CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Prophage number
NC_011657	Bacillus cereus AH187 plasmid pAH187_3, complete sequence	0 crisprs	NA	0	0
NC_011654	Bacillus cereus AH187 plasmid pAH187_12, complete sequence	0 crisprs	NA	0	0
NC_011656	Bacillus cereus AH187 plasmid pAH187_45, complete sequence	0 crisprs	NA	0	0
NC_011655	Bacillus cereus AH187 plasmid pAH187_270, complete sequence	0 crisprs	RT,cas14j,csa3	0	2
NC_011658	Bacillus cereus AH187, complete genome	1 crisprs	cas3,csa3,WYL,RT,DinG,DEDDh,c2c9_V-U4	1	9

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

42389 : 107906

Bacillus_phage(37.5%)

transposase,protease

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000160678.1\|42389_43502_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A286QQB7	Streptococcus_phage	3.3e-79	45.0
WP_000557422.1\|44527_45664_+	hypothetical protein	NA	NA	NA	NA
WP_001002941.1\|46373_47327_+	hypothetical protein	NA	NA	NA	NA
WP_000239320.1\|47346_48846_+	hypothetical protein	NA	NA	NA	NA
WP_001168864.1\|48862_49312_+	hypothetical protein	NA	NA	NA	NA
WP_001181745.1\|49337_49733_+	DUF4320 family protein	NA	NA	NA	NA
WP_001284466.1\|49987_51322_+	hypothetical protein	NA	NA	NA	NA
WP_000776686.1\|51471_53817_+	hypothetical protein	NA	NA	NA	NA
WP_085963576.1\|54351_55712_-\|transposase	IS3-like element ISBce15 family transposase	A0A1B1P773	Bacillus_phage	2.5e-89	60.4
WP_000804792.1\|56310_57171_+	Flp pilus assembly protein CpaB	NA	NA	NA	NA
WP_000441032.1\|57187_58009_+	AAA family ATPase	NA	NA	NA	NA
WP_000264623.1\|58024_59449_+	CpaF family protein	NA	NA	NA	NA
WP_000555801.1\|59441_60374_+	hypothetical protein	NA	NA	NA	NA
WP_000201161.1\|60375_61242_+	hypothetical protein	NA	NA	NA	NA
WP_000956353.1\|61284_61488_+	hypothetical protein	NA	NA	NA	NA
WP_000900885.1\|61554_61758_+	hypothetical protein	NA	NA	NA	NA
WP_000949458.1\|61830_62037_+	hypothetical protein	NA	NA	NA	NA
WP_000599424.1\|62316_63435_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	D2XQ03	Bacillus_virus	3.1e-165	75.5
WP_103141274.1\|63989_65162_+	hypothetical protein	NA	NA	NA	NA
WP_001029022.1\|65200_65746_+	hypothetical protein	NA	NA	NA	NA
WP_001088474.1\|65742_66366_+	hypothetical protein	NA	NA	NA	NA
WP_000823722.1\|66905_67409_-	hypothetical protein	NA	NA	NA	NA
WP_000732216.1\|67531_68233_-	class D sortase	NA	NA	NA	NA
WP_000734522.1\|68290_68818_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_000289504.1\|69749_69899_+	hypothetical protein	NA	NA	NA	NA
WP_000811978.1\|70205_70490_+	hypothetical protein	W8CYZ5	Bacillus_phage	4.3e-15	60.0
WP_000691220.1\|72988_73267_+	hypothetical protein	NA	NA	NA	NA
WP_001250590.1\|73624_73816_+	hypothetical protein	NA	NA	NA	NA
WP_000376554.1\|73958_74096_-	DUF3956 domain-containing protein	NA	NA	NA	NA
WP_002163380.1\|74365_74566_+	hypothetical protein	NA	NA	NA	NA
WP_095209908.1\|74841_75099_+	hypothetical protein	NA	NA	NA	NA
WP_000043818.1\|77742_77982_+	hypothetical protein	NA	NA	NA	NA
WP_000639134.1\|78102_78663_-	recombinase family protein	A0A219YB42	Aeromonas_phage	9.0e-25	37.7
WP_002029168.1\|79283_82679_+	S-layer protein	NA	NA	NA	NA
WP_000351384.1\|82699_82975_+	barnase inhibitor	NA	NA	NA	NA
WP_000267727.1\|83178_83358_-	hypothetical protein	NA	NA	NA	NA
WP_000548269.1\|84164_84716_+	hypothetical protein	NA	NA	NA	NA
WP_001048058.1\|84828_86604_+	hypothetical protein	Q08J70	Stx2-converting_phage	1.2e-22	38.9
WP_001108760.1\|86593_87907_+	DUF3854 domain-containing protein	NA	NA	NA	NA
WP_000118205.1\|88335_89259_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_000727316.1\|89467_89656_+	hypothetical protein	NA	NA	NA	NA
WP_001216648.1\|89805_90225_+	hypothetical protein	NA	NA	NA	NA
WP_001233525.1\|90291_90642_+	PrgI family protein	NA	NA	NA	NA
WP_000892011.1\|90642_91557_+	hypothetical protein	NA	NA	NA	NA
WP_000765116.1\|91559_92531_+	hypothetical protein	NA	NA	NA	NA
WP_000914978.1\|93246_95079_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	1.7e-32	27.0
WP_000878407.1\|95369_96338_+	hypothetical protein	NA	NA	NA	NA
WP_000884601.1\|96368_100349_+	hypothetical protein	NA	NA	NA	NA
WP_000081396.1\|100345_102553_+	peptidoglycan DD-metalloendopeptidase family protein	A7KUS1	Bacillus_phage	3.0e-15	40.7
WP_002163382.1\|102569_103145_+	hypothetical protein	NA	NA	NA	NA
WP_001237722.1\|103309_103693_+	hypothetical protein	NA	NA	NA	NA
WP_000426064.1\|103683_103989_+	DUF2325 domain-containing protein	NA	NA	NA	NA
WP_002029262.1\|104439_105144_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_001272211.1\|105322_106123_+	hypothetical protein	NA	NA	NA	NA
WP_001055915.1\|106475_107906_-\|transposase	IS4-like element ISBce2 family transposase	NA	NA	NA	NA

DBSCAN-SWA_2

130806 : 138076

Clostridium_phage(28.57%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001226074.1\|130806_131382_+	recombinase family protein	M9Q1K0	Clostridium_phage	4.6e-16	30.3
WP_000383881.1\|131494_132340_+	AraC family transcriptional regulator	A0A1B0RXG1	Streptococcus_phage	4.4e-23	42.9
WP_033656251.1\|132467_133043_+	recombinase family protein	M9Q1K0	Clostridium_phage	5.6e-14	30.6
WP_000701227.1\|133297_133750_-	hypothetical protein	NA	NA	NA	NA
WP_000475617.1\|134113_134812_+	N-acetylmuramoyl-L-alanine amidase	A0A0N6W8I1	Bacillus_phage	5.2e-46	47.4
WP_000957215.1\|135184_135754_-	histidine phosphatase family protein	NA	NA	NA	NA
WP_014315595.1\|135779_135953_-	HIT family protein	D7NW73	Streptomyces_phage	7.6e-07	45.8
WP_000588560.1\|136067_137321_+\|transposase	IS21-like element ISBce16 family transposase	U5N3F9	Enterobacteria_phage	2.5e-51	33.2
WP_000993737.1\|137317_138076_+	AAA family ATPase	U5N3V8	Enterobacteria_phage	1.3e-61	46.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NC_011658

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_011658_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_011658_1

1280088-1280322

Orphan

Consensus_repeat	Method
TGTATGATTACCTTCCGCATGAGAA	CRISPRCasFinder

3 spacers

The CRISPR arrays of NC_011658_1

>merge|NC_011658|1|1280088-1280322|CRISPRCasFinder
TGTATGATTACCTTCCGCATGAGAAGAGAATCCGTTAGCGATAGTCGCGGTTCCTTCTGCATGTGCTGCTTCGCCTAAAGCGATTGTATGTTTACCTTCCGCATGAGAATAGGAGCCACCTGCTATCGTTTCACTTCCTTCACTATGGGAACTATGTCCAGTTGCTTTTGTTTTTGATCCTTCTGCATGAGAGAAAGAACCTTTTGCATGTGTCAGAAGTCCTTCTGCATGTGAA

>NC_011658|1|1|1280088-1280322|CRISPRCasFinder
TGTATGATTACCTTCCGCATGAGAA	GAGAATCCGTTAGCGATAGTCGCGGTTCCTTCTGCATGTGCTGCTTCGCCTAAAGCGAT
TGTATGTTTACCTTCCGCATGAGAA	TAGGAGCCACCTGCTATCGTTTCACTTCCTTCACTATGGGAACTATGTCCAGTTGCTTT
TGTTTTTGATCCTTCTGCATGAGAG	AAAGAACCTTTTGCATG
TGTCAGAAGTCCTTCTGCATGTGAA

Protein	Signature genes	Signature genes Name	Protein_function
NC_011658.1\|WP_000612261.1\|1270787_1272032_+\|competence-protein	unknown	unknown	gnl\|CDD\|226875
NC_011658.1\|WP_000872720.1\|1281026_1281767_-\|bis(5'-nucleosyl)-tetraphosphatase-PrpE	unknown	unknown	gnl\|CDD\|184187
NC_011658.1\|WP_000428846.1\|1284981_1285827_-\|macrocin-O-methyltransferase	unknown	unknown	gnl\|CDD\|377550
NC_011658.1\|WP_001272381.1\|1288940_1289627_+\|streptomycin-biosynthesis-protein-StrF	unknown	unknown	gnl\|CDD\|379345
NC_011658.1\|WP_000003390.1\|1272082_1273909_+\|oligoendopeptidase-F	unknown	unknown	gnl\|CDD\|341071
NC_011658.1\|WP_001081482.1\|1277028_1277667_+\|GTP-pyrophosphokinase-family-protein	unknown	unknown	gnl\|CDD\|225232
NC_011658.1\|WP_000191110.1\|1275901_1276480_-\|CYTH-domain-containing-protein	unknown	unknown	gnl\|CDD\|143627
NC_011658.1\|WP_001180003.1\|1276626_1276998_+\|hypothetical-protein	unknown	unknown	unknown
NC_011658.1\|WP_001079095.1\|1278498_1279392_+\|RluA-family-pseudouridine-synthase	unknown	unknown	gnl\|CDD\|223638
NC_011658.1\|WP_000799204.1\|1269162_1270707_+\|cardiolipin-synthase	unknown	unknown	gnl\|CDD\|234967
NC_011658.1\|WP_001004740.1\|1284086_1284845_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|379312
NC_011658.1\|WP_000673184.1\|1277685_1278483_+\|NAD-kinase	unknown	unknown	gnl\|CDD\|235317
NC_011658.1\|WP_001087862.1\|1288254_1288944_+\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|372616
NC_011658.1\|WP_000043379.1\|1275322_1275721_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|381281
NC_011658.1\|WP_000069694.1\|1285949_1286837_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|375999
NC_011658.1\|WP_000655329.1\|1281841_1283002_-\|rod-shape-determining-protein-RodA	unknown	unknown	gnl\|CDD\|274033
NC_011658.1\|WP_000427737.1\|1283144_1284080_-\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|366154
NC_011658.1\|WP_000654997.1\|1289639_1290320_+\|streptomycin-biosynthesis-protein-StrF	unknown	unknown	gnl\|CDD\|379345
NC_011658.1\|WP_000932900.1\|1287002_1288103_+\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|133005
NC_011658.1\|WP_000360652.1\|1274429_1275323_-\|DsbA-family-protein	unknown	unknown	gnl\|CDD\|372699

Protein	Function_ID	Function_description	E-value
NC_011658.1\|WP_000612261.1\|1270787_1272032_+\|competence-protein	gnl\|CDD\|226875	COG4469, CoiA, Competence protein CoiA-like family, contains a predicted nuclease domain [General function prediction only].	8.31164e-58
NC_011658.1\|WP_000872720.1\|1281026_1281767_-\|bis(5'-nucleosyl)-tetraphosphatase-PrpE	gnl\|CDD\|184187	PRK13625, PRK13625, bis(5'-nucleosyl)-tetraphosphatase PrpE; Provisional.	0
NC_011658.1\|WP_000428846.1\|1284981_1285827_-\|macrocin-O-methyltransferase	gnl\|CDD\|377550	pfam05711, TylF, Macrocin-O-methyltransferase (TylF). This family consists of bacterial macrocin O-methyltransferase (TylF) proteins. TylF is responsible for the methylation of macrocin to produce tylosin. Tylosin is a macrolide antibiotic used in veterinary medicine to treat infections caused by Gram-positive bacteria and as an animal growth promoter in the swine industry. It is produced by several Streptomyces species. As with other macrolides, the antibiotic activity of tylosin is due to the inhibition of protein biosynthesis by a mechanism that involves the binding of tylosin to the ribosome, preventing the formation of the mRNA-aminoacyl-tRNA-ribosome complex. The structure of one representative sequence from this family, NovP, shows it to be an S-adenosyl-l-methionine-dependent O-methyltransferase that catalyzes the penultimate step in the biosynthesis of the aminocoumarin antibiotic novobiocin. Specifically, it methylates at 4-OH of the noviose moiety, and the resultant methoxy group is important for the potency of the mature antibiotic. It is likely that the key structural features of NovP are common to the rest of the family and include: a helical 'lid' region that gates access to the co-substrate binding pocket and an active centre that contains a 3-Asp putative metal binding site. A further conserved Asp probably acts as the general base that initiates the reaction by de-protonating the 4-OH group of the noviose unit.	2.61854e-149
NC_011658.1\|WP_000003390.1\|1272082_1273909_+\|oligoendopeptidase-F	gnl\|CDD\|341071	cd09608, M3B_PepF, Peptidase family M3B, oligopeptidase F (PepF). Peptidase family M3B oligopeptidase F (PepF; Pz-peptidase B; EC 3.4.24.-) is mostly bacterial and includes oligoendopeptidase F from Lactococcus lactis. This enzyme hydrolyzes peptides containing between 7 and 17 amino acids with fairly broad specificity. The PepF gene is duplicated in L. lactis on the plasmid that bears it, while a shortened second copy is found in Bacillus subtilis. Most bacterial PepFs are cytoplasmic endopeptidases; however, the Bacillus amyloliquefaciens PepF oligopeptidase is a secreted protein and may facilitate the process of sporulation. Specifically, the yjbG gene encoding the homolog of the PepF1 and PepF2 oligoendopeptidases of Lactococcus lactis has been identified in Bacillus subtilis as an inhibitor of sporulation initiation when over-expressed from a multicopy plasmid. This PepF family includes Streptococcus agalactiae PepB, a group B streptococcal oligopeptidase which has been shown to degrade a variety of bioactive peptides as well as the synthetic collagen-like substrate N-(3-[2-furyl]acryloyl)-Leu-Gly- Pro-Ala in vitro.	0
NC_011658.1\|WP_001081482.1\|1277028_1277667_+\|GTP-pyrophosphokinase-family-protein	gnl\|CDD\|225232	COG2357, COG2357, PpGpp synthetase catalytic domain [General function prediction only].	1.66713e-95
NC_011658.1\|WP_000191110.1\|1275901_1276480_-\|CYTH-domain-containing-protein	gnl\|CDD\|143627	cd07762, CYTH-like_Pase_1, Uncharacterized subgroup 1 of the CYTH-like superfamily. Enzymes belonging to the CYTH-like (also known as triphosphate tunnel metalloenzyme (TTM)-like) superfamily hydrolyze triphosphate-containing substrates, require metal cations as cofactors, and have a unique active site located at the center of an eight-stranded antiparallel beta barrel tunnel (the triphosphate tunnel). The name CYTH originated from the gene designation for bacterial class IV adenylyl cyclases (CyaB) and from thiamine triphosphatase. Class IV adenylate cyclases catalyze the conversion of ATP to 3',5'-cyclic AMP (cAMP) and PPi. Thiamine triphosphatase is a soluble cytosolic enzyme which converts thiamine triphosphate to thiamine diphosphate. This domain superfamily also contains RNA triphosphatases, membrane-associated polyphosphate polymerases, tripolyphosphatases, nucleoside triphosphatases, nucleoside tetraphosphatases and other proteins with unknown functions. Proteins of this subgroup are of bacterial origin and have not been characterized.	1.78128e-83
NC_011658.1\|WP_001272381.1\|1288940_1289627_+\|streptomycin-biosynthesis-protein-StrF	gnl\|CDD\|379345	pfam13712, Glyco_tranf_2_5, Glycosyltransferase like family. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.	4.7405e-109
NC_011658.1\|WP_001079095.1\|1278498_1279392_+\|RluA-family-pseudouridine-synthase	gnl\|CDD\|223638	COG0564, RluA, Pseudouridylate synthases, 23S RNA-specific [Translation, ribosomal structure and biogenesis].	6.99204e-99
NC_011658.1\|WP_000799204.1\|1269162_1270707_+\|cardiolipin-synthase	gnl\|CDD\|234967	PRK01642, cls, cardiolipin synthetase; Reviewed.	0
NC_011658.1\|WP_001004740.1\|1284086_1284845_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	4.45158e-20
NC_011658.1\|WP_000673184.1\|1277685_1278483_+\|NAD-kinase	gnl\|CDD\|235317	PRK04885, ppnK, inorganic polyphosphate/ATP-NAD kinase; Provisional.	0
NC_011658.1\|WP_001087862.1\|1288254_1288944_+\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|372616	pfam13489, Methyltransf_23, Methyltransferase domain. This family appears to be a methyltransferase domain.	3.95233e-18
NC_011658.1\|WP_000043379.1\|1275322_1275721_-\|hypothetical-protein	gnl\|CDD\|381281	cd14772, TrHb2_Bs-trHb-like_O, Truncated hemoglobins, group 2 (O); Bacillus subtilis TrHb like. The M- and S families exhibit the canonical secondary structure of hemoglobins, a 3-over-3 alpha-helical sandwich structure (3/3 Mb-fold), built by eight alpha-helical segments. Truncated hemoglobins (TrHbs, 2/2Hb, or 2/2 globins) or the T family globins adopt a 2-on-2 alpha-helical sandwich structure, resulting from extensive and complex modifications of the canonical 3-on-3 alpha-helical sandwich that are distributed throughout the whole protein molecule. TrHbs are classified into three main groups based on their structural properties and named after Mycobacterium sp. genes glbN, glbO, and glbP: TrHb1s (N), TrHb2s (O) and TrHb3s (P). TrHb2's belonging to this group include monomeric Bacillus subtilis trHb (Bs-trHb), which exhibits an extremely high oxygen affinity, and a dimeric TrHb2 from the thermophilic aerobic spore forming bacterium Geobacillus stearothermophilus(Gs-trHb).	2.09549e-70
NC_011658.1\|WP_000069694.1\|1285949_1286837_-\|hypothetical-protein	gnl\|CDD\|375999	pfam18573, BclA_C, BclA C-terminal domain. This is the C-terminal domain of BclA (Bacillus collagen-like protein of anthracis) which is expressed on spores of Bacillus species. Trimers of the C-terminal domain (CTD) form the tips of the spore's hair-like nap and are the immunodominant target of vertebrate antibodies and drive trimerization. Structure analysis indicate the C-terminal region of the peptide folding into an all-beta structure with a jelly-fold topology, similar to the first human complement C1q, a member of the tumor necrosis factor (TNF)-like family. The C-terminal globular domain has been shown to be located on the exterior of the exosporium, and therefore is critical in determining the immunogenicity of the spore in a mammalian host.	1.15219e-17
NC_011658.1\|WP_000655329.1\|1281841_1283002_-\|rod-shape-determining-protein-RodA	gnl\|CDD\|274033	TIGR02210, Rod_shape-determining_protein_RodA, rod shape-determining protein RodA. This protein is a member of the FtsW/RodA/SpoVE family (pfam01098). It is found only in species with rod (or spiral) shapes. In many species, mutation of rodA has been shown to correlate with loss of the normal rod shape. Note that RodA homologs are found, scoring below the cutoffs for this model, in a number of both rod-shaped and coccoid bacteria, including four proteins in Bacillus anthracis, for example. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan, Cellular processes, Cell division].	1.11727e-100
NC_011658.1\|WP_000427737.1\|1283144_1284080_-\|glycosyltransferase-family-2-protein	gnl\|CDD\|366154	pfam00535, Glycos_transf_2, Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.	1.2148e-22
NC_011658.1\|WP_000654997.1\|1289639_1290320_+\|streptomycin-biosynthesis-protein-StrF	gnl\|CDD\|379345	pfam13712, Glyco_tranf_2_5, Glycosyltransferase like family. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.	7.49705e-107
NC_011658.1\|WP_000932900.1\|1287002_1288103_+\|glycosyltransferase-family-2-protein	gnl\|CDD\|133005	cd02511, Beta4Glucosyltransferase, UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.	6.83297e-53
NC_011658.1\|WP_000360652.1\|1274429_1275323_-\|DsbA-family-protein	gnl\|CDD\|372699	pfam13743, Thioredoxin_5, Thioredoxin.	2.84958e-93

>NC_011658.1|WP_001079095.1|1278498_1279392_+|RluA-family-pseudouridine-synthase
MNRFTLKWDIDSAEEGTLVREFLKTKGISKAALTDIKFHGGSIEVNGQHASVRHQLQAGEELRVFFPVEERSEGMIAEDIPLCIVYEDDAVLVINKEANMSTIPSREHPAGSVANALLSHYDKRHLTSTVHIVTRLDRDTSGLMLIAKNRFVHHLLSKQHQQKAVKRTYEAIVHGEMVEREGTIDAPIGRKSDSIIERTVCEEGQRAVTHFRVIDSVNHKTHVSLELDTGRTHQIRVHMAYIGHPLLGDNLYGGKRDEMKRQALHSTSLTFYHPILEKEMSFTTPIPSDMQAVLRHT
>NC_011658.1|WP_000673184.1|1277685_1278483_+|NAD-kinase
MKFTIMSKGDQSSDALASTMKEYLLDFGFIMDEKEPDIVISVGGDGTLLYAFHRYYNRLDETAFVGVHTGHLGFYADWLPTEVEKLVIAIAKTPFQVVEYPLLEVIIRYVNGSKESQYLAMNEATVKSAEGTLVTEVEIRGEYFETFRGDGLCISTPSGSTAYNKALGGAIIHPSIEAIQIAEMASINNRVFRTVGSPLVLPKHHTCVLKPTAGMNLQITVDHLTMVHQDVKSIQYRVANEKVRFVRFRPFPFWKRVRDSFVADK
>NC_011658.1|WP_001081482.1|1277028_1277667_+|GTP-pyrophosphokinase-family-protein
MNRNWEEFLAPYHQAVAELKVKLKGMRTQFAMLTEHSPIEFVTGRVKSVASIIDKAEKRNVPLDRLREDMQDIAGLRMMCQFVDEIKPVVEYLRKRNDFEIVEERDYVTQKKDSGYRSYHVVISYPVQTIQGEQKVLVEIQIRTLAMNFWATIEHSLNYKYSGRFPEDIKIRLQRAAEAAFLLDEEMSSIRLEIQEAQKAFSRKQETKDSES
>NC_011658.1|WP_001180003.1|1276626_1276998_+|hypothetical-protein
MQNKIQVKSVEKRENALIFCAENSEIEVKELSARNHVLVDSDNLSFLYILENESSFIYVSIPHTCWEAMHEAMNNDVVMFVRVNDIEMELEGLKEEVEYLVENIEGNANYGEELVTAVEKVFL
>NC_011658.1|WP_000191110.1|1275901_1276480_-|CYTH-domain-containing-protein
MTQEIEIEFKNIVTEEEFNTLCKSFSIEGFTKQVNHYFETPSFSLKEAGSALRIRHKGETYTLTLKQPAEVGLLETHQVITADEARLMMETNTIIQGAVVDQLHTLQIPVSALTYMGSLTTERAETLFEGGTLVFDHSFYYNHDDYEIEFEVQDEEAGKAAFIHLLKQHDIPIRHTNNKVKRFFLAKQNKAR
>NC_011658.1|WP_000043379.1|1275322_1275721_-|hypothetical-protein
MSKQPMTPFEAIGGEQCIAILVDTFYSYVSKHPDLSPIFPDDLTETARKQKQFLTQYLGGPNLYTEEHGHPMLRARHLPFEITPKRAEAWLSCMEQAMDDTGVDGHIREFVFERLALTAQHMVNTPDETGEI
>NC_011658.1|WP_000360652.1|1274429_1275323_-|DsbA-family-protein
MDKQEAKHINMPSPSACEHKSVEAYLFIDPLCKDCWEIEPFIIKLWLEYGKYFSIRHIVTGKVDGTNASSHKWNKPANIRFVWEKTTSLQGFSCDGKVHMQEASSTPYLVSMAIKAAELQGRKAGSKFLRKLQEYIFLENVSNPDCELLLACAKDSNIDVEEFKKDLYSASAKKAFQCDLKFTNEMHITEIPSLVFFHANSDEEGIKIAGTYSYDVYVQLLKELVKCEIEPEPLPPLEVLLEATQFISSKEVAFIYDCSKQEIERELKKLQLKRKVQMIDVKCERYWKWIAKEKDLV
>NC_011658.1|WP_000003390.1|1272082_1273909_+|oligoendopeptidase-F
MSEQNTAKTLPDRNEIEESSTWRLEDIFQTDAEWEQEFQAIKELLPKLTEFKGKLGDSANNLLEALQYEDEISMRLGKLYTYAHMRYDQDTTNSVYQALNDRATNLYSQVSSSTAYIVPEILSISEDTLQTFLKENRDLSVYEHALEEITRQRPHVLSEAEEALLAEASEVMSASSNTFGMLNNADLKFPSIKGEDGEEVEITHGRYIQFLESDDRRVREDAFKAVYETYGKYKNTFASTLSGAVKRNNFNARVRKYDSARQAALSNNNIPEAVYDQLVQSVNDNLHLLHRYIDIRKRALGLDELHMYDLYTPLVPEVKMNVKYEEAQDMLLKSLHVLGDEYVDILKEAYENRWVDVYENKGKRSGAYSSGAYGTNPYILMNWHDNVNNLFTLAHEFGHSVHSYYTRKTQPHVYGDYSIFVAEVASTCNEALLNDYLLKTTEDKKERLYLLNHYLEGFRGTVFRQTMFAEFEHIIHKKVQEGHAVTPDMLTEIYYDLNKKYFGDALVIDEEIGLEWSRIPHFYYNYYVYQYATGFSAATALSKQILEEGQPAVERYINEFLKAGSSDYPIEVLKKAGVDMASPEPVKEALQVFEEKLNELEALLFEEK
>NC_011658.1|WP_000612261.1|1270787_1272032_+|competence-protein
MIPIFIAKRENGEKIHLLDHHDEELLHHMRKRESFFCIACGKEVLMRLGKQKRWHFAHKKVDSCLAFYEAESTYHMYGKELLYRWFKRQKVHVEIEHYLPEIQQRPDIFIERAGRKIAIEYQCANLSIEQLCKRTYSYWKAGIQVIWIIGGNQLKKHSAYWMKFSSIMAFSLQSYPQPLLIFFCSKQKSFMKCTFITSFFTSVAFSHIIYLPIETTTFEMLFSPVPFQREVLNREWKKRKDYFRQNALPILNYNDKSLLRLLYQCKCTPANFPSEIGVPLPSSFAFQTNSFIWQAFLYMKCIGELAVGDCISLKYVCSYIKKYTKRRMLPYFSQHIWKVAVTEYMTFLCYVGVLQRVGTYKYRKIRGISMLKTEEEVMKYDERSLAYALSLFEAKYNMREGKADIIKTDREGIT
>NC_011658.1|WP_000799204.1|1269162_1270707_+|cardiolipin-synthase
MKNTLKLIFFVLLLFALFVSLRMFIDVAFYSDVIGIKDVSILGIISILFTVSAFLIGCVIFLENRHPSKTLTWLIVLGIFPVFGFFAYLLFGQNFRRKRMFQKKALLDEQAFLQYKGHEDYEERILRNHKHQELLFRLADRLGALNISFQTETRTLTNGDETFQAILDGLKRAKHHIHMEYYIVRDDKLGTEIKDILIQKSKEGVVVRFLYDAVGSFKLSKSYIEELNDAGVEMIPFFPVRFPILNDKINYRNHRKIVIIDGNEGFVGGLNIGDEYLGKDKYFGFWRDTHLYLRGEAVQSLQLIFLQDWFYMTGEAVLAPEYLQAKAVEGEHWGGVQLVAGGPDNKWETIKHLYFAMIASARKSIWIATPYFIPDDDILSALKVAALAGIDVRLLMPSKPDKRTVFYASRSYFPELLDAGVKIYEYEKGFLHSKVVIVDSDLASIGTANMDMRSFHLNFEVNAFLYDTDSIRKLVQDFKDDLEESSEIHVDRFHKRRLHRRIVESTYRLLSPLL
>NC_011658.1|WP_000872720.1|1281026_1281767_-|bis(5'-nucleosyl)-tetraphosphatase-PrpE
MKYDIIGDIHGCLQEFQNLTEKLGYNWSSGLPVHPDQRKLAFVGDITDRGPHSLRMIEIVWELVIHKKVAYYAPGNHCNKLYRFFLGRNVTIAHGLETTVAEYEALPSHKQNMIKEKFITLYEQSPLYHVLDEKRLLVCHAGIRQDYIGRQDKKVQTFVLYGDITGEKHADGSPVRRDWAKEYKGTTWIVYGHTPVKEPRFVNHTVNIDTGAVFGGKLTGLRYPEMEIVSVPSSLPFVPEKFRPIS
>NC_011658.1|WP_000655329.1|1281841_1283002_-|rod-shape-determining-protein-RodA
MKDSNSQYQIDYVLLFILFAIGIVSCFAIASAQASLPSFLQHVNFVLKQIQWYFIGFIAIGIIMIIDFDRYQKIAWYLYSFALVLLIGLEFQVPGAVTIKGATAWYRLPGIGNFQPSEIMKLFLIIVIGRIIANHNEKYFYRTIQDDFLLLGKICATSLPPLLLIAKEPDLGNTMVISAMLAAMILVSGIRWRFIFGLASGIFAAGVTLTYIFFTHTKFFKAHILQEYQLNRFYGWLAPYKYDAQGYQLRQAFLATGSGEMQGKGWENGQVYFPEPHTDFIFTNVAEQFGFLGASVIIALFFLLIFRMIHIAIESNDPFGSYICAGTIGMFTFQVFQNIGMTIGLLPITGITLPLMSYGGSSLLTYMIAIGFVLNVRSRTKIFMFN
>NC_011658.1|WP_000427737.1|1283144_1284080_-|glycosyltransferase-family-2-protein
MENIKNVPLVSILIPTYNRPHYFKIALESALAQTYSNIEIIVGDDSTNNETEKLIYRDYLHKHKHITYIRNPSTLGQFHNALMLLEQSNGEYINFLMDDDIFYNNKIEKMMFYFQKDLDQNLALITSYRTWINDDGEIIEQHPSMNRLYDEDTLLNGKDLGNHMLILGQNIIGEPTTVLFRKRLLTEPFGTLNGRNYNCSVDMASWISLLSKGDAIYITEPLSSFRLHTGQQVHHKYLEGCEDFSHLVLHSKKYGFLQETDYYKTSLLKACEWYKNATTFYQLYPELIPTTDTHTRLSHCLNIVTKELHAI
>NC_011658.1|WP_001004740.1|1284086_1284845_-|class-I-SAM-dependent-methyltransferase
MNENEKKITLIPPPELVQYVGGHFEEVGKEFMQYFIEIGNLKSNETVLDVGCGIGRMAVPLMNYFSDDGNYYGFDLFNKGITWCKNNISTRRNNFHFEHVDIYNQFYNPDGKEDASQYKFPYEDESFDFIFLTSVFTHLLPKELEHYVREIARVLKKDGRCFITFFLINPESSYYLNAGLSPLGFYHQIDNCYVLNKDIPNFAVAYLEEDIRTLLNKYGLEMQTPPHYGSWCGRTEHTSYQDIILTQKISER
>NC_011658.1|WP_000428846.1|1284981_1285827_-|macrocin-O-methyltransferase
MENKSAVQLYLELLKKTILFEIWLEYEPYLPASLHISKELSYEPVTVPLPLFLKQYIENHNLKIVNPNVSNNERQGGKDWPRAAHSMVGRKRMNQLQEAMETVVKENIEGDFIETGVWRGGSCIFMNGFLQANNIKDRTVWVADSFEGLPAPNLEQYPKDYGDYLHTFDYLRVSLETVQENFRKYDLLNDQVKFLKGWFKDTLPSAPIEKIAIARLDGDMYESTMDSLVNLYDKVSIGGFIIIDDYGLITCAEAVTDFRSERNIKTPMTQIDDFGIFWRKE
>NC_011658.1|WP_000069694.1|1285949_1286837_-|hypothetical-protein
MSNNNYSDGLNPDESLSASAFDPNLVGPTLPPIPPFTLPTGPTGPTGPTGPTGPTVPTGPTGPTGPTGPTGPTGPTVPTGPTGSTGPTGPTGSTGPTGPTGPTGDTGATGPTGPTGTTGPTGPTGDTGTTGPTGPTGDTGATGPTGPTGPTGPTGPTGPSGLGLPAGLYAFNSAGISLDLGLNAPVPFNTVGSQFGTAISQLDADTFVISETGFYKITVIVYTAALSVLGGLTIQVNGVSVPGTGATLISVGAPIVVQAITQITTTPSLVEVIVTGLGLSLALGTSASIIIEKIA
>NC_011658.1|WP_000932900.1|1287002_1288103_+|glycosyltransferase-family-2-protein
MLNKQGITISLCMIVRDEEDTIGRCLDAVEKIVDEIIIVDTGSIDRTKEIVAQYTSNIYDFPWINDFAAARNFSFSKATQEYILWLDADDVLLEDAQEALKLLKRELDPKIDAVSMPYHLALDSSGKPLYCTKRNRLVKREKQFQWFGKVHEYLAISGETFSSNVAITHKKEKKVTNRNLKIFQNAVAAGEELSPRDLFYYANESMDNQKYDDAVMLYETFLNQDEGWYEEKIYACGKLGDCYAKLGSWEKAIESCVKSFRYDVPRGENCTRIGYIYMEQQKYNEAIFWFKLATEVPMATESPFHSPASYTWLPYLQMCICYSKLGDQDKAYYYNELAAAYVPNNAAIEYNRKYFRSVFDKQYKSL
>NC_011658.1|WP_001087862.1|1288254_1288944_+|class-I-SAM-dependent-methyltransferase
MNSPKNSLYEEKSGHYYNAVNPNLLKHIKKEWKEVLDIGCSSGALGAAIKENGTRVSGIEAFPEAAEQAKEKLDHVVLGDIETMDMPYEEEQFDCVIFGDVLEHLFDPWAVIEKVKPYIKENGVILASIPNVAHISVLAPLLAGNWTYTEYGLLDKTHIRFFTFNEMLRMFLKAGYSISKVDRVYIDHKVYEPLIEELYGICKKYRLGSGFMAETVVFQYIIEAEKSQL
>NC_011658.1|WP_001272381.1|1288940_1289627_+|streptomycin-biosynthesis-protein-StrF
MSAGEKTILFVTCINDRKMYAQCVRHILRLAVPPGYIVQFMPIRNAKSMTSGYNQAISHPAKYKVYIHQDVFIMNVAFLYGLLQLFNEHEHLGMIGMIGAQYVPPNGIWNEGKGVVGKVIGYMNDLFYMATQEQPYHESKTFMPVECIDGLLMATQYDIPWREDLFDGFDYYDVSQSFEFRKAGYTVGVPVQRDAWCIHYHIDVNMTNYDKYRKIFVENYMSDVNQDE
>NC_011658.1|WP_000654997.1|1289639_1290320_+|streptomycin-biosynthesis-protein-StrF
MKDRTILVVVCVNNEELFEQCERQIRNLFVPPDYVVQIFPIRDAKSMASAYNRALSYPAKYKVYIHQDTYLINREMFYTLISLFKDNEKLGLIGVAGAQFLPSNGIWWEGKNLVGKVIEYRRRNYQLLNLDQGFYGSQSFMSVQAIDGLFMATQYDIPWREDLFQGFHFYDVSQSLEFQRAGYLIGIPNQSNLWCIHYNGDEFDADTYEKDRKVFVEQYKDILSPS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NC_011658_1	1.3\|1280281\|17\|NC_011658\|CRISPRCasFinder	1280281-1280297	17	NC_011658.1	2131485-2131501	1	0.941

1. spacer 1.3|1280281|17|NC_011658|CRISPRCasFinder matches to position: 2131485-2131501, mismatch: 1, identity: 0.941

aaagaaccttttgcatg	CRISPR spacer
aaaggaccttttgcatg	Protospacer
****.************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

267146 : 275095

uncultured_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000917306.1\|267146_267431_+	co-chaperone GroES	A0A221S3C8	uncultured_virus	1.2e-20	53.8
WP_001029999.1\|267469_269104_+	chaperonin GroEL	A0A219YK78	uncultured_virus	2.0e-157	58.2
WP_000743925.1\|269511_271050_+	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	6.8e-22	31.2
WP_000833093.1\|271434_272760_+	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	5.4e-44	29.5
WP_001262951.1\|272904_273606_+	response regulator transcription factor	W8CYM9	Bacillus_phage	7.3e-40	36.9
WP_000719191.1\|273589_275095_+	aminopeptidase AmpS	W8CYF6	Bacillus_phage	2.4e-32	31.3

DBSCAN-SWA_2

320451 : 328824

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000625677.1\|320451_321759_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	4.9e-21	25.5
WP_001170542.1\|321847_322567_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	G8EYA2	Synechococcus_phage	5.2e-49	44.3
WP_000278826.1\|322559_322814_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_000666779.1\|322810_323494_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_000055586.1\|323477_325697_+	phosphoribosylformylglycinamidine synthase II	A6N228	Microbacterium_phage	1.3e-162	41.2
WP_000879038.1\|325681_327097_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	4.3e-55	35.4
WP_001262449.1\|327199_328240_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	1.6e-67	45.9
WP_000088580.1\|328236_328824_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	4.5e-27	37.1

DBSCAN-SWA_3

575472 : 624490

Bacillus_phage(92.59%)

portal,tRNA,tail,transposase,head,capsid,terminase,integrase,protease

attL 594654:594669|attR 627569:627584

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000859069.1\|575472_577020_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	D5GVD8	Campylobacter_virus	3.5e-10	27.2
WP_000345218.1\|577268_578411_+\|tRNA	tRNA epoxyqueuosine(34) reductase QueG	NA	NA	NA	NA
WP_000260539.1\|578455_579343_+	amidase domain-containing protein	NA	NA	NA	NA
WP_000538147.1\|579401_579890_+\|tRNA	tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL	NA	NA	NA	NA
WP_000664307.1\|580017_582087_+	phosphodiesterase	NA	NA	NA	NA
WP_000353279.1\|582479_584375_+	PrkA family serine protein kinase	A0MN77	Thermus_phage	1.2e-100	36.2
WP_000503503.1\|584822_585923_+	sporulation protein YhbH	A0A140HLI1	Bacillus_phage	8.3e-22	44.1
WP_000286206.1\|585907_587458_-	recombinase	D2XR37	Bacillus_phage	2.2e-254	100.0
WP_000377560.1\|587619_587799_+	hypothetical protein	D2XR40	Bacillus_phage	1.3e-17	75.0
WP_000351743.1\|587795_588230_-	ImmA/IrrE family metallo-endopeptidase	D2XR38	Bacillus_phage	4.2e-78	100.0
WP_000885769.1\|588248_588668_-	helix-turn-helix transcriptional regulator	D2XR39	Bacillus_phage	1.4e-67	100.0
WP_001071961.1\|588820_589042_+	helix-turn-helix transcriptional regulator	A0A142LP09	Marinitoga_camini_virus	9.1e-05	39.0
WP_000111278.1\|589050_589260_+	hypothetical protein	D2XR40	Bacillus_phage	2.6e-30	100.0
WP_000537281.1\|589301_589889_+	hypothetical protein	D2XR41	Bacillus_phage	4.7e-109	100.0
WP_000215307.1\|589901_590123_+	hypothetical protein	NA	NA	NA	NA
WP_000796000.1\|590305_590590_+	hypothetical protein	D2XR42	Bacillus_phage	1.1e-47	100.0
WP_000312146.1\|590875_591811_+	DnaD domain protein	D2XR43	Bacillus_phage	1.3e-164	100.0
WP_000063893.1\|591807_593130_+	replicative DNA helicase	D2XR44	Bacillus_phage	4.9e-247	100.0
WP_000926803.1\|593132_593321_+	hypothetical protein	D2XR45	Bacillus_phage	6.7e-25	100.0
WP_000604169.1\|593295_593565_+	hypothetical protein	D2XR46	Bacillus_phage	8.9e-47	100.0
WP_000549518.1\|593557_593920_+	hypothetical protein	D2XR47	Bacillus_phage	2.7e-62	100.0
WP_000974683.1\|593993_594185_+	DUF3954 domain-containing protein	D2XR48	Bacillus_phage	6.6e-28	98.4
WP_000778212.1\|594206_594722_+	dUTP diphosphatase	D2XR49	Bacillus_phage	2.3e-91	100.0
594654:594669	attL	NA	NA	NA	NA
WP_000397935.1\|594760_595030_+	hypothetical protein	D2XR50	Bacillus_phage	2.4e-44	100.0
WP_001099200.1\|595200_595509_+	hypothetical protein	D2XR51	Bacillus_phage	8.7e-54	100.0
WP_001002761.1\|595536_596211_+	hypothetical protein	D2XR52	Bacillus_phage	2.3e-131	100.0
WP_001216585.1\|596527_596749_+	hypothetical protein	D2XR53	Bacillus_phage	2.0e-36	100.0
WP_000399082.1\|596781_596964_+	hypothetical protein	D2XR54	Bacillus_phage	4.6e-31	100.0
WP_000243721.1\|597332_598052_+	hypothetical protein	D2XR55	Bacillus_phage	1.8e-134	100.0
WP_000854065.1\|598088_598298_+	hypothetical protein	NA	NA	NA	NA
WP_000389465.1\|598417_598693_+	hypothetical protein	A0A1B1P870	Bacillus_phage	1.2e-46	100.0
WP_000698669.1\|599150_599354_+	hypothetical protein	NA	NA	NA	NA
WP_000436952.1\|599493_599964_+	ArpU family transcriptional regulator	D2XR57	Bacillus_phage	2.8e-80	100.0
WP_001012140.1\|599960_600503_+\|integrase	site-specific integrase	D2XR58	Bacillus_phage	4.2e-96	100.0
WP_154231611.1\|600825_601014_+	hypothetical protein	D2XR59	Bacillus_phage	1.9e-27	100.0
WP_000778982.1\|601077_601296_+	hypothetical protein	D2XR60	Bacillus_phage	1.3e-32	100.0
WP_001014577.1\|601302_601575_+	hypothetical protein	NA	NA	NA	NA
WP_033693556.1\|601570_601906_+	HNH endonuclease	D2XR61	Bacillus_phage	3.7e-58	99.1
WP_000301146.1\|602029_602341_+\|terminase	terminase	D2XR14	Bacillus_phage	7.2e-48	100.0
WP_000621039.1\|602337_604005_+\|terminase	terminase large subunit	D2XR15	Bacillus_phage	0.0e+00	100.0
WP_041926159.1\|604013_605159_+\|portal	phage portal protein	D2XR16	Bacillus_phage	5.6e-207	100.0
WP_041926354.1\|605158_605902_+\|protease	Clp protease ClpP	D2XR17	Bacillus_phage	3.2e-134	100.0
WP_000234878.1\|605905_607057_+\|capsid	phage major capsid protein	D2XR18	Bacillus_phage	1.6e-217	100.0
WP_001098847.1\|607062_607356_+	hypothetical protein	D2XR19	Bacillus_phage	2.3e-48	100.0
WP_001247290.1\|607357_607708_+\|head	phage head closure protein	D2XR20	Bacillus_phage	8.3e-61	100.0
WP_000997562.1\|607709_608051_+	HK97 gp10 family phage protein	D2XR21	Bacillus_phage	5.4e-57	100.0
WP_000172093.1\|608050_608380_+	hypothetical protein	D2XR22	Bacillus_phage	4.0e-57	100.0
WP_001031290.1\|608380_608977_+\|tail	phage tail protein	D2XR23	Bacillus_phage	1.8e-111	100.0
WP_000415937.1\|608983_609328_+	hypothetical protein	D2XR24	Bacillus_phage	6.9e-60	100.0
WP_000338226.1\|609396_609546_+	hypothetical protein	Q0H231	Geobacillus_phage	7.4e-11	61.2
WP_000918796.1\|609563_610775_+	hypothetical protein	D2XR25	Bacillus_phage	3.2e-216	100.0
WP_157407103.1\|611284_613645_+\|tail	phage tail tape measure protein	D2XR26	Bacillus_phage	1.1e-191	100.0
WP_000094118.1\|613686_615162_+\|tail	phage tail protein	D2XR27	Bacillus_phage	1.5e-297	100.0
WP_001260212.1\|615158_619916_+	peptidase S74	D2XR28	Bacillus_phage	0.0e+00	100.0
WP_000434603.1\|620043_620739_+	hypothetical protein	D2XR29	Bacillus_phage	8.1e-124	100.0
WP_000822833.1\|620946_621906_+\|integrase	tyrosine-type recombinase/integrase	D2XR30	Bacillus_phage	6.2e-183	99.7
WP_000151211.1\|621920_622202_+	hypothetical protein	D2XR31	Bacillus_phage	1.2e-41	100.0
WP_000159645.1\|622204_622411_+	hypothetical protein	D2XR32	Bacillus_phage	2.5e-33	100.0
WP_000542512.1\|622410_623220_+	N-acetylmuramoyl-L-alanine amidase	D2XR33	Bacillus_phage	5.4e-164	100.0
WP_000713104.1\|623410_623923_-	hypothetical protein	D2XR34	Bacillus_phage	7.4e-50	100.0
WP_000632231.1\|624018_624267_-	hypothetical protein	D2XR35	Bacillus_phage	4.1e-38	100.0
WP_002170333.1\|624241_624490_-	winged helix DNA-binding protein	D2XR36	Bacillus_phage	6.8e-41	100.0
627569:627584	attR	NA	NA	NA	NA

DBSCAN-SWA_4

902766 : 942997

Mycobacterium_phage(40.0%)

coat,protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000265278.1\|902766_903336_-\|coat	spore coat protein CotJC	NA	NA	NA	NA
WP_001075543.1\|903348_903612_-\|coat	spore coat protein CotJB	NA	NA	NA	NA
WP_000362188.1\|903620_903836_-\|coat	spore coat associated protein CotJA	NA	NA	NA	NA
WP_014297665.1\|903930_904290_+	lactoylglutathione lyase	NA	NA	NA	NA
WP_000440985.1\|904304_905084_+	DUF2935 domain-containing protein	A0A2I2L551	Orpheovirus	2.0e-38	35.2
WP_000557764.1\|905101_905914_-	Ku protein	A0A249XRB2	Mycobacterium_phage	3.3e-28	31.1
WP_000733844.1\|906254_906536_+	DUF1232 domain-containing protein	NA	NA	NA	NA
WP_000437068.1\|906553_907159_+	DedA family protein	NA	NA	NA	NA
WP_001055915.1\|907313_908744_+\|transposase	IS4-like element ISBce2 family transposase	NA	NA	NA	NA
WP_000742049.1\|908917_909298_+	DUF3992 domain-containing protein	NA	NA	NA	NA
WP_000526007.1\|909312_909666_+	DUF3992 domain-containing protein	NA	NA	NA	NA
WP_000802321.1\|909768_910236_-	hypothetical protein	NA	NA	NA	NA
WP_000442459.1\|910545_913005_+	purple acid phosphatase	NA	NA	NA	NA
WP_000391504.1\|913084_913288_+	hypothetical protein	NA	NA	NA	NA
WP_000838719.1\|913499_914903_-	amino acid permease	NA	NA	NA	NA
WP_116869329.1\|915077_916289_+	cation:proton antiporter	NA	NA	NA	NA
WP_001223244.1\|916415_916730_+	hypothetical protein	NA	NA	NA	NA
WP_000648157.1\|916759_917623_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_000892365.1\|917776_918661_+	N-acetylmuramic acid 6-phosphate etherase	NA	NA	NA	NA
WP_000711319.1\|918685_920050_+	PTS transporter subunit EIIC	NA	NA	NA	NA
WP_000580609.1\|920098_921163_+	DUF871 domain-containing protein	NA	NA	NA	NA
WP_001077751.1\|921323_921728_+	DoxX family protein	NA	NA	NA	NA
WP_000045925.1\|921882_922284_+	ketosteroid isomerase	NA	NA	NA	NA
WP_000897971.1\|922283_922769_+	hypothetical protein	G3MB13	Bacillus_virus	7.9e-09	28.3
WP_001146277.1\|922803_923715_-	DMT family transporter	NA	NA	NA	NA
WP_000446103.1\|923920_924415_+	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_000686672.1\|924543_924999_+	N-acetyltransferase	NA	NA	NA	NA
WP_000796021.1\|925352_925697_+	multidrug efflux SMR transporter	NA	NA	NA	NA
WP_000539674.1\|925699_926014_+	multidrug efflux SMR transporter	NA	NA	NA	NA
WP_001993037.1\|926166_926745_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_000742940.1\|926957_928160_+	MFS transporter	NA	NA	NA	NA
WP_000997911.1\|928193_928538_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_000420689.1\|928697_929201_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_000680551.1\|929360_930470_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_000528112.1\|930522_931965_+	multidrug efflux MFS transporter	A0A0M3UL24	Mycobacterium_phage	1.5e-10	22.5
WP_000797638.1\|932093_933047_-	alpha/beta hydrolase	S4W4Z4	Pandoravirus	2.5e-19	31.1
WP_000797646.1\|933090_934032_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_000549137.1\|934518_935103_-	TetR family transcriptional regulator	NA	NA	NA	NA
WP_000856909.1\|935260_936487_+	cytochrome P450	NA	NA	NA	NA
WP_000064553.1\|936675_937230_+	TetR family transcriptional regulator	NA	NA	NA	NA
WP_000642452.1\|937437_938460_+	2,3-butanediol dehydrogenase	NA	NA	NA	NA
WP_000175816.1\|938781_940203_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_000169642.1\|940639_941230_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_000604767.1\|941609_942074_-	DUF523 domain-containing protein	NA	NA	NA	NA
WP_000008142.1\|942346_942997_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA

DBSCAN-SWA_5

1920784 : 1930114

Bacillus_phage(71.43%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000755553.1\|1920784_1922065_+	C40 family peptidase	A0A1V0DZX6	Clostridioides_phage	4.5e-11	31.5
WP_001194312.1\|1922162_1922927_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_000453859.1\|1923166_1924927_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	4.2e-270	96.7
WP_000937026.1\|1925015_1925693_+	response regulator transcription factor	W8CYM9	Bacillus_phage	2.6e-119	94.7
WP_001254317.1\|1925689_1926763_+	sensor histidine kinase	W8CYF6	Bacillus_phage	1.3e-176	90.5
WP_000818985.1\|1927570_1928290_+	3-ketoacyl-ACP reductase	W8CYX9	Bacillus_phage	5.9e-61	100.0
WP_000061722.1\|1928437_1929109_+	O-methyltransferase	W8CYT3	Bacillus_phage	7.7e-63	89.8
WP_001258509.1\|1929241_1930114_+	aminoglycoside 6-adenylyltransferase	A0A1X9I6F2	Streptococcus_phage	6.5e-62	42.5

DBSCAN-SWA_6

2058876 : 2102315

Bacillus_phage(96.3%)

portal,integrase,tail,head,terminase,capsid,protease

attL 2092241:2092256|attR 2097320:2097335

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000588613.1\|2058876_2060046_+	DEAD/DEAH box helicase	A0A1V0SBR7	Catovirus	2.2e-41	29.6
WP_000581460.1\|2060169_2060355_+	lactoylglutathione lyase	NA	NA	NA	NA
WP_000675867.1\|2060428_2061538_-\|integrase	site-specific integrase	A0A0U3U8Y8	Bacillus_phage	3.9e-181	100.0
WP_000803132.1\|2061836_2063030_+	helix-turn-helix transcriptional regulator	A0A0U3TNF6	Bacillus_phage	2.6e-215	100.0
WP_000481767.1\|2063438_2063792_-	helix-turn-helix transcriptional regulator	A0A0U3SD25	Bacillus_phage	3.9e-58	100.0
WP_000854265.1\|2063993_2064179_+	helix-turn-helix transcriptional regulator	A0A0U3SLC2	Bacillus_phage	3.7e-28	100.0
WP_033670234.1\|2064334_2064610_+	helix-turn-helix domain-containing protein	A0A0U3ULL9	Bacillus_phage	1.4e-42	100.0
WP_001151931.1\|2065040_2065931_+	hypothetical protein	A0A0U3TZZ4	Bacillus_phage	1.6e-148	99.3
WP_001171109.1\|2065945_2066860_+	AAA family ATPase	A0A0U3U1U1	Bacillus_phage	2.0e-170	100.0
WP_000338031.1\|2066872_2067067_+	hypothetical protein	A0A0U3K3J8	Bacillus_phage	5.9e-24	82.8
WP_000799086.1\|2067083_2067362_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	A0A2I7SC16	Paenibacillus_phage	7.9e-14	62.7
WP_001125952.1\|2067354_2067714_+	hypothetical protein	A0A1B1P7A1	Bacillus_phage	1.1e-31	53.3
WP_000717826.1\|2067732_2067900_+	DUF3954 domain-containing protein	A0A1B0T6B8	Bacillus_phage	1.4e-13	62.3
WP_000109486.1\|2067925_2068177_+	hypothetical protein	A0A1B1P7W1	Bacillus_phage	2.6e-16	51.3
WP_001102009.1\|2068196_2068679_+	nucleoside triphosphate pyrophosphohydrolase family protein	A0A0U4IBD0	Bacillus_phage	8.9e-21	49.5
WP_001030638.1\|2069203_2069749_+	hypothetical protein	A0A2I6UHP6	Bacillus_phage	1.8e-41	53.6
WP_001002761.1\|2069776_2070451_+	hypothetical protein	D2XR52	Bacillus_phage	2.3e-131	100.0
WP_001216585.1\|2070767_2070989_+	hypothetical protein	D2XR53	Bacillus_phage	2.0e-36	100.0
WP_000661412.1\|2071026_2071254_+	hypothetical protein	A0A218KCK2	Bacillus_phage	5.3e-24	65.3
WP_000439567.1\|2071288_2071486_+	hypothetical protein	NA	NA	NA	NA
WP_000678894.1\|2071519_2071783_+	hypothetical protein	A0A0U3K3K8	Bacillus_phage	1.8e-39	100.0
WP_000033082.1\|2072003_2072252_+	helix-turn-helix transcriptional regulator	A0A0U3J7D7	Bacillus_phage	2.0e-40	98.8
WP_001061241.1\|2072574_2072706_+	DUF3983 domain-containing protein	A0A1B1P7V8	Bacillus_phage	4.8e-14	97.7
WP_001209121.1\|2073004_2073478_+	ArpU family transcriptional regulator	A0A1B1P7X5	Bacillus_phage	4.0e-82	100.0
WP_001055139.1\|2073474_2074017_+\|integrase	tyrosine-type recombinase/integrase	A0A1B1P7Y2	Bacillus_phage	5.5e-96	100.0
WP_000443968.1\|2074617_2074992_+	hypothetical protein	A0A0A7AQ61	Bacillus_phage	1.2e-38	85.4
WP_000002729.1\|2074984_2075239_+	hypothetical protein	W8CZ42	Bacillus_phage	1.6e-05	64.6
WP_000761540.1\|2075262_2075475_+	hypothetical protein	A0A1B1P8F3	Bacillus_phage	1.1e-28	95.7
WP_001992786.1\|2075920_2076136_+	endonuclease	A0A1B1P8D2	Bacillus_phage	3.1e-34	98.6
WP_000357495.1\|2076296_2076677_+\|terminase	phage terminase small subunit P27 family	A0A1B1P7R2	Bacillus_phage	2.2e-67	100.0
WP_000633618.1\|2076657_2078430_+\|terminase	terminase large subunit	A0A1B1P7R3	Bacillus_phage	0.0e+00	99.5
WP_000767176.1\|2078445_2079660_+\|portal	phage portal protein	A0A0U3SQF0	Bacillus_phage	4.7e-236	100.0
WP_001107318.1\|2079637_2080393_+\|protease	Clp protease ClpP	A0A0U3U021	Bacillus_phage	9.6e-139	99.6
WP_000782636.1\|2080389_2081577_+\|capsid	phage major capsid protein	A0A1B1P7R4	Bacillus_phage	1.8e-216	100.0
WP_033679183.1\|2081635_2081854_+	fibronectin type III domain-containing protein	NA	NA	NA	NA
WP_000891191.1\|2081862_2082138_+\|head,tail	phage gp6-like head-tail connector protein	A0A1B1P7Q8	Bacillus_phage	8.0e-43	98.9
WP_001069940.1\|2082124_2082472_+\|head	phage head closure protein	A0A1B1P7T4	Bacillus_phage	8.2e-61	99.1
WP_000852722.1\|2082459_2082897_+	HK97 gp10 family phage protein	A0A1B1P7R6	Bacillus_phage	1.2e-77	100.0
WP_001211423.1\|2082893_2083253_+	hypothetical protein	A0A1B1P7S7	Bacillus_phage	2.8e-64	99.2
WP_000952020.1\|2083266_2083851_+\|tail	tail protein	A0A1B1P7S4	Bacillus_phage	5.2e-108	100.0
WP_001157384.1\|2083910_2084306_+	hypothetical protein	A0A1B1P7S9	Bacillus_phage	3.9e-59	100.0
WP_000938712.1\|2084323_2084464_+	hypothetical protein	A0A1B1P7R9	Bacillus_phage	1.5e-18	100.0
WP_000896623.1\|2084479_2089495_+\|tail	phage tail tape measure protein	A0A1B1P7S6	Bacillus_phage	0.0e+00	99.4
WP_000094086.1\|2089531_2091004_+\|tail	phage tail protein	H0USX4	Bacillus_phage	3.2e-231	78.5
WP_001260175.1\|2091000_2095026_+	hypothetical protein	H0USX5	Bacillus_phage	0.0e+00	85.8
2092241:2092256	attL	NA	NA	NA	NA
WP_000434602.1\|2095151_2095847_+	hypothetical protein	D2XR29	Bacillus_phage	1.8e-123	99.6
WP_000822837.1\|2096054_2097014_+\|integrase	tyrosine-type recombinase/integrase	D2XR30	Bacillus_phage	5.5e-171	93.1
WP_000151211.1\|2097028_2097310_+	hypothetical protein	D2XR31	Bacillus_phage	1.2e-41	100.0
WP_000159644.1\|2097312_2097519_+	hypothetical protein	D2XR32	Bacillus_phage	1.6e-32	98.5
2097320:2097335	attR	NA	NA	NA	NA
WP_000542512.1\|2097518_2098328_+	N-acetylmuramoyl-L-alanine amidase	D2XR33	Bacillus_phage	5.4e-164	100.0
WP_000340446.1\|2098383_2098590_-	helix-turn-helix domain-containing protein	A0A1B1P7S8	Bacillus_phage	8.4e-29	100.0
WP_000427397.1\|2098894_2099287_+	hypothetical protein	A0A1B1P7T3	Bacillus_phage	6.9e-72	100.0
WP_000488699.1\|2099299_2099626_+	hypothetical protein	A0A1B1P7T1	Bacillus_phage	2.7e-53	100.0
WP_002027563.1\|2099635_2100793_+	DNA translocase FtsK	A0A1B1P7T5	Bacillus_phage	6.3e-222	100.0
WP_012580673.1\|2100797_2101433_+	hypothetical protein	A0A0U3J2H0	Bacillus_phage	4.2e-119	99.5
WP_001287580.1\|2101453_2101669_+	hypothetical protein	A0A0U3TKC9	Bacillus_phage	4.1e-34	100.0
WP_000473087.1\|2101721_2102315_-	hypothetical protein	A0A0U3TZ58	Bacillus_phage	5.9e-99	100.0

DBSCAN-SWA_7

2634898 : 2643241

Geobacillus_phage(28.57%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000795732.1\|2634898_2636266_-	chitin-binding protein	A0A0K1Y848	Apis_mellifera_filamentous_virus	7.4e-20	38.1
WP_000124904.1\|2636623_2637817_-	glycosyl transferase family 1	Q0IKX4	Leucania_separata_nucleopolyhedrovirus	4.8e-07	26.8
WP_001058134.1\|2637902_2638583_-	SUMF1/EgtB/PvdO family nonheme iron enzyme	A0A075BUR2	Microcystis_phage	1.7e-30	38.2
WP_000720544.1\|2638729_2639233_-	DNA topology modulation protein	A0A097BYE2	Leuconostoc_phage	4.3e-42	45.5
WP_001093431.1\|2639254_2639641_-	DUF2809 domain-containing protein	NA	NA	NA	NA
WP_000655489.1\|2639706_2640414_-	class I SAM-dependent methyltransferase	A0A1X9I6N4	Streptococcus_phage	2.0e-16	26.5
WP_000648514.1\|2640435_2640789_-	MmcQ/YjbR family DNA-binding protein	NA	NA	NA	NA
WP_000288952.1\|2640802_2641210_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_000714650.1\|2641640_2643026_+	MBL fold metallo-hydrolase	Q0H255	Geobacillus_phage	2.7e-78	59.9
WP_000820162.1\|2643028_2643241_+	DUF3006 domain-containing protein	Q0H256	Geobacillus_phage	1.1e-12	54.4

DBSCAN-SWA_8

3701859 : 3782878

Bacillus_phage(59.26%)

holin,portal,plate,tRNA,tail,transposase,head,capsid,terminase,integrase,protease

attL 3752528:3752544|attR 3780828:3780844

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000455936.1\|3701859_3704625_-\|tRNA	isoleucine--tRNA ligase	A0A2K9L9X8	Tupanvirus	7.0e-86	27.1
WP_001131612.1\|3704972_3705479_-	septum site-determining protein DivIVA	NA	NA	NA	NA
WP_000029725.1\|3705568_3706336_-	RNA-binding protein	NA	NA	NA	NA
WP_000450919.1\|3706351_3706615_-	YggT family protein	NA	NA	NA	NA
WP_000119138.1\|3706621_3707092_-	cell division protein SepF	NA	NA	NA	NA
WP_000218169.1\|3707111_3707786_-	YggS family pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_001209000.1\|3707782_3708601_-	peptidoglycan editing factor PgeF	NA	NA	NA	NA
WP_001993471.1\|3708719_3709004_-	YlmC/YmxH family sporulation protein	NA	NA	NA	NA
WP_000197753.1\|3709171_3709951_-	RNA polymerase sporulation sigma factor SigG	A0A0Y0AU18	Bacillus_phage	5.8e-46	43.5
WP_000976948.1\|3710108_3710828_-	RNA polymerase sporulation sigma factor SigE	A0A2H4JC68	uncultured_Caudovirales_phage	3.3e-19	42.9
WP_000261978.1\|3710847_3711765_-	sigma-E processing peptidase SpoIIGA	NA	NA	NA	NA
WP_000888991.1\|3712080_3713235_-	cell division protein FtsZ	NA	NA	NA	NA
WP_001087555.1\|3713274_3714582_-	cell division protein FtsA	NA	NA	NA	NA
WP_000798230.1\|3714982_3715753_-	cell division protein DivIB	NA	NA	NA	NA
WP_000437043.1\|3715851_3716757_-	UDP-N-acetylmuramate dehydrogenase	NA	NA	NA	NA
WP_001265415.1\|3716818_3717913_-	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase	NA	NA	NA	NA
WP_000753510.1\|3718017_3719109_-	stage V sporulation protein E	NA	NA	NA	NA
WP_000860123.1\|3719199_3720552_-	UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase	NA	NA	NA	NA
WP_000893058.1\|3720552_3721527_-	phospho-N-acetylmuramoyl-pentapeptide- transferase	NA	NA	NA	NA
WP_000766298.1\|3721549_3723025_-	UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2, 6-diaminopimelate ligase	NA	NA	NA	NA
WP_001266227.1\|3723233_3725150_-	stage V sporulation protein D	NA	NA	NA	NA
WP_000600097.1\|3725231_3727331_-	penicillin-binding protein	NA	NA	NA	NA
WP_000067081.1\|3727403_3727766_-	cell division protein FtsL	NA	NA	NA	NA
WP_000481790.1\|3727781_3728714_-	16S rRNA (cytosine(1402)-N(4))-methyltransferase RsmH	NA	NA	NA	NA
WP_000403053.1\|3729082_3730699_-	bacillithiol biosynthesis cysteine-adding enzyme BshC	NA	NA	NA	NA
WP_000782393.1\|3730778_3731669_-	2-dehydropantoate 2-reductase	NA	NA	NA	NA
WP_000506707.1\|3731962_3732436_+	N-acetyltransferase	NA	NA	NA	NA
WP_000246478.1\|3732470_3732977_-	RsfA family transcriptional regulator	G3MB11	Bacillus_virus	1.0e-11	35.5
WP_001984764.1\|3733106_3733280_-	50S ribosomal protein L32	NA	NA	NA	NA
WP_000872145.1\|3733341_3733842_-	DUF177 domain-containing protein	NA	NA	NA	NA
WP_000105686.1\|3734115_3734733_-	hypothetical protein	A0A288WFQ7	Bacillus_phage	4.7e-83	79.5
WP_000571542.1\|3734674_3735859_-	cell division protein FtsK	H0USY1	Bacillus_phage	2.4e-144	62.8
WP_000156986.1\|3735977_3736160_-	hypothetical protein	A0A288WGN6	Bacillus_phage	2.4e-19	78.3
WP_001267642.1\|3736156_3736459_-	hypothetical protein	H0USY0	Bacillus_phage	3.1e-24	54.6
WP_001237237.1\|3736643_3736865_+	helix-turn-helix transcriptional regulator	Q2I8E4	Bacillus_phage	1.0e-27	89.0
WP_000277067.1\|3736857_3737349_+	hypothetical protein	Q3HL01	Bacillus_phage	1.0e-64	85.9
WP_000501729.1\|3737386_3738172_-	N-acetylmuramoyl-L-alanine amidase	A0A1B1P7T9	Bacillus_phage	6.1e-35	83.1
WP_000787573.1\|3738188_3738419_-\|holin	phage holin	A0A0S2MVE8	Bacillus_phage	1.4e-32	94.7
WP_001115042.1\|3738461_3738701_-	peptidase	A0A1B1P7E0	Bacillus_phage	7.4e-37	100.0
WP_000822821.1\|3738716_3739676_-\|integrase	tyrosine-type recombinase/integrase	D2XR30	Bacillus_phage	2.7e-170	91.8
WP_000323294.1\|3739919_3740537_-	hypothetical protein	A0A1B1P882	Bacillus_phage	3.7e-72	76.5
WP_001103319.1\|3740549_3740987_-	hypothetical protein	A0A1B1P8A7	Bacillus_phage	1.3e-79	100.0
WP_000143306.1\|3741028_3742522_-\|plate	BppU family phage baseplate upper protein	A0A1B1P899	Bacillus_phage	6.5e-280	99.4
WP_000587965.1\|3742567_3743689_-	hypothetical protein	A0A0K2CZQ1	Paenibacillus_phage	1.2e-57	38.1
WP_000896731.1\|3743700_3744543_-	hypothetical protein	A0A0K2CZJ3	Paenibacillus_phage	1.5e-18	29.4
WP_001231933.1\|3744567_3745440_-\|tail	phage tail family protein	NA	NA	NA	NA
WP_001173496.1\|3745436_3750419_-\|tail	phage tail protein	A0A2H4JI37	uncultured_Caudovirales_phage	0.0e+00	78.2
WP_000705185.1\|3750582_3750957_-	hypothetical protein	A0A2H4JBU8	uncultured_Caudovirales_phage	2.3e-53	83.9
WP_001251817.1\|3751018_3751591_-\|tail	tail protein	A0A2H4JET9	uncultured_Caudovirales_phage	8.2e-98	95.1
WP_001243514.1\|3751606_3751969_-	DUF3168 domain-containing protein	A0A2H4JBW1	uncultured_Caudovirales_phage	3.0e-53	82.5
WP_000818811.1\|3751965_3752403_-	hypothetical protein	A0A2H4JBV5	uncultured_Caudovirales_phage	8.0e-61	75.9
WP_001068033.1\|3752390_3752735_-\|head	phage head closure protein	A0A2H4JHA9	uncultured_Caudovirales_phage	1.1e-44	73.7
3752528:3752544	attL	NA	NA	NA	NA
WP_000923266.1\|3752731_3753025_-\|head,tail	phage gp6-like head-tail connector protein	A0A0A7S0C9	Clostridium_phage	3.5e-12	38.5
WP_001123700.1\|3753064_3754222_-\|capsid	phage major capsid protein	A0A2H4JHG1	uncultured_Caudovirales_phage	2.3e-123	62.3
WP_000383975.1\|3754259_3754952_-\|protease	Clp protease ClpP	A0A0A7RTN2	Clostridium_phage	9.3e-72	59.7
WP_000266102.1\|3754932_3756174_-\|portal	phage portal protein	A6M949	Geobacillus_virus	1.8e-121	52.4
WP_001082758.1\|3756187_3757903_-\|terminase	terminase large subunit	A0A0A7RVS5	Clostridium_phage	4.5e-216	63.0
WP_000113653.1\|3757912_3758434_-\|terminase	phage terminase small subunit P27 family	Q9ZXG2	Bacillus_phage	1.5e-53	64.9
WP_000924769.1\|3758533_3758947_-	HNH endonuclease	A0A0A7RUV1	Clostridium_phage	4.6e-26	47.1
WP_002028205.1\|3758937_3759192_-	hypothetical protein	Q2I8B8	Bacillus_phage	1.6e-16	57.7
WP_001012120.1\|3759940_3760483_-\|integrase	site-specific integrase	W8CYP1	Bacillus_phage	2.5e-88	91.1
WP_000166157.1\|3760482_3760965_-	ArpU family transcriptional regulator	H0USV3	Bacillus_phage	3.4e-73	83.1
WP_000645586.1\|3761277_3761400_-	DUF3983 domain-containing protein	NA	NA	NA	NA
WP_000937293.1\|3761417_3761747_-	hypothetical protein	NA	NA	NA	NA
WP_000273554.1\|3762223_3762601_-	hypothetical protein	A0A0S2MVH4	Bacillus_phage	1.6e-33	80.5
WP_014297965.1\|3762638_3762836_-	hypothetical protein	A0A1B1P864	Bacillus_phage	2.4e-25	86.2
WP_000181717.1\|3763543_3764050_-	hypothetical protein	A0A0M4RU27	Bacillus_phage	1.6e-81	83.3
WP_001208936.1\|3764273_3764672_-	hypothetical protein	Q5YA89	Bacillus_phage	3.5e-31	52.7
WP_000866997.1\|3765062_3765545_-	nucleoside triphosphate pyrophosphohydrolase family protein	A0A0U4IBD0	Bacillus_phage	1.5e-20	49.5
WP_000885283.1\|3765560_3765980_-	hypothetical protein	A0A1B1P8B9	Bacillus_phage	7.0e-14	41.9
WP_000811864.1\|3765992_3766247_-	hypothetical protein	A0A0U3SU43	Bacillus_phage	8.2e-42	98.8
WP_000805174.1\|3766261_3766435_-	DUF3954 domain-containing protein	A0A1B1P7U5	Bacillus_phage	1.2e-25	100.0
WP_000338030.1\|3766460_3766655_-	hypothetical protein	A0A0U3K3J8	Bacillus_phage	1.5e-24	84.4
WP_014297966.1\|3766669_3767473_-	ATP-binding protein	A0A1B1P7U2	Bacillus_phage	2.5e-145	98.9
WP_001060046.1\|3767441_3768314_-	DnaD domain protein	W8CYG5	Bacillus_phage	1.6e-57	45.5
WP_000364154.1\|3768310_3768496_-	hypothetical protein	A0A1B1P7U0	Bacillus_phage	4.6e-18	69.0
WP_000284333.1\|3768746_3768947_-	helix-turn-helix domain-containing protein	A0A0U4IIS1	Bacillus_phage	3.9e-07	48.0
WP_000516834.1\|3768998_3769226_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_000153813.1\|3769444_3769813_+	helix-turn-helix transcriptional regulator	A0A2H4J6F9	uncultured_Caudovirales_phage	2.0e-09	38.7
WP_001045402.1\|3770238_3771336_-	hypothetical protein	NA	NA	NA	NA
WP_001091274.1\|3771771_3772116_+	helix-turn-helix transcriptional regulator	A8ASM2	Listeria_phage	1.7e-05	27.8
WP_000833167.1\|3772205_3772385_-	hypothetical protein	NA	NA	NA	NA
WP_001199342.1\|3772901_3773741_-	DUF3800 domain-containing protein	NA	NA	NA	NA
WP_000323190.1\|3774023_3775154_+\|integrase	site-specific integrase	A0A0U4JNS1	Bacillus_phage	3.3e-66	39.3
WP_080001948.1\|3775303_3776530_+	nucleotidyltransferase	NA	NA	NA	NA
WP_000476304.1\|3776559_3777582_-	PDZ domain-containing protein	NA	NA	NA	NA
WP_000662598.1\|3777574_3778366_-	esterase	A0A1V0SCG0	Catovirus	3.1e-10	29.0
WP_000273097.1\|3778479_3779709_+	sporulation integral membrane protein YlbJ	NA	NA	NA	NA
WP_000200598.1\|3779700_3780192_-	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	8.5e-27	42.9
WP_001266987.1\|3780188_3780755_-	16S rRNA (guanine(966)-N(2))-methyltransferase RsmD	NA	NA	NA	NA
WP_153576963.1\|3781049_3781214_-	hypothetical protein	NA	NA	NA	NA
3780828:3780844	attR	NA	NA	NA	NA
WP_000616011.1\|3781258_3781648_+	hypothetical protein	NA	NA	NA	NA
WP_085962608.1\|3781721_3782878_-\|transposase	IS3 family transposase	A0A2I6AZV9	Macacine_betaherpesvirus	3.4e-34	44.7

DBSCAN-SWA_9

4716246 : 4771947

Bacillus_virus(16.67%)

coat,protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002028770.1\|4716246_4717062_+\|protease	YhfC family intramembrane metalloprotease	NA	NA	NA	NA
WP_000738184.1\|4717084_4717528_-	hypothetical protein	NA	NA	NA	NA
WP_000721018.1\|4717660_4718215_+	histidine phosphatase family protein	NA	NA	NA	NA
WP_000272743.1\|4718289_4718769_+	YbaK/EbsC family protein	NA	NA	NA	NA
WP_000166370.1\|4718789_4719686_-	lipoyl synthase	NA	NA	NA	NA
WP_000944673.1\|4719875_4720859_+	M23 family metallopeptidase	NA	NA	NA	NA
WP_002163411.1\|4720895_4721627_-	sporulation protein YunB	NA	NA	NA	NA
WP_000248463.1\|4721681_4721984_-	DUF1805 domain-containing protein	NA	NA	NA	NA
WP_079994036.1\|4722049_4723441_-	bifunctional metallophosphatase/5'-nucleotidase	NA	NA	NA	NA
WP_001118823.1\|4724032_4725430_-	Fe-S cluster assembly protein SufB	NA	NA	NA	NA
WP_000009523.1\|4725478_4725910_-	iron-sulfur cluster assembly scaffold protein SufU	A0A0K1LS29	Mycobacterium_phage	1.5e-14	37.6
WP_001020770.1\|4725899_4727120_-	cysteine desulfurase SufS	Q2XUY6	environmental_halophage	1.4e-118	47.6
WP_000152163.1\|4727119_4728412_-	Fe-S cluster assembly protein SufD	NA	NA	NA	NA
WP_000929157.1\|4728427_4729213_-	Fe-S cluster assembly ATPase SufC	A0A285PWH2	Cedratvirus	7.5e-09	25.8
WP_000722401.1\|4729451_4730258_-	MetQ/NlpA family ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_000735091.1\|4730330_4731143_-	MetQ/NlpA family ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_000359556.1\|4731166_4731832_-	ABC transporter permease	NA	NA	NA	NA
WP_000601758.1\|4731824_4732850_-	methionine ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.6e-27	32.4
WP_000424933.1\|4733382_4733727_-	hypothetical protein	NA	NA	NA	NA
WP_000568169.1\|4733879_4734179_-	thioredoxin family protein	NA	NA	NA	NA
WP_000640869.1\|4734191_4734536_-	DNA primase	NA	NA	NA	NA
WP_000026900.1\|4735035_4735419_-	glycine cleavage system protein GcvH	NA	NA	NA	NA
WP_000218967.1\|4735460_4735826_-	arsenate reductase family protein	M1PLC0	Streptococcus_phage	6.7e-21	48.6
WP_001224771.1\|4736554_4736926_-	hypothetical protein	NA	NA	NA	NA
WP_012644684.1\|4737043_4737307_-	DUF3937 domain-containing protein	NA	NA	NA	NA
WP_000826889.1\|4737539_4738067_-	hypothetical protein	NA	NA	NA	NA
WP_000713747.1\|4738210_4738858_+	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_000666170.1\|4738914_4739928_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_123805757.1\|4739950_4741150_-	L-lactate dehydrogenase	NA	NA	NA	NA
WP_001002987.1\|4741146_4741395_-\|coat	spore coat protein	NA	NA	NA	NA
WP_001180555.1\|4741408_4741594_-	hypothetical protein	NA	NA	NA	NA
WP_000005487.1\|4741740_4742454_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_000029292.1\|4742873_4743161_-	DUF2178 domain-containing protein	NA	NA	NA	NA
WP_000813827.1\|4743157_4743385_-	helix-turn-helix transcriptional regulator	A0A1V0E021	Clostridioides_phage	3.4e-07	45.6
WP_000457312.1\|4743566_4744133_-	hypothetical protein	NA	NA	NA	NA
WP_000074903.1\|4744231_4744789_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_001242590.1\|4744792_4745515_-	MBL fold metallo-hydrolase	A0A1X9I5D3	Streptococcus_phage	2.5e-11	31.4
WP_000416296.1\|4745653_4747438_-	acyl-CoA dehydrogenase	NA	NA	NA	NA
WP_002028756.1\|4747511_4747694_-	hypothetical protein	NA	NA	NA	NA
WP_001206325.1\|4747825_4748998_-	acetyl-CoA C-acetyltransferase	NA	NA	NA	NA
WP_000486345.1\|4749019_4751401_-	3-hydroxyacyl-CoA dehydrogenase/enoyl-CoA hydratase family protein	NA	NA	NA	NA
WP_001096348.1\|4751636_4751771_+	YuzL family protein	NA	NA	NA	NA
WP_000831479.1\|4752021_4752861_+	D-alanyl-D-alanine carboxypeptidase	NA	NA	NA	NA
WP_000436772.1\|4752883_4753801_-	proline dehydrogenase	A0A2H4PQT6	Staphylococcus_phage	1.0e-65	43.9
WP_001290594.1\|4754111_4754357_-	YusU family protein	NA	NA	NA	NA
WP_001018862.1\|4754404_4754707_-	MTH1187 family thiamine-binding protein	NA	NA	NA	NA
WP_000946342.1\|4754784_4756785_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	6.3e-12	51.1
WP_000599349.1\|4756943_4758074_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	D2XQ03	Bacillus_virus	4.7e-73	43.2
WP_000939490.1\|4758886_4759645_+	TrmB family transcriptional regulator	NA	NA	NA	NA
WP_000823840.1\|4759675_4761559_-	TQXA domain-containing protein	NA	NA	NA	NA
WP_002028752.1\|4762079_4763264_-	MFS transporter	NA	NA	NA	NA
WP_000736812.1\|4763662_4764370_+	hypothetical protein	NA	NA	NA	NA
WP_000788581.1\|4764437_4765652_+	hypothetical protein	NA	NA	NA	NA
WP_000546319.1\|4765776_4767090_-	amino acid permease	NA	NA	NA	NA
WP_000859063.1\|4767338_4768886_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	D5GVD8	Campylobacter_virus	3.2e-11	26.6
WP_000562242.1\|4769458_4769686_+	hypothetical protein	NA	NA	NA	NA
WP_000730859.1\|4769767_4770583_-	hypothetical protein	NA	NA	NA	NA
WP_085962608.1\|4770791_4771947_+\|transposase	IS3 family transposase	A0A2I6AZV9	Macacine_betaherpesvirus	3.4e-34	44.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_011655

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NC_011658

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection