CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NC_012858	Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132502, complete sequence	0 crisprs	DEDDh,csa3	0	0
NC_012850	Rhizobium leguminosarum bv. trifolii WSM1325, complete sequence	1 crisprs	cas3,csa3,WYL,DEDDh	1	6
NC_012848	Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132501, complete sequence	0 crisprs	csa3	0	1
NC_012854	Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132505, complete sequence	0 crisprs	NA	0	0
NC_012853	Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132503, complete sequence	0 crisprs	RT	0	0
NC_012852	Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132504, complete sequence	0 crisprs	NA	0	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_012850_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_012850_1

573643-573722

Orphan

Consensus_repeat	Method
GTGCAGCGGTTCCGGGATAAAGGCA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_012850_1

>merge|NC_012850|1|573643-573722|CRISPRCasFinder
GTGCAGCGGTTCCGGGATAAAGGCACGCATCACAACAAATGCATGTCGCCCGGAAGTGCAGCGGTTCCGGGATAACGGCA

>NC_012850|1|1|573643-573722|CRISPRCasFinder
GTGCAGCGGTTCCGGGATAAAGGCA	CGCATCACAACAAATGCATGTCGCCCGGAA
GTGCAGCGGTTCCGGGATAACGGCA

Protein	Signature genes	Signature genes Name	Protein_function
NC_012850.1\|WP_012756239.1\|578728_579067_+\|F0F1-ATP-synthase-assembly-protein	unknown	unknown	gnl\|CDD\|227641
NC_012850.1\|WP_012756235.1\|572457_573624_+\|Mrp/NBP35-family-ATP-binding-protein	unknown	unknown	gnl\|CDD\|378455
NC_012850.1\|WP_012756229.1\|566802_567690_-\|SMP-30/gluconolactonase/LRE-family-protein	unknown	unknown	gnl\|CDD\|225921
NC_012850.1\|WP_171815711.1\|569258_570026_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|212491
NC_012850.1\|WP_012756234.1\|571189_571924_+\|autoinducer-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|225360
NC_012850.1\|WP_012756238.1\|577227_578457_+\|cell-wall-hydrolase	unknown	unknown	gnl\|CDD\|226296
NC_012850.1\|WP_012756237.1\|575064_576963_+\|potassium-transporter-Kup	unknown	unknown	gnl\|CDD\|225700
NC_012850.1\|WP_017993096.1\|574047_575046_+\|magnesium-transporter	unknown	unknown	gnl\|CDD\|213371
NC_012850.1\|WP_128449650.1\|571916_572228_-\|hypothetical-protein	unknown	unknown	unknown
NC_012850.1\|WP_012756240.1\|579129_579882_+\|F0F1-ATP-synthase-subunit-A	unknown	unknown	gnl\|CDD\|235617
NC_012850.1\|WP_012756230.1\|567686_568328_-\|2-dehydro-3-deoxy-6-phosphogalactonate-aldolase	unknown	unknown	gnl\|CDD\|181670
NC_012850.1\|WP_012756233.1\|570134_570932_+\|IclR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224332
NC_012850.1\|WP_012756227.1\|564527_565892_+\|EAL-domain-containing-protein	unknown	unknown	gnl\|CDD\|227334
NC_012850.1\|WP_012756231.1\|568341_569259_-\|2-dehydro-3-deoxygalactonokinase	unknown	unknown	gnl\|CDD\|226257
NC_012850.1\|WP_012756244.1\|583111_583801_-\|ribonuclease-HII	unknown	unknown	gnl\|CDD\|234574
NC_012850.1\|WP_012756242.1\|580881_581373_+\|F0F1-ATP-synthase-subunit-B	unknown	unknown	gnl\|CDD\|169691
NC_012850.1\|WP_012755854.1\|581853_582972_-\|IS4-family-transposase	unknown	unknown	gnl\|CDD\|376573
NC_012850.1\|WP_012756228.1\|565963_566569_-\|PRC-barrel-domain-containing-protein	unknown	unknown	gnl\|CDD\|368352
NC_012850.1\|WP_012756241.1\|580254_580878_+\|F0F1-ATP-synthase-subunit-B	unknown	unknown	gnl\|CDD\|169692
NC_012850.1\|WP_003545854.1\|579949_580177_+\|F0F1-ATP-synthase-subunit-C	unknown	unknown	gnl\|CDD\|181027

Protein	Function_ID	Function_description	E-value
NC_012850.1\|WP_012756235.1\|572457_573624_+\|Mrp/NBP35-family-ATP-binding-protein	gnl\|CDD\|378455	pfam10609, ParA, NUBPL iron-transfer P-loop NTPase. This family contains ATPases involved in plasmid partitioning. It also contains the cytosolic Fe-S cluster assembling factor NBP35 which is required for biogenesis and export of both ribosomal subunits.	6.8977e-146
NC_012850.1\|WP_012756229.1\|566802_567690_-\|SMP-30/gluconolactonase/LRE-family-protein	gnl\|CDD\|225921	COG3386, COG3386, Gluconolactonase [Carbohydrate transport and metabolism].	1.18202e-84
NC_012850.1\|WP_171815711.1\|569258_570026_-\|SDR-family-oxidoreductase	gnl\|CDD\|212491	cd05233, SDR_c, classical (c) SDRs. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human prostaglandin dehydrogenase (PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, PGDH numbering) and/or an Asn (Asn-107, PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	1.61943e-62
NC_012850.1\|WP_012756234.1\|571189_571924_+\|autoinducer-binding-domain-containing-protein	gnl\|CDD\|225360	COG2771, CsgD, DNA-binding HTH domain-containing proteins [Transcription].	6.37994e-20
NC_012850.1\|WP_012756238.1\|577227_578457_+\|cell-wall-hydrolase	gnl\|CDD\|226296	COG3773, SleB, Cell wall hydrolyses involved in spore germination [Cell envelope biogenesis, outer membrane].	2.40121e-85
NC_012850.1\|WP_012756237.1\|575064_576963_+\|potassium-transporter-Kup	gnl\|CDD\|225700	COG3158, Kup, K+ transporter [Inorganic ion transport and metabolism].	0
NC_012850.1\|WP_017993096.1\|574047_575046_+\|magnesium-transporter	gnl\|CDD\|213371	cd12837, EcCorA-like_u1, uncharacterized subgroup of the Escherichia coli Mg2+ transporter CorA_like subfamily. A uncharacterized subgroup of the Escherichia coli CorA-Salmonella typhimurium ZntB_like family (EcCorA_ZntB-like) family of the MIT superfamily of essential membrane proteins involved in transporting divalent cations (uptake or efflux) across membranes. The EcCorA_ZntB-like family includes the Mg2+ transporters Escherichia coli and Salmonella typhimurium CorAs, which can also transport Co2+, and Ni2+. Structures of the intracellular domain of EcCorA_ZntB-like family members, Vibrio parahaemolyticus and Salmonella typhimurium ZntB, form funnel-shaped homopentamers, the tip of the funnel is formed from two C-terminal transmembrane (TM) helices from each monomer, and the large opening of the funnel from the N-terminal cytoplasmic domains. The GMN signature motif of the MIT superfamily occurs just after TM1, mutation within this motif is known to abolish Mg2+ transport through Salmonella typhimurium CorA. Natural variants such as GVN and GIN, such as occur in some ZntB family proteins, may be associated with the transport of different divalent cations, such as zinc and cadmium. The functional diversity of MIT transporters may also be due to minor structural differences regulating gating, substrate selection, and transport.	2.99058e-155
NC_012850.1\|WP_012756239.1\|578728_579067_+\|F0F1-ATP-synthase-assembly-protein	gnl\|CDD\|227641	COG5336, COG5336, Uncharacterized protein conserved in bacteria [Function unknown].	1.04393e-37
NC_012850.1\|WP_012756240.1\|579129_579882_+\|F0F1-ATP-synthase-subunit-A	gnl\|CDD\|235617	PRK05815, PRK05815, F0F1 ATP synthase subunit A; Validated.	1.66271e-64
NC_012850.1\|WP_012756230.1\|567686_568328_-\|2-dehydro-3-deoxy-6-phosphogalactonate-aldolase	gnl\|CDD\|181670	PRK09140, PRK09140, 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed.	3.40628e-114
NC_012850.1\|WP_012756233.1\|570134_570932_+\|IclR-family-transcriptional-regulator	gnl\|CDD\|224332	COG1414, IclR, Transcriptional regulator [Transcription].	7.82473e-67
NC_012850.1\|WP_012756227.1\|564527_565892_+\|EAL-domain-containing-protein	gnl\|CDD\|227334	COG5001, COG5001, Predicted signal transduction protein containing a membrane domain, an EAL and a GGDEF domain [Signal transduction mechanisms].	2.96794e-112
NC_012850.1\|WP_012756231.1\|568341_569259_-\|2-dehydro-3-deoxygalactonokinase	gnl\|CDD\|226257	COG3734, DgoK, 2-keto-3-deoxy-galactonokinase [Carbohydrate transport and metabolism].	1.27206e-118
NC_012850.1\|WP_012756244.1\|583111_583801_-\|ribonuclease-HII	gnl\|CDD\|234574	PRK00015, rnhB, ribonuclease HII; Validated.	1.2398e-103
NC_012850.1\|WP_012756242.1\|580881_581373_+\|F0F1-ATP-synthase-subunit-B	gnl\|CDD\|169691	PRK09173, PRK09173, F0F1 ATP synthase subunit B; Validated.	4.08454e-72
NC_012850.1\|WP_012755854.1\|581853_582972_-\|IS4-family-transposase	gnl\|CDD\|376573	pfam01609, DDE_Tnp_1, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction. This family contains transposases for IS4, IS421, IS5377, IS427, IS402, IS1355, IS5, which was original isolated in bacteriophage lambda.	1.82791e-08
NC_012850.1\|WP_012756228.1\|565963_566569_-\|PRC-barrel-domain-containing-protein	gnl\|CDD\|368352	pfam05239, PRC, PRC-barrel domain. The PRC-barrel is an all beta barrel domain found in photosystem reaction centre subunit H of the purple bacteria and RNA metabolism proteins of the RimM group. PRC-barrels are approximately 80 residues long, and found widely represented in bacteria, archaea and plants. This domain is also present at the carboxyl terminus of the pan-bacterial protein RimM, which is involved in ribosomal maturation and processing of 16S rRNA. A family of small proteins conserved in all known euryarchaea are composed entirely of a single stand-alone copy of the domain.	8.36894e-11
NC_012850.1\|WP_012756241.1\|580254_580878_+\|F0F1-ATP-synthase-subunit-B	gnl\|CDD\|169692	PRK09174, PRK09174, F0F1 ATP synthase subunit B.	9.92632e-90
NC_012850.1\|WP_003545854.1\|579949_580177_+\|F0F1-ATP-synthase-subunit-C	gnl\|CDD\|181027	PRK07558, PRK07558, F0F1 ATP synthase subunit C; Validated.	7.89276e-27

>NC_012850.1|WP_012756235.1|572457_573624_+|Mrp/NBP35-family-ATP-binding-protein
MADVTKEQVLETLKTVRGPDLEHDIVELGMVSDVFISDGKVYFSITVPADRAKELEPMRLAAERVIKEMPGVKGALVTLTADKKAAAAAPAARPAANPPHGHAGHDHGSHAHAPQQPPRAGKIGVPGIGAIIAVASGKGGVGKSTTAVNLALGLLANGLRVGILDADIYGPSMPRLLKISGRPTQIDGRIINPMENYGLKVMSMGFLVDEETAMIWRGPMVQSALLQMLREVAWGELDVLVVDMPPGTGDVQLTMAQQVPLAGAVIVSTPQDLALIDARKGLNMFRKVEVPVLGIVENMSYFIAPDTGTRYDIFGHGGARKEAERIGVPFLGEVPLTMNIRETSDAGTPLVASEPNGVVAGIYRGIAAKVWEQVAGQPQRPAPTIVFE
>NC_012850.1|WP_128449650.1|571916_572228_-|hypothetical-protein
MNAEDEIANSRERSGAKTQQPPPTPKGRKKSGIGVGQRCVGRAIFWRWSQSPLWTSRRRDAESVPDGKSGKTGQKRSGQASNGKDLPMRWAASKALGCFLQLI
>NC_012850.1|WP_012756234.1|571189_571924_+|autoinducer-binding-domain-containing-protein
MAPLSQTSTEEDDYVQEIAGLKTQFDIFRFMKRVTEAYRSRAFMVLNLPPITSFDLQGSTVITSWPAELLALYDQEGLMVNSPVLRRLRTSARPFFYDMSRQNLSRDDGKSILVASLFERFKMMRCAYFPTHEPSGLRGAISFAGDREPFSPAEMRELCYISIHIFDRLAEIRNLDTRMTDTLTDREIDCLNWTAAGKTSAEIAEILTLSEHTVNHYLNRATKKLDTVNRTQAVAKALRIGLIK
>NC_012850.1|WP_012756233.1|570134_570932_+|IclR-family-transcriptional-regulator
MNSNGDGAAQARETGTLGKLMVLLDLVTHADAPLRFTDILALAGQPRGTLHRQLSHLVEEGLLELDGDGRYAPGLRLLDFAARSWARNEFRLIAEPHLRDLQQATGETVHLGVLRGQSIIYLDKVEGRQPVRMYSQIGNASPCYCTGVGKAALSLLPAESLVDLIAGLSFTSFTASTHVSAETLLAEIREIADQGYAFDREEHEAGIRCVAAPVWSEDRTFMGGISITGPAYRLSMELLHQWTVPVQLAAVRIMEGMRVRLGPRR
>NC_012850.1|WP_171815711.1|569258_570026_-|SDR-family-oxidoreductase
MMPAAQFPEFKNRAVLVTGGGSGIGAAIVEGFARQGAKVSFIDIAEAAGRELAERLSRETTHPVSFHHADLRDIAAIRRTVDSVIASSGPIRVLVNNAAWDDRHEFDAVTEAYWDNNQAVNLKHVFFTSQAVVPSMRAAGGGAIINMSSIAFKLNMGGFPAYAAAKAAVVGLTKSMAGRLGPENIRVNCILPGMVVTERQMQHWLTEESIARSVEDQCLKVALKPDAIVGPCLFLASDCAAAMTAQSLIVDGGVL
>NC_012850.1|WP_012756231.1|568341_569259_-|2-dehydro-3-deoxygalactonokinase
MANPAYVAVDWGTSSFRLWLISRDGTVLAERRSGEGMTSAAKIGFSAVLAGHLAAIEAPENLPVIVCGMAGARQGWVEAGYIDVPAPLASILTGAVSVPGESRDIRILPGLAQRDIARPDVMRGEETQLLGALGRASAGAQAVCMPGTHSKWVHVTDSKVTGFSTFMTGELFDVISKHTILSHAVAGAEEQPADAAAFEAAVSAAFARPALASNLLFAARSGQLLHGISAAAAQARLSGTLIGLEIAGALQDAANGTTITLVASGRLQALYEQAVKTLSLAFTAIDADAAVRRGLSAAAEAIWPN
>NC_012850.1|WP_012756230.1|567686_568328_-|2-dehydro-3-deoxy-6-phosphogalactonate-aldolase
MNRIPFPDMKRPLIAILRGIRPDETESVVGALIDNGLTAIEIPLNSPEPFKSIEIAAKMAPAEVLIGAGTVLTVEAVDSLHAAGGKLLVTPNVEPEVIIRARDYGMVTMPGVFTPTEALAAARAGATGLKFFPASVLGPSGITAIRAILPPELTIAAVGGVSDKNFGDYTKAGIFAFGLGTSIYKPGMTASEVAERAKATIYAYDAAIGSVNV
>NC_012850.1|WP_012756229.1|566802_567690_-|SMP-30/gluconolactonase/LRE-family-protein
MTDIYEFEGKTLCNTNSVLGEGPTYDPDSNTVWWFNILGKELHELNLSTAAKKVHPLPVMASVLARIDAGRQLIATEEGLFVRDVASGNLTFYAALENDRPENRSNDGRTHPSGALWIGTMSKRAENQAGAIYHVASGKVTKIFNGISIPNSICFSPDGTVGYYTDSRINRLMRVMVDPLTGLPSGEPIVLVDSMDDPGSIDGSVVDADGYLWNARWGAGVVDRYSPDGLRISRYMVPAVQPSCPAFIGVNADRLAVTTAWEGLDEDARSAQPSAGALLELGIDVKGVFDPVYVI
>NC_012850.1|WP_012756228.1|565963_566569_-|PRC-barrel-domain-containing-protein
MTRKLLTTVAAGALFATAFAPAAFSQAAPQPADPAAPTQAAPADPAAPKPMTPDVTKPAGDAAQAPAAAPTADTAQAGYLTEQSPDQVSANTYIGQSVYNGNNESIGSVNDLILKKDGGFVAAIVGVGGFLGIGEKNVAVPMEKITVAQNTQDGSVKLTTSETAESLKAAPEFKTLAMQSAEKAPAATGTDTTATGSTTPK
>NC_012850.1|WP_012756227.1|564527_565892_+|EAL-domain-containing-protein
MMKSADIAFLTVGQNELQAMAYTDPLTGLGNRNRMRDKVLQISAERASDPAPFTIGIVNLDSFKPINDLFGSTAGDEILCQVAHRLRACIPDGALVTRHDGDEFAFVLPLIFERASAEKFGQMIREVLSAPYDLGDRNVRLSASLGFSIYPFAGEDCEELLKSAETALYRSKRRGRGQITVYSREIAQEMKRATQLEQALRNAIISDAIDVHFQPIVSLSNNQVVGFEALARWNDPDLGFVSPGVFVPLAEERGFIDALSEALLRKAAEAALSWPRELFLSFNLSSAQLMDPGTSSSVLSILGRVGFDPHRLELEITETAVMSSADTAHRIIADLRAAGVRISLDDFGTGQSSLGRLRDFIFDKIKIDRAFVSRINSDRASEHIIKAILTMCEGLELEVVAEGIEDYAEAVKLRTLGCGMGQGYHFGRPADGIATLRFLHENYYDPTMVERVSA
>NC_012850.1|WP_017993096.1|574047_575046_+|magnesium-transporter
MQPERRPVITAYCSNCKSVEIGDLSHAASFPEDVVWIDMIEPTRDEELYVEKVLGIEVPTRDDLKDIEPSARLYVENDAVFMTASLLWKADTDVPTLTDVAFILAGNRLVTIRYAHPKSFALFIAALHRLPENWRSGAALLAKLLETIVDRTAEILEIAVSRLDILSMHVFGERARKVRKPSNYLEEKLRDIAGHHRMISKVRDSLGSLARLLTFFHTIPAIQQDREAKELCRTVSRDIQSLSEHASFVAANITFLLDASLGLINIEQNSIIKIFSIASVVFLPPTLVASVYGMNFQVMPELTWAAGYPYSLALMVISAVIPFFFFRWKGWL
>NC_012850.1|WP_012756237.1|575064_576963_+|potassium-transporter-Kup
MSEESHPNERHMTPRKLFYLALGSVGVVYGDIGTSPLYAFREALKPVAHDGVTRFEVISLISLMIWALTIIVTIKYVLFLLRADNDGEGGTLSLLALLMKTANGHTAILMLLGLMGAALFLGDAMITPALSVLSAVEGLKLVTPRLADYIVPISVVILALLFVVQSRGTGAVARFFGPITAVWFLVMAAAGISHISDDYGILAAFNPYYAVSFLLHEGFYGVVVLGAVFLTVTGAEALYADLGHFGRRPIQWAWFMLVFPALTLNYLGQGALVLGNPATMSDPFYLMFPKWALLPVVILATAATIIASQAVITGAFSMVRQGINLGFLPRMEILFTSETNTGQIFVPSVNAVLFIGVIFLVLSFKTSDALATAYGISVTGAMVVTSIMAFEFVRARWNWSLPVAVIALAPLVVLEMIFLGANLLKIHDGGYIPIMIATAFTVVMWTWRRGTAILMEKTRHTDIPLASFVSSIERKSEHSPAQVPGTAIFLTSDPESAPAALLHNLKHNHVLHDRNVILTIRTINKPRVPSHDRYKIEQISERFSRVELLFGFMESQNVSQALATLRKTGLKFDIMSTSFYLGRRKLVPDAKSGMPYWQDRLYIALANAAANPSDYFRLPANRVVELGSHVII
>NC_012850.1|WP_012756238.1|577227_578457_+|cell-wall-hydrolase
MECSSVPCPESVLRRKSPSRSKLRLFPENWVSPVIFGLAGWLIFPSVASHADLAAMLAGLDHEGGNWRMVLTNSPAGSIHQAELAFAEPMVTGSIAADAGMVLPDGRKVAFNAKDKGTAKDRGHEDTPDEDRVNRSAKKGRVVAVEKMQPPKDFSAGSILERTKMLFTPSFDLKDRSAFVKPKIQGKEIEIATSFYKKQPVVTDNGVPAMLASLVTNNKADVLATAYAPAAPDYARQSPFDSILAEPDSGRFVPEIGPRDHAWAASVLAPSVFSAREQQCLASGIYFEARGESVKGQAAVAQVILNRVRNPSYPKTICGVVYQNEDWRNRCQFSFACDSIKDRVNSEYHWRVARDVAMAVTSGKIWLLQVGSATHYHAVYVRPKWAKTMEKVGRIGLHVFYRTYGGGWS
>NC_012850.1|WP_012756239.1|578728_579067_+|F0F1-ATP-synthase-assembly-protein
MADDREESLEKRRAQLGAKLATKGVETGEDEAREARAEVSRKGYAQAMKLSSEFISAIVVGALLGYLLDRFVGTAPWGLIVLLLLGFCAGVLNVLRSAGVVAHPLDDKDDKK
>NC_012850.1|WP_012756240.1|579129_579882_+|F0F1-ATP-synthase-subunit-A
MSNDPTHQFLIQKIVPIEIGGIDFSFTNASLFMAVSAAAAAGFLYFATSNRAIVPGRSQSVAEMSYEFIANMLKEGAGKQGMKFFPLVFSLFMFVLTANLLGMFPYFFTVTSQIIVTFALAILVIGTVLVYGFYKHGFHFLNVFVPSGVPGLLLPLVVTIEIISFLSRPISLSVRLFANMLAGHITLKVFAGFVASLGTMGALGIGGAVLPLIMTVALTGLEFLVAFLQAYVFAVLTCMYLNDAIHPGGH
>NC_012850.1|WP_003545854.1|579949_580177_+|F0F1-ATP-synthase-subunit-C
MEAEAAKYIGAGLACFGMAGTALGLGNIFGSYLSGALRNPSAADSQFGRLVFGFAVTEALGIFSLLVALLLLFAV
>NC_012850.1|WP_012756241.1|580254_580878_+|F0F1-ATP-synthase-subunit-B
MFFVTPAYAEEAPAAATGTDAHAAPAAGEVHTETGVAEGEHARGPFPPFDSTTFASQLLWLVITFGVFYLLMQKVIAPRIGTILDQRHTRISQDLEEAGRLKAEADAAVRTYEGELAAARAKSNAIGSAARDAAKAKAEEERRAVEASLSEKIKAAELRIGEIKAKAFADVGTIAEETAAAVVDQLIGGTVAKADVAAAVAAAKKEA
>NC_012850.1|WP_012756242.1|580881_581373_+|F0F1-ATP-synthase-subunit-B
MEFAFDATFFAFVGLVLFLALVVYLKVPGMMARSLDDRADQIRNELAEAKRLREEAQHLLAEYQRKRKEAEAEAAHIVAAAEREAEMLTAEAKKKTEEFVANRTALSEQKIKQAEVEAMKAVRSAAVDLAIAAAETVLAKRADTKIQSELFGNAVGQVKTRLN
>NC_012850.1|WP_012755854.1|581853_582972_-|IS4-family-transposase
MKIRPEVLDHWPEVRERLPAGFDLEATARLRGAFTRVREIKNAETLLRLALAYGGLGMSLRETCAWAEAGGIARLSDPSLLERLCKAAPWLGDIVAALIAEQAKVPTGRFAGYRLRVLDGTSICHPGADRTTWRLHVGYDLATAQVDQLELTDIHGAENLQRLTYAPGDIVLADRYYARPRDLRPVIDAGADFIVRTGWNSLRLLQTNGEPFDLFAALAAQQEQEGEVQVRVHEGMTGTPPPPPLALRLIVRRKDPQQAQAEQERLLKAARKHGKKPDPRSLEAAKYILLLTSLPATTFPPADILTLYRFRWQIELAFKRFKSLAGLDSLPAKKPELARAWLYARLIVAIIAEQIAGQVPDSPPSGCGNPTG
>NC_012850.1|WP_012756244.1|583111_583801_-|ribonuclease-HII
MKPRTSPDSPLLFDTAPLVPDFRLELKARKAGHWPVAGADEAGRGPLAGPVVAAAVILDPRRIPEGLNDSKQLSAQRREELFVQILATATVSIASSSSTRIDETDIRKASLDAMRRAICSLAIPASYVLTDGLDVPPGLDCPGQAVVKGDARSVSIAAASIVAKVTRDRMMARAHSVFPDYGFAAHVGYGTAQHRAGIERHGPCSLHRMSFRPLRKTEGAPETDELLSE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_012850_1	1.1\|573668\|30\|NC_012850\|CRISPRCasFinder	573668-573697	30	NC_011366	Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG202, complete sequence	132226-132255	6	0.8
NC_012850_1	1.1\|573668\|30\|NC_012850\|CRISPRCasFinder	573668-573697	30	NZ_CP054028	Rhizobium sp. JKLM19E plasmid pPR19E01, complete sequence	139099-139128	6	0.8
NC_012850_1	1.1\|573668\|30\|NC_012850\|CRISPRCasFinder	573668-573697	30	NZ_CP035000	Rhizobium acidisoli strain FH23 plasmid pRapFH23b, complete sequence	457538-457567	8	0.733
NC_012850_1	1.1\|573668\|30\|NC_012850\|CRISPRCasFinder	573668-573697	30	NZ_CP013553	Rhizobium phaseoli strain N931 plasmid pRphaN931a, complete sequence	132406-132435	9	0.7
NC_012850_1	1.1\|573668\|30\|NC_012850\|CRISPRCasFinder	573668-573697	30	NZ_CP013586	Rhizobium phaseoli strain N161 plasmid pRphaN161a, complete sequence	137771-137800	9	0.7
NC_012850_1	1.1\|573668\|30\|NC_012850\|CRISPRCasFinder	573668-573697	30	NZ_CP013538	Rhizobium phaseoli strain R630 plasmid pRphaR630a, complete sequence	126297-126326	9	0.7
NC_012850_1	1.1\|573668\|30\|NC_012850\|CRISPRCasFinder	573668-573697	30	NZ_CP013564	Rhizobium phaseoli strain N831 plasmid pRphaN831a, complete sequence	132406-132435	9	0.7

1. spacer 1.1|573668|30|NC_012850|CRISPRCasFinder matches to NC_011366 (Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG202, complete sequence) position: , mismatch: 6, identity: 0.8

----cgcatcacaacaaatgcatgtcgcccggaa	CRISPR spacer
gctgcccat----accaatgcatgtcgcccggaa	Protospacer
    * ***    ** ******************

2. spacer 1.1|573668|30|NC_012850|CRISPRCasFinder matches to NZ_CP054028 (Rhizobium sp. JKLM19E plasmid pPR19E01, complete sequence) position: , mismatch: 6, identity: 0.8

cgcatcacaacaaatgcatgtcgcccggaa	CRISPR spacer
cgagtttcaactgatgcatgtcgcccggaa	Protospacer
** .*. **** .*****************

3. spacer 1.1|573668|30|NC_012850|CRISPRCasFinder matches to NZ_CP035000 (Rhizobium acidisoli strain FH23 plasmid pRapFH23b, complete sequence) position: , mismatch: 8, identity: 0.733

cgcatcacaacaaatgcatgtcgcccggaa	CRISPR spacer
gcggtgccgactaatgcatgtcgcccggaa	Protospacer
   .*  *.** ******************

4. spacer 1.1|573668|30|NC_012850|CRISPRCasFinder matches to NZ_CP013553 (Rhizobium phaseoli strain N931 plasmid pRphaN931a, complete sequence) position: , mismatch: 9, identity: 0.7

cgcatcacaacaaatgcatgtcgcccggaa	CRISPR spacer
aaaagtcggaccaatgcatgtcgcccggaa	Protospacer
 . * .  .** ******************

5. spacer 1.1|573668|30|NC_012850|CRISPRCasFinder matches to NZ_CP013586 (Rhizobium phaseoli strain N161 plasmid pRphaN161a, complete sequence) position: , mismatch: 9, identity: 0.7

cgcatcacaacaaatgcatgtcgcccggaa	CRISPR spacer
aaaagtcggaccaatgcatgtcgcccggaa	Protospacer
 . * .  .** ******************

6. spacer 1.1|573668|30|NC_012850|CRISPRCasFinder matches to NZ_CP013538 (Rhizobium phaseoli strain R630 plasmid pRphaR630a, complete sequence) position: , mismatch: 9, identity: 0.7

cgcatcacaacaaatgcatgtcgcccggaa	CRISPR spacer
aaaagtcggactaatgcatgtcgcccggaa	Protospacer
 . * .  .** ******************

7. spacer 1.1|573668|30|NC_012850|CRISPRCasFinder matches to NZ_CP013564 (Rhizobium phaseoli strain N831 plasmid pRphaN831a, complete sequence) position: , mismatch: 9, identity: 0.7

cgcatcacaacaaatgcatgtcgcccggaa	CRISPR spacer
aaaagtcggaccaatgcatgtcgcccggaa	Protospacer
 . * .  .** ******************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1246059 : 1255309

Aeromonas_phage(14.29%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012756885.1\|1246059_1247358_+	serine hydroxymethyltransferase	A0A219Y950	Aeromonas_phage	1.9e-97	51.0
WP_003547190.1\|1247367_1247844_+	transcriptional repressor NrdR	NA	NA	NA	NA
WP_012756886.1\|1247847_1249164_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A1V0SE20	Indivirus	2.8e-32	38.9
WP_012756887.1\|1249163_1249775_+	riboflavin synthase	A0A2I2L4R9	Orpheovirus	2.6e-17	35.4
WP_012756888.1\|1249897_1250767_-	glucose-1-phosphate thymidylyltransferase RfbA	K7QKA7	Escherichia_phage	6.8e-96	59.2
WP_012756889.1\|1250777_1251665_-	dTDP-4-dehydrorhamnose reductase	NA	NA	NA	NA
WP_012756890.1\|1251668_1252724_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	2.0e-94	51.5
WP_012756891.1\|1252730_1253309_-	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A218MN57	uncultured_virus	3.2e-33	42.4
WP_012756892.1\|1253332_1255309_-	hypothetical protein	F2Y0P4	Organic_Lake_phycodnavirus	8.7e-06	36.4

DBSCAN-SWA_2

1318552 : 1329334

Bacillus_phage(16.67%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017993614.1\|1318552_1319968_-	diguanylate cyclase	A0A127AWB9	Bacillus_phage	5.8e-12	33.5
WP_012756949.1\|1320258_1320888_+	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	2.7e-62	58.7
WP_003547337.1\|1321191_1322469_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	7.9e-133	58.6
WP_012756950.1\|1322870_1325288_+	endopeptidase La	A0A0R6PGP8	Moraxella_phage	1.0e-205	49.6
WP_003547346.1\|1325494_1325770_+	HU family DNA-binding protein	A0A172Q061	Acinetobacter_phage	7.1e-07	34.1
WP_012756951.1\|1326138_1327050_+	DMT family transporter	NA	NA	NA	NA
WP_171815678.1\|1327123_1329334_+	esterase-like activity of phytase family protein	M4SLV1	Cyanophage	1.6e-80	42.9

DBSCAN-SWA_3

1679393 : 1692794

uncultured_Mediterranean_phage(90.91%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012757236.1\|1679393_1680407_+	beta-N-acetylhexosaminidase	A0A1B1IVS3	uncultured_Mediterranean_phage	1.6e-24	42.6
WP_012757237.1\|1680425_1681283_+	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	5.6e-34	38.5
WP_012757238.1\|1681279_1681996_+	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	3.1e-38	47.5
WP_012483600.1\|1682181_1682373_+	twin-arginine translocase TatA/TatE family subunit	A0A1B1IVR9	uncultured_Mediterranean_phage	8.9e-09	70.5
WP_012757240.1\|1682424_1683036_+	twin-arginine translocase subunit TatB	NA	NA	NA	NA
WP_012757241.1\|1683032_1683860_+	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	1.2e-52	46.5
WP_012757242.1\|1684059_1685343_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	1.1e-97	45.3
WP_012757243.1\|1685347_1686121_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	3.1e-23	30.2
WP_012757244.1\|1686117_1686771_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	9.9e-15	33.5
WP_012757245.1\|1687012_1688617_+	peptidoglycan DD-metalloendopeptidase family protein	I3PV24	Clostridium_phage	5.1e-12	29.2
WP_012757246.1\|1688781_1689654_-	ATP-binding protein	NA	NA	NA	NA
WP_003558894.1\|1689860_1690208_+	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	2.4e-12	39.1
WP_012757247.1\|1690253_1692794_+	protein translocase subunit SecDF	A0A1B1IVP7	uncultured_Mediterranean_phage	7.4e-58	49.8

DBSCAN-SWA_4

1916895 : 1927717

uncultured_Mediterranean_phage(83.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012757439.1\|1916895_1919817_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	0.0e+00	62.0
WP_012757440.1\|1920101_1920611_+	single-stranded DNA-binding protein	R9TP78	Rhizobium_phage	1.2e-44	73.7
WP_012757441.1\|1920739_1921285_+	hypothetical protein	NA	NA	NA	NA
WP_012757442.1\|1921307_1921955_-	MarC family protein	NA	NA	NA	NA
WP_012757443.1\|1922191_1925029_+	DNA gyrase subunit A	A0A1B1IVS2	uncultured_Mediterranean_phage	1.2e-75	41.6
WP_003539654.1\|1925365_1925521_-	hypothetical protein	NA	NA	NA	NA
WP_012757446.1\|1926068_1926563_+	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	6.7e-24	36.5
WP_012757447.1\|1926605_1927178_+	peptidylprolyl isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	2.2e-42	52.6
WP_003559389.1\|1927207_1927717_+	peptidylprolyl isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	4.2e-45	59.4

DBSCAN-SWA_5

2944599 : 2958155

Vibrio_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003561200.1\|2944599_2946657_-	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	1.7e-36	33.6
WP_003561203.1\|2947124_2947472_-	GFA family protein	NA	NA	NA	NA
WP_012758380.1\|2947481_2948519_-	L-threonine 3-dehydrogenase	R9TPW0	Vibrio_phage	7.1e-15	68.6
WP_012758381.1\|2948629_2949817_-	glycine C-acetyltransferase	D2TEZ5	Emiliania_huxleyi_virus	4.9e-36	27.8
WP_012758382.1\|2949982_2950711_-	class I SAM-dependent methyltransferase	A0A1X9I6N4	Streptococcus_phage	1.5e-48	42.4
WP_012758383.1\|2950782_2952651_-	DNA helicase RecQ	L7RCS0	Acanthamoeba_polyphaga_moumouvirus	2.4e-77	35.7
WP_012758384.1\|2952650_2954660_-	DNA primase	A0A0K1LMQ9	Caulobacter_phage	1.1e-88	41.9
WP_012758385.1\|2955330_2956221_+	hypothetical protein	NA	NA	NA	NA
WP_012758386.1\|2956224_2956680_-	GatB/YqeY domain-containing protein	A0A292GL36	Xanthomonas_phage	9.0e-15	38.7
WP_011652894.1\|2956949_2958155_+	glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit	R4TGJ8	Halovirus	1.6e-39	32.6

DBSCAN-SWA_6

3845937 : 3855998

Mycobacterium_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012759103.1\|3845937_3846648_+	7-cyano-7-deazaguanine synthase QueC	A0A2P1JXV3	Rhodococcus_phage	1.9e-51	49.6
WP_012759104.1\|3846647_3847004_+	6-carboxytetrahydropterin synthase QueD	NA	NA	NA	NA
WP_012759105.1\|3847000_3847729_+	7-carboxy-7-deazaguanine synthase QueE	A0A1U9WRB6	Streptococcus_virus	2.6e-40	38.0
WP_012759106.1\|3847747_3848980_-	adenylate/guanylate cyclase domain-containing protein	M1HLN3	Pelagibacter_phage	1.2e-13	28.8
WP_012759107.1\|3849084_3850059_-	class 1b ribonucleoside-diphosphate reductase subunit beta	R4TBI6	Mycobacterium_phage	2.3e-137	73.8
WP_017995273.1\|3850294_3852418_-	class 1b ribonucleoside-diphosphate reductase subunit alpha	V9VI16	Lactococcus_phage	6.3e-212	52.0
WP_012759109.1\|3852414_3852828_-	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	A1YTS5	Staphylococcus_phage	9.6e-08	33.9
WP_012759110.1\|3852837_3853059_-	glutaredoxin-like protein NrdH	V5UN81	Mycobacterium_phage	2.1e-17	53.4
WP_041935580.1\|3853730_3855998_-	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	6.9e-124	40.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NC_012848

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

256902 : 300328

Stx2-converting_phage(30.77%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_171815722.1\|256902_257307_+\|transposase	transposase	NA	NA	NA	NA
WP_171815723.1\|257333_257627_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_012755301.1\|257619_259209_+\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	1.8e-94	41.6
WP_012755302.1\|259247_259610_-	hypothetical protein	NA	NA	NA	NA
WP_012755303.1\|260313_262455_-	DEAD/DEAH box helicase	M1HWJ9	Paramecium_bursaria_Chlorella_virus	2.9e-07	23.6
WP_012755304.1\|262457_264083_-	DUF1837 domain-containing protein	NA	NA	NA	NA
WP_012755305.1\|264544_265168_-	plasmid pRiA4b ORF-3 family protein	A0A2H4PDG5	Mycobacterium_phage	1.3e-19	34.3
WP_012755306.1\|268315_268603_-	hypothetical protein	NA	NA	NA	NA
WP_012755307.1\|269578_270406_+	hypothetical protein	NA	NA	NA	NA
WP_012755309.1\|271546_272248_-	hypothetical protein	NA	NA	NA	NA
WP_085994801.1\|273857_275047_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.5e-48	40.8
WP_012755310.1\|275590_276520_+	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_080518582.1\|276941_277133_-	hypothetical protein	NA	NA	NA	NA
WP_012755312.1\|277726_277984_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_012755314.1\|279475_280138_+	transcriptional regulator	NA	NA	NA	NA
WP_012755315.1\|280266_280824_+	hypothetical protein	NA	NA	NA	NA
WP_012755316.1\|281172_281466_-	ferredoxin III, nif-specific	NA	NA	NA	NA
WP_012755317.1\|281994_283584_-\|transposase	IS66 family transposase	S5VLC8	Leptospira_phage	2.6e-37	32.8
WP_012755318.1\|283791_285447_-\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	2.7e-101	46.5
WP_003551791.1\|285492_285840_-	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZDM8	Stx2-converting_phage	8.9e-39	64.5
WP_012755319.1\|285836_286247_-	IS66 family insertion sequence hypothetical protein	A0A1B0YZU7	Pseudomonas_phage	9.9e-05	40.0
WP_050786652.1\|286290_286557_-	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	1.9e-12	50.0
WP_080518583.1\|286537_287020_-	IS66 family insertion sequence hypothetical protein	A0A0P0ZBP6	Stx2-converting_phage	8.1e-06	46.8
WP_012755320.1\|287287_288391_-	acyltransferase	A9YX16	Burkholderia_phage	5.4e-13	29.4
WP_012755321.1\|288675_289167_-	MaoC family dehydratase	NA	NA	NA	NA
WP_012755322.1\|289246_291073_-	glutamine--fructose-6-phosphate transaminase (isomerizing)	M1HHR4	Paramecium_bursaria_Chlorella_virus	1.8e-106	40.6
WP_012755323.1\|291503_292055_-	sugar O-acetyltransferase	NA	NA	NA	NA
WP_012755325.1\|292543_293752_-	beta-ketoacyl-[acyl-carrier-protein] synthase family protein	NA	NA	NA	NA
WP_012755326.1\|293751_294030_-	acyl carrier protein	NA	NA	NA	NA
WP_012755327.1\|294502_295450_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_012755328.1\|295684_296275_+	NodA family N-acyltransferase	NA	NA	NA	NA
WP_012755329.1\|296271_296910_+	chitooligosaccharide deacetylase NodB	NA	NA	NA	NA
WP_012755330.1\|296930_298211_+	chitooligosaccharide synthase NodC	NA	NA	NA	NA
WP_012755331.1\|298241_299270_+	nodulation factor ABC transporter ATP-binding protein NodI	W6JKT0	Anomala_cuprea_entomopoxvirus	2.2e-24	37.3
WP_012755332.1\|299266_300055_+	ABC transporter permease	NA	NA	NA	NA
WP_080518584.1\|300058_300328_-\|transposase	transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NC_012852

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

177043 : 186132

Planktothrix_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012760033.1\|177043_178099_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.6e-27	35.0
WP_012760034.1\|178098_178878_+	glycerophosphodiester phosphodiesterase	A0A173GBD0	Staphylococcus_phage	4.8e-08	35.2
WP_012760035.1\|178861_179866_+	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	6.0e-19	27.7
WP_012760036.1\|179865_180675_+	inositol monophosphatase	NA	NA	NA	NA
WP_012760037.1\|180741_182397_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	7.5e-19	36.1
WP_012760038.1\|182526_183390_-	hypothetical protein	NA	NA	NA	NA
WP_012760039.1\|183461_184556_-	alanine--glyoxylate aminotransferase family protein	NA	NA	NA	NA
WP_012760040.1\|184567_185347_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.7e-17	30.4
WP_012760041.1\|185343_186132_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.3e-16	31.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_012850

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NC_012848

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NC_012852

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection