CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NC_010625	Paraburkholderia phymatum STM815 plasmid pBPHY01, complete sequence	1 crisprs	csa3	2	1
NC_010622	Paraburkholderia phymatum STM815 chromosome 1, complete sequence	2 crisprs	RT,DEDDh,csa3,cas3,DinG,WYL	0	4
NC_010623	Paraburkholderia phymatum STM815 chromosome 2, complete sequence	0 crisprs	WYL,csa3,cas3,DinG	0	1
NC_010627	Paraburkholderia phymatum STM815 plasmid pBPHY02, complete sequence	0 crisprs	RT	0	3

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_010625_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_010625_1

1671623-1671767

Orphan

Consensus_repeat	Method
TTGAGACAATAGAGTTTGACACAAAC	PILER-CR

2 spacers

The CRISPR arrays of NC_010625_1

>merge|NC_010625|1|1671623-1671767|PILER-CR
GACAATAGAGTTTGACACATCCAATCCAATGAAATCAGATACTTGCTGGCGCAAGTGATACCTAGTTGAGCGAATAGAGTTTGACACAAACACTGCTCAACTCAAATCGAGCACACCGCTTGCGACAATAGAGTTTGACACAAGC

>NC_010625|1|1|1671623-1671767|PILER-CR
GACAATAGAGTTTGACACATCCAATC	CAATGAAATCAGATACTTGCTGGCGCAAGTGATACCTAGTTGAGCG
AATAGAGTTTGACACAAACACTGCTC	AACTCAAATCGAGCACACCGCTTGCGAC
AATAGAGTTTGACACAAGC

Protein	Signature genes	Signature genes Name	Protein_function
NC_010625.1\|WP_012406171.1\|1667812_1668898_-\|biotin/lipoyl-binding-protein	unknown	unknown	gnl\|CDD\|224482
NC_010625.1\|WP_012406163.1\|1652757_1653882_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|271320
NC_010625.1\|WP_052306226.1\|1660863_1662522_+\|AMP-binding-protein	unknown	unknown	gnl\|CDD\|236359
NC_010625.1\|WP_012406177.1\|1674170_1675247_-\|type-VI-secretion-system-baseplate-subunit-TssG	unknown	unknown	gnl\|CDD\|377755
NC_010625.1\|WP_012406184.1\|1682000_1684541_-\|type-VI-secretion-system-tip-protein-VgrG	unknown	unknown	gnl\|CDD\|274542
NC_010625.1\|WP_012406179.1\|1675943_1677233_-\|type-VI-secretion-system-protein-TssL	unknown	unknown	gnl\|CDD\|236157
NC_010625.1\|WP_157686942.1\|1658726_1659923_+\|GDSL-family-lipase	unknown	unknown	gnl\|CDD\|238868
NC_010625.1\|WP_012406178.1\|1675246_1675870_-\|hypothetical-protein	unknown	unknown	unknown
NC_010625.1\|WP_012406183.1\|1681138_1681993_-\|DUF4123-domain-containing-protein	unknown	unknown	gnl\|CDD\|379225
NC_010625.1\|WP_041766415.1\|1662659_1665503_+\|AMP-binding-protein	unknown	unknown	gnl\|CDD\|341254
NC_010625.1\|WP_012406173.1\|1669595_1670732_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223650
NC_010625.1\|WP_012406170.1\|1666353_1667835_-\|efflux-transporter-outer-membrane-subunit	unknown	unknown	gnl\|CDD\|273830
NC_010625.1\|WP_012406165.1\|1655035_1658206_-\|acetoacetate--CoA-ligase	unknown	unknown	gnl\|CDD\|341265
NC_010625.1\|WP_012406174.1\|1670800_1671271_-\|universal-stress-protein	unknown	unknown	gnl\|CDD\|238182
NC_010625.1\|WP_012406180.1\|1677229_1677508_-\|PAAR-domain-containing-protein	unknown	unknown	gnl\|CDD\|269829
NC_010625.1\|WP_012406182.1\|1678571_1681142_-\|hypothetical-protein	unknown	unknown	unknown
NC_010625.1\|WP_012406176.1\|1673088_1674174_-\|type-VI-secretion-protein-ImpA	unknown	unknown	gnl\|CDD\|274544
NC_010625.1\|WP_012406172.1\|1668894_1669593_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213222
NC_010625.1\|WP_012406181.1\|1677604_1678570_-\|hypothetical-protein	unknown	unknown	unknown
NC_010625.1\|WP_012406175.1\|1671856_1673092_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NC_010625.1\|WP_012406171.1\|1667812_1668898_-\|biotin/lipoyl-binding-protein	gnl\|CDD\|224482	COG1566, EmrA, Multidrug resistance efflux pump [Defense mechanisms].	6.93369e-24
NC_010625.1\|WP_012406163.1\|1652757_1653882_-\|hypothetical-protein	gnl\|CDD\|271320	cd05819, NHL, NHL repeat unit of beta-propeller proteins. The NHL(NCL-1, HT2A and LIN-41)-repeat is found in multiple tandem copies, typically as 6 instances. It is about 40 residues long and resembles the WD repeat and other beta-propeller structures. The repeats have a catalytic activity in Peptidyl-glycine alpha-amidating monooxygenase; proteolysis has shown that the Peptidyl-alpha-hydroxyglycine alpha-amidating lyase (PAL) activity is localized to the repeats. Tripartite motif-containing protein 32 interacts with the activation domain of Tat. This interaction is mediated by the NHL repeats.	1.09075e-12
NC_010625.1\|WP_052306226.1\|1660863_1662522_+\|AMP-binding-protein	gnl\|CDD\|236359	PRK08974, PRK08974, long-chain-fatty-acid--CoA ligase FadD.	0
NC_010625.1\|WP_012406177.1\|1674170_1675247_-\|type-VI-secretion-system-baseplate-subunit-TssG	gnl\|CDD\|377755	pfam06996, T6SS_TssG, Type VI secretion, TssG. This is a family of Gram-negative bacterial proteins that form part of the type VI pathogenicity secretion system (T6SS), including TssG. TssG is homologs to phage tail proteins and is required for proper assembly of the Hcp tube in bacteria.One other member in this family, SciB (Q93IT4) from Salmonella enterica, is thought to be involved in virulence.	1.34443e-118
NC_010625.1\|WP_012406179.1\|1675943_1677233_-\|type-VI-secretion-system-protein-TssL	gnl\|CDD\|236157	PRK08126, PRK08126, hypothetical protein; Provisional.	0
NC_010625.1\|WP_157686942.1\|1658726_1659923_+\|GDSL-family-lipase	gnl\|CDD\|238868	cd01830, XynE_like, SGNH_hydrolase subfamily, similar to the putative arylesterase/acylhydrolase from the rumen anaerobe Prevotella bryantii XynE. The P. bryantii XynE gene is located in a xylanase gene cluster. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.	1.60731e-71
NC_010625.1\|WP_012406184.1\|1682000_1684541_-\|type-VI-secretion-system-tip-protein-VgrG	gnl\|CDD\|274542	TIGR03361, VI_Rhs_Vgr, type VI secretion system Vgr family protein. Members of this protein family belong to the Rhs element Vgr protein family (see TIGR01646), but furthermore all are found in genomes with type VI secretion loci. However, members of this protein family, although recognizably correlated to type VI secretion according the partial phylogenetic profiling algorithm, are often found far the type VI secretion locus.	5.90335e-118
NC_010625.1\|WP_041766415.1\|1662659_1665503_+\|AMP-binding-protein	gnl\|CDD\|341254	cd05931, FAAL, Fatty acyl-AMP ligase (FAAL). FAAL belongs to the class I adenylate forming enzyme family and is homologous to fatty acyl-coenzyme A (CoA) ligases (FACLs). However, FAALs produce only the acyl adenylate and are unable to perform the thioester-forming reaction, while FACLs perform a two-step catalytic reaction; AMP ligation followed by CoA ligation using ATP and CoA as cofactors. FAALs have insertion motifs between the N-terminal and C-terminal subdomains that distinguish them from the FACLs. This insertion motif precludes the binding of CoA, thus preventing CoA ligation. It has been suggested that the acyl adenylates serve as substrates for multifunctional polyketide synthases to permit synthesis of complex lipids such as phthiocerol dimycocerosate, sulfolipids, mycolic acids, and mycobactin.	0
NC_010625.1\|WP_012406173.1\|1669595_1670732_-\|ABC-transporter-permease	gnl\|CDD\|223650	COG0577, SalY, ABC-type antimicrobial peptide transport system, permease component [Defense mechanisms].	1.30474e-09
NC_010625.1\|WP_012406170.1\|1666353_1667835_-\|efflux-transporter-outer-membrane-subunit	gnl\|CDD\|273830	TIGR01845, Outer_membrane_protein_OprM, efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family. Members of this model comprise a subfamily of the Outer Membrane Factor (TCDB 1.B.17) porins. OMF proteins operate in conjunction with a primary transporter of the RND, MFS, ABC, or PET systems, and a MFP (membrane fusion protein) to tranport substrates across membranes. The complex thus formed allows transport (export) of various solutes (heavy metal cations; drugs, oligosaccharides, proteins, etc.) across the two envelopes of the Gram-negative bacterial cell envelope in a single energy-coupled step. Current data suggest that the OMF (and not the MFP) is largely responsible for the formation of both the trans-outer membrane and trans-periplasmic channels. The roles played by the MFP have yet to be determined. [Cellular processes, Detoxification, Transport and binding proteins, Porins].	7.98004e-101
NC_010625.1\|WP_012406165.1\|1655035_1658206_-\|acetoacetate--CoA-ligase	gnl\|CDD\|341265	cd05943, AACS, Acetoacetyl-CoA synthetase (acetoacetate-CoA ligase, AACS). AACS is a cytosolic ligase that specifically activates acetoacetate to its coenzyme A ester by a two-step reaction. Acetoacetate first reacts with ATP to form an acyl-adenylate intermediate, which then reacts with CoA to produce an acyl-CoA ester. This is the first step of the mevalonate pathway of isoprenoid biosynthesis via isopentenyl diphosphate. Isoprenoids are a large class of compounds found in all living organisms. AACS is widely distributed in bacteria, archaea and eukaryotes. In bacteria, AACS is known to exhibit an important role in the metabolism of poly-b-hydroxybutyrate, an intracellular reserve of organic carbon and chemical energy by some microorganisms. In mammals, AACS influences the rate of ketone body utilization for the formation of physiologically important fatty acids and cholesterol.	0
NC_010625.1\|WP_012406174.1\|1670800_1671271_-\|universal-stress-protein	gnl\|CDD\|238182	cd00293, USP_Like, Usp: Universal stress protein family. The universal stress protein Usp is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. Usp enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae Usp reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, athough Usp lacks ATP-binding activity.	1.35405e-28
NC_010625.1\|WP_012406180.1\|1677229_1677508_-\|PAAR-domain-containing-protein	gnl\|CDD\|269829	cd14744, PAAR_CT_2, proline-alanine-alanine-arginine (PAAR) domain with uncharacterized C-terminal extension. This domain is found in the PAAR (proline-alanine-alanine-arginine) repeat family of mostly beta- and gamma-proteobacteria, and forms a sharp conical extension on the VgrG spike, a trimeric protein complex of the bacterial type VI secretion system (T6SS). Most members contain C-terminal domain extensions corresponding to several uncharacterized domains such as S-type pyocin, DUF2235, DUF2345 and cytotoxic proteins. However, these terminal domains are exposed to solution, and do not distort the binding site of VgrG. The pointed tip of the PAAR domain is stabilized by a zinc atom positioned close to the cone's vertex and is likely to be important for its integrity during penetration of the target cell envelope. VgrG proteins are orthologous to the central baseplate spikes of bacteriophages with contractile tails, and genes encoding proteins with PAAR motifs have been frequently found immediately downstream from vgrG-like genes.	1.8786e-25
NC_010625.1\|WP_012406176.1\|1673088_1674174_-\|type-VI-secretion-protein-ImpA	gnl\|CDD\|274544	TIGR03363, VI_chp_8, type VI secretion-associated protein, ImpA family. This protein family is one of two related families in type VI secretion systems that contain an ImpA-related N-terminal domain (pfam06812).	3.47096e-37
NC_010625.1\|WP_012406172.1\|1668894_1669593_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|213222	cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein. This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of lipoproteins from the cytoplasmic membrane (LolCDE). They are clustered together phylogenetically. MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all. An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport. The LolCDE complex catalyzes the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane.	5.38847e-93
NC_010625.1\|WP_012406183.1\|1681138_1681993_-\|DUF4123-domain-containing-protein	gnl\|CDD\|379225	pfam13503, DUF4123, Domain of unknown function (DUF4123). This presumed domain is functionally uncharacterized. It is about 120 amino acids in length and contains several conserved motifs that may be functionally important. This domain is sometimes associated with the FHA domain.	1.37117e-05

>NC_010625.1|WP_012406174.1|1670800_1671271_-|universal-stress-protein
MYKQILIALDGSKTSERVLNEAVHMARLTGGKIQAVYVVDKTPLFSYAGYYDPIALVDALRKDGRITLEKAEAACRQAGVACHAELVETERLNEDVATTLQHCAERLGADLVILGTHGRRGVRRIVLGSVAERFVRFAQCPVLLVRGTEAEHGEQR
>NC_010625.1|WP_012406173.1|1669595_1670732_-|ABC-transporter-permease
MKGILRLAFKLLVNDSAKFTALIVGITFAVFLMIEMTSLFAGILNKSSSTVINVGAKMWVMDPAVQTIASSIGMPDYVLDAVRSIDGVDYAVPLYSGIALVRLRDGAYQAVTVIGLDDASLFGWPKMKAGRIEDIYAENGFIAIDDAEFVKLHNPRLGTDFELNDHRGVVVGIATVTSSGLFGTPTLYTTYKRAVQYIPSTRYTTSYILVEPKSAADIAHIKQVVASLGYVAYTKKEFMQRIAHFYKYETGLGTNILLMTAISFIVGLSISGQTFYTFILENLEKFGALKAIGAKRHELVAMILFQATFTALTGYGLGVGLCAASISLVRLRVPDYAAMITFGNLVLAFAMVVVIAASSSYLGVRRVLRIEPFDIFRG
>NC_010625.1|WP_012406172.1|1668894_1669593_-|ABC-transporter-ATP-binding-protein
MPAIAIDAHGLNKWFGEGDARTHALSDVAMQARFGEMLLIVGPSGSGKTTLLSVISGILRPDSGAVSIDGVDLWQQDDNAIADFRLKRIGFVFQEYHLFPRLTTVENVAIPLILKRRDWDDSIAEAMTWLDVVGLRNRAALPPMKLSGGEQQRVAIARAIVSQPDILILDEPTASLDGDTGRSIIDFVKHQVLNDHRCIVIVTHDSRIFDYADRVMHMEDGKLKTIDAGGGK
>NC_010625.1|WP_012406171.1|1667812_1668898_-|biotin/lipoyl-binding-protein
MKQRLLFLFAFAGFVTSIVAAWVYGIQQRPQPPVFDPASNPYAHGVYATGIVESDQPAGANVNIYPDVSGPVTRLLVHDGDSVRRGDVLLVIDDTVQRATVAQLEAQADAAQSLLDALRAQPRPETLEVASAQVGAAAASLKLAQDQFDKQKHAYEIEPKAVSRDTLDNAANGVAVARANLDVVTRQYRLTRAGAWTYDVRNQERQVAALRKAAEAASAQLGRYTLRAPADGVVLSVNAAPGAYLSPQGVYDTYARGTAPVLVLGTPPDQLAVRCYVDEILISRLPDLHGLKARMFIRGTSVQADLQFMRVQPYVTPKIQLTDQRTERVDVRVLPVIFRVVMQQPARLFPGQIVDVYIAAS
>NC_010625.1|WP_012406170.1|1666353_1667835_-|efflux-transporter-outer-membrane-subunit
MCTLLPVERRERHSVVRVARAVALAAGVVLVAACTVGPNFSRPATPRVQRYDASDALGMASGGQPQSLSPAVQMRDDWWTSFGCRAIDMAVDEALTGNVTLEHGEATLRRSEYLLRAGAGVFFPQVDARGDASRQRFSPLRTGVDAPASIFNLFTLSATVSYTLDIWGGERRQVEALAAQAEAQRYTLVATYLTLAANVVNAMIARAAYSDEIAATREMVELVREQVHITQAQVAAGASAWSAVLSLQNELATLEASLPGLEQKRIETEHLLALLAGMYPEQWSGPAVSLAEIALPGVLPQTLPSSLVRRRPDILQAEAVLHVASAEIGVATAALFPQIALSASGGVESAVLHSLGTPAGQAWSVAAGVTAPVFHGGALWFQRKAALEAYNESSAAYREVVLAAFAQVADALRALEHDSQTVAAQTRAVQAAGEALQLIKEAYRAGTVGYLQILVADGQYHQARIAWLQAIAQRLQDTVALYAALGGGLIADS
>NC_010625.1|WP_041766415.1|1662659_1665503_+|AMP-binding-protein
MNDDAVGRSSANARRLLEIVDAFAAEMSPGRHKPPPAGLGSHFERDLGLDSLARTELLNRIEKTLGVRFPLELFGQAITPGDLLRALDGRTTGRPNAPTGAIALDAPGGALDPAADAGTLVEALQWHASRRPERTHIVLLDEDAAPHAMTYAALHEAALRVSRGLRQIGVNPGDTVALMLPTGSDYFACFAGILLLGAIVVPVYPPAQSARIDDHLARHAAILSDARARVMIVPSHAFVAGVMAKARIPTLHEIVAVPQLMGEMDAEQYVPRAEDVALLQYTSGSTGTPKGVVLTHANLLANIRAMGHTALIEEHDVFVSWLPLYHDMGLIGAWFGPLYFGIPLVLMSPLTFLARPARWLHAISDYHATITAAPNFAYERCARRVDDTDLEDVDLSSLRLAFCGAEPVSAATMRAFASRFARNGFRHTALTPVYGLAENTLGLAFSEPGRGVRTDCISRVRLADSQRAAPAESPDEVLELVSCGRALPRNQIRIMDADGNEVSERAVGRIEFRSPSATRGYFQNPNLTARLIHDGWLDTGDLGYMADEELFITGRVKDLVIRAGRHFYPYELEAAVGRLPGVRTGCVAVCGTPDVETGTDRLLVIAETRATAPATLAAIRSGINEASVALLGAPPEEVALVPPHSILKTSSGKIRHAATLDLYMRSRGNLLPRPAWRQWLDIGANTLLPLGRRLRIAAGRFAYGAWCWISTMLIAIPTALIIVWHPDANRNWKIASRAARLTLRLAGISLTVRGGALFDTAQPAIYVANHASYLDGLVLLAAFPVPLGVVAKRELARAPLLGCFLRAIGVRFVERVDYRRMADDERELAKQAMSGTSLLFFPEATFVRSAGLRQFRLGAFVTACASHRPIIPVAIAGTRAVLPDGQWLPIRAAVTVTVLPAQVPSGEDMKAAARSRDAAREAIAAYCGERVLSEISPLEIPTRHDAT
>NC_010625.1|WP_052306226.1|1660863_1662522_+|AMP-binding-protein
MTRADTRNLHGAEPPVAAIDPGSVRTLSDMFELACARYARRPAFSSFNHAIEYRDVARYVRHFAEFLINEFRLERSERVALILPNGLPYVVTFFGVLDAGLVVANVNPLATPREIQIQLSTAAVSAIVVLENFAYKLDDILDENLAKAVVSVAVGDLLPPRKRAAIHFVQRVFRHSIPPTKRRYWTFSAALSRQYPGARSHAVASLDDVALLQFTGGTTGTPKCAMLTHRNLSYNIAQIRAWLGEAFCSTPQTVLTPLPLCHIFALTASLLTFVELGGHNVLVTDPRDIAGLVRTLRRTRPTALLGVNTLFHALLDAPHFRAIDWSRLRLVIGGGAAIHPSVAERWQTATGMPIIEGYGLTEASPVVCVNPTDAKHFSGSVGYPLPSTEVSIRDDDGAVLAAGSIGEVWVRGPQVMRGYWMNPDETAKAISPDGWLRTGDVGYFTPTQMLVLVDRKKDVIIVSGFKVYPSEVEAVVSALPGVTAAAAVGVPDERTGQAVKLFVAPPSAGLTAAVVLAHCRANLSAYKVPRLVEFRETLPLNELGKVLHRALM
>NC_010625.1|WP_157686942.1|1658726_1659923_+|GDSL-family-lipase
MVAFLAAACLSCGGGGSTSDVTASNGTSSVPLVGTWAVAPWVAGGPGFKNETVRQIVHTSIGGSAVRVRLSNLYGSTAVVIGNVHVALRNTGPNTIASSTRTVTFGGQQSVTLPAGASIASDPVPFEVPALADLAVSLYLPAETPSRTTGHDNSLQDVYVASGNVGADAAFSRFTTNPSGQAYYFLTNVDVQNAQATGAVVAFGASITEGRASSKNANRRWPNYLAGRLSDAGIIAGVLNEGISGNTFFTDGDGEAGLNRFDRDALGQPGVKWIIVSDDAVNNLNTPAPASAEDLIAAFQQLIARAHRVNVKVVCSTLTPFRGTPLWTPAIETTREKVNAFVLGPSSGCDAVLDQARAVSDPGDPASFLPAFNSGDNLHPNDAGMRAIADALDLSRLR
>NC_010625.1|WP_012406165.1|1655035_1658206_-|acetoacetate--CoA-ligase
MNRLYLPDATQCRRVDAGRIRVCNDQCARPATSQLATFTAALQARTGEVIDDYQSLHDFSVRDYRTFWRCFVEWSKGLEMSGRIEPVCVGDECEHACFFPRAQLNYSANLLNLSVAPANAPALTACHADGRRVHLSRGELRERVARLAHSLSKLGLRDGDRAVAVMRNDADAAVTALAVTALGATFASAAPEMGVEAMLDRFAPLGPRLLFAHTAACDFDTGMPLATKVGQLASALPTLQGLVCLDERNGLLDTVSQPVYSIGELINAGDASSFRWPRFSFNHPLFIMFSSGTTGKPKCIVHGAGGSLLEHLKEHRLHSDLRPGDRMYFHTTCAWMMWNWQLSALASGVEIVTYDGPISTIDVLWRLVANERVTVFGTSPAYLKMCEDADLAPGLQFDLGALRTIMSTGAVLYDTQFDWVRDHVKPLLLQSISGGTDILGCFVLGNPDLPVRAGEAQCKSLALDVQAWDQGARTTGIGELVCINPFPSRPLGFYGDTDGAAFHAAYFSRHPGVWTHGDLIEFSPEGTARLHGRSDGILNVRGIKIAPAEIYRVLNDIREIREAMAVEQGPSDGLADSCTQTRDKRIVLLLVLQDGASLDGRLLARIRHDLAHRASPAHVPDRVIAVEALPVTHSGKLSERAACNAVNGLPLANVAALRNPECLDAIRTHPGLRPATRTLPPPGGSREQLECHLQALWERLFGFAPVARDDNFFELGGNSLLAARLLADVQQSTGHRMPIATLLIAPTISRLAGIIRDGAPQPMSPILVPVCAGTGTPLFLVHGLSGSVMECWALVQALRSPRPVFGLQARGIDGGETAQQRIEDMAACYIDQMRTVQPDGPYSVTGYSLGGLIAFEIAQQLRRAGDQVELLCLLDPYVYERWLPWSARMHHWYGRIRGQWRKLRTVPAPRVIAYLADRLIVGADHVQMRFGHKRLRPDATTAAFPPALRQVRETLALSMTRYRPLPYDAGPILYVRATSRLDEHGDPMLLWRRVARGGLAIVEVPGSHDDLVVEPNLRIVAALLDNALANTRDRGVSACAMSSRHESHKTRGSFTA
>NC_010625.1|WP_012406163.1|1652757_1653882_-|hypothetical-protein
MNTPFLSSLRGVPANCRRNCRGRTLHSTLLLAVVAIIAWLPPETATADNVFIGDVGDNSVKAFDATSGAFSGTFVIPKSAGLKGPTGMIFTDGQLVVVNQNSGSGGSSGQRGEVLRFDGTTGTFIGKLVASSDRNAPFAPQGIVRGGPGNAFYVADLGDQSKKCANEGNVKIYDDAGAFIADLDRQGFNFEFHPRGLVYGPDGLLYVSAVGCLDSTDALYAPLTGYILRFNASTRKFVDMFASNATVPALHRPEGLVFDAKGNLWVTSFRDSGNSNDTDKILKLDGKTGRLLDTLPLWTPGSSRAFAQAILFGPGGKLFVPITGNAPDTTGQVRRCDIGTKQCDVIVQAGGVLQSPWFLIFRSTDPATLSYTGQ
>NC_010625.1|WP_012406175.1|1671856_1673092_-|hypothetical-protein
MSLPDVRRKGWEPLPQETLIAAIEANPGDGFPWIIAPRGVAPEQRINRRRMFLAFALRATMQASLNAGGPRFASLPVPVRHRAAGTHDCWNGVREEAGEDGVALWSKLEDARCSPSRLRHDLSAFSACHLGRARPDDVQLDAWATEGALVQSYWLRQGALYEPTVALHQLLAASDVASDVPLSMLRLPSPAVCITPDPSTRERAGLDAVMVFEHGNPDDPDTGRWLTFGIWKRSEAGEFRLRLQVLSANAGAGARSVDAILSGGVGEGDGDTGKDEVSRQALDYAIKVLLYLSLDSSPVIHERPYSTAPREFRGLGKRRREERLADIERLYDRYLVGPVVLPDGLSRAAGRPEGAHHELRAHWRRGHFRMQPYGPAASQRKLIFVMPTLVRADRLGDDLGESQATTGDIAL
>NC_010625.1|WP_012406176.1|1673088_1674174_-|type-VI-secretion-protein-ImpA
MSSNGKKNPQKPGSRVATHDWMAPISAGSPCGSDLEYDPEFVVLSASVAAKATAQYGDFVGTPEPVNWSDVDRDCRRLMVRSKDVRLAVLFTRCRTRLAAAAGFAEGLGLLSGWLATFPDQVHPQPAVDEDRSAALEIRMNALQALTDTDGLIADLREIALTRSTATRLQLRDVERAFAHPRPSDALTPDSVTRLLDELRMRHPEVLAGFDEALESLTAIEGWCREHLDAYAPDLGALRRMLCHVARPADSGPVHDASGDAGGAYPDSDDAALAGDLPAAVDEHEADTAPEPRASPVTGKTPDRQAALSLIREARQWFEQHEPSSPIPVLLHRAEQFVGKRYPEVVGAIPADLLEQWEREA
>NC_010625.1|WP_012406177.1|1674170_1675247_-|type-VI-secretion-system-baseplate-subunit-TssG
MERAAQDSLLFGRKLSPALLEHLQAEPWRYGFISLMRRIGADPAIDPVGTAALPDAESFRLGQRPSLIFAPREIADASVKNGKLHMRLFGLGMLGPNGPLPIHVTEIAREREEQRRDPALSNFLDIFHHRSMTLFYRAWASAQSAASLDRPEHDRFSLYVASLSGYPLRRERPWPLPAHARLSAAPHLVREARNPEGLCSALAHYFGVPVRLDEFVLHWMELAPENCCVMGEHRASSFMGSGAVIGGHVPDRQYRFRIVIGPLDIEDYHRFTPQGADLLRLIEWVRAFVSEEFDWELELQIKPHSAPSAVLGGPQQLGWSSWMGQSPSSEPVTGMCFEPERYVQQLRQNMIKQERIEP
>NC_010625.1|WP_012406178.1|1675246_1675870_-|hypothetical-protein
MYVIVAAASPERTCVVYDRTPTGPVTRGFLSLFDADLAACWMSRTGGRFYGQRASLIDPSLFRTPEGAGFALNLHVGWAAGDHQVTLGIGGEPVSVCRPLRMHNRATAFEVDNSTMYLMSTVYEGAGLFAWRETLCDLENWEHGQLARAHARVRRPLFEGGRCTLHERGAFDHGGGYRDAWDQLALFEPEAGQWHFVPRDVLKGGVS
>NC_010625.1|WP_012406179.1|1675943_1677233_-|type-VI-secretion-system-protein-TssL
MSDKAALLRGTARDTEAQSYADAAVSGQEGLPYEVPLGEPALERLTKVRSAANPLLEAARVLLRSQADIPEMDLGAKGVIPTLRQLLLDEMKTFQKLCEQTSIRRDHMIGARYCLCTALDEAVMETPWGRTGDNGVSWGTVGLATNFHEDRDGGTKIYLLVARLMQDPDQHDDLLEVIYHILSFGFEGRYRSERDGHRKHEAVRQRIYNEIMARRPPVPVELSPHARSDVPPRRQSFYDFPVWITVTVLSLILLGMWGYFKYQLVTRADDIQKQIGDIARMTPPPAPPVLHLKTLLKDEIAAGTVSVDEDAKHSAVTFRGDSMFPPGGVAVNTSMGPLIAKIAAEIVKVPGKVTVLGYTDNLPIHSHAFASNDALSAERATQVLQMLQADGVPASRLEAMGKGEADPVADNSTPQGRAQNRRVEIHVAE
>NC_010625.1|WP_012406180.1|1677229_1677508_-|PAAR-domain-containing-protein
MSLLIIRVGDSTDHGGEVITGSPTHKLGGKPIARLNDLVECPQRYPDGRPHGVNRIIEAHPTFAVGGVRVALHGHHTECGCALIGSSVGSIG
>NC_010625.1|WP_012406181.1|1677604_1678570_-|hypothetical-protein
MRYIDLSQNIYRVNRKLTDEERQNQLRQKERLDLTPFYNVSTVTLNSTYLETVDRWFIYRGVMTFGCLLFIVFPILLVLMPFFVPPWHLIPTGSDLRYMKLTFPYFLPLWAFLIWVLFKESFRWTHFPIRFNYRNRMVYVFCLDGVIRSARWDDLFFTLGRCERTAAGQRWDIRGHALKADRETVEWTFALRADGVDVQQLRHIWEFVRRYMEEGPSTVYRDVFWCHDIAAKRETYRAGLDVLYLTFNGLPISQKVLTPVFWLIAIGRSFVMKTSRIPEWPAEIEAQCAVDGFDPYQRTAVQNPDRIPTESVGAAWDQVGS
>NC_010625.1|WP_012406182.1|1678571_1681142_-|hypothetical-protein
MSASTPAFNPLAQSMATAQKCDFCEKSGLAILPVRPAVMHPNSGAPQLPAALQPVDGEGGKALTVPGQTAQYTGRVLRSGYLYLYDERGFWEKYWITDYGYFMKVPVGVPLNPAFTVGREPCDKTGHKEIAACITVKDPAHAKRIWVAFSDVEWTPRVLKLHQDESYRKRHMRGFDVNAWMGSHHAPHAQTLDSVSSVVAEYAPKSKVETFAFSPYMFRSRASTLDALLGAAKTLGPGPGALLVLNDPVAAATEIAARLSELPHKFMSKDDRVRKLNASTAILGMQQVLSEKAEETTVSASDQLDMDNEWMDDGTGGVMRNPWPQKLPELTNRDLTTASSDSWKKYLKDYDEKSRDGWQRQFQTDFDTYTKQTLIPLAEAHVAWMKSGQLANHLDCAYDDASVEVGLVYVRILTMCMQGSQQYKPCADLYYKWISGSYSEEENLLLRAIVLNQKKLRDQIKEDIKPAITWTTIGWDNLCAGFVGLADTALEKSADVLTDFLVAAGGSITKLLQEAVEGPVRHGLVAVGMASQRPVVPVELTGAYRTFRGSLIRQLIKASGIKGLGENAMQREVAQALRRLGIHGEPMSSVVPVRLMVMIDGETLKGMPKGLSKAEQAKWVASSLRTAEDIEALNLSAWRERINVDIPTSAGNAAAKAAKAFPVIGNLIAGYVQVATARSIFQSAKTTTGLAGVENWSRLLGSASLISSTAADSVKRMMEALAHSKLVAGRAAYLEEFAARLAPWAKGFGIAGALIGAVWDGIEAYQAFEKGDENLFRAYFFSALAGVGIAAAIYFGSILLAIAAAVLYLFAQYRIAALGDDKLDTWLQRCIWGTDTANRYSSSGIEMTEFGSAAGF
>NC_010625.1|WP_012406183.1|1681138_1681993_-|DUF4123-domain-containing-protein
MQSQTFSEAWDASTHLLADRFLIRDWDADLPWHEVVPDALSREAHLLPVVLELAQLDDVQRAFLQTHLVMADTRDPGPAMLLSSDLGVTALARELSRHVVVTLADASRAMLRMADPQVFVQLLWILPLPYLASLCHAARRWWIPFSGQWHELGFHERPAPQWEALPEDPSIALSNVGLINQVLRTLPEPDGLKAFWRTSQHCNQWLRTAQAEAGLAAADDCVAYARHGVVLGKLFSSHPVLASCLQGARETPGLYAQRTASMSDREWDRVIADIEEIKRKQEAA
>NC_010625.1|WP_012406184.1|1682000_1684541_-|type-VI-secretion-system-tip-protein-VgrG
MFKPLQPRTLSVASDALPLRAGEPVLIAQRVHGTEALGNLFDYRVELATRDTPTCRLSDAQPLVIPGQLIGKSLTISIEFEGKGVFVPGMPGNLGAANVGAGVRQITGLITAVSSTGSDDRRAYYELTVRPWLWMATQNSESRAYQNLNVVEVTQAILKGGQYPWPYELRLGAVGLQNNVYPPRDYVRQYWESDYAFLTRIWREWGIYYLFDGMTLVLCDSPGSHKKHHDAYDTVTYHAPDGKRIDEEHIHRLRISQQITPGDVTLNDYDYTRSLGKFDVNQSQYSKSSFDNIEQYHWGEYSQPLAGAMGLSGDPNDYDTEGAYLARVRLNALRCRRLRIYGTGNLRGLTTGKTFRLEGHPQREVNADYLVVSTSLDVRNPDEITRSAGDGVQYQCVTDFVLQPASAFFKNRLRKKPQAHAETAVVVGPANRPVWLDGYARTKVSFLWDRHSSRDENSSCWVRVGLPWHGGPHSFIAVPRIGDELTIDYHEGDPDKPYISASKVNEFNQPPFELPKNQALTGLVGSGLDGKGHNYVVTDDTPGQLQVQVASDQDYSRLSLGYITRIDYGTGRQQARGSGWELATDAWGVLRANRGMLITTEARGGAQAAAKDMGETVQRLTKARDTHESLAELAQQNNAQEQGADQSEITAALKAQNDAIRGGAKSGPNDFPEFAEAHVTIASPSGIETTTAGSTHIASGEHLALTAGEHLGMAVGKSLFATIREKLRIFVYQSGIRLIAGAGSIDIQALSDAVNVLAKLKIHQSAKRIEIWAEEELSLRGGKSYLTLNNAGIENGTPGQWQSYASTHQMPGPKSGPEDVPAAQLNVCEMSAASASSQHAAIVPLA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_010625_1	1.1\|1671649\|46\|NC_010625\|PILER-CR	1671649-1671694	46	NC_010625	Paraburkholderia phymatum STM815 plasmid pBPHY01, complete sequence	1671642-1671687	0	1.0
NC_010625_1	1.2\|1671721\|28\|NC_010625\|PILER-CR	1671721-1671748	28	NC_010625	Paraburkholderia phymatum STM815 plasmid pBPHY01, complete sequence	1671714-1671741	0	1.0

1. spacer 1.1|1671649|46|NC_010625|PILER-CR matches to NC_010625 (Paraburkholderia phymatum STM815 plasmid pBPHY01, complete sequence) position: , mismatch: 0, identity: 1.0

tccaatccaatgaaatcagatacttgctggcgcaagtgatacctag	CRISPR spacer
tccaatccaatgaaatcagatacttgctggcgcaagtgatacctag	Protospacer
**********************************************

2. spacer 1.2|1671721|28|NC_010625|PILER-CR matches to NC_010625 (Paraburkholderia phymatum STM815 plasmid pBPHY01, complete sequence) position: , mismatch: 0, identity: 1.0

actgctcaactcaaatcgagcacaccgc	CRISPR spacer
actgctcaactcaaatcgagcacaccgc	Protospacer
****************************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

661144 : 689124

Escherichia_phage(50.0%)

transposase,plate

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012405326.1\|661144_662491_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_012405327.1\|662514_663021_-	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_012405328.1\|663138_663624_-	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_012405329.1\|663702_665196_-	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_012405330.1\|665220_665754_-	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_012405331.1\|665803_668524_-	type VI secretion system ATPase TssH	A0A1C3S747	Escherichia_phage	8.1e-87	32.7
WP_012405332.1\|668948_669632_+	TagK domain-containing protein	NA	NA	NA	NA
WP_012405333.1\|669628_670495_+	virulence protein SciE type	NA	NA	NA	NA
WP_012405334.1\|670481_671033_+\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_012405335.1\|671059_672949_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_012405336.1\|672948_674037_+\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_012405337.1\|674033_675119_+	type VI secretion protein ImpA	NA	NA	NA	NA
WP_012405338.1\|675122_675779_+	hypothetical protein	NA	NA	NA	NA
WP_157686867.1\|675750_676455_+	hypothetical protein	NA	NA	NA	NA
WP_012405340.1\|676638_678783_+	type VI secretion system tip protein VgrG	NA	NA	NA	NA
WP_012405341.1\|678825_681066_+	M23 family metallopeptidase	G3BM12	Salmonella_phage	2.8e-08	29.0
WP_012405342.1\|681062_681656_+	hypothetical protein	NA	NA	NA	NA
WP_012405343.1\|681695_681950_+	hypothetical protein	NA	NA	NA	NA
WP_012405344.1\|681981_682656_+	hypothetical protein	NA	NA	NA	NA
WP_052306199.1\|682616_683600_+	peptidoglycan DD-metalloendopeptidase family protein	NA	NA	NA	NA
WP_052306200.1\|683569_684685_+	hypothetical protein	NA	NA	NA	NA
WP_157686868.1\|684867_685413_+	hypothetical protein	NA	NA	NA	NA
WP_012405346.1\|685479_686142_+	hypothetical protein	NA	NA	NA	NA
WP_012405347.1\|686268_686934_+	hypothetical protein	NA	NA	NA	NA
WP_012405348.1\|687104_688211_+\|transposase	IS5-like element ISBph2 family transposase	NA	NA	NA	NA
WP_095211895.1\|688366_689124_-\|transposase	IS5 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NC_010622

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_010622_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_010622_1

638193-638298

Orphan

Consensus_repeat	Method
CGAAGCTGCTGCTGCCGGAGCTGCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_010622_1

>merge|NC_010622|1|638193-638298|CRISPRCasFinder
CGACGCTGCCGAAGCTGCTGCTGCCGGAGCTGCCTTCTTGTGCGACTTCTTGTGCGAAACCTTCTTCGTTGCCTTGTGCGACGAAGCTGCTGCTGCCGGAGCTGCC

>NC_010622|1|1|638193-638298|CRISPRCasFinder
CGACGCTGCCGAAGCTGCTGCTGCC	GGAGCTGCCTTCTTGTGCGACTTCTTGTGCGAAACCTTCTTCGTTGCCTTGTGCGA
CGAAGCTGCTGCTGCCGGAGCTGCC

Protein	Signature genes	Signature genes Name	Protein_function
NC_010622.1\|WP_012399983.1\|643810_646111_+\|ATP-dependent-Clp-protease-ATP-binding-subunit-ClpA	unknown	unknown	gnl\|CDD\|274241
NC_010622.1\|WP_012399975.1\|633403_634423_-\|HoxN/HupN/NixA-family-nickel/cobalt-transporter	unknown	unknown	gnl\|CDD\|225911
NC_010622.1\|WP_012399974.1\|631459_633145_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173868
NC_010622.1\|WP_012399982.1\|643499_643814_+\|ATP-dependent-Clp-protease-adapter-ClpS	unknown	unknown	gnl\|CDD\|225038
NC_010622.1\|WP_012399980.1\|638814_639384_-\|pseudouridine-synthase	unknown	unknown	gnl\|CDD\|211334
NC_010622.1\|WP_012399987.1\|649162_649663_-\|lipoprotein-signal-peptidase	unknown	unknown	gnl\|CDD\|234739
NC_010622.1\|WP_012399968.1\|624954_625701_-\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225099
NC_010622.1\|WP_012399986.1\|647801_649013_-\|bifunctional-phosphopantothenoylcysteine-decarboxylase/phosphopantothenate--cysteine-ligase-CoaBC	unknown	unknown	gnl\|CDD\|235513
NC_010622.1\|WP_012399971.1\|627421_629527_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|223521
NC_010622.1\|WP_012399973.1\|630419_631430_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223674
NC_010622.1\|WP_007586257.1\|642760_642967_-\|cold-shock-domain-containing-protein-CspD	unknown	unknown	gnl\|CDD\|224197
NC_010622.1\|WP_012399969.1\|625880_626726_+\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381364
NC_010622.1\|WP_012399984.1\|646212_646659_-\|dUTP-diphosphatase	unknown	unknown	gnl\|CDD\|234802
NC_010622.1\|WP_012399972.1\|629523_630423_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224094
NC_010622.1\|WP_012399985.1\|646723_647728_-\|LLM-class-flavin-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|274646
NC_010622.1\|WP_012399976.1\|634451_634937_-\|cupin-domain-containing-protein	unknown	unknown	gnl\|CDD\|380340
NC_010622.1\|WP_012399977.1\|635153_637259_-\|elongation-factor-G	unknown	unknown	gnl\|CDD\|234569
NC_010622.1\|WP_012399981.1\|639715_640972_+\|NADP-dependent-isocitrate-dehydrogenase	unknown	unknown	gnl\|CDD\|180792
NC_010622.1\|WP_012399978.1\|637526_638042_-\|DUF192-domain-containing-protein	unknown	unknown	gnl\|CDD\|376876
NC_010622.1\|WP_012399988.1\|649662_652500_-\|isoleucine--tRNA-ligase	unknown	unknown	gnl\|CDD\|235588

Protein	Function_ID	Function_description	E-value
NC_010622.1\|WP_012399983.1\|643810_646111_+\|ATP-dependent-Clp-protease-ATP-binding-subunit-ClpA	gnl\|CDD\|274241	TIGR02639, ATP-dependent_Clp_protease_subunit, ATP-dependent Clp protease ATP-binding subunit clpA. [Protein fate, Degradation of proteins, peptides, and glycopeptides].	0
NC_010622.1\|WP_012399975.1\|633403_634423_-\|HoxN/HupN/NixA-family-nickel/cobalt-transporter	gnl\|CDD\|225911	COG3376, HoxN, High-affinity nickel permease [Inorganic ion transport and metabolism].	2.82009e-130
NC_010622.1\|WP_012399974.1\|631459_633145_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|173868	cd08503, PBP2_NikA_DppA_OppA_like_17, The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	4.4052e-160
NC_010622.1\|WP_012399982.1\|643499_643814_+\|ATP-dependent-Clp-protease-adapter-ClpS	gnl\|CDD\|225038	COG2127, COG2127, Uncharacterized conserved protein [Function unknown].	2.23073e-43
NC_010622.1\|WP_012399980.1\|638814_639384_-\|pseudouridine-synthase	gnl\|CDD\|211334	cd02566, PseudoU_synth_RluE, Pseudouridine synthase, Escherichia coli RluE. This group is comprised of bacterial proteins similar to E. coli RluE. Pseudouridine synthases catalyze the isomerization of specific uridines in an RNA molecule to pseudouridines (5-ribosyluracil, psi). No cofactors are required. Escherichia coli RluE makes psi2457 in 23S RNA. psi2457 is not universally conserved.	3.38274e-82
NC_010622.1\|WP_012399987.1\|649162_649663_-\|lipoprotein-signal-peptidase	gnl\|CDD\|234739	PRK00376, lspA, lipoprotein signal peptidase.	4.1339e-68
NC_010622.1\|WP_012399968.1\|624954_625701_-\|GntR-family-transcriptional-regulator	gnl\|CDD\|225099	COG2188, PhnF, Transcriptional regulators [Transcription].	4.9897e-75
NC_010622.1\|WP_012399986.1\|647801_649013_-\|bifunctional-phosphopantothenoylcysteine-decarboxylase/phosphopantothenate--cysteine-ligase-CoaBC	gnl\|CDD\|235513	PRK05579, PRK05579, bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated.	0
NC_010622.1\|WP_012399971.1\|627421_629527_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|223521	COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	6.5111e-126
NC_010622.1\|WP_012399973.1\|630419_631430_-\|ABC-transporter-permease	gnl\|CDD\|223674	COG0601, DppB, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	2.5883e-102
NC_010622.1\|WP_007586257.1\|642760_642967_-\|cold-shock-domain-containing-protein-CspD	gnl\|CDD\|224197	COG1278, CspC, Cold shock proteins [Transcription].	2.00014e-38
NC_010622.1\|WP_012399969.1\|625880_626726_+\|aldo/keto-reductase	gnl\|CDD\|381364	cd19138, AKR_YeaE, Escherichia coli YeaE and similar proteins. Escherichia coli YeaE is the prototype of this family. It acts as an aldo-keto reductase (AKR) that catalyzes the reversible reduction of ketones to the respective alcohols using NAD(P)H as a hydride donor.	2.35665e-158
NC_010622.1\|WP_012399984.1\|646212_646659_-\|dUTP-diphosphatase	gnl\|CDD\|234802	PRK00601, dut, dUTP diphosphatase.	4.04916e-98
NC_010622.1\|WP_012399972.1\|629523_630423_-\|ABC-transporter-permease	gnl\|CDD\|224094	COG1173, DppC, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	1.50087e-84
NC_010622.1\|WP_012399985.1\|646723_647728_-\|LLM-class-flavin-dependent-oxidoreductase	gnl\|CDD\|274646	TIGR03558, oxido_grp_1, luciferase family oxidoreductase, group 1. The Pfam domain family pfam00296 is named for luciferase-like monooxygenases, but the family also contains several coenzyme F420-dependent enzymes. This protein family represents a well-resolved clade within family pfam00296 and shows no restriction to coenzyme F420-positive species, unlike some other clades within pfam00296. [Unknown function, Enzymes of unknown specificity].	8.34259e-151
NC_010622.1\|WP_012399976.1\|634451_634937_-\|cupin-domain-containing-protein	gnl\|CDD\|380340	cd02210, cupin_BLR2406-like, Bradyrhizobium japonicum BLR2406 and related proteins, cupin domain. This family includes bacterial and fungal proteins homologous to BLR2406, a Bradyrhizobium japonicum protein of unknown function with a cupin beta barrel domain. Proteins in this subfamily appear to align closest to RmlC carbohydrate epimerase which is involved in dTDP-L-rhamnose production, and belong to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold capable of homodimerization.	1.99564e-52
NC_010622.1\|WP_012399977.1\|635153_637259_-\|elongation-factor-G	gnl\|CDD\|234569	PRK00007, PRK00007, elongation factor G; Reviewed.	0
NC_010622.1\|WP_012399981.1\|639715_640972_+\|NADP-dependent-isocitrate-dehydrogenase	gnl\|CDD\|180792	PRK07006, PRK07006, isocitrate dehydrogenase; Reviewed.	0
NC_010622.1\|WP_012399978.1\|637526_638042_-\|DUF192-domain-containing-protein	gnl\|CDD\|376876	pfam02643, DUF192, Uncharacterized ACR, COG1430. Two structures have been solved for members of this large (>500 members) family of bacterial proteins present mostly in environmental bacteria and metagenomes (distant homologs are also present in several Plasmodium species). TOPSAN analysis for Structure 3pjy shows that there is much similarity with the other solved structure, Structure 3m7a, solved for UniProt:Q2GA55 (Saro_0823), a homolog of Thermotoga maritima TM1668, UniProt:Q9X1Z6., The homolog in Caulobacter crescentus (CC1388), UniProt:Q9A8G6, is associated with CspD, a cold shock protein (CC1387), UniProt:Q9A8G7. However, the genomic context of UniProt:Q2GA55 is most conserved with a putative xylose isomerase, suggesting a possible role in extracellular sugar processing. Saro_0821, UniProt:Q2GA57, is annotated as an AMP-dependent synthetase and ligase. Structure 3m7a structure corresponds to the C-terminal (27-165) fragment of the YP_496102 (Saro_0823) protein and it is structurally unique, as the best hits from Dali have a Z-score of 3.8 (1nt0, 2j1t, 3kq4) and it is thus a likely candidate for a new fold. Interestingly, many of the top Dali hits are involved in sugar metabolism. There are no obvious active site-like cavities on the protein surface of 3m7a (http://www.topsan.org/Proteins/JCSG/).	9.25579e-43
NC_010622.1\|WP_012399988.1\|649662_652500_-\|isoleucine--tRNA-ligase	gnl\|CDD\|235588	PRK05743, ileS, isoleucyl-tRNA synthetase; Reviewed.	0

>NC_010622.1|WP_012399978.1|637526_638042_-|DUF192-domain-containing-protein
MRFSLRSLIARLAIAVALPVAALSAVSFAAMSAQDAYAQQMPQGAKQPGDFPRAKLTAGMFVIDAAVAASDADREQGLMYRTQLAPNEGMLFVFGENAVHCFWMKNTLIPLSIAFMRADGTITDIDEMQAETTNNHCPKNNGVYALEMSKGWFTSKGIKPGMKIQGLPAPQ
>NC_010622.1|WP_012399977.1|635153_637259_-|elongation-factor-G
MPRKTPIERYRNIGISAHIDAGKTTTTERILFYTGVTHKIGEVHDGAATMDWMEQEQERGITITSAATTAFWKGMAGNYPEHRINIIDTPGHVDFTIEVERSMRVLDGACMVYDSVGGVQPQSETVWRQANKYKVPRIAFVNKMDRVGADFFRVQKQIGERLKGVAVPIQIPIGAEEHFQGVVDLVKMKAIVWDDESQGIKFTYEEIPDNLKELAHEWREKMVEAAAEASEEMLEKYLTDHESLTEEEIKTGLRKRTIANEIVPMLCGSAFKNKGVQAMLDAVIDYLPSPIDVPAILGHTEDDKEAERHPSDDEPFSALAFKIMTDPFVGQLIFFRVYSGVVESGDTVYNPVKEKKERLGRILQMHANERKEIKEVRAGDIAAAVGLKEATTGDTLCDPNNIIILERMIFPEPVISQAVEPKTKADQEKMGIALNRLAQEDPSFRVQTDEESGQTIISGMGELHLEILVDRMKREFGVEATVGKPQVAYRETVRTKVEDIEGKFVKQSGGRGQYGHAVITLEPVPGKGYEFIDAIKGGVIPREFIPAVDKGIQETLKAGVLAGYPVVDVKVTLTFGSYHDVDSNENAFRMAGSMAFKEAMRKAKPVLLEPMMAVEVETPEDFMGNVMGDLSGRRGIVQGMEDIAGGGGKLVRAEVPLSEMFGYSTSLRSLTQGRATYTMEFKQYAETPNNVSEAIINSKSK
>NC_010622.1|WP_012399976.1|634451_634937_-|cupin-domain-containing-protein
MSQDNEQPIDWRINGVKVIKGNQLDTNTPQTPGMNRAAAINAARVGAQKIWAGTVTIHPNAKTGAHHHGALESVIYVVRGHARMRWGEHLEFTAEAGPGDFIFVPPYVPHQEINASTDDPLECVLVRSDNEAVVVNLNIDAVEQPETVYWVDPIHRHPHDH
>NC_010622.1|WP_012399975.1|633403_634423_-|HoxN/HupN/NixA-family-nickel/cobalt-transporter
MTPSLSLRSRLVALYAGLIAANLAAWAWALIALRHYPLLLGTALLAYGFGLRHAVDADHIAAIDAVTRKLMQEGKRPLGVGLAFSLGHSTIVLAATVGIALTALSLHGRFEAFHAVGGTIGTIVSSVFLLVLAGVNLVILRDVWRRYRHVQQGGQLTHDDAARSAPGGLLSRALKPLFKLVTNSWHMYPVGVLFGLGFDTATEVGLLAIAAAEAGKGLPLYSILVFPALFTAGMTLVDSTDNVLMVHAYSWAMDDPKRKLYYNASITFVSAVVAIAIGGIEALDLLADKLRLSGSAWDAVAAVNERFGMLGYGIVSVCMLCWFGSILLHRWRRPAAATR
>NC_010622.1|WP_012399974.1|631459_633145_-|ABC-transporter-substrate-binding-protein
MKNSADPRFAPRLAGSVDLEAARVGADAHGNHAIDEFLAGRLTRRELLRYASVIGMSLAGGSLLAPRSARAQGAAGANATIRVAHLTPAGAVDPMTVTDAASLCLLNQTGEFLIDDDGEKQTLKPALALSWKPNDKGDVWTFKLRENVKFHDGQTFTAKDVAATFDRLADPAAGSAALSTLKGVLSKGNTKVVDDHTVAFHLDAPNGNFPYYVSSDNYNAVILPANYAGNYEKTFIGTGPFKLEKYQAKVGASFVRNPDYWGDKALPQRVQFTFYADQQAQILALQGHQADVMGTFTVQGGQGLMNNPEFKVIGVKSSAHRQIHMRVDSPQFKDKRVRQALALSLDREVIVKGLFKGRAQVGNDSPFAPAFPSSDAGVAQRKIDVAKAKQLLAQAGVPNGFDATLTTEKYMEIPDLAVVVQNYAKAVGIRINLKVESQSQYYGSGTPGKSDWLDSPLGITDYGSRGVPNVFLSAPLTSGGTWNAAHFKNPQYDKLVADYVAALDIAGQKKVSAQIQTLLLDETPVIFPFFYDQLIAARKQLNGVRFTAIAQLYFDRATLAG
>NC_010622.1|WP_012399973.1|630419_631430_-|ABC-transporter-permease
MSTTVSSSVARGSGSSAARIARFVATRVGLSLITLWLLSVIVFAGGQLLPGDIGRAILGPLADARAVAALNHQLGADRPLLAQYTQWIIHFVQGDMGVSFVFREPVAQFVGNALANSAKLGLLAFAVVVPLGIAGGVWAAMHAGRWLDRTISIAGLSATVVPEFVSSIVLILVFGVWLQWLPIDASYPPGSGILTQLKHLVLPVLPLVFVFFGYIARMARAGTVEALDADYTRTAILKGLPPHIVIFRHVLRNALLPTITVAATQLGYMIGGLVVVETLFHYQGIGSLIYNAAKAKDFPMLEAGVLTIGVVYTVANLIADGLYVLLNPRLRVRSAE
>NC_010622.1|WP_012399972.1|629523_630423_-|ABC-transporter-permease
MSASTSSTPPTPQTPAAPSTPRARDSRHDVLRALMRSPTFVVGALIVLWWIVCAIAGVWVAPLDPYASDPLNSLTPPAHGHWFGTDQLGRDVLSRVIVGARDILTIAPLATLLGTLAGTALGLVVGYFDGWVDNVVGRAIDAVLALPLVIVALLALAAVGASNFTVILVIGITFTPITARTVRAAVFAERHLDYVAAAQLRGENAFYIMFAEILPNVLPPIIVEATVRLGYAIFAVATLSFLGFGIQPPSADWGLALSESYTLMAGGAWWTVVFDAAAIASLVVGVNLIADAVQGAVDV
>NC_010622.1|WP_012399971.1|627421_629527_-|ABC-transporter-ATP-binding-protein
MNGPSPPPPPASFPAFDVSKSEQSDALTIVGLTVAYRTRGRERDVLQDVSFRIRRGESYGLVGESGCGKSTVAMATLRYLARNGRVKAGRVSIAGKDVNALDAAALRALRANSISMVYQDPSRALNPSLTVARQVAEAFEAAGAVHEAALRQTVEILRKVRIAEPERVMDSYPHQLSGGMQQRVVIAMALASKPALLILDEPTTGLDATVEAEVLDLVAQLREEFHTAVLFISHNLAVIGRMCERVGVLYAGKLVEEGATQDVFGRPRHPYTVGLLRCLPTVGRSKDTDRLDTIAGSLPQPGSVTQGCVYLERCRLADDRCRREAPPPYRVSAQHGDQMSRCHYHERAVELPRVTPVAPPANGRIAYDASPVLRAQNVSKTFHVNGSALRAVDDVSLEVAKGETLGLVGESGSGKTTLAKLLLGLVSPDAGSVLELDGAPLPPRVTHRNDDQVKSLQIVFQNPDSALNRAHSVRRLIGRALSRLSALRGDAREARLASLTQAVRLPDRYLTSRTRQLSGGLKQRVAIARAFAGDPRIVVCDEPTSALDVSVQAAILNLLAELQRDRGVSYVFISHDLNVVRYLSDRIAVLYVGRLLEIGPAAAVFDGPHHPYTEALLSSVPTLDLHDGETPGSARTQRIHLSGELPSPASPPSGCVFQTRCPRKLGAICEQQDPPYAEAGDGHRIRCHIPVDELRKLQRHT
>NC_010622.1|WP_012399969.1|625880_626726_+|aldo/keto-reductase
MTNDIASVTLPDGERIPKLGQGTWEMGENPSRRKAEIDALRGGIELGMTLIDTAEMYGEGATESLLGEALHGLRDEVFLVSKVYPHNASRRGVQHACEQSLRRLKTDRIDLYLLHWRGSVPLEETVAGFEALRRDGKIRHWGVSNFDVDDMEELVGVTDGDACATNQILYNVARRGPEFDLLPWLAARKMPAMAYSPVDHARLPKRSPLDDIAGRLGVSAVQVALAWVLRQPDVLAIPKSGRIEHVRDNRRALELPLSADDLAAIDAHFRAPRSKRPLEML
>NC_010622.1|WP_012399968.1|624954_625701_-|GntR-family-transcriptional-regulator
MNPVSEDRWRDLRPDPENDTPLYLQLARKLGTAIHENRWNAGEALPSERVLSDALGVSRITARKAIALLVEQGLIRRSQGAGSFITPRYEDPLSRLSSFSEMLRRRGFTPSSQWLSREIVPANRDEVIQLGLSPAAAVTRLRRLRLADGIVMAVENSTFPASVIPDPQAIGDSLYSYLEQRGLTIVRALQHFRAVNASDEIAQQMSIAPNDALLLITRVGYTADQRAIELTDTYCRNDYYDFVAELRK
>NC_010622.1|WP_012399980.1|638814_639384_-|pseudouridine-synthase
MTLLALNKPFGTICQFSPHETRASLADWVKVPGVYPAGRLDSDSEGLLLLTDDGTLQARIAEPRHKLVKRYWAQVEGAPTEQHLEALARGVDLGDYVTRPCRAGFVEPGQALWDRTPPIRYRAAIPTTWIELSITEGKNRQVRRMTAAVGFPTLRLVRVGVGALDIFSLGLQPGESIGLSPRAPWDGVT
>NC_010622.1|WP_012399981.1|639715_640972_+|NADP-dependent-isocitrate-dehydrogenase
MAYQHITVPADGDKITVNADFSLNVSDQPIIPYIEGDGTGVDITPVMIKVVDAAVEKAYGGKKKIHWMEIFAGEKATRVYGPDVWLPDETLEVVKEYIVSIKGPLTTPVGGGIRSLNVTLRQELDLYVCLRPVQYFKGVPSPLREPEKVNMVIFRENSEDIYAGIEWPAGSPEAKKVIQFLRDEMGVKKIRFPDSSGIGVKPVSREGTERLVRKAIQYALDNDRRTVTLVHKGNIMKYTEGAFRDYGYALAQKEFNAELIDGGPWMKVKNPKTGNDVVVKDVIADAFLQQILLRPAEYDVIATLNLNGDYISDALAAQVGGIGIAPGANMSDSVAMFEATHGTAPKYAGKDYVNPGSEILSAEMMLRHLGWTDAADRILASMEKSILSKRVTYDFARLMEGATQVSCSGFGQVMIENM
>NC_010622.1|WP_007586257.1|642760_642967_-|cold-shock-domain-containing-protein-CspD
MATGTVKWFNDAKGFGFITPDEGGEDLFAHFSAIQMNGFKTLKEGQKVSFEVVQGPKGKQASNIQSAA
>NC_010622.1|WP_012399982.1|643499_643814_+|ATP-dependent-Clp-protease-adapter-ClpS
MAIIPDKQDNTVLERQEQKLKPPAMFKVVLLNDDFTPMEFVVMIVQEYFNKDRETATQIMLKVHREGRGVCGVYTRDIASTKVEQVVTHARQAGHPLQCVMEEA
>NC_010622.1|WP_012399983.1|643810_646111_+|ATP-dependent-Clp-protease-ATP-binding-subunit-ClpA
MIAQELEVSLHMAFMEARQARHEFITVEHLLLALLDNPTAAEVLRACAANIEDLRQNLRNFIHDNTPTVPGTDDVDTQPTLGFQRVIQRAIMHVQSTSNGKKEVTGANVLVAIFGEKDSHAVYYLQQQGVTRLDVVNFISHGIAKTNSSEAAKSTDANAESDEAAAQKETPLAQFTQNLNQMAKDGRIDPLIGREAEVERVVQVLCRRRKNNPLLVGEAGVGKTAIAEGLAWRITRGEVPDILVDAQVYSLDMGALLAGTKYRGDFEQRLKTVLKELKERPNAILFIDEIHTLIGAGAASGGTLDASNLLKPALSSGTLKCIGATTFTEFRGIFEKDAALSRRFQKIDVTEPTVEQTVAILRGLKSRFEEHHGVKYSSGALSAAAELSARFITDRHLPDKAIDVIDEAGAAQRILPKSKQKKTIGKSEIEEIISKIARVPAQSVSQDDRSKLQTLDRDLKAVVFGQDPAIDALSASIKMARAGLGKTDKPIGAFLFSGPTGVGKTEVARQLAFTLGIELIRFDMSEYMERHAVSRLIGAPPGYVGFDQGGLLTEAVTKKPHCVLLLDEIEKAHPDIYNVLLQVMDHGTLTDNNGRKADFRNVIIIMTTNAGAESMQKSTIGFTTRRETGDEMADIKRMFTPEFRNRLDATISFRSLDEEIIMRVVDKFLMQLEDQLHEKKVDALFTDALRKHLAKHGFDPLMGARPMQRLIQDTIRRALADELLFGKLMNGGRVTVDVDADDKVQLTFDENSAPPRNPNPEAVEVD
>NC_010622.1|WP_012399984.1|646212_646659_-|dUTP-diphosphatase
MKLDIKILDPRMREQLPAYATTGSAGLDLRACLDAPLTLEPGQTVLVPTGLAIHLADPGYAALILPRSGMGHKHGIVLGNLVGLIDSDYQGQLMISTWNRGTTTFTLNPMERLAQLVIVPVVQATFNIVDEFDTSERGEGGFGSTGKH
>NC_010622.1|WP_012399985.1|646723_647728_-|LLM-class-flavin-dependent-oxidoreductase
MTLLSVLDQTPVIDGHTVTDAIAATVELAQLADDLGYTRYWCAEHHGLYGVSNPCPEVMLARLGSVTRRIRIGSGGIMLPYYSPFKIAEQFMMLEALFPNRVDLGVGRAPGGDMRTAQAVAAGAYNRGELFPQQVTDLVALMDGTLPSDHLAHGVLLQPQIDTRPQLWVLGSSDFGGMLAAQLGIRFSFAHFINAHFGHAVAHAYRERFKPGHEPKPYLAAAVFVICADTEQEAADLEKAVDLRRVQMAYGLNAPIPSVAQGLAQEYGEREQLIIDREKPRSIIGTPESVTERLHALQEQFVADELIVLTVAGSYRARLRSYELLAGAFDLGKS
>NC_010622.1|WP_012399986.1|647801_649013_-|bifunctional-phosphopantothenoylcysteine-decarboxylase/phosphopantothenate--cysteine-ligase-CoaBC
MATELAGKHIVLGMTGGIACYKIAELTRLLVKAGATVQVAMTEAATQFITPVTMQALSGRPVYTSQWDARIANNMPHIDLSREADAIVIAPASTDFLARLAHGLCDDLLSALCIARDCPLLVVPAMNRQMWMNPATQRNVAQLRADGIELLGPDSGAQACGEVGDGRMLEPEAVYEAIAAFFTPKTLTGRRVLLTAGPTFEPLDPVRGITNRSSGKMGFALARAAQQAGANVHLVAGPVGLETPWGVYREDVQTAQQMHDAVMRAVPGYDIFIGVAAVADWRVDHVAEHKIKKTADRAIPSFSFVENPDILAAVAKLPHPPFCVGFAAESGDLDVHGEEKRKRKNVPLLIGNLGPQTFGLDHNEVVLFEAAGTTRLPRADKQTLARALIAEIAKRLPDASVTG
>NC_010622.1|WP_012399987.1|649162_649663_-|lipoprotein-signal-peptidase
MSRTLSKPAGGSLAPWLGVAVIVILFDQLTKIAVAKVFAYGSSHAIAPFFNLVLVYNRGAAFSFLAMAGGWQRWAFTALGVAAAVLICYLLKRHGTQKMFCTALALIMGGAIGNVIDRLLYGHVIDFLDFHVGAWHWPAFNLADSAITIGAALLVFDELRRVRGAR
>NC_010622.1|WP_012399988.1|649662_652500_-|isoleucine--tRNA-ligase
MSNKKADSKPQARYPVNLLDTPFPMRGDLPRREPQWVKDWQERKIYEKIRAASKGRKKFILHDGPPYANGDIHLGHAVNKILKDMIVKARNLAGFDAVYVPGWDCHGMPIEIQIEKQFGKSLPAAEVMQKARAYATEQIEKQKAGFRRLGVLGDWDNPYKTMNFANEAGEIRALAKIMEKGYVFRGLKPVNWCFDCGSALAEAEVEYKDKTDPTIDVMFTFADPEKTAHAFGLAALPRNEGGIVIWTTTPWTIPANQALNLHPEIVYALVDTPRGLLILAEERVEACLKSYGIAGTVIATAPGAKLANLRFNHPLASAHPSYKRTSPVYLGDYVTTETGTGIVHSSPAYGVEDFISCKTHGMADSDILSPVMGDGRYIESLALFGGLSIWDANPKIVEALDEAGTLLRTEKYLHSYMHCWRHKTPIIYRATSQWFAGMDIKPNDSDKTLRETALEGIEATAFYPSWGKQRLFAMIANRPDWTLSRQRQWGVPMAFFVHKETGELHPRTLELLEEVAKRVEVSGIEAWQTLDPRELIGDDANMYEKNRDTLDVWFDSGTTHWHVLRGSHKDELQFPADLYLEGSDQHRGWFHSSLLTASMLDGRPPYNALLTHGFTVDGEGRKMSKSLGNGIDPHEVSNRLGAEIIRLWIASTDYSGELAISEEILKRVTESYRRIRNTLRFLLANLSDFDIGKHARPVGEWLEIDRYAVALTANLQADILSHYDRYEFHPVVAKLQTFCSEDLGGFYLDVLKDRLYTTAADSKARRSAQTALYHIAHGLLRLMAPFLSFTAEEAWKVFQPQSETIYTETYHAYPDVPEASTLLDKWTLLRAVRSDVTKALEEARVANQIGSSLQAEVEIRAAGARHDALASLGADLKFVLITSGATVVKVDSVDEEGVDVITSKYLKCERCWHYRKDVGESAEHPTLCGRCISNLFGNGETRSAA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_010622_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_010622_2

1535750-1535853

Orphan

Consensus_repeat	Method
GGCGGCAACCGCGAAGGCGGCTA	CRISPRCasFinder

2 spacers

The CRISPR arrays of NC_010622_2

>merge|NC_010622|2|1535750-1535853|CRISPRCasFinder
GGCGACAAGCCGGCAGGCGGCAACCGCGAAGGCGGCTACAACAGCGGCTCGCGTGAAGGCGGCTATCGGAGCGAAGGCTATCGCGGCAACCGCGAAGGCGGCTA

>NC_010622|2|2|1535750-1535853|CRISPRCasFinder
GGCGACAAGCCGGCAGGCGGCAA	CCGCGAAGGCGGCTACAAC
AGCGGCTCGCGTGAAGGCGGCTA	TCGGAGCGAAGGCTAT
CGCGGCAACCGCGAAGGCGGCTA

Protein	Signature genes	Signature genes Name	Protein_function
NC_010622.1\|WP_012400766.1\|1538380_1539283_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NC_010622.1\|WP_012400765.1\|1537708_1538143_-\|universal-stress-protein	unknown	unknown	gnl\|CDD\|366180
NC_010622.1\|WP_012400770.1\|1542509_1543004_-\|ribonuclease-E-activity-regulator-RraA	unknown	unknown	gnl\|CDD\|236487
NC_010622.1\|WP_041763400.1\|1526498_1527569_-\|alanine-racemase	unknown	unknown	gnl\|CDD\|143500
NC_010622.1\|WP_012400772.1\|1544111_1544576_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NC_010622.1\|WP_012400757.1\|1529175_1529982_+\|bifunctional-hydroxymethylpyrimidine-kinase/phosphomethylpyrimidine-kinase	unknown	unknown	gnl\|CDD\|180561
NC_010622.1\|WP_012400769.1\|1542049_1542457_-\|gamma-glutamylcyclotransferase	unknown	unknown	gnl\|CDD\|377602
NC_010622.1\|WP_012400753.1\|1524644_1524908_-\|DUF2866-domain-containing-protein	unknown	unknown	gnl\|CDD\|378547
NC_010622.1\|WP_012400758.1\|1530010_1531027_-\|DUF1853-family-protein	unknown	unknown	gnl\|CDD\|378094
NC_010622.1\|WP_012400773.1\|1545636_1547046_-\|glutamate--tRNA-ligase	unknown	unknown	gnl\|CDD\|234953
NC_010622.1\|WP_012400762.1\|1533535_1533805_+\|acyl-CoA-binding-protein	unknown	unknown	gnl\|CDD\|226731
NC_010622.1\|WP_012400759.1\|1531023_1532049_-\|uracil-DNA-glycosylase	unknown	unknown	gnl\|CDD\|381680
NC_010622.1\|WP_012400768.1\|1540299_1541892_+\|malate-synthase-A	unknown	unknown	gnl\|CDD\|236432
NC_010622.1\|WP_041763825.1\|1543208_1544042_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380379
NC_010622.1\|WP_012400764.1\|1536280_1537585_+\|isocitrate-lyase	unknown	unknown	gnl\|CDD\|237893
NC_010622.1\|WP_012400761.1\|1532526_1533366_-\|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-dimerization-subunit-type-1-TsaB	unknown	unknown	gnl\|CDD\|274750
NC_010622.1\|WP_012400760.1\|1532035_1532530_-\|ribosomal-protein-S18-alanine-N-acetyltransferase	unknown	unknown	gnl\|CDD\|273701
NC_010622.1\|WP_012400767.1\|1539437_1540226_+\|haloacid-dehalogenase-type-II	unknown	unknown	gnl\|CDD\|130495
NC_010622.1\|WP_012400756.1\|1527788_1529096_+\|lysophospholipid-transporter-LplT	unknown	unknown	gnl\|CDD\|236879
NC_010622.1\|WP_012400754.1\|1525047_1526424_-\|DNA-repair-protein-RadA	unknown	unknown	gnl\|CDD\|236994

Protein	Function_ID	Function_description	E-value
NC_010622.1\|WP_012400766.1\|1538380_1539283_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	2.2213e-92
NC_010622.1\|WP_012400765.1\|1537708_1538143_-\|universal-stress-protein	gnl\|CDD\|366180	pfam00582, Usp, Universal stress protein family. The universal stress protein UspA is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. UspA enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae UspA reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, though UspA lacks ATP-binding activity.	7.67185e-31
NC_010622.1\|WP_012400770.1\|1542509_1543004_-\|ribonuclease-E-activity-regulator-RraA	gnl\|CDD\|236487	PRK09372, PRK09372, ribonuclease E inhibitor RraA.	6.52853e-90
NC_010622.1\|WP_041763400.1\|1526498_1527569_-\|alanine-racemase	gnl\|CDD\|143500	cd06827, PLPDE_III_AR_proteobact, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes, Proteobacterial Alanine Racemases. This subfamily is composed mainly of proteobacterial alanine racemases (EC 5.1.1.1), fold type III PLP-dependent enzymes that catalyze the interconversion between L- and D-alanine, which is an essential component of the peptidoglycan layer of bacterial cell walls. hese proteins are similar to other bacterial ARs and are fold type III PLP-dependent enzymes containing contains an N-terminal PLP-binding TIM-barrel domain and a C-terminal beta-sandwich domain. They exist as homodimers with active sites that lie at the interface between the TIM barrel domain of one subunit and the beta-sandwich domain of the other subunit. Homodimer formation and the presence of the PLP cofactor are required for catalytic activity.	0
NC_010622.1\|WP_012400772.1\|1544111_1544576_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	5.23493e-12
NC_010622.1\|WP_012400757.1\|1529175_1529982_+\|bifunctional-hydroxymethylpyrimidine-kinase/phosphomethylpyrimidine-kinase	gnl\|CDD\|180561	PRK06427, PRK06427, bifunctional hydroxy-methylpyrimidine kinase/ hydroxy-phosphomethylpyrimidine kinase; Reviewed.	3.70679e-141
NC_010622.1\|WP_012400769.1\|1542049_1542457_-\|gamma-glutamylcyclotransferase	gnl\|CDD\|377602	pfam06094, GGACT, Gamma-glutamyl cyclotransferase, AIG2-like. GGACT, gamma-glutamylamine cyclotransferase, is a ubiquitous enzyme found in bacteria, plants, and metazoans from Dictyostelium through to humans. It converts gamma-glutamylamines to free amines and 5-oxoproline.	1.75774e-24
NC_010622.1\|WP_012400753.1\|1524644_1524908_-\|DUF2866-domain-containing-protein	gnl\|CDD\|378547	pfam11065, DUF2866, Protein of unknown function (DUF2866). This bacterial family of proteins have no known function.	8.65676e-29
NC_010622.1\|WP_012400758.1\|1530010_1531027_-\|DUF1853-family-protein	gnl\|CDD\|378094	pfam08907, DUF1853, Domain of unknown function (DUF1853). This family of proteins are functionally uncharacterized.	1.26578e-102
NC_010622.1\|WP_012400773.1\|1545636_1547046_-\|glutamate--tRNA-ligase	gnl\|CDD\|234953	PRK01406, gltX, glutamyl-tRNA synthetase; Reviewed.	0
NC_010622.1\|WP_012400762.1\|1533535_1533805_+\|acyl-CoA-binding-protein	gnl\|CDD\|226731	COG4281, ACB, Acyl-CoA-binding protein [Lipid metabolism].	5.00146e-33
NC_010622.1\|WP_012400759.1\|1531023_1532049_-\|uracil-DNA-glycosylase	gnl\|CDD\|381680	cd10030, UDG-F4_TTUDGA_SPO1dp_like, Uracil DNA glycosylase family 4, includes Thermotoga maritima TTUDGA, Bacillus phage SPO1 DNA polymerase, and similar proteins. Uracil DNA glycosylase family 4 includes Thermotoga maritima TTUDGA, a robust uracil DNA glycosylase that shares narrow substrate specificity and high catalytic efficiency with family 1, acting on double-stranded and single-stranded uracil-containing DNA. Members of this family possess four conserved cysteine residues required to coordinate the [4Fe-4S] iron-sulfur cluster. This family also includes the N-terminal domain of Bacillus phage SPO1 DNA polymerase. Bacteriophage SPO1 is one of a group of large, lytic, tailed bacteriophages of Bacillus subtilis, and contains hydroxymethyluracil (hmUra) in place of thymine in their DNA. It has been speculated that this UDG domain may help discriminate between hmUra containing SPO1 DNA and thymine-containing host DNA. Uracil-DNA glycosylases (UDGs) initiate repair of uracils in DNA. Uracil in DNA can arise as a result of mis-incorporation of dUMP residues by DNA polymerase or via deamination of cytosine. Uracil in DNA mispaired with guanine is one of the major pro-mutagenic events, causing G:C->A:T mutations. Thus, UDG is an essential enzyme for maintaining the integrity of genetic information. UDGs have been classified into various families on the basis of their substrate specificity, conserved motifs, and structural similarities. Although these families demonstrate different substrate specificities, often the function of one enzyme can be complemented by the other.	1.42543e-94
NC_010622.1\|WP_012400768.1\|1540299_1541892_+\|malate-synthase-A	gnl\|CDD\|236432	PRK09255, PRK09255, malate synthase; Validated.	0
NC_010622.1\|WP_041763825.1\|1543208_1544042_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|380379	cd06124, cupin_NimR-like_N, AraC/XylS family transcriptional regulators similar to NimR, N-terminal cupin domain. This family contains mostly bacterial proteins containing an AraC/XylS family helix-turn-helix (HTH) DNA-binding domain C-terminal to a cupin domain, and may be possible transcriptional regulators. Included in this family is Escherichia coli HTH-type transcriptional regulator NimR (also called YeaM) that negatively regulates expression of the nimT operon and its own expression. Proteins in this family belong to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold capable of homodimerization.	1.55388e-29
NC_010622.1\|WP_012400764.1\|1536280_1537585_+\|isocitrate-lyase	gnl\|CDD\|237893	PRK15063, PRK15063, isocitrate lyase; Provisional.	0
NC_010622.1\|WP_012400761.1\|1532526_1533366_-\|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-dimerization-subunit-type-1-TsaB	gnl\|CDD\|274750	TIGR03725, T6A_YeaZ, tRNA threonylcarbamoyl adenosine modification protein YeaZ. This family describes a protein family, YeaZ, now associated with the threonylcarbamoyl adenosine (t6A) tRNA modification. Members of this family may occur as fusions with ygjD (previously gcp) or the ribosomal protein N-acetyltransferase rimI, and is frequently encoded next to rimI. [Protein synthesis, tRNA and rRNA base modification].	5.66537e-54
NC_010622.1\|WP_012400760.1\|1532035_1532530_-\|ribosomal-protein-S18-alanine-N-acetyltransferase	gnl\|CDD\|273701	TIGR01575, rimI, ribosomal-protein-alanine acetyltransferase. Members of this model belong to the GCN5-related N-acetyltransferase (GNAT) superfamily. This model covers prokarotes and the archaea. The seed contains a characterized accession for Gram negative E. coli. An untraceable characterized accession (PIR\|S66013) for Gram positive B. subtilis scores well (205.0) in the full alignment. Characterized members are lacking in the archaea. Noise cutoff (72.4) was set to exclude M. loti paralog of rimI. Trusted cutoff (80.0) was set at next highest scoring member in the mini-database. [Protein synthesis, Ribosomal proteins: synthesis and modification].	3.45362e-37
NC_010622.1\|WP_012400767.1\|1539437_1540226_+\|haloacid-dehalogenase-type-II	gnl\|CDD\|130495	TIGR01428, Haloacetate_dehalogenase, 2-haloalkanoic acid dehalogenase, type II. Catalyzes the hydrolytic dehalogenation of small L-2-haloalkanoic acids to yield the corresponding D-2-hydroxyalkanoic acids. Belongs to the Haloacid Dehalogenase (HAD) superfamily of aspartate-nucleophile hydrolases (pfam00702), class (subfamily) I. Note that the Type I HAD enzymes have not yet been fully characterized, but clearly utilize a substantially different catalytic mechanism and are thus unlikely to be related.	1.23957e-80
NC_010622.1\|WP_012400756.1\|1527788_1529096_+\|lysophospholipid-transporter-LplT	gnl\|CDD\|236879	PRK11195, PRK11195, lysophospholipid transporter LplT; Provisional.	0
NC_010622.1\|WP_012400754.1\|1525047_1526424_-\|DNA-repair-protein-RadA	gnl\|CDD\|236994	PRK11823, PRK11823, DNA repair protein RadA; Provisional.	0

>NC_010622.1|WP_012400762.1|1533535_1533805_+|acyl-CoA-binding-protein
MSDVNGLFVQAQDDVKQLRERPGNLTLLRLYALFKQATDGDVHGDKPGFTDIVGKYKYDAWAALQGTAPDIAKQQYVELVEALKNGTAA
>NC_010622.1|WP_012400761.1|1532526_1533366_-|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-dimerization-subunit-type-1-TsaB
MTKTVLLALDTSTEFCSVALLTAESASDASPAEADAPAPERRVWVRHEETGAVSSTRLLPAIRELFEEAGLALADCNAIAFGAGPGSFTGLRTATGVAQGLAFGLNCPVVPIGTLLVCAESARLRDPSAARVLAALDARMDEVYWADYAWDEGAGEWRTVHPASLAAPDALPCPDQPFTLAGNAAAAFGERLKATAAARHVDREAVPHALPLAFAALRAFRAGRTLPADQAAPEYIRDKVAQTTEERMAAKAAQSAAVSSGQPGHAGRSTRAAHDEGAR
>NC_010622.1|WP_012400760.1|1532035_1532530_-|ribosomal-protein-S18-alanine-N-acetyltransferase
MSGVLLADRYMSPMTEGDLDEVAVVEKLAYEFPWSRGNFEDSLRNGYFGVCLRHVTGTLIGYCVLMPVVDEMHLLNLCVAPAAQHAGAGLALLRESVRIARSEKLAGMLLEVRPSNHRAIKLYERFGFTSIGRRKNYYPARHRSREDAIVMRFSFVKEGADGAA
>NC_010622.1|WP_012400759.1|1531023_1532049_-|uracil-DNA-glycosylase
MALHESALEELGLAPMWVRRAGAPDAAVDAQASHGDGEVAANVARAAPVASTADAQRPGDDAAVSGEAQSDSRFSNATSEPAASPESARAEVEAAPGGARQSRRASPPPAPDEAPPFPDDDFAWFDDLPAGPPSDLEANTSEPVQPGIDTLDWAALEARVSACERCRLCERRTNTVFGVGDREADWMLIGEAPGENEDKQGEPFVGQAGKLLDNMLRSLGLARGTNVYIANVIKCRPPGNRNPERDEVARCEPYLQRQVALVKPKLIIALGRFAAQSLLKTEASISSLRGRVYEYEGVPVVVTYHPAYLLRSLGDKAKSWQDLCLARDMWHKASTEGDAAT
>NC_010622.1|WP_012400758.1|1530010_1531027_-|DUF1853-family-protein
MTEAAGPTVSFEAPSSARLDALSDAAVRDIAWLLFSPDLLRAQPPAGALAKPFESPDEAAAAMAWLEAQDADPAGLHRHIDAARVTRLGRYAECLLAWFLKHGPAARLIAANVPLRRAGVTLGECDFLAETRAGRRLHWELAVKCYLHAGDGRGELADYVGPNLQDRFDLKLAHLLHHQLRLSAREEFASLGHRGPWDAQMFVKGWLFYRNGRAERDPAEIEPAHARGWWTTRAEWTEFSAGHADAWMVLPRLEWLALRVRHAGGASPEATGGASHAASFVSADMLAQQLAGQTGPAMVAAFVEHAAGQWSERSRGFIVPDDWPEQAHAFARQSTRRP
>NC_010622.1|WP_012400757.1|1529175_1529982_+|bifunctional-hydroxymethylpyrimidine-kinase/phosphomethylpyrimidine-kinase
MTRPIPNVLTIAGSDSGGGAGIQADLKTFSALGAYGASVITALTAQNTRGVTAIHTPEPAFVSAQLDAVFDDIRIDAVKIGMLANASIVLAVADALRRHKPKHVVLDTVMISKSNHALLAPEAVDAVRSELLPLADLLTPNLPEAAALLGTSSARDEAAMVDQGEALRKLGARAVLMKGGHLAATDSPDWLIQESGTMRLAGPRVPVKNTHGTGCSLSSAIAALIPQHNDLASAVADAKQWLTGALEQSGRLDVGHGVGPVHHFYRWW
>NC_010622.1|WP_012400756.1|1527788_1529096_+|lysophospholipid-transporter-LplT
MKKGFYTIMAAQFFSSLADNALLIAAIALLKDLHAPNWMTPLLKLFFVLSYVVLAAFVGAFADSRPKGRVMFVTNTIKVVGCLTMLIGAHPLLAYGIVGFGAAAYSPAKYGILTELLPPDRLVAANGWIEGTTVGSIILGTVLGGALISPHIASHIIKHTPPAIHTPAEAAMLIIILIYAIAALFNLRIPDTGARYPRQEHGPIRLITDFADCFVVLWRDKLGQISLAVTTLFWGAGATLQFIVLKWAEVSLGMSLSEGAILQAVVAVGVAAGAMIAAARVPLKKSLSVLPVGIIMGIAVMLMAFYTKHLFPSHWGIYFGRMHIPGYLIFAYIFLMVVGALSGFFVVPMNALLQHRGHVLLSAGHSIAVQNFNENLSVLVMLCLYAVLVWLDVPVAIVIVLFGTFVCVMMWLVMRRHQANQRTFDSVSLIGEARH
>NC_010622.1|WP_041763400.1|1526498_1527569_-|alanine-racemase
MPRPVSATIHTAALANNLAVARRYAPKSKIWAVVKANAYGHGLARAFPGLRATDGFGLLDLEEAVKLRELGWAGPILLLEGFFRPTDIDVIDRYSLTTALHSDEQLRMLEMARLSKPVNIQLKMNSGMNRLGYTPEKFRAAWERARACQGVGQITLMTHFSDADSERGISHQMEAFERGAQGIAGARSLANSAATLWYPEAHFDWVRPGVMLYGASPSGVSSAIKDTGLQPAMTLASELIAVQTLAQGQTIGYGSTFTAREGMRIGVVACGYADGYPRVAPEGTPIIVDGIRTRIVGRVSMDMITVDLTPCPQANVGSRVELWGAQLPVDDVAQSCGTIGYELVCAVAPRVPVRAE
>NC_010622.1|WP_012400754.1|1525047_1526424_-|DNA-repair-protein-RadA
MAKQKTLYTCTECGGQAPKWQGQCPACHAWNTLVETVAESPSAHRFQSLAKNQPVQRLADIEASDVPRFTTGVGEFDRVLGGGLVAGGVVLIGGDPGIGKSTLLLQSLAQIASERRALYVSGEESAAQIALRAQRLSLLEPGSHATELKLLAEIQLEKIQATIAEQKPDVAVIDSIQTIYSEALSSAPGSVAQVRECAAQLTRVAKQSGTAIIMVGHVTKEGALAGPRVLEHIVDTVLYFEGDTHSSFRLVRAFKNRFGAVNELGVFAMTERGLRGVANPSALFLSQHEQIVPGSCVLVTQEGTRPLLVEVQALVDAANVPNPRRLAVGLEQNRLAMLLAVLHRHAGIACFDQDVFLNAVGGVKITEPAADLAVLLAIHSSMRNKPLPKGLIVFGEVGLAGEIRPSPRGQERLKEAAKLGFSIALIPKANAPKQAIDGLQVIAVERIEQAIDRIRTLE
>NC_010622.1|WP_012400753.1|1524644_1524908_-|DUF2866-domain-containing-protein
MKQSHQSSGEFLSNLRGCRVSAPIQGPWGGGCRIVEWIDTAGQISRRVVAENVTADEVRETIRHHVEGRKHRLIDDEREPRQTLPRR
>NC_010622.1|WP_012400764.1|1536280_1537585_+|isocitrate-lyase
MTRNEQAKQLQQQWESDSRWKGIKRGFTAEDVVRLRGSVQPEHTLARRGAEKLWSDMHQEPFVNALGALTGNQAMQQVKAGLKAIYLSGWQVAGDANVAGEMYPDQSLYPANSVPLVVKRINNTLTRADQIQWSEGKNPGDEGYIDYFAPIVADAEAGFGGVLNAFELMKAMIEAGAAGVHFEDQLASVKKCGHMGGKVLVPTRENVAKLTAARLAADVLGVPTVLIARTDAEAADLITSDVDDNDKPFLTGERTVEGFFRTKPGLEQAVSRGLAYAPYADLIWCETGKPDLEYAKKFAEAIHKQFPGKMLSYNCSPSFNWKKNLDDATIAKFQKELGAMGYKFQFITLAGFHALNYSMFNLAHGYARQQMSAFVELQQAEFAAAERGFTAVKHQREVGTGYFDAVTQTVEREASTTALHGSTEDEQFFDKKVA
>NC_010622.1|WP_012400765.1|1537708_1538143_-|universal-stress-protein
MFKHILVPTDGSDLSKKAIDGAIDLAQAVGARVTAYACLPQYPYSPFSEVVIEPPVDFQDRSEREARQHLQEVEEAARGAGVECTSQTSVHPSPYLGIIEAAEQGGCDVIFMASHGRRGLGSLLIGSETQRVLTHTKIPVIVYR
>NC_010622.1|WP_012400766.1|1538380_1539283_-|LysR-family-transcriptional-regulator
MDRFKQIETFVTVAARGSLSAAAQAEGVAPAIIGRRIDALEERLGVKLLVRTTRRITLTYEGSAFLEDCQRIIHDMQNAEASVSAGGVKASGHLRLSAPAGFGRRHVAPLVPAFTVAHPDVSISLDLSDRMVDLVNEGFDCAIRLGELPDSSLVSLKLGENRRVCVASPAYLARRAAPQTLADLAHHNCLALGASANQQRGWVFQQGDKVVTIKVSGTMECSDGAVLHEWCLEGYGLAWRSWWEVGADIAAGSLVSVLDNHAAPPIGIHAVFPQRRHLPLRVRLFLDFLKHTYGNPAYWI
>NC_010622.1|WP_012400767.1|1539437_1540226_+|haloacid-dehalogenase-type-II
MSATTTLSSTQHLKAVIFDAYGTLFDVHSVVAAAEQMFPGHGDALSQLWRQKQIEYAQLRTAADPAGAHYQPFWNITLDALRFAARKLGLSLNAAGEKRLMDEYACLSAFPDVLPVLRRLRELKIGLAILSNGNPQMLDIAVKSAGMSGLFHHVLSVDAVRTFKPAPATYALGTAAFGATARDIVFVSSNGWDASGANWFGYTVFWLNRLGAPAEELGVTPHGTGRSMNDLIAFIANEPSPEKAEKAAKREKGSRTRHGPGA
>NC_010622.1|WP_012400768.1|1540299_1541892_+|malate-synthase-A
MANTLSLPQGMNITGEIKPGFEAILTPQALELVAALHRTFEPRRQQLLKLRAERAQRLDAGERPDFLAGTRAIREGDWTIAPLPHDLQCRRVEITGPIERKMIINALNSGADSYMTDFEDSNAPSWDNQITGHINLKEAVRRTISLEQNGKSYRLNDRIATLIVRPRGWHLDEKHVTVDGQRVSGGIFDFALFLHHNAKEQRSRGTGPYFYLPKMESHLEARLWNDIFVAAQEAVGVPRGTIRATVLIETILAAFEMDEILYELREHSSGLNAGRWDYIFSAIKKFKNDKDFCLADRSQITMTVPFMRAYALQLLKTCHRRNAPAIGGMSALIPIKSDAAANDKAMTGVRSDKARDATDGYDGGWVAHPGLVPIAMEEFVKVLGDKPNQIGKQRDDVQVTGKDLLDFRPEAPITEAGLRNNINVGIHYLGSWLAGNGCVPIHNLMEDAATAEISRSQVWQWIRSPKGKLDDGRKVTAELVRELTGQELDKVKAAIAGDTAPYVRAAQIFVDMSTSETFTEFLTLPLYEEL
>NC_010622.1|WP_012400769.1|1542049_1542457_-|gamma-glutamylcyclotransferase
MQNVFVYGTLRAGEINDIGAAAARNDISAPTLIGAATIRGRLFDFGAYPGLVPDDAGIQVRGDVYEIDDELVAVLDEIEEIYPGVEGLFLPREVTVEVDGMPVMCRYYPVQREAVKGLPEIRGGDWVEHRRSNAR
>NC_010622.1|WP_012400770.1|1542509_1543004_-|ribonuclease-E-activity-regulator-RraA
MNFATADLCDAHEDQLTAGTLRVLDPVFSRFGRASRFGGEAVTLKVFEDNTLVRATLEEKGVARVLVVDGGGSLRCALVGGNLGKLGEKNGWAGIVVFGCVRDTLELNECNLGIIALATHPQRSQKRGGGERDVSLRLPGSVVRPGEWIYADSDGVLVSSAPLV
>NC_010622.1|WP_041763825.1|1543208_1544042_+|helix-turn-helix-transcriptional-regulator
MSTRVDFADIPPEFAPTPTHPIRVRSRPMPAGVRIARHTHAWAQVAYASRGVLRVGTFGTTWMVPPSRAIWIPPYVLHEVAIVEEAFLRTLYVNETVVPAGLDACRVVEVSGLLREVIAALDTAGLAPDRERLLGSLALDEITRSQPLPLSVPMPTEKRLRALCEAVIADPAHTESLERCASTVGASTRTIARLFRQELGVSFSQWRQQAVLARAIPLLSQGRPLSHVARELGYQSQSAFSAMFRRAFGESPRAFMVRGAERGRNDREREEEEDESR
>NC_010622.1|WP_012400772.1|1544111_1544576_-|GNAT-family-N-acetyltransferase
MLDPTDDPSPFHLRKASMDDFQFAEALTRNNMGGYYRRHHLVWRSDLFLASWRESENFILEVDGERIGVLRITEEGDSLHIRDVQIAEGHRRRGAGTYLLDTSHRWARARGLSELQLRVFVDNPAARLYQRMGYRLAGPRLAQLGSIRHMARRV
>NC_010622.1|WP_012400773.1|1545636_1547046_-|glutamate--tRNA-ligase
MTTPVRTRFAPSPTGFIHLGNIRSALYPWAFARKSKGVFVLRIEDTDVERSTEQSVDAILEGMQWLGLDYDEGPFYQMQRMDRYREVLKHMQEQGLVYPCYMSTEELDALRERQRASGEKPRYDGTWRPEPGKVLPTPPAGVQPVLRFRNPLTGVVAWDDAVKGRVEISNEELDDLVIARPDGTPTYNFCVVVDDLDMKITHVIRGDDHVNNTPRQINILRALGGEPPVYAHLPTVLNEQGEKMSKRHGAMSVMGYRDAGYLPEAVLNYLARLGWSHGDAEIFSREQLIEWFDLEHLGKSPAQYDHNKLNWLNNHYIKEADNARLADLSKPFFAALGIDEPTLAKGADLVSVIALMKDRASTVKEVVDNAAMFYREPNPDADALAQHVTDAVRPALADLAAALKACEWTKEGIAAALKATLGAHKLKMPQLAMPVRVLVAGTTHTPSIDSVLMLFGRDVVVSRIEKAVV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

635153 : 649013

Streptococcus_phage(12.5%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012399977.1\|635153_637259_-	elongation factor G	E4ZFJ7	Streptococcus_phage	6.4e-55	25.9
WP_012399978.1\|637526_638042_-	DUF192 domain-containing protein	A0A222YVT9	Synechococcus_phage	3.6e-12	42.4
WP_028370957.1\|638186_638381_-	hypothetical protein	NA	NA	NA	NA
WP_012399980.1\|638814_639384_-	pseudouridine synthase	NA	NA	NA	NA
WP_012399981.1\|639715_640972_+	NADP-dependent isocitrate dehydrogenase	Q77Z09	Phage_21	1.3e-10	61.1
WP_007586257.1\|642760_642967_-	cold shock domain-containing protein CspD	A0A2H4N7Y6	Lake_Baikal_phage	4.0e-23	81.8
WP_012399982.1\|643499_643814_+\|protease	ATP-dependent Clp protease adapter ClpS	A0A218MMY6	uncultured_virus	1.7e-12	41.2
WP_012399983.1\|643810_646111_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	6.1e-168	41.7
WP_012399984.1\|646212_646659_-	dUTP diphosphatase	Q2NP83	Xanthomonas_phage	2.3e-47	63.0
WP_012399985.1\|646723_647728_-	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_012399986.1\|647801_649013_-	bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC	Q9HH70	Methanothermobacter_phage	2.3e-41	32.2

DBSCAN-SWA_2

2120887 : 2138968

Moraxella_phage(15.38%)

tail,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_041763899.1\|2120887_2121064_+	type II toxin-antitoxin system HicA family toxin	A0A0R6PGU2	Moraxella_phage	1.4e-08	56.4
WP_012401246.1\|2121119_2121536_+	type II toxin-antitoxin system HicB family antitoxin	A0A0R6PH90	Moraxella_phage	4.8e-39	59.6
WP_041763505.1\|2121568_2121874_+	hypothetical protein	NA	NA	NA	NA
WP_012401247.1\|2121908_2122289_-	DUF1353 domain-containing protein	M1PQ58	Synechococcus_phage	2.8e-09	38.2
WP_012401248.1\|2122288_2122708_-	hypothetical protein	NA	NA	NA	NA
WP_012401249.1\|2122749_2122962_-	hypothetical protein	NA	NA	NA	NA
WP_012401250.1\|2123013_2123853_-	hypothetical protein	I6WLM5	Burkholderia_virus	2.2e-43	50.3
WP_012401251.1\|2123921_2124419_-	hypothetical protein	NA	NA	NA	NA
WP_012401252.1\|2124415_2124988_-	lysozyme	A0A059VA40	Pseudomonas_phage	2.5e-38	48.8
WP_041763509.1\|2124989_2125289_-	hypothetical protein	NA	NA	NA	NA
WP_012401254.1\|2125473_2125758_+	hypothetical protein	NA	NA	NA	NA
WP_012401255.1\|2125760_2126453_+	hypothetical protein	NA	NA	NA	NA
WP_012401256.1\|2126505_2127699_+	acyltransferase	A0A2H4IZR3	uncultured_Caudovirales_phage	2.3e-17	25.1
WP_052306069.1\|2127688_2127880_-	hypothetical protein	Q6UIZ9	Burkholderia_virus	4.6e-05	50.9
WP_012401258.1\|2128762_2129356_-	YmfQ family protein	NA	NA	NA	NA
WP_012401259.1\|2129364_2130468_-\|plate	baseplate J/gp47 family protein	A0A192Y6E4	Salmonella_phage	1.9e-34	33.5
WP_083775865.1\|2130467_2131034_-	phage GP46 family protein	A0A2P9JZK5	Alteromonadaceae_phage	2.2e-18	37.7
WP_012401261.1\|2131681_2132281_-\|plate	phage baseplate assembly protein V	NA	NA	NA	NA
WP_012401262.1\|2132277_2133369_-	Mu P family protein	M1PVV2	Vibrio_phage	1.1e-31	30.1
WP_012401263.1\|2133372_2134845_-	DNA circulation family protein	U5P4I0	Shigella_phage	3.0e-19	24.6
WP_012401264.1\|2134841_2136644_-\|tail	phage tail tape measure protein	Q4L1H3	Burkholderia_phage	8.8e-21	24.5
WP_012401265.1\|2136762_2137050_-\|tail	phage tail assembly protein	NA	NA	NA	NA
WP_012401266.1\|2137053_2137425_-\|tail	phage tail protein	NA	NA	NA	NA
WP_012401267.1\|2137486_2138968_-\|tail	tail protein	S5FKL0	Shigella_phage	3.0e-91	39.1

DBSCAN-SWA_3

2148982 : 2172348

Burkholderia_virus(33.33%)

integrase

attL 2156176:2156192|attR 2172511:2172527

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_157686524.1\|2148982_2149453_-	hypothetical protein	A0A067ZG41	Vibrio_phage	2.9e-08	31.7
WP_157686525.1\|2149562_2149802_-	hypothetical protein	NA	NA	NA	NA
WP_041763915.1\|2150349_2150790_-	hypothetical protein	NA	NA	NA	NA
WP_157686526.1\|2151183_2151765_-	hypothetical protein	NA	NA	NA	NA
WP_012401284.1\|2151794_2152049_-	hypothetical protein	I6NMK4	Burkholderia_virus	2.4e-09	42.5
WP_012401285.1\|2152045_2152312_-	hypothetical protein	NA	NA	NA	NA
WP_012401286.1\|2152308_2152590_-	hypothetical protein	NA	NA	NA	NA
WP_012401287.1\|2152586_2152847_-	hypothetical protein	NA	NA	NA	NA
WP_012401288.1\|2152897_2153632_-	serine/threonine protein phosphatase	A0A2H4J0P0	uncultured_Caudovirales_phage	2.8e-58	48.5
WP_012401289.1\|2153628_2154078_-	DUF1364 family protein	Q6JIF7	Burkholderia_virus	8.0e-40	62.5
WP_012401290.1\|2154074_2154437_-	DUF4406 domain-containing protein	A0A0U4IBL4	Pseudomonas_phage	9.3e-23	54.2
WP_041763515.1\|2154433_2154922_-	hypothetical protein	NA	NA	NA	NA
WP_012401292.1\|2154981_2155512_-	DUF1064 domain-containing protein	A0A0R6PIZ9	Moraxella_phage	1.0e-17	50.0
WP_012401294.1\|2155671_2155902_-	hypothetical protein	NA	NA	NA	NA
WP_012401295.1\|2155898_2156918_-	hypothetical protein	Q6JIG0	Burkholderia_virus	4.4e-118	64.4
2156176:2156192	attL	NA	NA	NA	NA
WP_012401296.1\|2156914_2157226_-	hypothetical protein	NA	NA	NA	NA
WP_012401297.1\|2157239_2157476_-	hypothetical protein	NA	NA	NA	NA
WP_041763516.1\|2157612_2157804_-	hypothetical protein	NA	NA	NA	NA
WP_157686572.1\|2157805_2158150_-	XRE family transcriptional regulator	NA	NA	NA	NA
WP_052306070.1\|2158305_2158593_-	hypothetical protein	A0A2H4JCB6	uncultured_Caudovirales_phage	2.1e-09	59.3
WP_012401300.1\|2158678_2159674_+	LexA family transcriptional regulator	B6SCU0	Bacteriophage	8.5e-26	47.0
WP_157686528.1\|2159912_2160089_+	hypothetical protein	NA	NA	NA	NA
WP_157686529.1\|2160106_2160310_+	hypothetical protein	NA	NA	NA	NA
WP_157686530.1\|2160467_2160617_+	hypothetical protein	NA	NA	NA	NA
WP_012401302.1\|2160648_2160984_+	hypothetical protein	NA	NA	NA	NA
WP_012401303.1\|2161028_2161859_+	YfdQ family protein	I6NVL7	Burkholderia_virus	3.6e-38	36.6
WP_012401304.1\|2162050_2162797_+	hypothetical protein	A0A0U1SZL2	Pseudomonas_phage	1.4e-36	45.0
WP_012401305.1\|2162799_2163777_+	hypothetical protein	NA	NA	NA	NA
WP_012401306.1\|2163785_2165393_+	DNA cytosine methyltransferase	H9C171	Pectobacterium_phage	6.6e-137	43.8
WP_012401307.1\|2165423_2166110_+	hypothetical protein	A4JWW2	Burkholderia_virus	1.9e-08	58.0
WP_012401308.1\|2166111_2166621_+	hypothetical protein	A0A2I7RKD9	Vibrio_phage	2.2e-22	42.2
WP_052306105.1\|2166653_2167139_+	class I SAM-dependent methyltransferase	A0A0N7IRF6	Acinetobacter_phage	1.5e-47	60.4
WP_012401310.1\|2167135_2167333_+	hypothetical protein	NA	NA	NA	NA
WP_012401311.1\|2167344_2167923_+	restriction alleviation protein, Lar family	NA	NA	NA	NA
WP_041763520.1\|2167879_2168290_-	hypothetical protein	NA	NA	NA	NA
WP_012401313.1\|2168319_2169207_+	phage Gp37/Gp68 family protein	Q6JIJ3	Burkholderia_virus	6.5e-110	64.7
WP_157686531.1\|2169203_2169671_+	hypothetical protein	NA	NA	NA	NA
WP_012401315.1\|2169667_2169889_+	DUF4224 domain-containing protein	NA	NA	NA	NA
WP_012401316.1\|2169888_2170941_+\|integrase	tyrosine-type recombinase/integrase	A0A2H4JDJ8	uncultured_Caudovirales_phage	4.8e-27	31.5
WP_012401317.1\|2171358_2172348_-	zinc-ribbon domain-containing protein	A0A1V0SKV6	Klosneuvirus	3.3e-30	27.0
2172511:2172527	attR	NA	NA	NA	NA

DBSCAN-SWA_4

2801395 : 2810545

Pandoravirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012401868.1\|2801395_2803012_+	polynucleotide adenylyltransferase PcnB	H7BUW3	unidentified_phage	7.6e-24	34.5
WP_012401869.1\|2803060_2803651_+	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	S4VNV0	Pandoravirus	2.6e-14	40.1
WP_041764031.1\|2803662_2804343_+	deoxynucleoside kinase	NA	NA	NA	NA
WP_012401871.1\|2804385_2805201_+	3-methyl-2-oxobutanoate hydroxymethyltransferase	A0A0N7HVJ8	Ostreococcus_lucimarinus_virus	2.6e-36	29.6
WP_012401872.1\|2805304_2807170_-	aminodeoxychorismate synthase component I	S4VNU7	Pandoravirus	6.9e-53	32.7
WP_012401873.1\|2807194_2808328_-	molecular chaperone DnaJ	E3T4P7	Cafeteria_roenbergensis_virus	8.2e-25	38.3
WP_012401874.1\|2808583_2810545_-	molecular chaperone DnaK	A0A1V0SH73	Hokovirus	4.6e-148	48.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NC_010623

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

148251 : 219219

Burkholderia_phage(40.0%)

integrase,holin,transposase

attL 154483:154498|attR 167802:167817

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012402562.1\|148251_149355_-\|transposase	IS5-like element ISBph3 family transposase	NA	NA	NA	NA
WP_012402564.1\|151121_152426_-\|integrase	site-specific integrase	A0A0F6TJM5	Escherichia_coli_O157_typing_phage	2.7e-112	51.6
WP_012402565.1\|153283_153865_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_012402566.1\|153892_154384_-	DUF302 domain-containing protein	NA	NA	NA	NA
WP_012402567.1\|154447_155914_-	indoleacetamide hydrolase	NA	NA	NA	NA
154483:154498	attL	NA	NA	NA	NA
WP_012402568.1\|157194_158121_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_157686753.1\|159117_159333_-	AlpA family phage regulatory protein	C7BGF0	Burkholderia_phage	8.0e-14	55.1
WP_012402570.1\|159817_161092_-\|integrase	integrase family protein	C7BGE7	Burkholderia_phage	6.3e-175	68.4
WP_085965105.1\|161312_161954_-	GTP cyclohydrolase II	A0A2I2L4Y7	Orpheovirus	1.4e-29	41.9
WP_012402572.1\|162300_162735_+	CBS domain-containing protein	NA	NA	NA	NA
WP_012402573.1\|162992_163319_-	DUF4148 domain-containing protein	NA	NA	NA	NA
WP_012402574.1\|163549_164188_-	3-methyladenine DNA glycosylase	NA	NA	NA	NA
WP_012402575.1\|164515_164872_+	BON domain-containing protein	NA	NA	NA	NA
WP_041764907.1\|165101_166193_+	ionic transporter y4hA	NA	NA	NA	NA
WP_041764909.1\|166231_167107_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_012402578.1\|167367_168177_+	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
167802:167817	attR	NA	NA	NA	NA
WP_012402579.1\|168220_168967_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_012402580.1\|168963_169620_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_012402581.1\|170190_171459_-	cytochrome c	NA	NA	NA	NA
WP_012402582.1\|171470_173711_-	xanthine dehydrogenase family protein molybdopterin-binding subunit	NA	NA	NA	NA
WP_012402583.1\|173712_174168_-	(2Fe-2S)-binding protein	NA	NA	NA	NA
WP_012402584.1\|174461_179090_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_157686755.1\|179062_180256_-	cellulase	NA	NA	NA	NA
WP_012402586.1\|180296_182861_-	cellulose biosynthesis cyclic di-GMP-binding regulatory protein BcsB	NA	NA	NA	NA
WP_012402587.1\|182864_185096_-	UDP-forming cellulose synthase catalytic subunit	NA	NA	NA	NA
WP_012402588.1\|185092_185881_-	cellulose synthase operon protein YhjQ	NA	NA	NA	NA
WP_041764272.1\|185877_186735_-	hypothetical protein	NA	NA	NA	NA
WP_012402590.1\|186859_187315_-	cellulose synthase	NA	NA	NA	NA
WP_041764912.1\|187650_188052_+	hypothetical protein	NA	NA	NA	NA
WP_012402592.1\|188142_188961_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_012402593.1\|189080_190076_-	peptidoglycan DD-metalloendopeptidase family protein	A0A292GJG6	Xanthomonas_phage	8.3e-13	41.7
WP_012402594.1\|190481_190889_+	hypothetical protein	NA	NA	NA	NA
WP_012402595.1\|190912_191668_-	DeoR/GlpR transcriptional regulator	NA	NA	NA	NA
WP_012402596.1\|191829_192417_+	NUDIX domain-containing protein	NA	NA	NA	NA
WP_012402597.1\|192871_193870_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_012402598.1\|194426_195551_-	glycosyltransferase	NA	NA	NA	NA
WP_012402599.1\|195547_196534_-	glycosyltransferase	NA	NA	NA	NA
WP_012402600.1\|196533_197058_-	serine acetyltransferase	NA	NA	NA	NA
WP_012402601.1\|197054_198257_-	capsular polysaccharide biosynthesis protein	NA	NA	NA	NA
WP_041764916.1\|198283_199516_-	oligosaccharide flippase family protein	NA	NA	NA	NA
WP_157686757.1\|199682_200324_-	sugar transferase	NA	NA	NA	NA
WP_041764275.1\|200997_201993_-	hypothetical protein	NA	NA	NA	NA
WP_012402605.1\|202126_204337_-	polysaccharide biosynthesis tyrosine autokinase	NA	NA	NA	NA
WP_085965115.1\|204355_204790_-	low molecular weight phosphotyrosine protein phosphatase	NA	NA	NA	NA
WP_012402607.1\|204854_206027_-	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_041764925.1\|206381_207485_+	OpgC domain-containing protein	NA	NA	NA	NA
WP_012402609.1\|207558_208644_-	AI-2E family transporter	NA	NA	NA	NA
WP_012402610.1\|209020_209308_+	DUF3331 domain-containing protein	NA	NA	NA	NA
WP_012402611.1\|209355_210291_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_012402612.1\|210345_210837_-	4-hydroxybenzoyl-CoA thioesterase	NA	NA	NA	NA
WP_012402613.1\|210923_211889_-	L-carnitine dehydrogenase	NA	NA	NA	NA
WP_012402614.1\|211938_212868_-	3-keto-5-aminohexanoate cleavage protein	NA	NA	NA	NA
WP_012402615.1\|212954_213905_-\|holin	choline ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_012402616.1\|214219_215215_+	GlxA family transcriptional regulator	NA	NA	NA	NA
WP_012402617.1\|215286_216429_-	porin	NA	NA	NA	NA
WP_012402618.1\|216670_217636_-\|holin	choline ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_012402619.1\|217677_219219_-\|holin	choline-sulfatase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NC_010627

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

128433 : 205889

Phage_21(16.67%)

integrase,transposase

attL 128921:128939|attR 202395:202413

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012406494.1\|128433_129564_-\|transposase	IS110 family transposase	NA	NA	NA	NA
128921:128939	attL	NA	NA	NA	NA
WP_012406497.1\|132168_133401_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_012406498.1\|134194_134740_-	hypothetical protein	NA	NA	NA	NA
WP_012406499.1\|134791_135319_-	hypothetical protein	NA	NA	NA	NA
WP_012406500.1\|135616_136168_-	hypothetical protein	NA	NA	NA	NA
WP_146174482.1\|137455_137797_+	hypothetical protein	NA	NA	NA	NA
WP_012406501.1\|138648_139440_-	2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase	NA	NA	NA	NA
WP_052306260.1\|141007_141478_+	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_012406504.1\|142089_144249_+	hypothetical protein	NA	NA	NA	NA
WP_012406505.1\|144296_144860_+	hypothetical protein	NA	NA	NA	NA
WP_107203824.1\|145166_145454_-	hypothetical protein	NA	NA	NA	NA
WP_012406507.1\|145624_145996_-	hypothetical protein	NA	NA	NA	NA
WP_146174484.1\|146415_146724_-	hypothetical protein	NA	NA	NA	NA
WP_157686956.1\|147272_147449_+	hypothetical protein	NA	NA	NA	NA
WP_012406509.1\|147596_147947_+	hypothetical protein	NA	NA	NA	NA
WP_012406511.1\|148687_148906_-	hypothetical protein	NA	NA	NA	NA
WP_167538912.1\|149164_149335_-	hypothetical protein	NA	NA	NA	NA
WP_012406514.1\|149477_149678_-	hypothetical protein	NA	NA	NA	NA
WP_146174485.1\|149717_149987_+	hypothetical protein	NA	NA	NA	NA
WP_012406515.1\|149983_150403_+	excisionase domain-containing protein	NA	NA	NA	NA
WP_052306261.1\|150408_151005_+	hypothetical protein	O21940	Phage_21	4.2e-20	39.5
WP_041766554.1\|151674_151983_+	hypothetical protein	NA	NA	NA	NA
WP_012406517.1\|152051_152303_+	DUF1488 domain-containing protein	NA	NA	NA	NA
WP_157686957.1\|152536_152695_+	hypothetical protein	NA	NA	NA	NA
WP_012406518.1\|153129_153333_+	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	8.3e-21	71.6
WP_012406519.1\|153745_154510_-	H-NS histone family protein	NA	NA	NA	NA
WP_012406520.1\|154987_155431_+	DNA-binding protein	NA	NA	NA	NA
WP_012406521.1\|155740_156241_-	RES domain-containing protein	NA	NA	NA	NA
WP_012406522.1\|156237_156759_-	DUF2384 domain-containing protein	NA	NA	NA	NA
WP_041766558.1\|157189_157567_+	hypothetical protein	NA	NA	NA	NA
WP_041766560.1\|157612_158212_+	hypothetical protein	NA	NA	NA	NA
WP_063713894.1\|158301_158712_-	hypothetical protein	NA	NA	NA	NA
WP_012406526.1\|158924_159866_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_012406527.1\|159961_160417_+	hypothetical protein	NA	NA	NA	NA
WP_012406426.1\|160872_161883_-	YecA family protein	NA	NA	NA	NA
WP_012406528.1\|162439_163636_+	pectate lyase	A0A076FFT1	Aureococcus_anophage	1.3e-07	24.6
WP_107203682.1\|164187_166326_-	type II secretion system secretin GspD	R9TEZ5	Vibrio_phage	5.2e-20	28.7
WP_041766561.1\|166607_166796_+	hypothetical protein	NA	NA	NA	NA
WP_012406530.1\|167154_168996_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_012406532.1\|170152_171646_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	2.5e-29	30.2
WP_012406533.1\|175678_177157_+	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_012406534.1\|177245_179309_+	maltose alpha-D-glucosyltransferase	NA	NA	NA	NA
WP_012406537.1\|183741_183990_-	hypothetical protein	NA	NA	NA	NA
WP_012406540.1\|185491_186448_+	fatty acid desaturase	NA	NA	NA	NA
WP_012406541.1\|186434_187673_+	sodium:solute symporter	NA	NA	NA	NA
WP_052306265.1\|187776_188691_-	HTH-type transcriptional regulator ArgP	NA	NA	NA	NA
WP_012406543.1\|189401_190163_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_012406544.1\|190682_191996_-	histidinol dehydrogenase	NA	NA	NA	NA
WP_107203684.1\|192173_193235_+	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_012406547.1\|194453_195311_-	ATP-binding protein	NA	NA	NA	NA
WP_012406548.1\|196835_197414_-	hypothetical protein	NA	NA	NA	NA
WP_012406549.1\|198067_199666_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_012406550.1\|200047_201064_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_012406551.1\|201865_202996_-\|transposase	IS110 family transposase	NA	NA	NA	NA
202395:202413	attR	NA	NA	NA	NA
WP_012406553.1\|204013_204772_-	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	3.0e-63	50.8
WP_167538891.1\|205634_205889_+\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_2

228639 : 256529

Bacillus_phage(25.0%)

integrase,transposase

attL 225548:225563|attR 235299:235314

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
225548:225563	attL	NA	NA	NA	NA
WP_012406571.1\|228639_229647_-\|integrase	site-specific integrase	A0A1B1P7C7	Bacillus_phage	1.6e-11	25.2
WP_012406572.1\|229633_230590_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_012406573.1\|230586_231843_-\|integrase	tyrosine-type recombinase/integrase	A0A2H4JBC4	uncultured_Caudovirales_phage	9.5e-06	22.6
WP_012405793.1\|232354_233563_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_012405792.1\|233571_234450_-\|integrase	site-specific integrase	S5W9T9	Leptospira_phage	1.3e-30	30.3
WP_012406574.1\|235359_236871_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	1.1e-149	54.6
235299:235314	attR	NA	NA	NA	NA
WP_012406575.1\|238311_238665_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_012406576.1\|238664_239129_-	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_083775967.1\|239209_239446_-\|transposase	transposase	NA	NA	NA	NA
WP_012406577.1\|241111_242344_+	glutamine amidotransferase class-II	NA	NA	NA	NA
WP_083775968.1\|243001_243730_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_083775976.1\|243866_244271_+	hypothetical protein	NA	NA	NA	NA
WP_012406578.1\|244326_244761_+	MaoC family dehydratase	NA	NA	NA	NA
WP_085965140.1\|245371_245569_-\|transposase	transposase	NA	NA	NA	NA
WP_107204265.1\|245934_246816_+	GHMP kinase	NA	NA	NA	NA
WP_052306267.1\|246852_248478_+	pyridoxal-phosphate dependent enzyme	NA	NA	NA	NA
WP_012406581.1\|250051_250774_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_012406583.1\|254003_254888_-	DMT family transporter	NA	NA	NA	NA
WP_012406584.1\|255305_256529_-\|transposase	ISL3 family transposase	NA	NA	NA	NA

DBSCAN-SWA_3

331917 : 456947

uncultured_Caudovirales_phage(17.65%)

integrase,transposase

attL 371727:371743|attR 396779:396808

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012406494.1\|331917_333048_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_012406651.1\|334038_335280_+	cystathionine gamma-synthase family protein	A0A2I2L687	Orpheovirus	1.6e-05	24.1
WP_012406652.1\|335655_335955_+	hypothetical protein	NA	NA	NA	NA
WP_012406653.1\|336580_338311_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	5.1e-10	29.9
WP_012406656.1\|340416_340635_-	hypothetical protein	NA	NA	NA	NA
WP_107203130.1\|340634_340937_-	hypothetical protein	NA	NA	NA	NA
WP_041766597.1\|340991_341306_-	hypothetical protein	NA	NA	NA	NA
WP_041766718.1\|341374_342085_+	translesion DNA synthesis-associated protein ImuA	NA	NA	NA	NA
WP_012406660.1\|342132_343095_+	hypothetical protein	NA	NA	NA	NA
WP_012406661.1\|343197_343557_-	diacylglycerol kinase	NA	NA	NA	NA
WP_012406662.1\|343853_344132_-	hypothetical protein	NA	NA	NA	NA
WP_041766720.1\|344697_345099_+	hypothetical protein	NA	NA	NA	NA
WP_041766600.1\|345301_345526_+	hypothetical protein	NA	NA	NA	NA
WP_012406665.1\|345522_347478_-	DNA ligase D	A0A068CDF3	Rhizobium_phage	8.5e-54	37.7
WP_012406666.1\|347479_347779_-	hypothetical protein	NA	NA	NA	NA
WP_012406667.1\|347756_348317_-	hypothetical protein	NA	NA	NA	NA
WP_012406668.1\|348409_350005_-	sensor domain-containing diguanylate cyclase	G3MA91	Bacillus_virus	3.4e-16	35.0
WP_012406669.1\|350555_353177_-	AAA family ATPase	NA	NA	NA	NA
WP_012406670.1\|353344_359959_-	DUF3320 domain-containing protein	NA	NA	NA	NA
WP_012406671.1\|361034_362291_+	DNA repair exonuclease	NA	NA	NA	NA
WP_012406672.1\|362294_365756_+	AAA family ATPase	NA	NA	NA	NA
WP_041766601.1\|366078_366282_+	hypothetical protein	NA	NA	NA	NA
WP_012406673.1\|366847_367297_-	SET domain-containing protein-lysine N-methyltransferase	NA	NA	NA	NA
WP_012406674.1\|367561_367738_+	DNA-binding protein HU-alpha	NA	NA	NA	NA
WP_012406675.1\|367806_368802_-\|integrase	site-specific integrase	A0A142F1N9	Bacillus_phage	1.2e-16	25.6
WP_012406676.1\|368794_369724_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_012406677.1\|369720_370962_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_012406678.1\|371381_371651_-	DUF1488 domain-containing protein	NA	NA	NA	NA
371727:371743	attL	NA	NA	NA	NA
WP_012406679.1\|371753_372050_-	type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family	NA	NA	NA	NA
371727:371743	attL	NA	NA	NA	NA
WP_012406680.1\|372046_372505_-	hypothetical protein	NA	NA	NA	NA
WP_012406681.1\|372506_372812_-	hypothetical protein	NA	NA	NA	NA
WP_012406682.1\|374028_375477_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_012406684.1\|376290_377352_+	hypothetical protein	A0A2H4J9J6	uncultured_Caudovirales_phage	7.7e-25	29.9
WP_012406685.1\|377348_379244_+	hypothetical protein	A0A2H4J185	uncultured_Caudovirales_phage	5.6e-34	24.9
WP_012406686.1\|379240_379603_+	hypothetical protein	NA	NA	NA	NA
WP_012406689.1\|383648_383981_-	hypothetical protein	NA	NA	NA	NA
WP_107203132.1\|384033_384315_-	Y4bD/Y4pK family protein	NA	NA	NA	NA
WP_095211896.1\|384332_385358_+	group II intron reverse transcriptase/maturase	NA	NA	NA	NA
WP_107203129.1\|388391_388886_+\|transposase	transposase	NA	NA	NA	NA
WP_012406692.1\|388885_389239_+	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	5.7e-17	39.8
WP_012405793.1\|391093_392302_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_012405792.1\|392310_393189_-\|integrase	site-specific integrase	S5W9T9	Leptospira_phage	1.3e-30	30.3
WP_012406693.1\|393452_394484_-\|integrase	tyrosine-type recombinase/integrase	A0A076YL28	Mesorhizobium_phage	1.2e-11	27.9
WP_012406694.1\|394480_395458_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_012406695.1\|395454_396672_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_167538891.1\|398159_398414_+\|transposase	transposase	NA	NA	NA	NA
396779:396808	attR	NA	NA	NA	NA
WP_012404130.1\|398602_399055_+	helix-turn-helix domain containing protein	NA	NA	NA	NA
396779:396808	attR	NA	NA	NA	NA
WP_012404129.1\|399325_401410_+	recombinase family protein	NA	NA	NA	NA
WP_041766609.1\|403071_404058_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_012406699.1\|406020_407094_+	D-alanine--D-alanine ligase	NA	NA	NA	NA
WP_012406700.1\|407422_408811_+	multi anti extrusion protein MatE	NA	NA	NA	NA
WP_012406701.1\|409523_413858_+	AMP-binding protein	A0A2K9KZV5	Tupanvirus	4.7e-36	26.8
WP_012406702.1\|413873_414629_+	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_012406703.1\|415071_415668_-	plasmid pRiA4b ORF-3 family protein	A0A2H4PDG5	Mycobacterium_phage	7.1e-20	34.3
WP_012406704.1\|419298_420885_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_012406705.1\|420895_421966_+	ABC transporter permease	NA	NA	NA	NA
WP_012406706.1\|422024_422939_+	ABC transporter permease	NA	NA	NA	NA
WP_012406707.1\|422940_423816_+	ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_012406708.1\|423812_424571_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.6e-22	33.8
WP_012406709.1\|424752_426249_+	M81 family metallopeptidase	NA	NA	NA	NA
WP_012406710.1\|427103_428459_+	aminotransferase class III-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_012406711.1\|428553_429423_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_107203687.1\|429434_430322_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_167538906.1\|430275_431283_+	DUF5376 domain-containing protein	NA	NA	NA	NA
WP_012406713.1\|431279_432278_+	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_083775972.1\|432307_432577_+	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_107203689.1\|432677_432827_+	hypothetical protein	NA	NA	NA	NA
WP_012406714.1\|432982_433807_+	inositol phosphatase	NA	NA	NA	NA
WP_012406715.1\|436054_436894_-	AAA family ATPase	A0A2L1IVB6	Escherichia_phage	5.8e-76	56.4
WP_012406716.1\|436890_437937_-\|transposase	IS21 family transposase	A0A2L1IVA1	Escherichia_phage	1.6e-75	45.6
WP_012404963.1\|441180_442509_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_012404130.1\|443564_444017_-	helix-turn-helix domain containing protein	NA	NA	NA	NA
WP_167538891.1\|444205_444460_-\|transposase	transposase	NA	NA	NA	NA
WP_012406553.1\|445322_446081_+	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	3.0e-63	50.8
WP_107204354.1\|446748_447207_+	DUF4145 domain-containing protein	NA	NA	NA	NA
WP_012406719.1\|447241_447493_+	hypothetical protein	NA	NA	NA	NA
WP_157686964.1\|447532_447706_+	hypothetical protein	NA	NA	NA	NA
WP_167538907.1\|447732_447933_+	hypothetical protein	NA	NA	NA	NA
WP_107204378.1\|451530_451788_-	hypothetical protein	NA	NA	NA	NA
WP_012406723.1\|452219_452588_-\|transposase	transposase	NA	NA	NA	NA
WP_012406724.1\|452708_453299_-	hypothetical protein	A0A2D1GNJ8	Pseudoalteromonas_phage	1.5e-25	38.5
WP_041766763.1\|456671_456947_-\|transposase	transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_010625

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NC_010622

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NC_010623

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. NC_010627

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection