CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NC_011916	Caulobacter crescentus NA1000, complete genome	1 crisprs	csa3,WYL,DEDDh,DinG,cas3	0	0	5	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_011916_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_011916_1

777855-777959

Orphan

Consensus_repeat	Method
GGACTTCCTTAGAAGTCCATGTCGCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_011916_1

>merge|NC_011916|1|777855-777959|CRISPRCasFinder
GGACTTCCTTAGAAGTCCATGTCGCCGCTCTGGATCGGCTGGGCCGATCCAGATCTCTTTGGGAGATGGGCGACTTTATGGACTTCCTTAGAAGTCCATGTCGCC

>NC_011916|1|1|777855-777959|CRISPRCasFinder
GGACTTCCTTAGAAGTCCATGTCGCC	GCTCTGGATCGGCTGGGCCGATCCAGATCTCTTTGGGAGATGGGCGACTTTAT
GGACTTCCTTAGAAGTCCATGTCGCC

Protein	Signature genes	Signature genes Name	Protein_function
NC_011916.1\|YP_009020504.1\|773732_773987_-\|hypothetical-protein	unknown	unknown	unknown
NC_011916.1\|YP_009020501.1\|771720_771834_-\|hypothetical-protein	unknown	unknown	unknown
NC_011916.1\|YP_009020500.1\|771135_771327_-\|hypothetical-protein	unknown	unknown	unknown
NC_011916.1\|YP_009020502.1\|772789_772894_-\|hypothetical-protein	unknown	unknown	unknown
NC_011916.1\|YP_002516089.2\|771390_771567_-\|hypothetical-protein	unknown	unknown	unknown
NC_011916.1\|YP_002516099.1\|781662_782970_-\|acyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173844
NC_011916.1\|YP_002516092.1\|774393_775635_+\|type-I-secretion-adaptor-protein-hlyD	unknown	unknown	gnl\|CDD\|130902
NC_011916.1\|YP_002516098.1\|780949_781612_-\|O6-methylguanine-DNA-methyltransferase	unknown	unknown	gnl\|CDD\|223427
NC_011916.1\|YP_002516101.1\|783795_784959_+\|hypothetical-protein	unknown	unknown	unknown
NC_011916.1\|YP_002516097.1\|780320_780749_+\|hypothetical-protein	unknown	unknown	unknown
NC_011916.1\|YP_002516104.1\|787360_789274_-\|DNA-mismatch-repair-protein-mutL	unknown	unknown	gnl\|CDD\|234630
NC_011916.1\|YP_002516093.1\|775595_777776_+\|type-I-protein-secretion-ATP-binding-protein/type-I-protein-secretion-transmembrane-subunit/type-I-secretion-processing-peptidase	unknown	unknown	gnl\|CDD\|225183
NC_011916.1\|YP_009020503.1\|773436_773730_-\|hypothetical-protein	unknown	unknown	unknown
NC_011916.1\|YP_002516091.1\|771886_772783_-\|abortive-infection-protein	unknown	unknown	gnl\|CDD\|376806
NC_011916.1\|YP_002516100.2\|783126_783723_+\|ribosomal-protein-alanine-acetyltransferase	unknown	unknown	gnl\|CDD\|224584
NC_011916.1\|YP_002516095.1\|779642_779933_-\|chaperonin-GroES	unknown	unknown	gnl\|CDD\|178988
NC_011916.1\|YP_009020505.1\|774017_774278_-\|hypothetical-protein	unknown	unknown	unknown
NC_011916.1\|YP_002516103.1\|786433_787201_+\|SkaA-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133381
NC_011916.1\|YP_002516096.1\|780107_780302_+\|glyoxalase-family-protein	unknown	unknown	gnl\|CDD\|319923
NC_011916.1\|YP_002516102.2\|785053_786358_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|237030

Protein	Function_ID	Function_description	E-value
NC_011916.1\|YP_002516103.1\|786433_787201_+\|SkaA-family-transcriptional-regulator	gnl\|CDD\|133381	cd01106, HTH_TipAL-Mta, Helix-Turn-Helix DNA binding domain of the transcription regulators TipAL, Mta, and SkgA. Helix-turn-helix (HTH) TipAL, Mta, and SkgA transcription regulators, and related proteins, N-terminal domain. TipAL regulates resistance to and activation by numerous cyclic thiopeptide antibiotics, such as thiostrepton. Mta is a global transcriptional regulator; the N-terminal DNA-binding domain of Mta interacts directly with the promoters of mta, bmr, blt, and ydfK, and induces transcription of these multidrug-efflux transport genes. SkgA has been shown to control stationary-phase expression of catalase-peroxidase in Caulobacter crescentus. These proteins are comprised of distinct domains that harbor an N-terminal active (DNA-binding) site and a regulatory (effector-binding) site. The conserved N-terminal domain of these transcription regulators contains winged HTH motifs that mediate DNA binding. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. Unique to this family, is a TipAL-like, lineage specific Bacilli subgroup, which has five conserved cysteines in the C-terminus of the protein.	6.80486e-49
NC_011916.1\|YP_002516104.1\|787360_789274_-\|DNA-mismatch-repair-protein-mutL	gnl\|CDD\|234630	PRK00095, mutL, DNA mismatch repair endonuclease MutL.	0
NC_011916.1\|YP_002516093.1\|775595_777776_+\|type-I-protein-secretion-ATP-binding-protein/type-I-protein-secretion-transmembrane-subunit/type-I-secretion-processing-peptidase	gnl\|CDD\|225183	COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms].	0
NC_011916.1\|YP_002516100.2\|783126_783723_+\|ribosomal-protein-alanine-acetyltransferase	gnl\|CDD\|224584	COG1670, RimL, Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis].	2.22772e-22
NC_011916.1\|YP_002516095.1\|779642_779933_-\|chaperonin-GroES	gnl\|CDD\|178988	PRK00364, groES, co-chaperonin GroES; Reviewed.	6.24247e-56
NC_011916.1\|YP_002516099.1\|781662_782970_-\|acyl-CoA-dehydrogenase	gnl\|CDD\|173844	cd01155, ACAD_FadE2, Acyl-CoA dehydrogenases similar to fadE2. FadE2-like Acyl-CoA dehydrogenase (ACAD). Acyl-CoA dehydrogenases (ACAD) catalyze the alpha,beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of ACAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. The ACAD family includes the eukaryotic beta-oxidation, as well as amino acid catabolism enzymes. These enzymes share high sequence similarity, but differ in their substrate specificities. ACAD's are generally homotetramers and have an active site glutamate at a conserved position.	0
NC_011916.1\|YP_002516091.1\|771886_772783_-\|abortive-infection-protein	gnl\|CDD\|376806	pfam02517, Abi, CAAX protease self-immunity. Members of this family are probably proteases (after a isoprenyl group is attached to the Cys residue in the C-terminal CAAX motif of a protein to attach it to the membrane, the AAX tripeptide being removed by one of the CAAX prenyl proteases). The family contains the CAAX prenyl protease. The proteins contain a highly conserved Glu-Glu motif at the amino end of the alignment. The alignment also contains two histidine residues that may be involved in zinc binding. While they are involved in membrane anchoring of proteins in eukaryotes, little is known about their function in prokaryotes. In some known bacteriocin loci, Abi genes have been found downstream of bacteriocin structural genes where they are probably involved in self-immunity. Investigation of the bacteriocin-like loci in the Gram positive bacteria locus from Lactobacillus sakei 23K confirmed that the bacteriocin-like genes (sak23Kalphabeta) exhibited antimicrobial activity when expressed in a heterologous host and that the associated Abi gene (sak23Ki) conferred immunity against the cognate bacteriocin. Interestingly, the immunity genes from three similar systems conferred a high degree of cross-immunity against each other's bacteriocins, suggesting the recognition of a common receptor. Site-directed mutagenesis demonstrated that the conserved motifs constituting the putative proteolytic active site of the Abi proteins are essential for the immunity function of Sak23Ki - thus a new concept in self-immunity.	7.44372e-12
NC_011916.1\|YP_002516092.1\|774393_775635_+\|type-I-secretion-adaptor-protein-hlyD	gnl\|CDD\|130902	TIGR01843, Hemolysin_secretion_protein_D_plasmid, type I secretion membrane fusion protein, HlyD family. Type I secretion is an ABC transport process that exports proteins, without cleavage of any signal sequence, from the cytosol to extracellular medium across both inner and outer membranes. The secretion signal is found in the C-terminus of the transported protein. This model represents the adaptor protein between the ATP-binding cassette (ABC) protein of the inner membrane and the outer membrane protein, and is called the membrane fusion protein. This model selects a subfamily closely related to HlyD; it is defined narrowly and excludes, for example, colicin V secretion protein CvaA and multidrug efflux proteins. [Protein fate, Protein and peptide secretion and trafficking].	2.04755e-26
NC_011916.1\|YP_002516098.1\|780949_781612_-\|O6-methylguanine-DNA-methyltransferase	gnl\|CDD\|223427	COG0350, Ada, Methylated DNA-protein cysteine methyltransferase [DNA replication, recombination, and repair].	2.67004e-57
NC_011916.1\|YP_002516096.1\|780107_780302_+\|glyoxalase-family-protein	gnl\|CDD\|319923	cd07262, VOC_like, uncharacterized subfamily of vicinal oxygen chelate (VOC) family. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	1.25045e-20
NC_011916.1\|YP_002516102.2\|785053_786358_+\|hypothetical-protein	gnl\|CDD\|237030	PRK12270, kgd, multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine pyrophosphate-binding subunit/dihydrolipoyllysine-residue succinyltransferase subunit.	3.19302e-08

>NC_011916.1|YP_002516093.1|775595_777776_+|type-I-protein-secretion-ATP-binding-protein/type-I-protein-secretion-transmembrane-subunit/type-I-secretion-processing-peptidase
MVARSPLRGRTPLMDIPAELNFARRRRLPVIVGAEAAECGLACMAMVARYHGHDVDLNGLRQRFTLSMSGATLRSIMGFADHLGFAPRALKVELSALDKVRLPAILHWDLNHFVVLKSVQGGRAVVHDPALGARTYSLDELSKHFTGVALELTPSGRFEKITARAPIKLTSLWSRMIGFWPAFFQILGLSLALQVAVFAMPFQMQLVVDEAIFRADRDLLTVLALGFGALVIIQSAIEALRAWALQVFGQMLSFQIVGNLVRHMMRLPSDWYEKRHVGDILSRIGSASAIQDVLTRGVIAAIIDGLMAVVAIIILLLYAPTLAAVVVGAVALNLGLALALFPAMRARTEEQILESAREQSHVMETVRAATTIKLMGREAERESSWRNLYANAINAAVSVGKFQISLSFTQALITGLQTVIVIYLGARTILAGDGFSVGMLFAFLSFRQTFTDRANALINQFIQFKFLNLHLERLADIVTAETEAADTAAPRLEVAGALQLKDVSFRYGAADRPVLQGVDLEVAPGEFLAITGASGGGKTTLLKLMLGLRAPTEGTITLDGQPASPQLWRAWREQVGVVAQDDRLLSGTIADNIAFFDPDLDMERVQHAAMAAQVHDDIARMPMQYLSLVGDMGSTLSGGQKQRVLLARALYRRPRILVLDEGTANLDVQTEELIADLIAQLPITRIVVAHRPALLKRASRILVVEGGVLSTTCSELSRAEPKRAVF
>NC_011916.1|YP_002516092.1|774393_775635_+|type-I-secretion-adaptor-protein-hlyD
MSDLFRKEAVVHATRRLAGEVVLATSVPSRVLAGLVCLVVLAGATFAATASYARKETVVGWLTPQAGMIRLAARQGGIVANVHVREGDRVVVGQPIATLTLSSALEGGDSFAVLSRSLGAQSSAAGSRAAATQAALAAESRQLTQRRAALNRELAEAKRSLALQTERLTLARAEVARAETIAAQGFLSPRELQARRSAELAVQQEASTLSSQALSYERQIGEVDARLAAIPIDLQAARAEAASTLAGLEQQATQVEAQGRYVVVATVAGRVAALPVEAGQTVGVGAAVAVLTPGDSALVAELYAPSRAAGFVRQGQEVRLMYQAFPHQKFGVGEGVVTAVSRTVLAPSEVAIPGLQVQEPVFRIRVKLARDNVAAYGETLPLQPGMLLSADVVIDRRSLLEWLLDPLYAVGRR
>NC_011916.1|YP_009020505.1|774017_774278_-|hypothetical-protein
MTALAMNVRELSFEEVDEVAGANMRAASVGVGGVAGAGAGWHAGVAVAARGAMWGARVGAIGGVGGAVAGVVLGAAIALIAYDLAE
>NC_011916.1|YP_009020504.1|773732_773987_-|hypothetical-protein
MKTLTLAEIDYVSGGSERGAMVSGAAVAGGVGGANYARAAIHGASWGARIGAVGGVAGIVAGALVGAAAGGILAYALYEAVDGS
>NC_011916.1|YP_009020503.1|773436_773730_-|hypothetical-protein
MTKRATLQFTQILNWTIGILLVFGWLQLIGVFSVKGLDPVVLFGVSAFLTGYISLRDFRSMGLGNIKSFIASSALGILILGLVTLLSKATEYIPKLF
>NC_011916.1|YP_009020502.1|772789_772894_-|hypothetical-protein
MISSAVNPCDDAPHPHKALSEAHSTLGRRRSSAA
>NC_011916.1|YP_002516091.1|771886_772783_-|abortive-infection-protein
MIGIDNSVPTPSLARQAISILAGALGGFASGLIAVSILLGVLGIFDLRPLTDSERLSVFENGALYTAELAIILLALAVGFVGTAGAVLKRPFVEWLTDGRGLRFDLCLYGLTLGAAATLAGLIGNAAIDGDRLGFIGSTPSGLAPGIWVYLVAMPLGFLVAAFAEELFFRGYLLKLLRWWGAHPVVAITVTSIAFAAFHLEFQPEVFALRMLSGAALAWSVYRLGGIEFAVGAHAAGNIVLAFFIPPLSETTTSSADLYGVGIEILTSAMIIIGVEVVRARLSFRADTFSLWAKEGGT
>NC_011916.1|YP_009020501.1|771720_771834_-|hypothetical-protein
MKSPFKRPHTNEAKTLEFALGVILGGIATAIAIVILV
>NC_011916.1|YP_002516089.2|771390_771567_-|hypothetical-protein
MMTHAPRTKAIARLLRRWWFAEPAFKAAVLASAALLVVSTVNALIEIGALVHDAVCPH
>NC_011916.1|YP_009020500.1|771135_771327_-|hypothetical-protein
MSQRRLDLIFVGLLPALIGLAWGRSSDVFPEQPYAFGAVVTLLAWAGVLWFFLAGPGKTPRDP
>NC_011916.1|YP_002516095.1|779642_779933_-|chaperonin-GroES
MKFRPLGDRVLVKRVEEETKTKGGIIIPDTAKEKPQEGEVVAVGPGARNDKGDVVALDVKAGDRILFGKWSGTEVKVDGQDLLIMKESDVLGVVEA
>NC_011916.1|YP_002516096.1|780107_780302_+|glyoxalase-family-protein
MMDHMGVTVRDLQASRAFYGATLAAGGLDNGAPGVRPHYHPHYYGAFVLDPDGRNVEAVCHAPA
>NC_011916.1|YP_002516097.1|780320_780749_+|hypothetical-protein
MSSYVLSLLLAVIACVIGGTLGGMILARPATLLEAAGLSNDDTPKPPLFAEGRALGGVLIASHGVAALYLGYQPRIGAAMALALALAWLGAAAGRAVSLALDGDAGRYNRGAMLFNALIGVTLTLPWFQIGKVVLRGPLGLA
>NC_011916.1|YP_002516098.1|780949_781612_-|O6-methylguanine-DNA-methyltransferase
MRGRCGGPFFVKGGPVFPPLIRPSGPPSPARGEGRNYRADSRARLGDHRPMPRPAHLFLDRAPSPLGDLLIVTDETGLLRAVDFHDFEPRLRRLARLHYGDLVLETGPAPAAIKAAFARYFAGDLAALVSLAWATNGTPFQQAVWTALTQIPAGQTITYSELARRAGRPLAIRAAGAANGANPLSLVAPCHRVIGTDGALTGYAGGIDRKRWLLAHEGAL
>NC_011916.1|YP_002516099.1|781662_782970_-|acyl-CoA-dehydrogenase
MDFDISPKQRAFLDRVTAFMDEHVYPAIPAYEAEMNVLGAERWKVVQVVEDLKKKAKAAGLWNFFMPPHSGQTHVDDTFQFEGVQLTNLEYSLIAEQLGKVGFASEVFNCSAPDTGNMEVLMRYGTLAQKEKWLRPLMNGEIRSAFLMTEPAVASSDATNIETRIERDGDHYVINGRKWWSSGVGDPRCKVAIVMGKTDPDNASRHAQQSQVLVPLDSPGIEIVRMLPVFGYDDAPHGHAEVILKNVRVPIEDALLLGEGRGFEIAQGRLGPGRIHHCMRTIGTAEVALEKMCQRLMSRKAFGKYVSDHSVWEERVADARIDIEMCRLLCLKAADMMDKAGNKSARLEIAMIKVAAPRLALKIIDDAIQAHGGGGVTTDFGLAKAYAGIRTLRLADGPDEVHQRTIARMEYGKYGDLMYKQKAEKEAALHVPGIR
>NC_011916.1|YP_002516100.2|783126_783723_+|ribosomal-protein-alanine-acetyltransferase
MLNLTADILQGRYVRLEPVTVDHHDELKAAIDCDPASWEIMSVNGCGEGFEDFWGALQGETDRGERIGFAIRRLVDGKVVGTSSYLNIRRLHGGLEIGATFLNPEARSGPVNPESKRLMLGHAFDKAGAIRVELVTDVRNARSQAAIQKLGATKEGVLRNHKVTWTGHVRDTAVFSITDYDWPAIRERLEFRLSETFA
>NC_011916.1|YP_002516101.1|783795_784959_+|hypothetical-protein
MAGMACLRICIEHGARSVTLDGVTPAKIDKVASGYIDVNWRAPRRHGRVGPGAYVLIDPSAETLNGEELRQMAAELQVHLFGTQGQQDLCMLTFEGDEEQVLKFTTLPEEELLAMRGGAEPPPPEGRTRIVSQDGIRELAPWGSTPRVAAEQEKVEAPPVRLGWRGVYSLPSQRFEAAQVQSFLKPGEAEPQSDADFMDRDLQALDRAVAALEGDPRLKAWVGVRLWTVARGGLRDTCRERFAAIPPSVRERLGAMVYDAPRDLPFSAIGPLRDLVQPYFARVGLCVNDPGFYVQALPDALVHCVVFQLPEEDEKARVLKAHRFLSARGQYVARSLRMGLAGVKTPRELELARKMGAHMVKGPMISALFATPVSDQVVPVTELPLRT
>NC_011916.1|YP_002516102.2|785053_786358_+|hypothetical-protein
MTAIACLRILFTADADMRAGDMPKHKAQGVADAFLKAKWRKPRKCGAVAPLAFVLADHNATELDPTEVQGLAVELEKVLFPNRPIGQIALMTFEGDETAVLHFSALSQKELASLMAGEGYGGEPGRVHVVTADAVKPMPVTREEAKVYAAEKAKAAEAEKPAAAAPAAAAPAPVQAPAPSPAKSAPAPAPTPAPVAAKVVTPQRPADTGWWGVYDLSQGAFVGSTVAMRADLVEPPPEDDAKLLKRDLVALTDVQAALKTASFGEIQASFGFWNLITPASQESYKARLSRYPLDARPRLTASIYGAPREASIGMLQQMRAQLSGAFAAMDLRITDPTFPVQGLPPELLESVTLVLSGETEHDRLKQILKFVERKSAYAAKGVMQCVANVASAVELEACKVAGVVRVQGPAVTDFMDTPVAAADGAPLALAKSAA
>NC_011916.1|YP_002516103.1|786433_787201_+|SkaA-family-transcriptional-regulator
MSVYTVKQMARLSGVSVRALHHYDAIGLLKPRAVGANGYRYYDRQDLLRLQQILFHRALETPLKDIQAALDQPGFDLAAALRAQRERLAAQAERYARLVDVVDRTLADLEGDETMDDKHLFEGFDPEKQARHEAWLVEHYGDEATRRIADAKAGMKSWGKKDWSQFQEEAKAIEHDLAKALTQGLPVDSAPVTAIMRRHWAWVGRSWNREPTPDAFAGLGHLYQANPEFTARYEAIAPGLTEYFSEAMRAFARGR
>NC_011916.1|YP_002516104.1|787360_789274_-|DNA-mismatch-repair-protein-mutL
MPIRRLPPETVNRIAAGEVVERPASAIKELVDNAIDAGATRIEVEAHGGGLTRILVADDGCGLSPEELPVAIERHATSKLAPDADGLWDLLRIHTMGFRGEALPSIGSVARLQISSRAKGAKDAFSILVEGGQVGEVAPAAFPGPHGARIEVRDLFYATPARLKFMKSERAEALAITEEIKRQAMANESVGFSLDIDGRRVLRLPPEHPGPQGRLARLAAVLGREFQENALEIDQTRDGVRLSGFAGLPTYNRGNAAHQYLFVNGRPVRDRLLQGALRAAYADFLARDRHPTAALYVTLETTEVDVNVHPAKAEVRFRDPALVRGLIVGALRHALAGAGHRASTTVAAQALDSIRAQQSPFPGYQPQYQPGPSPAGFSAWREGGWTPPTQRPMDLPGLNEVSARVEPSYGGDLAGVVREAYAAAAFEDRPPTDYPGATAPFDPVDYPLGAARAQVHETYIVAQTRDGMVIVDQHAAHERLVYERMKGEMASGGVTRQTLLLPEVVDLDPAEAERVVARAEELAGLGLVLESFGPGAVLVRETPALLGKTDAAALVRDIADDLAENGQALALKERLEEVCSTMACHGSVRAGRRLNGAEMNALLREMEATPHSGQCNHGRPTYVELKLADIEKLFGRR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1768404 : 1776976

uncultured_Mediterranean_phage(57.14%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
YP_002517021.1\|1768404_1769667_+	adenosylmethionine-8-amino-7-oxononanoate	A0A1V0SKB7	Klosneuvirus	9.2e-17	30.3
YP_002517022.1\|1769663_1770605_+	transporter, drug/metabolite exporter family	NA	NA	NA	NA
YP_002517023.1\|1770654_1771179_-	copper/zinc superoxide dismutase	Q9MC02	Salmonella_phage	2.3e-14	34.4
YP_002517024.1\|1771303_1774063_+	DNA gyrase subunit A	G3M9Z5	Bacillus_virus	1.5e-96	31.9
YP_002517025.1\|1774089_1774581_+	phosphopantetheine adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	6.5e-35	49.7
YP_002517026.1\|1774738_1775572_+	cyclophilin-type peptidylprolyl cis-trans isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	8.2e-22	34.5
YP_002517027.1\|1775568_1776417_+	cyclophilin-type peptidylprolyl cis-trans isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	1.8e-24	37.3
YP_002517028.1\|1776508_1776976_+	cyclophilin-type peptidylprolyl cis-trans isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	3.6e-35	52.8

DBSCAN-SWA_2

2887327 : 2932736

Klosneuvirus(10.0%)

transposase,integrase,holin

attL 2922177:2922192|attR 2937193:2937208

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
YP_002518098.1\|2887327_2888995_-\|holin	choline dehydrogenase	A0A1V0SI18	Klosneuvirus	2.3e-60	31.0
YP_002518099.1\|2889286_2889817_-	gamma carbonic anhydrase family protein	NA	NA	NA	NA
YP_009020545.1\|2889996_2890155_+	hypothetical protein	NA	NA	NA	NA
YP_002518100.1\|2890142_2890931_+	phosphate starvation-inducible protein PhoH	A0A0S0MVD6	Pseudomonas_phage	7.7e-46	44.8
YP_002518101.1\|2891106_2891412_+	hypothetical protein	NA	NA	NA	NA
YP_002518102.1\|2891506_2893507_+	oligopeptide transporter	NA	NA	NA	NA
YP_002518103.1\|2893513_2894161_+	glutathione S-transferase	NA	NA	NA	NA
YP_002518104.2\|2894157_2894847_-	acetyltransferase	NA	NA	NA	NA
YP_002518105.1\|2894962_2895169_-	hypothetical protein	NA	NA	NA	NA
YP_002518106.1\|2895429_2896212_-	glutaminyl-peptide cyclotransferase	NA	NA	NA	NA
YP_002518107.1\|2896212_2897085_-	serine acetyltransferase	NA	NA	NA	NA
YP_002518108.1\|2897128_2897845_-	ADP-ribose pyrophosphatase family protein	NA	NA	NA	NA
YP_002518109.1\|2897849_2898464_+	nitroreductase family	NA	NA	NA	NA
YP_002518110.1\|2898472_2898928_-	queuosine biosynthesis protein QueF	E7DN65	Pneumococcus_phage	6.6e-26	52.4
YP_002518111.1\|2898996_2899818_+	3-ketoacyl-(acyl-carrier-protein) reductase	F2NZ40	Diadromus_pulchellus_ascovirus	1.0e-16	33.2
YP_009020546.1\|2899488_2899896_-	hypothetical protein	NA	NA	NA	NA
YP_002518112.1\|2899969_2900950_-\|transposase	transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	6.9e-12	24.8
YP_002518113.1\|2900946_2901381_-\|transposase	transposase	NA	NA	NA	NA
YP_002518114.1\|2901592_2902285_+	hypothetical protein	NA	NA	NA	NA
YP_002518115.1\|2902465_2903737_-	hypothetical protein	NA	NA	NA	NA
YP_009020547.1\|2903733_2903886_-	hypothetical protein	NA	NA	NA	NA
YP_002518116.1\|2903885_2906294_-	TonB dependent receptor	NA	NA	NA	NA
YP_002518117.2\|2906465_2907182_-	GntR-family transcriptional regulator	NA	NA	NA	NA
YP_002518118.1\|2907541_2908183_-	TetR-family transcriptional regulator	NA	NA	NA	NA
YP_002518119.3\|2908258_2909275_+	hypothetical protein	NA	NA	NA	NA
YP_002518120.2\|2909314_2910127_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
YP_002518121.2\|2910261_2910510_+	hypothetical protein	NA	NA	NA	NA
YP_002518122.1\|2910513_2910963_-	hypothetical protein	NA	NA	NA	NA
YP_002518123.1\|2911007_2911682_-	ABC transporter permease protein	NA	NA	NA	NA
YP_002518124.1\|2911678_2912677_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	9.4e-25	32.1
YP_002518125.1\|2912770_2914843_-	GAF/PAS-family histidine kinase/receiver protein	Q8QKV7	Ectocarpus_siliculosus_virus	1.5e-45	32.0
YP_002518126.1\|2915011_2917471_-	aminoacyl peptidase	NA	NA	NA	NA
YP_002518127.1\|2917964_2919263_-	L-lysine/L-arginine carboxypeptidase	NA	NA	NA	NA
YP_002518128.2\|2919670_2920069_+	HipB-family transcriptional regulator	K4K6E9	Caulobacter_phage	3.3e-29	54.6
YP_002518129.1\|2920072_2920831_-	competence/damage-inducible protein CinA	NA	NA	NA	NA
YP_002518130.1\|2920985_2921705_+	sugar fermentation stimulation protein A	NA	NA	NA	NA
YP_002518131.1\|2921762_2922152_+	hypothetical protein	NA	NA	NA	NA
2922177:2922192	attL	NA	NA	NA	NA
YP_002518132.1\|2922304_2923135_+	methionine aminopeptidase	NA	NA	NA	NA
YP_002518133.1\|2923195_2923462_+	hypothetical protein	NA	NA	NA	NA
YP_009020548.1\|2923461_2923683_+	hypothetical protein	NA	NA	NA	NA
YP_002518134.1\|2923672_2923918_+	hypothetical protein	NA	NA	NA	NA
YP_002518135.1\|2924123_2924789_+	DNA repair protein RadC	NA	NA	NA	NA
YP_002518136.2\|2924941_2926183_+\|integrase	bacteriophage P4 integrase	A0A248SL35	Klebsiella_phage	5.4e-155	63.2
YP_002518137.2\|2926214_2926454_-	hypothetical protein	NA	NA	NA	NA
YP_002518138.1\|2926505_2926889_-	hypothetical protein	NA	NA	NA	NA
YP_002518139.1\|2926885_2927164_-	hypothetical protein	NA	NA	NA	NA
YP_002518140.1\|2927175_2928432_-	conjugal transfer protein TrbI	NA	NA	NA	NA
YP_002518141.1\|2928428_2929412_-	conjugal transfer protein TrbG	NA	NA	NA	NA
YP_002518142.1\|2929408_2930173_-	conjugal transfer protein TrbF	NA	NA	NA	NA
YP_002518143.1\|2930176_2931532_-	conjugal transfer protein TrbL	NA	NA	NA	NA
YP_002518144.1\|2931549_2931816_+\|transposase	transposase	NA	NA	NA	NA
YP_002518145.1\|2931809_2932736_+\|transposase	transposase	S5WIU1	Leptospira_phage	4.6e-50	43.0
2937193:2937208	attR	NA	NA	NA	NA

DBSCAN-SWA_3

2970102 : 2983442

Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
YP_002518186.1\|2970102_2970537_+\|transposase	transposase	NA	NA	NA	NA
YP_002518187.1\|2970533_2971514_+\|transposase	transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	6.9e-12	24.8
YP_002518188.1\|2971566_2973531_-	ice nucleation protein	NA	NA	NA	NA
YP_002518189.1\|2973536_2973908_-	hypothetical protein	NA	NA	NA	NA
YP_002518190.2\|2973978_2974182_-	hypothetical protein	NA	NA	NA	NA
YP_002518191.1\|2974860_2974974_+	hypothetical protein	NA	NA	NA	NA
YP_002518192.1\|2975199_2975355_-	hypothetical protein	NA	NA	NA	NA
YP_002518193.1\|2975364_2977254_+	TadG-family protein	A0A2I7RHS5	Vibrio_phage	1.3e-06	40.0
YP_002518194.1\|2977477_2978812_-	hipA-related phosphatidylinositol 3/4-kinase	NA	NA	NA	NA
YP_002518195.1\|2978808_2979663_-	MerR-family transcriptional regulator	NA	NA	NA	NA
YP_009020550.1\|2979669_2979816_-	hypothetical protein	NA	NA	NA	NA
YP_009020551.1\|2979689_2979911_+	hypothetical protein	NA	NA	NA	NA
YP_002518196.1\|2979911_2980037_-	hypothetical protein	NA	NA	NA	NA
YP_002518197.1\|2980221_2980575_+	hypothetical protein	NA	NA	NA	NA
YP_002518198.1\|2980585_2980978_+\|transposase	transposase	NA	NA	NA	NA
YP_002518199.1\|2981108_2982131_+\|transposase	transposase	NA	NA	NA	NA
YP_002518200.1\|2982255_2982522_+\|transposase	transposase	NA	NA	NA	NA
YP_002518201.1\|2982515_2983442_+\|transposase	transposase	S5WIU1	Leptospira_phage	4.6e-50	43.0

DBSCAN-SWA_4

2998629 : 3028719

Rhodobacter_phage(18.18%)

head,protease,tail,terminase,portal

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
YP_002518219.1\|2998629_3000222_-\|protease	DegP/HtrA-family serine protease	A0A1B1IT49	uncultured_Mediterranean_phage	7.7e-21	28.4
YP_002518220.1\|3000401_3000854_-	cytochrome c-type biogenesis protein ccmH	NA	NA	NA	NA
YP_002518221.1\|3000850_3002833_-	heme chaperone-apocytochrome heme-lyase	NA	NA	NA	NA
YP_002518222.1\|3002987_3003476_-	cytochrome c-type biogenesis heme chaperone	NA	NA	NA	NA
YP_002518223.1\|3003472_3004585_-	cytochrome c-type biogenesis protein ccmI	NA	NA	NA	NA
YP_002518224.2\|3004684_3005377_+	alpha/beta hydrolase family protein	NA	NA	NA	NA
YP_002518225.1\|3005377_3006748_-	hypothetical protein	NA	NA	NA	NA
YP_002518226.1\|3006908_3008306_-	two-component sensor histidine kinase	NA	NA	NA	NA
YP_002518227.1\|3008436_3009114_-	two-component response regulator	NA	NA	NA	NA
YP_002518228.1\|3009132_3009450_-	PepSY peptidase propeptide domain protein	NA	NA	NA	NA
YP_002518229.1\|3009578_3010088_-	hypothetical protein	NA	NA	NA	NA
YP_002518231.1\|3010289_3011597_-	hipA-family phosphatidylinositol 3/4-kinase	NA	NA	NA	NA
YP_002518232.1\|3011593_3011953_-	hypothetical protein	NA	NA	NA	NA
YP_002518233.1\|3012115_3013060_-	DnaJ-class molecular chaperone	A0A2L0UZR4	Agrobacterium_phage	1.1e-17	26.2
YP_002518234.1\|3013148_3015680_-	phage host specificity protein	A0A0K1LLC1	Rhodobacter_phage	2.5e-146	40.0
YP_002518235.1\|3015315_3016860_-	phage host specificity protein	A0A1V0DY94	Dinoroseobacter_phage	1.0e-65	43.0
YP_002518236.3\|3016984_3017605_-	Spr-family cell wall-associated hydrolase	F4YXU4	Roseobacter_phage	1.9e-36	53.3
YP_002518237.1\|3017601_3018228_-	phage conserved hypothetical protein	A0A0K1Y6Z2	Rhodobacter_phage	4.9e-19	41.0
YP_002518238.1\|3018227_3018863_-	phage-derived conserved hypothetical protein	A0A0B5A2K3	Paracoccus_phage	2.7e-41	44.3
YP_002518239.2\|3019010_3019475_+	hypothetical protein	NA	NA	NA	NA
YP_002518240.1\|3019648_3020155_-\|tail	phage tail length tape measure-related protein	NA	NA	NA	NA
YP_002518241.1\|3020151_3020331_-	hypothetical protein	NA	NA	NA	NA
YP_002518242.1\|3020327_3020612_-	hypothetical protein	NA	NA	NA	NA
YP_002518243.1\|3020767_3021184_-	phage protein	NA	NA	NA	NA
YP_002518244.2\|3021199_3021598_-	hypothetical protein	NA	NA	NA	NA
YP_008877619.1\|3021594_3021876_-\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
YP_002518245.1\|3022018_3023239_-\|head,protease	phage prohead protease	Q3HQT0	Burkholderia_phage	3.3e-80	43.3
YP_002518246.1\|3023435_3023798_+	glyoxalase/bleomycin resistance protein, dioxygenase superfamily	NA	NA	NA	NA
YP_002518247.1\|3023771_3024188_-\|head,protease	phage prohead protease	A0A0U2BX10	Paracoccus_phage	6.7e-25	46.6
YP_002518248.1\|3024177_3024576_-	hypothetical protein	NA	NA	NA	NA
YP_002518249.1\|3024588_3025917_-\|portal	portal protein	W8ECU7	Geobacillus_phage	9.5e-65	40.8
YP_002518250.1\|3025888_3026329_+	very short patch repair (Vsr) endonuclease	NA	NA	NA	NA
YP_002518251.1\|3026556_3026715_-	hypothetical protein	NA	NA	NA	NA
YP_002518252.1\|3026789_3026885_-	genetic exchange related protein	NA	NA	NA	NA
YP_002518253.3\|3027015_3028719_-\|terminase	terminase-like family protein	A0A0K1LMR9	Caulobacter_phage	1.6e-69	41.8

DBSCAN-SWA_5

3604488 : 3652485

Staphylococcus_phage(15.38%)

transposase,tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
YP_002518814.1\|3604488_3604857_-\|transposase	transposase	NA	NA	NA	NA
YP_002518815.1\|3604871_3605282_-\|transposase	transposase	A0A0N9SHJ4	Paenibacillus_phage	2.8e-23	43.1
YP_002518816.1\|3605304_3605787_-	hypothetical protein	A0A075BSJ0	Microcystis_phage	5.4e-34	55.1
YP_002518817.1\|3606022_3608536_+	TonB-dependent receptor	NA	NA	NA	NA
YP_002518818.2\|3608705_3611123_+	M28-family zinc metallopeptidase	NA	NA	NA	NA
YP_002518819.1\|3611127_3612993_-	feruloyl-CoA synthetase	A0A2H4PQM9	Staphylococcus_phage	3.3e-07	26.8
YP_002518820.1\|3613083_3613359_-	hypothetical protein	NA	NA	NA	NA
YP_002518821.2\|3613396_3613870_-	hypothetical protein	NA	NA	NA	NA
YP_002518822.2\|3613939_3615472_-	S-adenosylmethionine-dependent methyltransferases	NA	NA	NA	NA
YP_002518823.1\|3615470_3615809_+	hypothetical protein	NA	NA	NA	NA
YP_002518824.2\|3616200_3616425_+	hypothetical protein	NA	NA	NA	NA
YP_002518825.1\|3616453_3616693_-	hypothetical protein	NA	NA	NA	NA
YP_002518826.2\|3616711_3617341_-	AcrR-family transcriptional regulator	NA	NA	NA	NA
YP_002518827.1\|3617632_3618478_+	UDP-2,3-diacylglucosamine hydrolase	A0A218MKA7	uncultured_virus	1.6e-65	47.1
YP_002518828.1\|3618477_3619569_+	GT1-family glycosyltransferase	NA	NA	NA	NA
YP_002518829.1\|3619645_3620482_+	esterase/lipase	NA	NA	NA	NA
YP_002518830.3\|3620487_3621267_-	horizontally transferred transmembrane domain (HTTM) protein	NA	NA	NA	NA
YP_002518831.1\|3621164_3621650_-	hypothetical protein	NA	NA	NA	NA
YP_009020564.1\|3621640_3621718_-	UDP-glucose 6-dehydrogenase-related protein	NA	NA	NA	NA
YP_002518832.1\|3621828_3623598_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	8.9e-10	60.9
YP_002518833.1\|3623647_3624148_-	hypothetical protein	NA	NA	NA	NA
YP_002518834.1\|3624144_3624564_-	hypothetical protein	NA	NA	NA	NA
YP_002518835.1\|3624695_3626276_-	glycine cleavage system protein P, C-terminal domain	E3ST28	Prochlorococcus_phage	1.1e-70	37.3
YP_002518836.1\|3626272_3627619_-	glycine cleavage system protein P, N-terminal domain	E3SN07	Prochlorococcus_phage	1.7e-45	33.6
YP_002518837.1\|3627737_3628103_-	glycine cleavage system H protein	NA	NA	NA	NA
YP_002518838.1\|3628122_3629250_-	glycine cleavage system aminomethyltransferase T	NA	NA	NA	NA
YP_002518839.1\|3629633_3630437_+	ORF6N domain protein	NA	NA	NA	NA
YP_002518840.1\|3630433_3632938_-\|protease	zinc-dependent metalloprotease, MMP subfamily 2	NA	NA	NA	NA
YP_002518841.1\|3633140_3634934_+	methyl-accepting chemotaxis protein	NA	NA	NA	NA
YP_002518842.1\|3635002_3636805_-\|tRNA	arginyl-tRNA synthetase	M1PAX3	Moumouvirus	2.1e-54	27.0
YP_008877628.1\|3636801_3637524_-	hypothetical protein	NA	NA	NA	NA
YP_002518844.1\|3637665_3638625_+	4-hydroxy-3-methylbut-2-enyl diphosphate reductase	NA	NA	NA	NA
YP_002518845.1\|3638699_3638969_+	hypothetical protein	NA	NA	NA	NA
YP_002518846.1\|3639148_3639541_-	death on curing toxin protein doc	A0A1B3AYM0	Gordonia_phage	1.0e-06	41.0
YP_002518847.1\|3639537_3639765_-	SpoVT-AbrB family transcription factor, phd antitoxin	NA	NA	NA	NA
YP_002518848.1\|3639846_3640800_+	homoserine kinase	NA	NA	NA	NA
YP_002518849.1\|3640796_3641246_+	ribonuclease HI	J9Q745	Salmonella_phage	3.6e-40	56.7
YP_002518850.2\|3641242_3641656_-	rhodanese-related sulfurtransferase	NA	NA	NA	NA
YP_002518851.2\|3641743_3642703_+	AraC-family transcription regulator FtrA	NA	NA	NA	NA
YP_002518852.1\|3642811_3643258_-	MarR-family transcriptional regulator	NA	NA	NA	NA
YP_002518853.1\|3643336_3644191_+	triphenylmethane reductase (TMR)-like protein	NA	NA	NA	NA
YP_002518854.2\|3644279_3644732_+	DNA integration/recombination/inversion protein	NA	NA	NA	NA
YP_002518855.1\|3644814_3645576_-	ABC transporter permease protein	NA	NA	NA	NA
YP_002518856.1\|3645572_3646517_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.4e-22	34.4
YP_002518857.1\|3646620_3647085_-\|protease	NfeD-related membrane protease regulator	NA	NA	NA	NA
YP_002518858.1\|3647086_3648061_-\|protease	membrane protease family, stomatin/prohibitin-like protein	J3IZE5	Acanthamoeba_polyphaga_lentillevirus	2.5e-22	32.5
YP_002518859.1\|3648095_3648524_-	hypothetical protein	NA	NA	NA	NA
YP_002518860.2\|3648686_3648914_+	zonular occludens toxin, zot-like protein	NA	NA	NA	NA
YP_002518861.1\|3648910_3649450_-	hypothetical protein	NA	NA	NA	NA
YP_002518862.1\|3649562_3650528_-	nitropropane dioxygenase/trans-enoyl-CoA reductase family	NA	NA	NA	NA
YP_002518863.1\|3650596_3650818_-	hypothetical protein	NA	NA	NA	NA
YP_002518864.1\|3650870_3651653_-	gluconate 5-dehydrogenase (Ga5DH)-related protein	Q06VL0	Trichoplusia_ni_ascovirus	2.9e-13	28.2
YP_002518865.2\|3651717_3652485_-\|protease	M50-like Site-2 protease	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage