\|histidinol-phosphatase	gnl\|CDD\|238819	cd01641, Bacterial_IMPase_like_1, Predominantly bacterial family of Mg++ dependend phosphatases, related to inositol monophosphatases. These enzymes may dephosphorylate fructose-1,6-bisphosphate, inositol monophospate, 3'-phosphoadenosine-5'-phosphate, or similar substrates.	3.28699e-114
NC_010725.1\|WP_003596089.1\|5429549_5430758_-\|IS256-like-element-ISMex14-family-transposase	gnl\|CDD\|307151	pfam00872, Transposase_mut, Transposase, Mutator family.	5.92888e-148
NC_010725.1\|WP_041371771.1\|5437901_5439938_-\|AI-2E-family-transporter	gnl\|CDD\|223701	COG0628, yhhT, Predicted permease, member of the PurR regulon [General function prediction only].	2.49311e-61

>NC_010725.1|WP_131801332.1|5433733_5433943_+|hypothetical-protein
MLSYVVGFAPLAVRLLPYLGGWGIILSLGGVIIALPFRAAAAPALLRRRETRSHSRLALTIEPTRRPRN
>NC_010725.1|WP_012456764.1|5432688_5433678_+|alpha/beta-hydrolase
MLSLRPTPGNPVPPGARLVPVETADGVSLRAATWQPTTRSVKGTVCLLQGRAEFIEKYFETISDLRARGFCVVAFDWRGQGDSSRQVRDAHKGHVRHFDDYRLDLKAITETVLVPMMPEPYFGLAHSMGGAVALTIAAEGRLPFRRLVTVAPMLAIRMVRWPAGASLLARGLHRLGLGRCYIPFGKAVSIATKPFAGNRLSTDPARYARNAAAAREVGAGAVGDPTIAWLAAAFRAMRRLEDPATVRRIRTPCLIVAAGADPVCSTPAVERFAARLKTGHLIVLPGARHEILTECDAVRTDFWAAFDAFIPGHGAHGVAEEASHPAEVG
>NC_010725.1|WP_012456763.1|5432035_5432506_-|Hsp20-family-protein
MRQFDLAPLYRSTVGFDRLFSALDGFVSTESAPTYPPYNIERTGENVYRVTVAVAGFTEADLSIEVKENALTIKGERKPAEGKSAEVLYQGIAARAFERRFQLADHVQVTGAALENGLLHVDLVREVPEAKKPRRIEIASRPSSQPVIEGSVQQAA
>NC_010725.1|WP_012456762.1|5431586_5431898_+|hypothetical-protein
MRRVLVSLLLSWAVLAAGLSPALAQRPSTTNLTCAQARTVVARQGAAVLGTGGPTFDRFVRDRSFCEATEIGRRAFVPTRDNPGCFVGYTCYEPGPGDRFGDF
>NC_010725.1|WP_012456761.1|5431127_5431541_+|cupin-domain-containing-protein
MAGTGEALCRVVRPGEPFTGRQGLSYAPGISAETAGATGIHLQMVTIPPGARAKAHKHEGHETAIYALAGTSCTWWGERLEHHTELKPGEYFYIPAGVPHLPYNPSATEPCTAIIARTDPNEQESVVLLPELDGIHP
>NC_010725.1|WP_003596089.1|5429549_5430758_-|IS256-like-element-ISMex14-family-transposase
MTDDRVALIEAFQKADDGNFLRSLAETVLQILMEADVDGLIGAGRYERSGERSTYRNGYRERSLDTRLGSLNLKIPKLRTGSYFPGFLEPRKTVEKALVAVIQEAWIAGVSTRRVDDLVQAMGLSGISKSSVSKLCKDIDERVNAFLKRPLSGAWPYLWLDATYLKVREGGRIVSVAAIVAVAVDTEGRREIIGLHIGPSEAEVFWTDFLRDLVKRGLSGVQLVISDAHEGLKAAICRVLKATWQRCRVHWTRNALAYVPRAQQTMVAAGLRHAFQQPDQEAARAALHHLAEQLHNRWPKLKGFIDATSEDVLAYLTFPLQHRTKLHSTNPLERLNKEIKRRADVVGIFPNTDSIQRLIGAVLLEANDEWQLQHRYMQIEGMAGFTPSLLDDTLTAIPPQAA
>NC_010725.1|WP_012456758.1|5428100_5428970_-|hypothetical-protein
MISPVLPVSRSEAVPGAPGLVEALESGSVLVFRDLDFPLDAFEQRFVERPFADGKAKNVAIRSETAALRGGAGSEEEQARLRDLLVRYRRFAENLIDTYLPAYRNKVSLAGTSYRPFDVDKRKLSWRRDDTRMHVDAFPSNPIGERRILRIFRNINAEGQPRLWRVGEDFGSMAEKFLPKLPGYSGLSASLLAALKITKAKRSEYDHLMLHLHDALKRDLDYQANAPQADVRFQPGETWVTFSDLVMHGAMGGRYMLEQTAYIAVADQADPEKSPQRILARKLGRPLKH
>NC_010725.1|WP_012456757.1|5427016_5428096_+|AI-2E-family-transporter
MRPSDQTEPEAARIQRVLRALLVAALLGLGLYILHGFLRALVWALVLAIALWPLFNRARRRFPPGRHNILWPAVFTGLVAGLLLLPIAGLAVEAGREAHDLLAYAREAERNGIPVPDFVAHLPYGAAAVTEWWNAHLAHAGLAHEVTERLNTTSNRDLTRTLGAGLVHRVVLFGFCLLALFFLFREGDAVVAQSLRASQRLFGPRGERVARQMVASVHGTVDGLVLVGIGEGFLLGIVYALAGVPHPVLFGALTAVAAMIPFGAPLAFGLAAVLLLAGGAVVPAAIVVAAGFVITFVADHFVRPALIGGTTRLPFLWVLLGILGGVETFGLLGLFVGPAVMAALILLWRELTEGPETSA
>NC_010725.1|WP_012456756.1|5425836_5426940_+|GGDEF-domain-containing-protein
MVALPNVPTLGLCSILSSLAFFGVFLCLWGGRRDETYFLHWASGSLSYALAIFCFNHLAPSPLQTGLLYGVLSASTLAVLTGVRRFDGRPPFRPWMLLPILVASLGYILPALTLGPDDAACRIGGTFGSLLTMAVAGSSLALGRASRPSPGRRIAGAALLAYIPGFVAAMVAEAVGGAEVNMAALIPLLSDQLLLAVLNLGLITMPGERAQAELREAARRDFLTGAWNRAGLAALAPRLLRPGTAVIVLDVDHFKAINDGHGHAAGDRVLTALAACVQTVIPEPDASLVRLGGDEFVLLVADRSPAEARWIADEIRQIAGRGNGLPAWTISLGIAAVEPGETDFSAAIERADRSLYRAKAEGRDRAA
>NC_010725.1|WP_012456755.1|5424972_5425461_-|hypothetical-protein
MIEIGFDDDVIDRPAPAAQNASPDRDWCIRDDGLEHAASGYFIAREEIASRRGDGLWTWPMQLAEKAWCAPVSFRRVFLAALERYGVTADADLARSFALGFGIQDSGQRHNDRFVALGELVRPRVPGRKRTLPLEGRRSGRERPRQGADTRAPALDLSRSAG
>NC_010725.1|WP_012456767.1|5437055_5437847_-|histidinol-phosphatase
MSVVDLAQFMEDLATQSGAAILPFFRAHFGLDDKSHGTGRAFDPVTEADRAAEAVMRRMIKDRLPNHGILGEEFGSERADAECVWVLDPIDGTRAFISGLPTWGTLIGLTHHGAAVRGLMHQPYLGERFLGDGKTASVRSPKGERRLHTRRSEALGDAILATTDPRLFADGEEAERFRAVEAAVKMSRYGADCYAYCMLAAGQIDLVVEAGLKPYDIVALIPIVEGAGGVVTTWDGGPATGGGRIVAAGDRRLHDAALRRLNP
>NC_010725.1|WP_041371771.1|5437901_5439938_-|AI-2E-family-transporter
MKRMSTGEGFVVPPRPTRVPAAEAPKGPLASSMIVFAIIVAGLFLGREVLIPIAIAVLLSFVLGPLVNFLRRLRLGRAVAVLVSVLLAAGIIAALATVIGVQVAELAQDVPRYQRTIERKVEGLREGTLGRTMDYIANINRAIHQGGEENKEAAEKARREQAARDSTRKTEPEPPKPMLVQVEERRPSPLELATTVLSPVAQPLATAGIVIVVLLFILMQREDLRDRLIRLAGSSDLHRTTVAMDDAARRLSRYFLGQLALNSAFGVVIGVGLWIIGVPSPVLWGIFALVMRFVPYIGAFLSAVLPIALAAAVDPGWSMVVATFLLFAIVEPIVGQIIEPLVYGHSTGLSPFSVLVSALFWTWLWGPVGLLLSTPLTVCLVVLGRHVDRLEFLDVLFSNRPALTPIENFYQRMLADDPEEAQEHAELILQECSLSAYYDDVVLKGLELAARDAARGVLTPDQKDEIRASITALVEDLEDREDAVPDPDSKPGRLISAGAGEGESACKSDPIPRSDPDDLPAAWRADGAVILVSGRGFLDGAATAIADQLLRKRGFGTRQVPFAEVARVRIAEWNPGPAQAVCVISLALSGEPTHLRRLVARLRQKVDRVPVVAGLWRLDEPMLADDALRAKLGADDHVTSLRDLIETILALARQNGAPDVSGPRDAAAPPRQALPEPA
>NC_010725.1|WP_012456769.1|5440141_5440909_-|5-oxoprolinase-subunit-PxpA
MSTRIDLNADLGEGFGPWRMGDDAALLDIVTSANVACGFHAGDPDIMVETVLAAKARGVAVGAHPGFFDLRGFGRNRVQESPKRIERDIAYQIGALQACAALAGARVTHVKAHGALANLSNEDAAIAEALARAVVGVDRTLALVVMPGLPAERAGERAGLALVREIYADRAYAEDGTLAPRARPDAVIHDAEEAAARVVHMVEQRAVFTISGRRIPVAIDTVCVHGDNPQALAMAGTVRAGLERAGFTLRPFSEP
>NC_010725.1|WP_012456770.1|5440905_5441223_-|hypothetical-protein
MPSPSITPARIRAGRGLLKWTQGVLAHGAAVSVVTPNMIESDQAARRAKALDAIRSPLVGEGIRFIGDAMEGFGVTMRPRPGDSAQTGPFEPRRRRASRAMRAAA
>NC_010725.1|WP_012456771.1|5441366_5442665_-|nicotinate-phosphoribosyltransferase
MIDLAKRVYDHNFRIDPIVRSLLDTDFYKLLMAQMIFRRHRDVRVSFGIQNRTRSVRVADEIDLGELRAQLDHARTIRLSRGESTWLRGNTFYGKRQILSSEFMAWFETFRLPEYELEVRDGQVALTFHGPWVETTLWEVPALAILNELRSRAVLRGMGKFELQVLYARAMTRVWEKIERLKRLPDLSIADFGTRRRHGFLWQDWCVQAMSEGLGERAFLGTSNCLIAMRREVEAVGTNAHELPMVYAALAGDDDDALAQAPYAVLADWQQDYAGNLLVALPDTYGTTGFLANAPDWLTAWTGIRIDSKEPIAGGEEALAFWESRGCDPRDKLAIFSDGLDIDDIEAIHAHFHGRMRIGYGWGTRLTNDFRGLVPEGRLDPISVVCKVTEAEGRPTVKISDNPSKAQGPAAEVERYKRVFGVGEQAALPVAV
>NC_010725.1|WP_012456772.1|5442821_5443325_-|pyridoxamine-5'-phosphate-oxidase-family-protein
MHQGNHRDHEGAKKLFELTKDVKVAMLTTADQSGTLNSRPMWNNEIDENGDIWFFTKLHSPKTAEISRDNQVNLAYSDPSSQTYVSIAGKAEVIRDQKLIDEKWQESLKTWFPNGKNDPEVGLIRIHPEQGEYWDSPSSTMVHLYGYVKASLTGESPKTETKKVNLA
>NC_010725.1|WP_041372193.1|5443463_5443736_+|hypothetical-protein
MRVALLAALMIAGPGPAAAGVRFGPGVRIGGHDFSNRRTRSVHIERVKRLRGPVGCRHLRRGAYRRGDGSVVRGPMDACNLIAIPPGQRR
>NC_010725.1|WP_012456774.1|5443839_5444961_+|Mrp/NBP35-family-ATP-binding-protein
MAITRDDVLKALSTVTVDRGGTTLPGSGRLSPVVIDPGNRVMFSILIDPSEAERFEPVRREAEGRVLALPGVSSVLASLTSERAPNAPPPGAAPRAPGPGVPPRQGNALPGVRHIVAVASGKGGVGKSTTACNLALGLSAQGLRVGLLDADIYGPSVPKLLGLSGKPRVLEGKTLEPMQAYGLKAMSIGFLIEPESAMIWRGPMVQSAITQMLRDVAWGELDVLVVDMPPGTGDAQLTMAQATPLSGAVIVSTPQDLALIDARRGVTMFRKVSVPILGVIENMATFICPNCGAASAIFGHGGARHEAERLEVPFLGEIPLTMAIRETSDAGRPVVATDPDGPQAKVYREIAQKLWGNLTGAPAGRAAPRIVIE
>NC_010725.1|WP_041372194.1|5445065_5445668_+|molybdenum-cofactor-guanylyltransferase-MobA
MGLILAGGLSRRMGGGDKPLRTLSGRTLLARVAERLAPQCGGGLALSANGDPARFRSVFAGRVLPDTVPDHPGPLAGILAGMEAAAALPGLTHVASVPGDAPFLPHDFVARLVAAAAAEGKPIALAASGERRHFTSALWPVALREDLRDWLSRGERRVGGFIERHGAAVAIWPAEPLDPFLNLNAPEDLAAAEALLARRP
>NC_010725.1|WP_012456776.1|5445983_5448710_+|DNA-gyrase-subunit-A
MADDKDDTGAGTPPPATDIKPVSITDEMRRSYLDYAMSVIVSRALPDARDGLKPVHRRILYSAFESGHLPERKYVKSARIVGDVIGQYHPHGDQSIYDALVRMAQDFSMRLMLIDGQGNFGSVDGDPPAAMRYTESRLARPAISLLTDIDKNTVDFQSNYDDSREEPTVLPARFPNLLVNGAGGIAVGMATNIPPHNLGELVDACVALIDDPALTIEALNEIVPGPDFPTGGMILGRAGTRQAYTTGRGSIIMRARSHVEELRKEREALIFTEIPYQVNKATLIEKIAELVKDKRIEGISDLRDESDRDGMRIVVEIKRDAMADVVLNQLYRYTPLQTSFGANMVALNGGRPELMNLKDLLLAFNDFREEVVSRRTKFLLNKARERAHVLCGLAIAVANIDEVIRLIRTSPDPNTAREALMARDWPAHDIAPLIALVDDPRHRVADDGTYRLSETQARAILDLRLQRLTALGRDEIGDELKKLADEIADYLDILRSRARIQAIVKHELAEVRELFATPRKTEIIDSDFSVEDEDLIAREDMVVTVSHAGYVKRVPLSTYRSQKRGGKGRSGMSTRDEDFVTRLFVANTHTPVLFFSDQGQAYKEKVWRLPVAAPNARGKALVNILHLQNEGERITTIMPLPEDEASWETLDVMFATASGNVRRNKLSDFVQVNRNGKIAMKLDPGDHIVHVEICRPDQNVLLTTALGQCIRFPVEDVRVFKGRDSTGVRGINLGKDDKVISMAILNAFDASPEERAGYLKMRRAVIGDSGEEGTENGEAEEASAAAISPERYTQMGAAEQFVLTLSERGFGKRSSSYEYRTSGRGGKGITAMRVNARNGNLVASFPVEASDQIMLVTNAGQLIRVPVDDIRIVGRASQGVTVFNTDKAERVVSVEHIEGEEEGGEEAV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	CP036421	Rhodobacter sphaeroides strain HJ plasmid unnamed1, complete sequence	2338-2367	4	0.867
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	NZ_CP020471	Rhodobacter blasticus strain 28/5 plasmid pRsa, complete sequence	50755-50784	4	0.867
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	NZ_CP020471	Rhodobacter blasticus strain 28/5 plasmid pRsa, complete sequence	51046-51075	4	0.867
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	NZ_CP020471	Rhodobacter blasticus strain 28/5 plasmid pRsa, complete sequence	51337-51366	4	0.867
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	NZ_CP020471	Rhodobacter blasticus strain 28/5 plasmid pRsa, complete sequence	51627-51656	4	0.867
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	NZ_CP029357	Azospirillum sp. CFH 70021 plasmid unnamed2	227101-227130	5	0.833
NC_010725_1	1.1\|5435245\|30\|NC_010725\|CRISPRCasFinder	5435245-5435274	30	NC_008042	Ruegeria sp. TM1040 plasmid unnamed, complete sequence	4691-4720	6	0.8
NC_010725_1	1.1\|5435245\|30\|NC_010725\|CRISPRCasFinder	5435245-5435274	30	NZ_CP023071	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence	593139-593168	6	0.8
NC_010725_1	1.1\|5435245\|30\|NC_010725\|CRISPRCasFinder	5435245-5435274	30	NZ_CP023071	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence	594075-594104	6	0.8
NC_010725_1	1.1\|5435245\|30\|NC_010725\|CRISPRCasFinder	5435245-5435274	30	NZ_CP023071	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence	595011-595040	6	0.8
NC_010725_1	1.1\|5435245\|30\|NC_010725\|CRISPRCasFinder	5435245-5435274	30	NZ_CP020952	Rhizobium sp. CIAT894 plasmid pRheCIAT894e, complete sequence	35311-35340	6	0.8
NC_010725_1	1.1\|5435245\|30\|NC_010725\|CRISPRCasFinder	5435245-5435274	30	NZ_CP018231	Rhizobium leguminosarum strain Vaf-108 plasmid unnamed3	200026-200055	6	0.8
NC_010725_1	1.1\|5435245\|30\|NC_010725\|CRISPRCasFinder	5435245-5435274	30	CP040467	Streptomyces albidoflavus strain UYFA156 plasmid unnamed, complete sequence	8607-8636	6	0.8
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	MH371116	Mycobacterium phage DMoney, complete genome	33272-33301	6	0.8
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	MH045569	Mycobacterium phage Schiebel, complete genome	33257-33286	6	0.8
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	MH371119	Mycobacterium phage OctaviousRex, complete genome	33272-33301	6	0.8
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	MF919497	Mycobacterium phage Chance64, complete genome	33272-33301	6	0.8
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	MH001456	Mycobacterium phage CLED96, complete genome	33272-33301	6	0.8
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	GQ303261	Mycobacterium phage Hope, complete genome	33272-33301	6	0.8
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	MG099946	Mycobacterium phage LouisV14, complete genome	35537-35566	6	0.8
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	MH779514	Mycobacterium phage Paito, complete genome	33513-33542	6	0.8
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	MH779513	Mycobacterium phage Olga, complete genome	33272-33301	6	0.8
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	MK919475	Mycobacterium phage Camri, complete genome	33272-33301	6	0.8
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	MK310146	Mycobacterium phage Crespo, complete genome	33273-33302	6	0.8
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	MK524493	Mycobacterium phage Darionha, complete genome	33272-33301	6	0.8
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	MH779505	Mycobacterium phage Grizzly, complete genome	33257-33286	6	0.8
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	EU568876	Mycobacterium phage BPs, complete genome	33272-33301	6	0.8
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	MF668268	Mycobacterium phage Aroostook, complete genome	33272-33301	6	0.8
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	MK524494	Mycobacterium phage Rabbs, complete genome	33460-33489	6	0.8
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	KX588251	Mycobacterium phage Jane, complete genome	33272-33301	6	0.8
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	MH001455	Mycobacterium phage Remy19, complete genome	33272-33301	6	0.8
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	KX641266	Mycobacterium phage Terror, complete genome	32963-32992	6	0.8
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	KT355472	Mycobacterium phage Cedasite, complete genome	33272-33301	6	0.8
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	KX664455	Mycobacterium phage Zombie, complete genome	33272-33301	6	0.8
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	MH077584	Mycobacterium phage Phish, complete genome	33272-33301	6	0.8
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	MN444875	Mycobacterium phage Jonghyun, complete genome	33272-33301	6	0.8
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	MK433279	Mycobacterium phage Kareem, complete genome	33272-33301	6	0.8
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	NC_031102	Mycobacterium phage Sneeze, complete genome	33459-33488	6	0.8
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	MK305884	Mycobacterium phage BQuat, complete genome	33263-33292	6	0.8
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	MF668272	Mycobacterium phage Gideon, complete genome	33272-33301	6	0.8
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	MH779515	Mycobacterium phage Sweets, complete genome	33267-33296	6	0.8
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	MW119570	Mycobacterium phage Lang, complete genome	33331-33360	6	0.8
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	NC_012788	Mycobacterium phage Angel, complete genome	33257-33286	6	0.8
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	KX443326	Mycobacterium phage BruceB, complete genome	33272-33301	6	0.8
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	KX641265	Mycobacterium phage Taheera, complete genome	32963-32992	6	0.8
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	MK433277	Mycobacterium phage Renaissance, complete genome	33272-33301	6	0.8
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	MH590605	Mycobacterium phage Cherrybomb426, complete genome	33272-33301	6	0.8
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	MH779509	Mycobacterium phage Kasen3, complete genome	33258-33287	6	0.8
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	JN699002	Mycobacterium phage Avrafan, complete genome	33272-33301	6	0.8
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	MH779507	Mycobacterium phage Hotshotbaby7, complete genome	33272-33301	6	0.8
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	KT355474	Mycobacterium phage Frosty24, complete genome	33272-33301	6	0.8
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	MH479920	Mycobacterium phage Mowgli, complete genome	33272-33301	6	0.8
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	NC_008202	Mycobacterium phage Halo, complete genome	33267-33296	6	0.8
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	KM923970	Mycobacterium phage Gomashi, complete genome	33273-33302	6	0.8
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	MH450127	Mycobacterium phage Plagueis, complete genome	33092-33121	6	0.8
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	KT347314	Mycobacterium phage Phreak, complete genome	33272-33301	6	0.8
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	KT365399	Mycobacterium phage Annihilator, complete genome	33263-33292	6	0.8
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	NZ_CP023071	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence	1068621-1068650	6	0.8
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	NC_012811	Methylorubrum extorquens AM1 megaplasmid, complete sequence	142265-142294	6	0.8
NC_010725_1	1.1\|5435245\|30\|NC_010725\|CRISPRCasFinder	5435245-5435274	30	NZ_CP038235	Leisingera sp. NJS201 plasmid unnamed1, complete sequence	10763-10792	7	0.767
NC_010725_1	1.1\|5435245\|30\|NC_010725\|CRISPRCasFinder	5435245-5435274	30	NZ_CP026928	Agrobacterium tumefaciens strain 1D1609 plasmid pAt1D1609b, complete sequence	104572-104601	7	0.767
NC_010725_1	1.1\|5435245\|30\|NC_010725\|CRISPRCasFinder	5435245-5435274	30	NZ_AP014705	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence	1079323-1079352	7	0.767
NC_010725_1	1.1\|5435245\|30\|NC_010725\|CRISPRCasFinder	5435245-5435274	30	NZ_CP045395	Roseovarius sp. THAF27 plasmid pTHAF27_b, complete sequence	5245-5274	7	0.767
NC_010725_1	1.1\|5435245\|30\|NC_010725\|CRISPRCasFinder	5435245-5435274	30	NC_011368	Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG201, complete sequence	307761-307790	7	0.767
NC_010725_1	1.1\|5435245\|30\|NC_010725\|CRISPRCasFinder	5435245-5435274	30	NZ_CP006370	Aureimonas sp. AU20 plasmid pAU20c, complete sequence	112981-113010	7	0.767
NC_010725_1	1.1\|5435245\|30\|NC_010725\|CRISPRCasFinder	5435245-5435274	30	NZ_CP032346	Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence	560908-560937	7	0.767
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	NZ_CP012399	Chelatococcus sp. CO-6 plasmid pCO-6, complete sequence	614794-614823	7	0.767
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	KC787112	Mycobacterium phage Clark, partial genome	31186-31215	7	0.767
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	KC787107	Mycobacterium phage Bo4, complete genome	7397-7426	7	0.767
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	KC787103	Mycobacterium phage Chy2, partial genome	31421-31450	7	0.767
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	KC787108	Mycobacterium phage DNAIII, complete genome	31906-31935	7	0.767
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	KJ725374	Mycobacterium phage Guo1, complete genome	1925-1954	7	0.767
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	MT818422	Mycobacterium phage Periodt, complete genome	33263-33292	7	0.767
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	KC787111	Mycobacterium phage Sedge, partial genome	32597-32626	7	0.767
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	KC787104	Mycobacterium phage Chy3, partial genome	32276-32305	7	0.767
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	KC787109	Mycobacterium phage Legendre, partial genome	8053-8082	7	0.767
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	KC787110	Mycobacterium phage Leo, complete genome	31913-31942	7	0.767
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	NZ_CP045736	Aeromicrobium sp. MF47 plasmid p001, complete sequence	14411-14440	7	0.767
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	NZ_CP044425	Paracoccus pantotrophus strain DSM 2944 plasmid pPAN2, complete sequence	411844-411873	7	0.767
NC_010725_1	1.1\|5435245\|30\|NC_010725\|CRISPRCasFinder	5435245-5435274	30	NZ_CP032322	Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence	235311-235340	8	0.733
NC_010725_1	1.1\|5435245\|30\|NC_010725\|CRISPRCasFinder	5435245-5435274	30	NZ_CP032322	Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence	273605-273634	8	0.733
NC_010725_1	1.1\|5435245\|30\|NC_010725\|CRISPRCasFinder	5435245-5435274	30	NZ_CP032322	Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence	1286589-1286618	8	0.733
NC_010725_1	1.1\|5435245\|30\|NC_010725\|CRISPRCasFinder	5435245-5435274	30	NZ_CP032322	Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence	1634139-1634168	8	0.733
NC_010725_1	1.1\|5435245\|30\|NC_010725\|CRISPRCasFinder	5435245-5435274	30	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	114261-114290	8	0.733
NC_010725_1	1.1\|5435245\|30\|NC_010725\|CRISPRCasFinder	5435245-5435274	30	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	851611-851640	8	0.733
NC_010725_1	1.1\|5435245\|30\|NC_010725\|CRISPRCasFinder	5435245-5435274	30	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	1414077-1414106	8	0.733
NC_010725_1	1.1\|5435245\|30\|NC_010725\|CRISPRCasFinder	5435245-5435274	30	NC_009427	Novosphingobium aromaticivorans DSM 12444 plasmid pNL2, complete sequence	136725-136754	8	0.733
NC_010725_1	1.1\|5435245\|30\|NC_010725\|CRISPRCasFinder	5435245-5435274	30	NZ_CP017947	Bosea sp. Tri-49 plasmid unnamed1, complete sequence	38896-38925	8	0.733
NC_010725_1	1.1\|5435245\|30\|NC_010725\|CRISPRCasFinder	5435245-5435274	30	NZ_CP054022	Rhizobium sp. JKLM12A2 plasmid pPR12A201, complete sequence	774682-774711	8	0.733
NC_010725_1	1.1\|5435245\|30\|NC_010725\|CRISPRCasFinder	5435245-5435274	30	NZ_CP054032	Rhizobium sp. JKLM13E plasmid pPR13E01, complete sequence	444460-444489	8	0.733
NC_010725_1	1.1\|5435245\|30\|NC_010725\|CRISPRCasFinder	5435245-5435274	30	NZ_CP022304	Thalassococcus sp. S3 plasmid pS3A, complete sequence	5032-5061	8	0.733
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	MK494105	Mycobacterium phage Pinnie, complete genome	34517-34546	8	0.733
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	MK494124	Mycobacterium phage Kristoff, complete genome	28726-28755	8	0.733
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	MN586038	Mycobacterium phage WalterMcMickey, complete genome	28290-28319	8	0.733
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	JX411619	Mycobacterium virus Rebeuca, complete genome	28727-28756	8	0.733
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	NC_041982	Mycobacterium phage Twister, complete genome	28290-28319	8	0.733
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	MT522002	Mycobacterium phage Topanga, complete genome	28379-28408	8	0.733
NC_010725_1	1.2\|5435299\|30\|NC_010725\|CRISPRCasFinder	5435299-5435328	30	NC_016587	Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence	578463-578492	9	0.7

1. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to CP036421 (Rhodobacter sphaeroides strain HJ plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.867

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
ggccgggaacgacgtgctggacgggggaga	Protospacer
** .**********.************ **

2. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to NZ_CP020471 (Rhodobacter blasticus strain 28/5 plasmid pRsa, complete sequence) position: , mismatch: 4, identity: 0.867

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
ggccggcaacgatgcgctggacgggggcga	Protospacer
** .** *****.*****************

3. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to NZ_CP020471 (Rhodobacter blasticus strain 28/5 plasmid pRsa, complete sequence) position: , mismatch: 4, identity: 0.867

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
ggccggcaacgatgcgctggacgggggcga	Protospacer
** .** *****.*****************

4. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to NZ_CP020471 (Rhodobacter blasticus strain 28/5 plasmid pRsa, complete sequence) position: , mismatch: 4, identity: 0.867

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
ggccggcaacgatgcgctggacgggggcga	Protospacer
** .** *****.*****************

5. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to NZ_CP020471 (Rhodobacter blasticus strain 28/5 plasmid pRsa, complete sequence) position: , mismatch: 4, identity: 0.867

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
ggccggcaacgatgcgctggacgggggcga	Protospacer
** .** *****.*****************

6. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to NZ_CP029357 (Azospirillum sp. CFH 70021 plasmid unnamed2) position: , mismatch: 5, identity: 0.833

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
ggacgggaacgacacgctggacggcaggga	Protospacer
***.*********.********** .* **

7. spacer 1.1|5435245|30|NC_010725|CRISPRCasFinder matches to NC_008042 (Ruegeria sp. TM1040 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

ccggggcgacgacaagctcttcggcggcct	CRISPR spacer
tgcgggcaacgacacgctcttcggcggccc	Protospacer
.  ****.****** **************.

8. spacer 1.1|5435245|30|NC_010725|CRISPRCasFinder matches to NZ_CP023071 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence) position: , mismatch: 6, identity: 0.8

ccggggcgacgacaagctcttcggcggcct	CRISPR spacer
cgagggcgacgacacgctcttgggcggcga	Protospacer
* .*********** ****** ******

9. spacer 1.1|5435245|30|NC_010725|CRISPRCasFinder matches to NZ_CP023071 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence) position: , mismatch: 6, identity: 0.8

ccggggcgacgacaagctcttcggcggcct	CRISPR spacer
cgagggcgacgacacgctcttgggcggcga	Protospacer
* .*********** ****** ******

10. spacer 1.1|5435245|30|NC_010725|CRISPRCasFinder matches to NZ_CP023071 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence) position: , mismatch: 6, identity: 0.8

ccggggcgacgacaagctcttcggcggcct	CRISPR spacer
cgagggcgacgacacgctcttgggcggcga	Protospacer
* .*********** ****** ******

11. spacer 1.1|5435245|30|NC_010725|CRISPRCasFinder matches to NZ_CP020952 (Rhizobium sp. CIAT894 plasmid pRheCIAT894e, complete sequence) position: , mismatch: 6, identity: 0.8

ccggggcgacgacaagctcttcggcggcct	CRISPR spacer
cctcgacgacgacaagctctgcgccggcca	Protospacer
**  *.************** ** *****

12. spacer 1.1|5435245|30|NC_010725|CRISPRCasFinder matches to NZ_CP018231 (Rhizobium leguminosarum strain Vaf-108 plasmid unnamed3) position: , mismatch: 6, identity: 0.8

ccggggcgacgacaagctcttcggcggcct	CRISPR spacer
cctcgacgacgacaagctctgcgccggcca	Protospacer
**  *.************** ** *****

13. spacer 1.1|5435245|30|NC_010725|CRISPRCasFinder matches to CP040467 (Streptomyces albidoflavus strain UYFA156 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

ccggggcgacgacaagctcttcggcggcct	CRISPR spacer
ccggggcaacgccaagctcttcgtcaagct	Protospacer
*******.*** *********** *.. **

14. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to MH371116 (Mycobacterium phage DMoney, complete genome) position: , mismatch: 6, identity: 0.8

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
ggatgggaacgacgcgctggacagcttgca	Protospacer
**********************.*     *

15. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to MH045569 (Mycobacterium phage Schiebel, complete genome) position: , mismatch: 6, identity: 0.8

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
ggatgggaacgacgcgctggacagcttgca	Protospacer
**********************.*     *

16. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to MH371119 (Mycobacterium phage OctaviousRex, complete genome) position: , mismatch: 6, identity: 0.8

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
ggatgggaacgacgcgctggacagcttgca	Protospacer
**********************.*     *

17. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to MF919497 (Mycobacterium phage Chance64, complete genome) position: , mismatch: 6, identity: 0.8

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
ggatgggaacgacgcgctggacagcttgca	Protospacer
**********************.*     *

18. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to MH001456 (Mycobacterium phage CLED96, complete genome) position: , mismatch: 6, identity: 0.8

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
ggatgggaacgacgcgctggacagcttgca	Protospacer
**********************.*     *

19. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to GQ303261 (Mycobacterium phage Hope, complete genome) position: , mismatch: 6, identity: 0.8

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
ggatgggaacgacgcgctggacagcttgca	Protospacer
**********************.*     *

20. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to MG099946 (Mycobacterium phage LouisV14, complete genome) position: , mismatch: 6, identity: 0.8

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
ggatgggaacgacgcgctggacagcttgca	Protospacer
**********************.*     *

21. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to MH779514 (Mycobacterium phage Paito, complete genome) position: , mismatch: 6, identity: 0.8

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
ggatgggaacgacgcgctggacagcctgca	Protospacer
**********************.*     *

22. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to MH779513 (Mycobacterium phage Olga, complete genome) position: , mismatch: 6, identity: 0.8

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
ggatgggaacgacgcgctggacagcttgca	Protospacer
**********************.*     *

23. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to MK919475 (Mycobacterium phage Camri, complete genome) position: , mismatch: 6, identity: 0.8

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
ggatgggaacgacgcgctggacagcttgca	Protospacer
**********************.*     *

24. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to MK310146 (Mycobacterium phage Crespo, complete genome) position: , mismatch: 6, identity: 0.8

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
ggatgggaacgacgcgctggacagcttgca	Protospacer
**********************.*     *

25. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to MK524493 (Mycobacterium phage Darionha, complete genome) position: , mismatch: 6, identity: 0.8

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
ggatgggaacgacgcgctggacagcttgca	Protospacer
**********************.*     *

26. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to MH779505 (Mycobacterium phage Grizzly, complete genome) position: , mismatch: 6, identity: 0.8

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
ggatgggaacgacgcgctggacagcttgca	Protospacer
**********************.*     *

27. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to EU568876 (Mycobacterium phage BPs, complete genome) position: , mismatch: 6, identity: 0.8

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
ggatgggaacgacgcgctggacagcttgca	Protospacer
**********************.*     *

28. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to MF668268 (Mycobacterium phage Aroostook, complete genome) position: , mismatch: 6, identity: 0.8

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
ggatgggaacgacgcgctggacagcttgca	Protospacer
**********************.*     *

29. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to MK524494 (Mycobacterium phage Rabbs, complete genome) position: , mismatch: 6, identity: 0.8

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
ggatgggaacgacgcgctggacagcttgca	Protospacer
**********************.*     *

30. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to KX588251 (Mycobacterium phage Jane, complete genome) position: , mismatch: 6, identity: 0.8

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
ggatgggaacgacgcgctggacagcttgca	Protospacer
**********************.*     *

31. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to MH001455 (Mycobacterium phage Remy19, complete genome) position: , mismatch: 6, identity: 0.8

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
ggatgggaacgacgcgctggacagcttgca	Protospacer
**********************.*     *

32. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to KX641266 (Mycobacterium phage Terror, complete genome) position: , mismatch: 6, identity: 0.8

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
ggatgggaacgacgcgctggacagcttgca	Protospacer
**********************.*     *

33. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to KT355472 (Mycobacterium phage Cedasite, complete genome) position: , mismatch: 6, identity: 0.8

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
ggatgggaacgacgcgctggacagcttgca	Protospacer
**********************.*     *

34. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to KX664455 (Mycobacterium phage Zombie, complete genome) position: , mismatch: 6, identity: 0.8

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
ggatgggaacgacgcgctggacagcttgca	Protospacer
**********************.*     *

35. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to MH077584 (Mycobacterium phage Phish, complete genome) position: , mismatch: 6, identity: 0.8

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
ggatgggaacgacgcgctggacagcttgca	Protospacer
**********************.*     *

36. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to MN444875 (Mycobacterium phage Jonghyun, complete genome) position: , mismatch: 6, identity: 0.8

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
ggatgggaacgacgcgctggacagcttgca	Protospacer
**********************.*     *

37. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to MK433279 (Mycobacterium phage Kareem, complete genome) position: , mismatch: 6, identity: 0.8

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
ggatgggaacgacgcgctggacagcttgca	Protospacer
**********************.*     *

38. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to NC_031102 (Mycobacterium phage Sneeze, complete genome) position: , mismatch: 6, identity: 0.8

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
ggatgggaacgacgcgctggacagcctgca	Protospacer
**********************.*     *

39. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to MK305884 (Mycobacterium phage BQuat, complete genome) position: , mismatch: 6, identity: 0.8

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
ggatgggaacgacgcgctggacagcttgca	Protospacer
**********************.*     *

40. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to MF668272 (Mycobacterium phage Gideon, complete genome) position: , mismatch: 6, identity: 0.8

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
ggatgggaacgacgcgctggacagcttgca	Protospacer
**********************.*     *

41. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to MH779515 (Mycobacterium phage Sweets, complete genome) position: , mismatch: 6, identity: 0.8

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
ggatgggaacgacgcgctggacagcttgca	Protospacer
**********************.*     *

42. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to MW119570 (Mycobacterium phage Lang, complete genome) position: , mismatch: 6, identity: 0.8

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
ggatgggaacgacgcgctggacagcttgca	Protospacer
**********************.*     *

43. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to NC_012788 (Mycobacterium phage Angel, complete genome) position: , mismatch: 6, identity: 0.8

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
ggatgggaacgacgcgctggacagcttgca	Protospacer
**********************.*     *

44. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to KX443326 (Mycobacterium phage BruceB, complete genome) position: , mismatch: 6, identity: 0.8

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
ggatgggaacgacgcgctggacagcttgca	Protospacer
**********************.*     *

45. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to KX641265 (Mycobacterium phage Taheera, complete genome) position: , mismatch: 6, identity: 0.8

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
ggatgggaacgacgcgctggacagcttgca	Protospacer
**********************.*     *

46. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to MK433277 (Mycobacterium phage Renaissance, complete genome) position: , mismatch: 6, identity: 0.8

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
ggatgggaacgacgcgctggacagcttgca	Protospacer
**********************.*     *

47. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to MH590605 (Mycobacterium phage Cherrybomb426, complete genome) position: , mismatch: 6, identity: 0.8

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
ggatgggaacgacgcgctggacagcttgca	Protospacer
**********************.*     *

48. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to MH779509 (Mycobacterium phage Kasen3, complete genome) position: , mismatch: 6, identity: 0.8

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
ggatgggaacgacgcgctggacagcttgca	Protospacer
**********************.*     *

49. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to JN699002 (Mycobacterium phage Avrafan, complete genome) position: , mismatch: 6, identity: 0.8

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
ggatgggaacgacgcgctggacagcttgca	Protospacer
**********************.*     *

50. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to MH779507 (Mycobacterium phage Hotshotbaby7, complete genome) position: , mismatch: 6, identity: 0.8

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
ggatgggaacgacgcgctggacagcttgca	Protospacer
**********************.*     *

51. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to KT355474 (Mycobacterium phage Frosty24, complete genome) position: , mismatch: 6, identity: 0.8

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
ggatgggaacgacgcgctggacagcttgca	Protospacer
**********************.*     *

52. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to MH479920 (Mycobacterium phage Mowgli, complete genome) position: , mismatch: 6, identity: 0.8

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
ggatgggaacgacgcgctggacagcttgca	Protospacer
**********************.*     *

53. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to NC_008202 (Mycobacterium phage Halo, complete genome) position: , mismatch: 6, identity: 0.8

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
ggatgggaacgacgcgctggacagcttgca	Protospacer
**********************.*     *

54. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to KM923970 (Mycobacterium phage Gomashi, complete genome) position: , mismatch: 6, identity: 0.8

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
ggatgggaacgacgcgctggacagcttgca	Protospacer
**********************.*     *

55. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to MH450127 (Mycobacterium phage Plagueis, complete genome) position: , mismatch: 6, identity: 0.8

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
ggatgggaacgacgcgctggacagcttgca	Protospacer
**********************.*     *

56. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to KT347314 (Mycobacterium phage Phreak, complete genome) position: , mismatch: 6, identity: 0.8

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
ggatgggaacgacgcgctggacagcttgca	Protospacer
**********************.*     *

57. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to KT365399 (Mycobacterium phage Annihilator, complete genome) position: , mismatch: 6, identity: 0.8

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
ggatgggaacgacgcgctggacagcttgca	Protospacer
**********************.*     *

58. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to NZ_CP023071 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence) position: , mismatch: 6, identity: 0.8

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
gggcgggaacgacgcgctcgacggcggccg	Protospacer
**..************** ***** *** .

59. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to NC_012811 (Methylorubrum extorquens AM1 megaplasmid, complete sequence) position: , mismatch: 6, identity: 0.8

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
gaaccggcacgacgcgctggacggcggcaa	Protospacer
*.*. ** **************** ***.*

60. spacer 1.1|5435245|30|NC_010725|CRISPRCasFinder matches to NZ_CP038235 (Leisingera sp. NJS201 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ccggggcgacgacaagctcttcggcggcct	CRISPR spacer
cgacggcaacgacaagctgttcggcggcgg	Protospacer
* . ***.********** *********

61. spacer 1.1|5435245|30|NC_010725|CRISPRCasFinder matches to NZ_CP026928 (Agrobacterium tumefaciens strain 1D1609 plasmid pAt1D1609b, complete sequence) position: , mismatch: 7, identity: 0.767

ccggggcgacgacaagctcttcggcggcct	CRISPR spacer
cgtcggcgacgacacgctcatcggcggcga	Protospacer
*   ********** **** ********

62. spacer 1.1|5435245|30|NC_010725|CRISPRCasFinder matches to NZ_AP014705 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence) position: , mismatch: 7, identity: 0.767

ccggggcgacgacaagctcttcggcggcct	CRISPR spacer
ggtgcgcgacgaccagcccttcggcggccc	Protospacer
   * ******** ***.***********.

63. spacer 1.1|5435245|30|NC_010725|CRISPRCasFinder matches to NZ_CP045395 (Roseovarius sp. THAF27 plasmid pTHAF27_b, complete sequence) position: , mismatch: 7, identity: 0.767

ccggggcgacgacaagctcttcggcggcct	CRISPR spacer
gcctggcgatgaccagctcttcggcggcaa	Protospacer
 *  *****.*** **************

64. spacer 1.1|5435245|30|NC_010725|CRISPRCasFinder matches to NC_011368 (Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG201, complete sequence) position: , mismatch: 7, identity: 0.767

ccggggcgacgacaagctcttcggcggcct	CRISPR spacer
cttcgacgacgacaagctctgcgccggcca	Protospacer
*.  *.************** ** *****

65. spacer 1.1|5435245|30|NC_010725|CRISPRCasFinder matches to NZ_CP006370 (Aureimonas sp. AU20 plasmid pAU20c, complete sequence) position: , mismatch: 7, identity: 0.767

ccggggcgacgacaagctcttcggcggcct	CRISPR spacer
tatgcgcaacgccaagctcttcggcggcgt	Protospacer
.  * **.*** **************** *

66. spacer 1.1|5435245|30|NC_010725|CRISPRCasFinder matches to NZ_CP032346 (Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.767

ccggggcgacgacaagctcttcggcggcct	CRISPR spacer
ccaaggcgacgaccagctgttcggcggggc	Protospacer
**..********* **** ********  .

67. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to NZ_CP012399 (Chelatococcus sp. CO-6 plasmid pCO-6, complete sequence) position: , mismatch: 7, identity: 0.767

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
caacgacaacgacacgctggacggcggcga	Protospacer
 .*.*. ******.********** *****

68. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to KC787112 (Mycobacterium phage Clark, partial genome) position: , mismatch: 7, identity: 0.767

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
ggatgggaacaacgcgctggacagcctgca	Protospacer
**********.***********.*     *

69. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to KC787107 (Mycobacterium phage Bo4, complete genome) position: , mismatch: 7, identity: 0.767

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
ggatgggaacaacgcgctggacagcctgca	Protospacer
**********.***********.*     *

70. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to KC787103 (Mycobacterium phage Chy2, partial genome) position: , mismatch: 7, identity: 0.767

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
ggatgggaacaacgcgctggacagcctgca	Protospacer
**********.***********.*     *

71. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to KC787108 (Mycobacterium phage DNAIII, complete genome) position: , mismatch: 7, identity: 0.767

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
ggatgggaacaacgcgctggacagcctgca	Protospacer
**********.***********.*     *

72. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to KJ725374 (Mycobacterium phage Guo1, complete genome) position: , mismatch: 7, identity: 0.767

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
ggatgggaacaacgcgctggacagcctgca	Protospacer
**********.***********.*     *

73. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to MT818422 (Mycobacterium phage Periodt, complete genome) position: , mismatch: 7, identity: 0.767

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
ggatgggaacaacgcgctggacagcctgca	Protospacer
**********.***********.*     *

74. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to KC787111 (Mycobacterium phage Sedge, partial genome) position: , mismatch: 7, identity: 0.767

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
ggatgggaacaacgcgctggacagcctgca	Protospacer
**********.***********.*     *

75. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to KC787104 (Mycobacterium phage Chy3, partial genome) position: , mismatch: 7, identity: 0.767

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
ggatgggaacaacgcgctggacagcctgca	Protospacer
**********.***********.*     *

76. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to KC787109 (Mycobacterium phage Legendre, partial genome) position: , mismatch: 7, identity: 0.767

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
ggatgggaacaacgcgctggacagcctgca	Protospacer
**********.***********.*     *

77. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to KC787110 (Mycobacterium phage Leo, complete genome) position: , mismatch: 7, identity: 0.767

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
ggatgggaacaacgcgctggacagcctgca	Protospacer
**********.***********.*     *

78. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to NZ_CP045736 (Aeromicrobium sp. MF47 plasmid p001, complete sequence) position: , mismatch: 7, identity: 0.767

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
tgtcgtgaacgacgacctggacgggggcgg	Protospacer
 * .* ********  *************.

79. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to NZ_CP044425 (Paracoccus pantotrophus strain DSM 2944 plasmid pPAN2, complete sequence) position: , mismatch: 7, identity: 0.767

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
tgtcgccatcgacgcgctggaagggggcga	Protospacer
 * .*  * ************ ********

80. spacer 1.1|5435245|30|NC_010725|CRISPRCasFinder matches to NZ_CP032322 (Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.733

ccggggcgacgacaagctcttcggcggcct	CRISPR spacer
ggagggcgacgacacgctgttcggcggggc	Protospacer
  .*********** *** ********  .

81. spacer 1.1|5435245|30|NC_010725|CRISPRCasFinder matches to NZ_CP032322 (Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.733

ccggggcgacgacaagctcttcggcggcct	CRISPR spacer
ggagggcgacgacacgctgttcggcggggc	Protospacer
  .*********** *** ********  .

82. spacer 1.1|5435245|30|NC_010725|CRISPRCasFinder matches to NZ_CP032322 (Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.733

ccggggcgacgacaagctcttcggcggcct	CRISPR spacer
ggagggcgacgacacgctgttcggcggggc	Protospacer
  .*********** *** ********  .

83. spacer 1.1|5435245|30|NC_010725|CRISPRCasFinder matches to NZ_CP032322 (Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.733

ccggggcgacgacaagctcttcggcggcct	CRISPR spacer
ggagggcgacgacacgctgttcggcggggc	Protospacer
  .*********** *** ********  .

84. spacer 1.1|5435245|30|NC_010725|CRISPRCasFinder matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 8, identity: 0.733

ccggggcgacgacaagctcttcggcggcct	CRISPR spacer
ggagggcgacgacacgctgttcggcggggc	Protospacer
  .*********** *** ********  .

85. spacer 1.1|5435245|30|NC_010725|CRISPRCasFinder matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 8, identity: 0.733

ccggggcgacgacaagctcttcggcggcct	CRISPR spacer
ggagggcgacgacacgctgttcggcggggc	Protospacer
  .*********** *** ********  .

86. spacer 1.1|5435245|30|NC_010725|CRISPRCasFinder matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 8, identity: 0.733

ccggggcgacgacaagctcttcggcggcct	CRISPR spacer
ggagggcgacgacacgctgttcggcggggc	Protospacer
  .*********** *** ********  .

87. spacer 1.1|5435245|30|NC_010725|CRISPRCasFinder matches to NC_009427 (Novosphingobium aromaticivorans DSM 12444 plasmid pNL2, complete sequence) position: , mismatch: 8, identity: 0.733

ccggggcgacgacaagctcttcggcggcct	CRISPR spacer
gttctacgacgacaagctctacgccggcct	Protospacer
 .   .************** ** ******

88. spacer 1.1|5435245|30|NC_010725|CRISPRCasFinder matches to NZ_CP017947 (Bosea sp. Tri-49 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ccggggcgacgacaagctcttcggcggcct	CRISPR spacer
catcggcgacgacacgctcttcggcgatgg	Protospacer
*   ********** ***********..

89. spacer 1.1|5435245|30|NC_010725|CRISPRCasFinder matches to NZ_CP054022 (Rhizobium sp. JKLM12A2 plasmid pPR12A201, complete sequence) position: , mismatch: 8, identity: 0.733

ccggggcgacgacaagctcttcggcggcct	CRISPR spacer
cattggcgacgacacgctcttcggcgatgc	Protospacer
*   ********** ***********.. .

90. spacer 1.1|5435245|30|NC_010725|CRISPRCasFinder matches to NZ_CP054032 (Rhizobium sp. JKLM13E plasmid pPR13E01, complete sequence) position: , mismatch: 8, identity: 0.733

ccggggcgacgacaagctcttcggcggcct	CRISPR spacer
cattggcgacgacacgctcttcggcgatgc	Protospacer
*   ********** ***********.. .

91. spacer 1.1|5435245|30|NC_010725|CRISPRCasFinder matches to NZ_CP022304 (Thalassococcus sp. S3 plasmid pS3A, complete sequence) position: , mismatch: 8, identity: 0.733

ccggggcgacgacaagctcttcggcggcct	CRISPR spacer
gatcagcgacgaccagcttttcggcggcat	Protospacer
    .******** ****.********* *

92. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to MK494105 (Mycobacterium phage Pinnie, complete genome) position: , mismatch: 8, identity: 0.733

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
ggatcgggacgacgcgctggacggcctgcc	Protospacer
**** **.****************

93. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to MK494124 (Mycobacterium phage Kristoff, complete genome) position: , mismatch: 8, identity: 0.733

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
caagctcaacgacgcgctggacgaggccga	Protospacer
 .*    ****************.** ***

94. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to MN586038 (Mycobacterium phage WalterMcMickey, complete genome) position: , mismatch: 8, identity: 0.733

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
caagctcaacgacgcgctggacgaggccga	Protospacer
 .*    ****************.** ***

95. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to JX411619 (Mycobacterium virus Rebeuca, complete genome) position: , mismatch: 8, identity: 0.733

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
caagctcaacgacgcgctggacgaggccga	Protospacer
 .*    ****************.** ***

96. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to NC_041982 (Mycobacterium phage Twister, complete genome) position: , mismatch: 8, identity: 0.733

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
caagctcaacgacgcgctggacgaggccga	Protospacer
 .*    ****************.** ***

97. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to MT522002 (Mycobacterium phage Topanga, complete genome) position: , mismatch: 8, identity: 0.733

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
caagctcaacgacgcgctggacgaggccga	Protospacer
 .*    ****************.** ***

98. spacer 1.2|5435299|30|NC_010725|CRISPRCasFinder matches to NC_016587 (Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence) position: , mismatch: 9, identity: 0.7

ggatgggaacgacgcgctggacgggggcga	CRISPR spacer
cagcaacaacgacacgctggacggcggcga	Protospacer
 ..... ******.********** *****

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

333037 : 367180

Tetraselmis_virus(25.0%)

integrase,transposase

attL 334612:334632|attR 370962:370982

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_081435370.1\|333037_334396_-\|transposase	IS701 family transposase	NA	NA	NA	NA
334612:334632	attL	NA	NA	NA	NA
WP_012452255.1\|335124_336417_+	NAD(P)-binding protein	NA	NA	NA	NA
WP_081435371.1\|336359_337109_+	response regulator	NA	NA	NA	NA
WP_012452257.1\|337152_337536_-	response regulator	NA	NA	NA	NA
WP_012452258.1\|337532_340238_-	PAS domain S-box protein	NA	NA	NA	NA
WP_052300021.1\|340469_340691_-	DUF2934 domain-containing protein	NA	NA	NA	NA
WP_012452259.1\|341258_341675_-	ester cyclase	NA	NA	NA	NA
WP_158022316.1\|341687_341942_-	hypothetical protein	NA	NA	NA	NA
WP_041371834.1\|341995_343093_-	catalase family protein	NA	NA	NA	NA
WP_012452262.1\|343340_344423_+	catalase family protein	NA	NA	NA	NA
WP_012452263.1\|344461_345031_+	type 1 glutamine amidotransferase	NA	NA	NA	NA
WP_012452264.1\|345089_345854_+	SDR family oxidoreductase	A0A2P0VP75	Tetraselmis_virus	2.3e-10	28.2
WP_041370975.1\|346000_346531_-	DNA starvation/stationary phase protection protein Dps	NA	NA	NA	NA
WP_012452266.1\|346807_347017_+	hypothetical protein	NA	NA	NA	NA
WP_012452267.1\|347073_347592_-	peptide-methionine (S)-S-oxide reductase MsrA	NA	NA	NA	NA
WP_085985393.1\|348176_348942_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_012452268.1\|349146_349332_-	hypothetical protein	NA	NA	NA	NA
WP_012452269.1\|349356_350778_-	exonuclease VII large subunit-like protein	NA	NA	NA	NA
WP_012452270.1\|350855_351776_-	hypothetical protein	NA	NA	NA	NA
WP_012452271.1\|352115_353987_-	hypothetical protein	NA	NA	NA	NA
WP_012452272.1\|354049_354478_-	hypothetical protein	NA	NA	NA	NA
WP_041370979.1\|354476_354704_+	hypothetical protein	NA	NA	NA	NA
WP_012452273.1\|355006_355318_-	hypothetical protein	NA	NA	NA	NA
WP_012452274.1\|355926_356502_+	hypothetical protein	NA	NA	NA	NA
WP_012452275.1\|356608_357448_+	hypothetical protein	NA	NA	NA	NA
WP_162091587.1\|357455_357893_+	hypothetical protein	NA	NA	NA	NA
WP_012452277.1\|360009_361056_+\|transposase	IS110-like element ISMpo4 family transposase	NA	NA	NA	NA
WP_012452279.1\|361807_362272_-	translesion error-prone DNA polymerase V autoproteolytic subunit	F1C5A6	Cronobacter_phage	4.7e-19	40.0
WP_012452280.1\|362630_362870_+	hypothetical protein	NA	NA	NA	NA
WP_041370981.1\|363128_363680_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_003596089.1\|364462_365671_-\|transposase	IS256-like element ISMex14 family transposase	A0A220NQR7	Corynebacterium_phage	4.9e-92	48.5
WP_085985395.1\|365996_367180_-\|transposase	IS3-like element ISMex5 family transposase	S5WIU1	Leptospira_phage	7.3e-32	32.4
370962:370982	attR	NA	NA	NA	NA

DBSCAN-SWA_2

1478694 : 1541119

Paracoccus_phage(20.0%)

head,protease,integrase,tail

attL 1477863:1477878|attR 1524317:1524332

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1477863:1477878	attL	NA	NA	NA	NA
WP_012453281.1\|1478694_1480038_+\|integrase	tyrosine-type recombinase/integrase	Q2A0C3	Sodalis_phage	1.5e-12	33.1
WP_052300028.1\|1480174_1484065_-	glycosyltransferase	NA	NA	NA	NA
WP_012453283.1\|1484607_1485516_+	hypothetical protein	NA	NA	NA	NA
WP_012453284.1\|1485657_1486428_-	anti-sigma factor	NA	NA	NA	NA
WP_012453285.1\|1486512_1487091_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_012453286.1\|1487329_1488634_-	L,D-transpeptidase family protein	NA	NA	NA	NA
WP_012453287.1\|1488915_1489320_+	hypothetical protein	NA	NA	NA	NA
WP_012453288.1\|1489429_1490503_+	DUF1775 domain-containing protein	NA	NA	NA	NA
WP_012453289.1\|1490594_1491140_+	copper chaperone PCu(A)C	NA	NA	NA	NA
WP_012453290.1\|1491129_1491765_+	SCO family protein	NA	NA	NA	NA
WP_052300029.1\|1491887_1492244_+	hypothetical protein	NA	NA	NA	NA
WP_012453292.1\|1492285_1494427_+	TonB-dependent receptor	NA	NA	NA	NA
WP_012453293.1\|1494601_1494844_+	hypothetical protein	NA	NA	NA	NA
WP_012453294.1\|1494844_1495246_+	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_041371144.1\|1495291_1496764_-	carbohydrate porin	NA	NA	NA	NA
WP_012453296.1\|1496903_1497575_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_012453297.1\|1497738_1498761_+	TRAP transporter substrate-binding protein DctP	NA	NA	NA	NA
WP_012453298.1\|1498757_1499483_+	TRAP transporter small permease	NA	NA	NA	NA
WP_012453299.1\|1499479_1500832_+	TRAP transporter large permease	NA	NA	NA	NA
WP_012453300.1\|1501088_1501286_+	hypothetical protein	NA	NA	NA	NA
WP_012453301.1\|1501788_1502019_+	hypothetical protein	NA	NA	NA	NA
WP_012453302.1\|1502080_1503127_+	cysteine synthase A	A0A1X9I5K7	Streptococcus_phage	1.5e-41	36.4
WP_012453303.1\|1503236_1503389_+	DUF3309 family protein	NA	NA	NA	NA
WP_012453304.1\|1503408_1504863_-	trypsin-like peptidase domain-containing protein	NA	NA	NA	NA
WP_012453305.1\|1505144_1510451_+	alpha-2-macroglobulin family protein	NA	NA	NA	NA
WP_012453306.1\|1510455_1512570_+	penicillin-binding protein 1C	NA	NA	NA	NA
WP_012453307.1\|1512709_1513030_+	quaternary ammonium compound efflux SMR transporter SugE	NA	NA	NA	NA
WP_012453308.1\|1513034_1513832_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_012453309.1\|1513882_1514494_-	class GN sortase	NA	NA	NA	NA
WP_114415924.1\|1514490_1516674_-	marine proteobacterial sortase target protein	A0A2K9L1J5	Tupanvirus	7.1e-09	21.5
WP_012453311.1\|1516907_1517519_+	histidine phosphatase family protein	NA	NA	NA	NA
WP_012453312.1\|1517509_1518235_-	hypothetical protein	NA	NA	NA	NA
WP_012453313.1\|1518299_1519313_-	nickel transporter	NA	NA	NA	NA
WP_012453314.1\|1519303_1519963_-	DUF1007 family protein	NA	NA	NA	NA
WP_012453315.1\|1520045_1520507_-	cytochrome c-type biogenesis protein CcmH	NA	NA	NA	NA
WP_012453316.1\|1520503_1522504_-	heme lyase CcmF/NrfE family subunit	NA	NA	NA	NA
WP_012453317.1\|1522550_1523060_-	cytochrome c maturation protein CcmE	NA	NA	NA	NA
WP_012453318.1\|1523222_1524773_-	c-type cytochrome biogenesis protein CcmI	NA	NA	NA	NA
1524317:1524332	attR	NA	NA	NA	NA
WP_012453319.1\|1524921_1526337_-	ATP-binding protein	NA	NA	NA	NA
WP_012453320.1\|1526429_1526666_+	type II toxin-antitoxin system VapB family antitoxin	NA	NA	NA	NA
WP_012453321.1\|1526665_1527064_+	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_012453322.1\|1527070_1527748_-	response regulator transcription factor	NA	NA	NA	NA
WP_041371149.1\|1527787_1528162_-	PepSY domain-containing protein	NA	NA	NA	NA
WP_012453324.1\|1528344_1528581_-	hypothetical protein	NA	NA	NA	NA
WP_012453325.1\|1528599_1528953_-	hypothetical protein	NA	NA	NA	NA
WP_012453326.1\|1529050_1529641_-	hypothetical protein	NA	NA	NA	NA
WP_012453327.1\|1529627_1530257_-	glycoside hydrolase family protein	W6E9Q2	Rhizobium_phage	2.0e-25	42.1
WP_012453328.1\|1530303_1531386_-	DUF2793 domain-containing protein	A0A0S0MV96	Pseudomonas_phage	7.1e-10	43.0
WP_012453329.1\|1531412_1535315_-	hypothetical protein	A0A0B5A7K5	Paracoccus_phage	1.1e-198	37.0
WP_012453330.1\|1535341_1535800_-	peptidase P60	A0A1V0DYB6	Dinoroseobacter_phage	5.3e-31	49.3
WP_012453331.1\|1535807_1536701_-	DUF2163 domain-containing protein	A0A1V0DY93	Dinoroseobacter_phage	2.3e-54	38.9
WP_012453332.1\|1536711_1537353_-	DUF2460 domain-containing protein	A0A0B5A2K3	Paracoccus_phage	1.9e-47	48.8
WP_012453333.1\|1537364_1537991_-\|tail	phage tail tape measure protein	G9JXH3	Shigella_phage	1.5e-07	67.4
WP_012453334.1\|1537977_1538220_-\|tail	phage tail assembly chaperone	NA	NA	NA	NA
WP_012453335.1\|1538216_1538543_-	gene transfer agent family protein	NA	NA	NA	NA
WP_012453336.1\|1538545_1538956_-\|tail	phage major tail protein, TP901-1 family	NA	NA	NA	NA
WP_012453337.1\|1538986_1539406_-	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_012453338.1\|1539402_1539741_-\|head,tail	head-tail adaptor protein	NA	NA	NA	NA
WP_012453339.1\|1539763_1540339_-	phiE125 gp8 family protein	NA	NA	NA	NA
WP_012453340.1\|1540372_1541119_+\|protease	trypsin-like serine protease	NA	NA	NA	NA

DBSCAN-SWA_3

3406518 : 3413887

Cronobacter_phage(16.67%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012455040.1\|3406518_3407790_-\|tRNA	tyrosine--tRNA ligase	K4F5T3	Cronobacter_phage	1.2e-53	33.2
WP_012455041.1\|3407928_3409062_+	anhydro-N-acetylmuramic acid kinase	NA	NA	NA	NA
WP_012455042.1\|3409058_3409664_+	DUF3578 domain-containing protein	NA	NA	NA	NA
WP_012455043.1\|3409668_3409956_-	putative addiction module antidote protein	A4JWV1	Burkholderia_virus	7.4e-15	45.1
WP_012455044.1\|3409952_3410255_-	type II toxin-antitoxin system RelE/ParE family toxin	A0A141GEX6	Brucella_phage	2.0e-23	57.0
WP_012455045.1\|3410387_3411488_+	chorismate synthase	A0A291AU41	Pandoravirus	6.2e-78	47.2
WP_012455046.1\|3411523_3412600_+	3,4-dihydroxy-2-butanone-4-phosphate synthase	A0A2H4PQS2	Staphylococcus_phage	1.1e-58	36.4
WP_012455047.1\|3412699_3412933_+	hypothetical protein	NA	NA	NA	NA
WP_041372038.1\|3412957_3413887_-	histone deacetylase family protein	A0A2K9KZC4	Tupanvirus	3.6e-34	32.4

DBSCAN-SWA_4

3930323 : 4073253

120

Corynebacterium_phage(11.11%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012452059.1\|3930323_3931667_+\|transposase	IS1380-like element ISMpo3 family transposase	NA	NA	NA	NA
WP_012455550.1\|3934229_3934991_-	ubiquitin-activating protein	NA	NA	NA	NA
WP_012455551.1\|3934983_3936609_-	guanylate cyclase	NA	NA	NA	NA
WP_012455552.1\|3936623_3937244_-	adenylate/guanylate cyclase domain-containing protein	NA	NA	NA	NA
WP_157228243.1\|3937459_3938335_+	thiamine biosynthesis protein ThiF	NA	NA	NA	NA
WP_012455554.1\|3938518_3940549_-	HAMP domain-containing protein	NA	NA	NA	NA
WP_012455555.1\|3940536_3941907_-	sigma-54-dependent Fis family transcriptional regulator	NA	NA	NA	NA
WP_012455556.1\|3942036_3943674_-	OFA family MFS transporter	NA	NA	NA	NA
WP_012455557.1\|3944159_3946355_+	TonB-dependent receptor	NA	NA	NA	NA
WP_012455558.1\|3946408_3946948_+	hypothetical protein	NA	NA	NA	NA
WP_012455559.1\|3946944_3947931_+	cytochrome-c peroxidase	NA	NA	NA	NA
WP_012455560.1\|3948015_3948939_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_012455561.1\|3949152_3950319_+	NAD-dependent formate dehydrogenase	NA	NA	NA	NA
WP_012455562.1\|3950406_3950910_+	HPP family protein	NA	NA	NA	NA
WP_081435406.1\|3951350_3951704_+	hypothetical protein	NA	NA	NA	NA
WP_081435407.1\|3951756_3951936_-	DUF2478 domain-containing protein	NA	NA	NA	NA
WP_017487495.1\|3951966_3952269_-	DUF2478 domain-containing protein	NA	NA	NA	NA
WP_012455563.1\|3952673_3953663_-	hypothetical protein	NA	NA	NA	NA
WP_012455564.1\|3953764_3955018_-	DUF2325 domain-containing protein	NA	NA	NA	NA
WP_012455565.1\|3955110_3955455_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_012455566.1\|3955550_3956801_-	molybdopterin molybdotransferase MoeA	NA	NA	NA	NA
WP_012455567.1\|3958031_3958829_+	molybdate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_012455568.1\|3958825_3959518_+	molybdate ABC transporter permease subunit	NA	NA	NA	NA
WP_012455569.1\|3959545_3960622_+	molybdenum ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.1e-17	33.9
WP_012455570.1\|3960781_3960991_+	TOBE domain-containing protein	NA	NA	NA	NA
WP_158022296.1\|3961304_3961667_-	hypothetical protein	NA	NA	NA	NA
WP_003596089.1\|3961980_3963189_+\|transposase	IS256-like element ISMex14 family transposase	A0A220NQR7	Corynebacterium_phage	4.9e-92	48.5
WP_012455572.1\|3963176_3964166_-	hypothetical protein	NA	NA	NA	NA
WP_012455573.1\|3964162_3965113_-	hypothetical protein	NA	NA	NA	NA
WP_012455574.1\|3965621_3966929_-	type II toxin-antitoxin system HipA family toxin	NA	NA	NA	NA
WP_012455575.1\|3966918_3967263_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_017487491.1\|3970168_3970420_-	hypothetical protein	NA	NA	NA	NA
WP_012455579.1\|3970930_3971266_-	hypothetical protein	NA	NA	NA	NA
WP_012455580.1\|3971282_3971690_-	hypothetical protein	NA	NA	NA	NA
WP_041372075.1\|3971803_3972328_-	Hsp20/alpha crystallin family protein	NA	NA	NA	NA
WP_012455541.1\|3972418_3972901_-	Hsp20 family protein	E3SM62	Prochlorococcus_phage	1.9e-18	37.2
WP_026105999.1\|3973360_3973774_-	thioredoxin TrxC	V9SJ74	Achromobacter_phage	1.0e-12	43.6
WP_012455582.1\|3974006_3975227_+	GAF domain-containing protein	NA	NA	NA	NA
WP_012455583.1\|3975395_3978020_+	ATP-dependent chaperone ClpB	A0A2I7SAX5	Vibrio_phage	5.6e-125	36.2
WP_158022297.1\|3978358_3978640_+	hypothetical protein	NA	NA	NA	NA
WP_012455584.1\|3980197_3980434_-	hypothetical protein	NA	NA	NA	NA
WP_012455585.1\|3983590_3984019_+	hypothetical protein	NA	NA	NA	NA
WP_012455586.1\|3984679_3985171_+	raiA ribosome-associated inhibitor A	NA	NA	NA	NA
WP_012452059.1\|3985566_3986910_+\|transposase	IS1380-like element ISMpo3 family transposase	NA	NA	NA	NA
WP_085985407.1\|3987078_3987833_-\|transposase	IS5 family transposase	A0A0N9SJT9	Paenibacillus_phage	1.2e-11	34.7
WP_012455588.1\|3989134_3989881_-	glutaredoxin	A0A248SKD6	Salicola_phage	4.8e-05	42.4
WP_012455589.1\|3990004_3990172_-	hypothetical protein	NA	NA	NA	NA
WP_012455591.1\|3991046_3991469_+	hypothetical protein	NA	NA	NA	NA
WP_012455592.1\|3991588_3992086_+	PRC-barrel domain-containing protein	NA	NA	NA	NA
WP_012455593.1\|3992272_3992488_+	hypothetical protein	NA	NA	NA	NA
WP_012455594.1\|3992571_3992964_+	hypothetical protein	NA	NA	NA	NA
WP_012455595.1\|3992947_3995014_+	histidine kinase	NA	NA	NA	NA
WP_012455596.1\|3995032_3995698_+	response regulator transcription factor	NA	NA	NA	NA
WP_012455597.1\|3995782_3997081_-	DUF2254 domain-containing protein	NA	NA	NA	NA
WP_012455599.1\|3997609_3998728_-\|protease	site-2 protease family protein	NA	NA	NA	NA
WP_012455600.1\|3999244_3999430_+	hypothetical protein	NA	NA	NA	NA
WP_012455601.1\|3999498_4001910_-	endopeptidase La	A0A0R6PGP8	Moraxella_phage	3.0e-149	38.9
WP_012455602.1\|4001923_4002331_-	Hsp20/alpha crystallin family protein	NA	NA	NA	NA
WP_012452059.1\|4002481_4003825_+\|transposase	IS1380-like element ISMpo3 family transposase	NA	NA	NA	NA
WP_012455603.1\|4004055_4004337_-	hypothetical protein	NA	NA	NA	NA
WP_012455604.1\|4004333_4005245_-	DnaJ domain-containing protein	A0A0P0YMJ9	Yellowstone_lake_phycodnavirus	1.7e-12	27.0
WP_012452059.1\|4005477_4006821_-\|transposase	IS1380-like element ISMpo3 family transposase	NA	NA	NA	NA
WP_012455605.1\|4007009_4007576_+	hypothetical protein	NA	NA	NA	NA
WP_012455606.1\|4007860_4008112_+	hypothetical protein	NA	NA	NA	NA
WP_012455607.1\|4008095_4008488_+	hypothetical protein	NA	NA	NA	NA
WP_012455609.1\|4008741_4009149_-	helix-turn-helix transcriptional regulator	Q8W6G2	Sinorhizobium_phage	4.1e-19	44.5
WP_012455610.1\|4009329_4009515_-	hypothetical protein	NA	NA	NA	NA
WP_153876384.1\|4009842_4010049_-	hypothetical protein	NA	NA	NA	NA
WP_012455611.1\|4011218_4011452_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_012455612.1\|4011804_4012767_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_012455613.1\|4013069_4014263_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_012455614.1\|4014389_4015265_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_012455615.1\|4015261_4017043_+	branched-chain amino acid ABC transporter ATP-binding protein/permease	A0A285PWH2	Cedratvirus	2.6e-09	29.4
WP_012455616.1\|4017042_4017780_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.4e-12	27.0
WP_012455617.1\|4017861_4018563_+	cyclase family protein	NA	NA	NA	NA
WP_012455618.1\|4018615_4020025_+	amidase	NA	NA	NA	NA
WP_012455620.1\|4021068_4022433_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_012455621.1\|4022442_4022772_+	nitrile hydratase subunit beta	NA	NA	NA	NA
WP_081435408.1\|4022768_4023398_+	hypothetical protein	NA	NA	NA	NA
WP_012455623.1\|4023331_4024342_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_003596089.1\|4024528_4025737_+\|transposase	IS256-like element ISMex14 family transposase	A0A220NQR7	Corynebacterium_phage	4.9e-92	48.5
WP_157228163.1\|4025814_4026603_+	hypothetical protein	NA	NA	NA	NA
WP_012455624.1\|4026745_4027279_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_085985411.1\|4027770_4028527_+\|transposase	IS5-like element ISMpo7 family transposase	NA	NA	NA	NA
WP_081435409.1\|4028555_4029143_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_012455626.1\|4029139_4029937_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.3e-29	31.0
WP_012455627.1\|4029948_4030260_+	nitrile hydratase subunit beta	NA	NA	NA	NA
WP_012455628.1\|4030259_4030547_+	nitrile hydratase subunit beta	NA	NA	NA	NA
WP_012455629.1\|4030539_4031196_+	nitrile hydratase subunit alpha	NA	NA	NA	NA
WP_012455630.1\|4031617_4032448_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_012455631.1\|4032707_4033376_-	hypothetical protein	NA	NA	NA	NA
WP_157228162.1\|4036673_4037431_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_026105551.1\|4037699_4039877_+	response regulator	NA	NA	NA	NA
WP_012455636.1\|4040089_4042513_+	response regulator	NA	NA	NA	NA
WP_012455637.1\|4042539_4042860_-	DUF3140 domain-containing protein	NA	NA	NA	NA
WP_012455638.1\|4042950_4043463_-	DUF892 family protein	NA	NA	NA	NA
WP_017484712.1\|4043812_4043971_+	hypothetical protein	NA	NA	NA	NA
WP_157228161.1\|4044176_4044410_-	hypothetical protein	NA	NA	NA	NA
WP_157228160.1\|4045623_4047912_-	TonB-dependent siderophore receptor	NA	NA	NA	NA
WP_012455641.1\|4049563_4050094_-	AAA family ATPase	A0A1J0GSM4	Shigella_phage	2.2e-12	34.5
WP_012455642.1\|4050105_4051071_-	hypothetical protein	NA	NA	NA	NA
WP_012455643.1\|4051048_4051864_-	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	2.0e-09	25.4
WP_012455644.1\|4051860_4052907_-	iron ABC transporter permease	NA	NA	NA	NA
WP_012455645.1\|4052903_4053749_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_017484710.1\|4053756_4055691_-	TonB-dependent receptor	NA	NA	NA	NA
WP_012455647.1\|4056563_4058789_+	TonB-dependent siderophore receptor	NA	NA	NA	NA
WP_012455648.1\|4058815_4060381_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_012455649.1\|4060377_4061316_+	ABC transporter permease	NA	NA	NA	NA
WP_157228159.1\|4061324_4062149_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_012455651.1\|4062145_4063534_+	ABC transporter ATP-binding protein	A0A285PWH2	Cedratvirus	2.0e-12	32.8
WP_012455652.1\|4064565_4065162_-	glutathione S-transferase	NA	NA	NA	NA
WP_012455653.1\|4065279_4065657_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_085985395.1\|4065874_4067057_+\|transposase	IS3-like element ISMex5 family transposase	S5WIU1	Leptospira_phage	7.3e-32	32.4
WP_012455654.1\|4067380_4068019_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_012455655.1\|4068230_4068863_+	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_012455656.1\|4068859_4069822_+	hypothetical protein	NA	NA	NA	NA
WP_012455657.1\|4069890_4070502_+	glutathione S-transferase family protein	NA	NA	NA	NA
WP_012455658.1\|4070516_4070723_+	hypothetical protein	NA	NA	NA	NA
WP_012455659.1\|4070829_4071597_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_012455660.1\|4071816_4073253_+\|transposase	IS1182-like element ISMpo6 family transposase	NA	NA	NA	NA

DBSCAN-SWA_5

4231703 : 4244029

Corynebacterium_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003596089.1\|4231703_4232912_-\|transposase	IS256-like element ISMex14 family transposase	A0A220NQR7	Corynebacterium_phage	4.9e-92	48.5
WP_052300063.1\|4233488_4233998_-\|transposase	transposase	NA	NA	NA	NA
WP_085985412.1\|4234931_4235688_+\|transposase	IS5-like element ISMpo8 family transposase	NA	NA	NA	NA
WP_041371609.1\|4236138_4237464_+\|transposase	IS701-like element ISMpo9 family transposase	NA	NA	NA	NA
WP_131801334.1\|4237849_4238299_+	hypothetical protein	NA	NA	NA	NA
WP_012455798.1\|4238503_4239307_+	hypothetical protein	NA	NA	NA	NA
WP_012452059.1\|4240535_4241879_-\|transposase	IS1380-like element ISMpo3 family transposase	NA	NA	NA	NA
WP_012452059.1\|4242685_4244029_-\|transposase	IS1380-like element ISMpo3 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NC_010727

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

11364 : 19640

Aurantimonas_phage(28.57%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012457141.1\|11364_12129_+	metallophosphoesterase	K4K650	Caulobacter_phage	2.7e-19	31.0
WP_012457142.1\|12216_12960_-	GntR family transcriptional regulator	A0A0A8IK91	Aurantimonas_phage	1.4e-12	33.0
WP_012457143.1\|13501_13792_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_012457144.1\|13784_14054_-	type II toxin-antitoxin system ParD family antitoxin	NA	NA	NA	NA
WP_012457145.1\|14312_14999_+	ParA family protein	A0A0A8IL09	Aurantimonas_phage	6.5e-41	45.8
WP_158022323.1\|14995_15364_+	stability/partitioning determinant	NA	NA	NA	NA
WP_158022324.1\|15472_15637_-	hypothetical protein	NA	NA	NA	NA
WP_012457147.1\|15792_16230_-	hypothetical protein	A0A097EYP5	Mycobacterium_phage	1.1e-12	37.3
WP_012457148.1\|16234_16816_-	recombinase family protein	E5FFF9	Burkholderia_phage	1.3e-42	50.8
WP_012457137.1\|17646_18399_-\|transposase	IS6-like element ISMpo1 family transposase	A0A0N9SKD3	Staphylococcus_phage	1.1e-30	36.8
WP_012457149.1\|18395_19640_-	ergothioneine biosynthesis protein EgtB	A0A075BUR2	Microcystis_phage	6.1e-05	36.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_010725

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NC_010727

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection