CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NC_013406	Paenibacillus sp. Y412MC10, complete sequence	3 crisprs	csa3,cas3,RT,Cas9_archaeal,WYL,DinG,cas14k,DEDDh	0	34	4	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_013406_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_013406_1

163343-163452

Orphan

Consensus_repeat	Method
GGTCGGGGGTTCGATCCCCTCCGCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_013406_1

>merge|NC_013406|1|163343-163452|CRISPRCasFinder
GGTCGGGGGTTCGATCCCCTCCGCCGCTACCATACATACCTGGAGGCTTAGCTCAGCTGGGAGAGCATCTGCCTTACAAGCAGAGGGTCGGGGGTTCGATCCCCTCAGCC

>NC_013406|1|1|163343-163452|CRISPRCasFinder
GGTCGGGGGTTCGATCCCCTCCGCC	GCTACCATACATACCTGGAGGCTTAGCTCAGCTGGGAGAGCATCTGCCTTACAAGCAGAG
GGTCGGGGGTTCGATCCCCTCAGCC

Protein	Signature genes	Signature genes Name	Protein_function
NC_013406.1\|WP_012818387.1\|151649_152927_+\|radical-SAM-protein	unknown	unknown	gnl\|CDD\|100105
NC_013406.1\|WP_012818386.1\|150288_151617_+\|transcription-termination-factor-Rho	unknown	unknown	gnl\|CDD\|236490
NC_013406.1\|WP_012818384.1\|147698_148553_+\|class-II-fructose-1,6-bisphosphate-aldolase	unknown	unknown	gnl\|CDD\|169068
NC_013406.1\|WP_012818398.1\|174272_175556_+\|histidinol-dehydrogenase	unknown	unknown	gnl\|CDD\|376389
NC_013406.1\|WP_009595542.1\|156893_157181_+\|hypothetical-protein	unknown	unknown	unknown
NC_013406.1\|WP_012818395.1\|170693_171920_+\|acyltransferase	unknown	unknown	gnl\|CDD\|376607
NC_013406.1\|WP_012818397.1\|173516_174158_+\|ATP-phosphoribosyltransferase	unknown	unknown	gnl\|CDD\|234971
NC_013406.1\|WP_009595669.1\|167235_168174_+\|HPr-kinase/phosphorylase	unknown	unknown	gnl\|CDD\|235459
NC_013406.1\|WP_012818396.1\|172269_173463_+\|ATP-phosphoribosyltransferase-regulatory-subunit	unknown	unknown	gnl\|CDD\|237043
NC_013406.1\|WP_012818390.1\|164258_165473_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|379258
NC_013406.1\|WP_012818393.1\|169342_169993_+\|pyrophosphatase-PpaX	unknown	unknown	gnl\|CDD\|237336
NC_013406.1\|WP_012818392.1\|168195_169335_+\|prolipoprotein-diacylglyceryl-transferase	unknown	unknown	gnl\|CDD\|183527
NC_013406.1\|WP_012818391.1\|165581_166706_+\|sn-glycerol-3-phosphate-ABC-transporter-ATP-binding-protein-UgpC	unknown	unknown	gnl\|CDD\|236947
NC_013406.1\|WP_006207505.1\|153099_153297_+\|50S-ribosomal-protein-L31	unknown	unknown	gnl\|CDD\|376487
NC_013406.1\|WP_012818388.1\|153976_155692_+\|DNA-polymerase-III-subunit-gamma/tau	unknown	unknown	gnl\|CDD\|235505
NC_013406.1\|WP_012818389.1\|157231_157501_+\|pro-sigmaK-processing-inhibitor-BofA-family-protein	unknown	unknown	gnl\|CDD\|377835
NC_013406.1\|WP_009595539.1\|156069_156669_+\|recombination-protein-RecR	unknown	unknown	gnl\|CDD\|234616
NC_013406.1\|WP_009595540.1\|155732_156044_+\|YbaB/EbfC-family-nucleoid-associated-protein	unknown	unknown	gnl\|CDD\|234669
NC_013406.1\|WP_012818394.1\|170006_170513_+\|acyltransferase	unknown	unknown	gnl\|CDD\|100053
NC_013406.1\|WP_012818385.1\|148874_150134_+\|UDP-N-acetylglucosamine-1-carboxyvinyltransferase	unknown	unknown	gnl\|CDD\|183779

Protein	Function_ID	Function_description	E-value
NC_013406.1\|WP_012818387.1\|151649_152927_+\|radical-SAM-protein	gnl\|CDD\|100105	cd01335, Radical_SAM, Radical SAM superfamily. Enzymes of this family generate radicals by combining a 4Fe-4S cluster and S-adenosylmethionine (SAM) in close proximity. They are characterized by a conserved CxxxCxxC motif, which coordinates the conserved iron-sulfur cluster. Mechanistically, they share the transfer of a single electron from the iron-sulfur cluster to SAM, which leads to its reductive cleavage to methionine and a 5'-deoxyadenosyl radical, which, in turn, abstracts a hydrogen from the appropriately positioned carbon atom. Depending on the enzyme, SAM is consumed during this process or it is restored and reused. Radical SAM enzymes catalyze steps in metabolism, DNA repair, the biosynthesis of vitamins and coenzymes, and the biosynthesis of many antibiotics. Examples are biotin synthase (BioB), lipoyl synthase (LipA), pyruvate formate-lyase (PFL), coproporphyrinogen oxidase (HemN), lysine 2,3-aminomutase (LAM), anaerobic ribonucleotide reductase (ARR), and MoaA, an enzyme of the biosynthesis of molybdopterin.	2.25935e-11
NC_013406.1\|WP_012818386.1\|150288_151617_+\|transcription-termination-factor-Rho	gnl\|CDD\|236490	PRK09376, rho, transcription termination factor Rho; Provisional.	0
NC_013406.1\|WP_012818384.1\|147698_148553_+\|class-II-fructose-1,6-bisphosphate-aldolase	gnl\|CDD\|169068	PRK07709, PRK07709, fructose-bisphosphate aldolase; Provisional.	3.36372e-164
NC_013406.1\|WP_012818398.1\|174272_175556_+\|histidinol-dehydrogenase	gnl\|CDD\|376389	pfam00815, Histidinol_dh, Histidinol dehydrogenase.	0
NC_013406.1\|WP_012818385.1\|148874_150134_+\|UDP-N-acetylglucosamine-1-carboxyvinyltransferase	gnl\|CDD\|183779	PRK12830, PRK12830, UDP-N-acetylglucosamine 1-carboxyvinyltransferase; Reviewed.	0
NC_013406.1\|WP_012818397.1\|173516_174158_+\|ATP-phosphoribosyltransferase	gnl\|CDD\|234971	PRK01686, hisG, ATP phosphoribosyltransferase catalytic subunit; Reviewed.	7.2258e-121
NC_013406.1\|WP_012818395.1\|170693_171920_+\|acyltransferase	gnl\|CDD\|376607	pfam01757, Acyl_transf_3, Acyltransferase family. This family includes a range of acyltransferase enzymes. This domain is found in many as yet uncharacterized C. elegans proteins and it is approximately 300 amino acids long.	3.03509e-18
NC_013406.1\|WP_012818396.1\|172269_173463_+\|ATP-phosphoribosyltransferase-regulatory-subunit	gnl\|CDD\|237043	PRK12292, hisZ, ATP phosphoribosyltransferase regulatory subunit; Provisional.	1.74555e-145
NC_013406.1\|WP_012818390.1\|164258_165473_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|379258	pfam13556, HTH_30, PucR C-terminal helix-turn-helix domain. This helix-turn-helix domain is often found at the C-terminus of PucR-like transcriptional regulators such as Bacillus subtilis pucR and is likely to be DNA-binding.	5.41983e-16
NC_013406.1\|WP_012818393.1\|169342_169993_+\|pyrophosphatase-PpaX	gnl\|CDD\|237336	PRK13288, PRK13288, pyrophosphatase PpaX; Provisional.	3.41646e-86
NC_013406.1\|WP_012818392.1\|168195_169335_+\|prolipoprotein-diacylglyceryl-transferase	gnl\|CDD\|183527	PRK12437, PRK12437, prolipoprotein diacylglyceryl transferase; Reviewed.	3.12003e-113
NC_013406.1\|WP_012818391.1\|165581_166706_+\|sn-glycerol-3-phosphate-ABC-transporter-ATP-binding-protein-UgpC	gnl\|CDD\|236947	PRK11650, ugpC, sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC.	1.59438e-178
NC_013406.1\|WP_006207505.1\|153099_153297_+\|50S-ribosomal-protein-L31	gnl\|CDD\|376487	pfam01197, Ribosomal_L31, Ribosomal protein L31.	2.37971e-38
NC_013406.1\|WP_012818388.1\|153976_155692_+\|DNA-polymerase-III-subunit-gamma/tau	gnl\|CDD\|235505	PRK05563, PRK05563, DNA polymerase III subunits gamma and tau; Validated.	0
NC_013406.1\|WP_012818389.1\|157231_157501_+\|pro-sigmaK-processing-inhibitor-BofA-family-protein	gnl\|CDD\|377835	pfam07441, BofA, SigmaK-factor processing regulatory protein BofA. This family contains the sigmaK-factor processing regulatory protein BofA (Bypass-of-forespore protein A) (approximately 80 residues long). During sporulation in Bacillus subtilis, transcription is controlled in the developing sporangium by a cascade of sporulation-specific transcription factors (sigma factors). Following engulfment, processing of sigmaK is inhibited by BofA. It has been suggested that this effect is exerted by alteration of the level of the SpoIVFA protein.	0.000417503
NC_013406.1\|WP_009595539.1\|156069_156669_+\|recombination-protein-RecR	gnl\|CDD\|234616	PRK00076, recR, recombination protein RecR; Reviewed.	3.2034e-125
NC_013406.1\|WP_009595540.1\|155732_156044_+\|YbaB/EbfC-family-nucleoid-associated-protein	gnl\|CDD\|234669	PRK00153, PRK00153, YbaB/EbfC family nucleoid-associated protein.	3.55439e-44
NC_013406.1\|WP_012818394.1\|170006_170513_+\|acyltransferase	gnl\|CDD\|100053	cd04647, LbH_MAT_like, Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins. MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates. MAT acetylates maltose and glucose exclusively while GAT specifically acetylates galactopyranosides. XAT catalyzes the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others. XATs are implicated in inactivating xenobiotics leading to xenobiotic resistance in patients. Members of this family contain a a left-handed parallel beta-helix (LbH) domain with at least 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X). They are trimeric in their active form.	1.09899e-31
NC_013406.1\|WP_009595669.1\|167235_168174_+\|HPr-kinase/phosphorylase	gnl\|CDD\|235459	PRK05428, PRK05428, HPr kinase/phosphorylase; Provisional.	1.38014e-167

>NC_013406.1|WP_012818389.1|157231_157501_+|pro-sigmaK-processing-inhibitor-BofA-family-protein
MKLIVLGVLCISLLLLIYVVFRKKLGLGWLTVFGAHLALSAVAIYVVNFTGLAAEAYIPLNPMTIGTVMVLGLPGVALLIGLKFTILGS
>NC_013406.1|WP_009595542.1|156893_157181_+|hypothetical-protein
MKIWWKSRKKEEETYITAEEQERMWHVFLDVQRSQMEWERAHLLFQEATGQDQIDYAIYMLEAAERKYQMNLKQAKQLNLDGARMQYIEQKRENG
>NC_013406.1|WP_009595539.1|156069_156669_+|recombination-protein-RecR
MYYPEPIAKLIDAFTRLPGVGPKTAARLAFHVLNMKEDDVIDFAKALVSVKRNLHYCSVCCNITDTDPCRVCQDKTRDASIICVVQDAKDLVAMERTKEFEGYYHVLHGAISPMEGIGPDEIRLKELLTRLSDERVKELILATNANIEGEATAMYISRLVRPFDIKVTRIAHGLPVGGDLEYADEVTLSKALEGRRELN
>NC_013406.1|WP_009595540.1|155732_156044_+|YbaB/EbfC-family-nucleoid-associated-protein
MNNMNQMMKQVKKMQEQMLKAQEELATKTVEGTSGGGVVTVEANGHKQILSINIKPEAVDPDDVEMLQDLVLTAVNDALAKAEEIANADMGKFTGGMKIPGLF
>NC_013406.1|WP_012818388.1|153976_155692_+|DNA-polymerase-III-subunit-gamma/tau
MEHIALYRAWRPQSFGDMVGQQHIIQTLQNAIREQRVSHAYLFSGPRGTGKTSAAKILAKAVNCEHGPAEEPCNACEACRRITSGAVMDVQEIDAASNRGVEEIRDLREKVKYAPTEVRRKVYIIDEVHMLTTEAFNALLKTLEEPPAHVMFILATTEPHRLPATIISRCQRFDFRRVSLEEQTGRLEQICGEEGITAEHEALQYIARLSDGGMRDALSILDQIASFTGGTVSYRQVMDMTGGIASEQFGRLAGAVKQGDAGLVLQIVEQFMQEGKSADKCMENLLYYFRDLLMIKMVPDADKLTDRVLNPAEFQEMANAFSRDELFQMIDTLNRYQSEMKYASQPQTLFEVALLKLSGITQSGGGSAAAHSTADAGELAQLKQHVAALEKKLERLIQNGVPASNQREPAKSTRTPAPKAASTAKIPQHMDQYVSSRTGEDYTAVHRQWAQILQNVKEEKVTVHAWLMDGEPVSVWEDKVLVAFKNNIHRETTEKPANKQVIEGVLESMLGKPYHLVTMMLRDWNDAVEGVGKPQAEELKLEHEEADAGGEKPWIDEAIQLFGEDLVVIKD
>NC_013406.1|WP_006207505.1|153099_153297_+|50S-ribosomal-protein-L31
MKQDIQPKYHVTTVTCACGNTFETGSVKPDLRVEICSNCHPFFTGKQKFLDAGGRVDRFKKKYGI
>NC_013406.1|WP_012818387.1|151649_152927_+|radical-SAM-protein
MYLVYADEQGNVYDHSELFGLARSGDMIVEILEDELIPLPEGATLVGLPSTRAIGMDPETGDMMPLEDGYTAVGALLPQGYTRLCLPGYVKSDKEYKLPLFGYSAVVWKDGAFYTTARLSDDPEKWNPVNCDLDDLEHGVKTLKEKYPENRLYEHLSNCALGYECLTASNTFLNRWEGAVPVSYSCNAGCFGCISEQPDDSGFVSPQTRMNFRPRVDELVQVMLEHLKTPESIISFGQGCEGEPSTQAKIIIEAMREVRAQTDMGYININTNAGLTDFIRGIVDAGLDLMRVSTISALDAHYNAYYKPRGYTLANVEKSLRYATDQGVYTSINYLIFPGVTDREEELEAMIEFARRTGLKLIQLRNLNIDPESYLGLIPPAQGEILGMKQAIEIMQEELPDVVIGSYTHVPPAGQARPKKRPSII
>NC_013406.1|WP_012818386.1|150288_151617_+|transcription-termination-factor-Rho
MDLQIADLEGMKLTDLYKLAKKYQIPYYGQLKKKELIFAILRAQAEQSGLMFMEGVLEILPEGYGFLRPINYLPSTEDIYISASQIRKFDLRTGDLVSGKCRTPKENERYFGLLQVNAVNGENPAVAAERLHFPALTPLYPQEKLVLETSPNQLSTRIMDLLAPVGLGQRGLIVAPPKAGKTLLLKEIANSISTNNPEIELFVLLIDERPEEVTDMQRSVKGEVVASTFDELPENHIKVAELVLSRALRLVEHKKDVVILLDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFGSARNVEEGGSLTILATALVETGSRMDDIIYEEFKGTGNMELHLDRRFAERRIFPAIDIRRSGTRREEVLLNKDELDTIWAIRKNMNDSADFVEGFLKKMRDSKNNAEFLASFDVNANNGGGTGTQGQTARRPSRASAATAPQS
>NC_013406.1|WP_012818385.1|148874_150134_+|UDP-N-acetylglucosamine-1-carboxyvinyltransferase
MEKLMISGGRPLRGAVTISGAKNSAIALIPAAILAESEVVLDNLPLLSDVAVYAEILEELGGQVSWEGNQMRIDPSDIKSIPMPNGPVKKLRASYYMMGAMLGRFKEAVIGLPGGCNFEPRPIDQHIKGFEALGATVTNEHGSIHLHAKELRGAKIYLDVSSVGATINIMLAAAKAKGSTIIENAAKEPEIIDVATLLNSMGAVIKGAGTETIRIEGVTEMHGCRHSIIPDRIQAGTYMIAAAATRGDVLIDNVIPKHLEALTAKLIEMGVGIEELDESIRVIGKDRYQHVDVKALIYPGFATDLQSPMTSLLTQAEGVSVLSDFVYSNRFKHVPELVRMGAKIRVEGRSAIIEGGPLNAAKVKATDLRAGAALVIAGLTVPEGITEVSGVEFIDRGYDHLVSNLRELGADVWRETEEE
>NC_013406.1|WP_012818384.1|147698_148553_+|class-II-fructose-1,6-bisphosphate-aldolase
MPLVSMTDMLNKALEGKYAVGQYNINNLEWTYAILEAAEQEKSPVILGVSEGAARYMGGFSTVVHMVKGLMEDLKVTVPVAIHLDHGSSVEKCKEAIDAGFTSVMIDDSHSPIETNIATTKQVVEYAHAKGVSVEAEVGMVGGQEDDVIGDVMYAKLDDCVRIVNETGIDTLAPALGSVHGPYKGEPNLGFKEMEEIRDAVKLPLVLHGGTGIPTHDIKKAISLGTSKINVNTENQISFTKVVREVLAAKPEAYDPRTFLKPGREAIKETVVGKIREFGSNNQA
>NC_013406.1|WP_012818390.1|164258_165473_+|helix-turn-helix-domain-containing-protein
MVEMEHIVQKLEQTLGTSLGLKTLNEQESLWLTESMAITSRYGDRLGREESAASSNRHGEKVSSNTTRMVDGAYVHKELGEIWFPVNQQDLSRVLVADSNALTESEIGLVALLLANLQEAPSGAMSKNAAKVEEERRAQQLGGWLKERLQAGELLAELPDEMLIRTSLTEEMVPFLLIHESEHAPTPSYKALLRLLRSYFDGDIVLVPLLDKEWIILANQELLGGITTDDKEEASSEADQDLLSLFCMGLYELISTEWVGDFHISAIPAVNALHALPQTVGMLRETMTIGRTFQVKEHIHLSTGLHLERLVYSIPEYQRNQFLREYAAGHTDLFEDSETLSTLESFFELDCNVSETAKHLYIHRNTLLYRLDKIKQETGLDVRSFSDAVLVKITLLLYKVTKRK
>NC_013406.1|WP_012818391.1|165581_166706_+|sn-glycerol-3-phosphate-ABC-transporter-ATP-binding-protein-UgpC
MAGVRLEHIYKKYAGADKATVIDVNLDIKDKEFLVLVGPSGCGKSTTLRMIAGLEEISEGKLYIGDRVVNDVAPKDRDIAMVFQSYALYPHMNVYQNMAFGLKLRKVKKDEIDKRVREAAKILDIEHLLERKPKALSGGQRQRVALGRAIVRDPQVFLMDEPLSNLDAKLRGQMRAEITKLVKRLETTCIYVTHDQTEAMTMGDRIVVMQDGIIQQADSPEQLYNNPNNLFVAGFIGSPTMNFINGKLSEQNGGVYFTSQGLNVQVPGGKAQLLKNKSMIGKEVIMGVRPEDIHEEPVFLEASPNTIFTAKVDVTENLGHEMLLYLSGLGTDTVIGRVDGRSTTREGDNVKLALDMNKVHIFDKESELNVLLED
>NC_013406.1|WP_009595669.1|167235_168174_+|HPr-kinase/phosphorylase
MAKKVKVSELVQQFQLEVIAGEEGLKRQITTDDLNRPGLEMAGYFEYHPRERVQLMGRTELAFFGMLKPEERKERMRSLCTEETPCIVVTRSLEVPEELVELGNERGLPVLRSSMATTILTSRFTSFLERRLAPTTTIHGVLCDVYGVGMLITGSSGIGKSETALELVKRGHRLIADDAVEIRQTSDFQLHGTAPELIRHLLEIRGVGIINVMTLFGAGAVRNNKRITLVVRLEAWQQDKQYDRLGLDEETTRIIETDIPLVTIPVRPGRNLAVIIEVAAMNYRLKQMGLNAALQFTNKLTATIAEDMDDLD
>NC_013406.1|WP_012818392.1|168195_169335_+|prolipoprotein-diacylglyceryl-transferase
MQTLLIDPVAFSIGSLRVHWYGLILGLGALAGLLLAIREGKRFGIPQEFFMDLLLLGVPSAIIGARIYYVAFKWEDYKDNFLDVFKIWNGGIAIFGALIGAIICALIYVRRKGYNFWRIADICAPSLLAGQIIGRWGNFVNQEAYGGPVSESFLRGELHLPDFIVNQMNVQGVFHHPTFLYESLWNLLGIVILLIIRRQKFLRAGELFIGYFIWYSIGRFFIEAVRTDSLAFQGATGLADFINNTLWAPMTWMGFELGHLDPAYGNIRISQLLSVLIVIGGIVLIIVRRVTGRANVRYLDPIVSTKTGAGPTPEADLQTNKTVKSSAPAPAKQHKQAAGPEEMADKDVVTQAEETEVKSSPRAEEDTPTIKPDTEDKKE
>NC_013406.1|WP_012818393.1|169342_169993_+|pyrophosphatase-PpaX
MIETVLFDLDGTIIDTNELIISSFMHVFEAQAPGPLTREQIIPHMGTTLEQQLQAFSGGVEDVSPLIKAYRSFNTIHHDDMVRPFPHVNEVVERLHRHGLSLGIVTTKIRPSTMMTLEKYDLERFMSAIVTVNDVEHPKPHPEPVLTAIEQLGANPATTLMIGDSPVDIQSAKAAGVKAAAVAWSLKGEQKLMEYGPDFILKDMRDLYEIVGLQEE
>NC_013406.1|WP_012818394.1|170006_170513_+|acyltransferase
MARKITRYPVEGPNALWQIYRTVSPFKGVKNFIFIQIARYCPILPMKNWIYRHMLGMKVGKHTAFGLMVMVDVFFPEKITIGENSVIGYNTTILAHEYLIKEYRLGEVRIGENVLIGANTTILPGVTIGDGAVVAAGSVVHKDVAPGVFVGGNPLRELKRASTESESI
>NC_013406.1|WP_012818395.1|170693_171920_+|acyltransferase
MGATLNKKERLPQLDIYRALAILGVLHVHATSFATVDAIDSRFYYIINFLNIFFKYGTPSFIFLSSFVLFYNYADRPLTKDLIKNFYKRRLLYILLPYVLFSIIYFFVRMYQNGMLNSSFDLWAQMPLFFERLARGQNYTHLYFVFISLQFYILFPIFLKLFKSSRFLVRWAVPIGFLLQWGFIIWNKYELQYTFKGSLAISYLAYYMLGAYLAMNYDKFKGWLTSSWKKQTSGQRAGTIVLWAGWLAMALTHVQIWYNQRLHGAKYDSLLYELLWNLHTVFSAIVLMQLASWLYSSGWKLIVKVLTRIGELSFAIYLVHPLWLFLYREFDPKLNPVTDDYLIWIYGGMVTALIVSALVVQTVFRWIPGSWMLLGSVPRSLKPSSKAPATPSQRKDTVTGDSKKSVDL
>NC_013406.1|WP_012818396.1|172269_173463_+|ATP-phosphoribosyltransferase-regulatory-subunit
MSKPKGFEKPAGVRDYLPHAVTKLRRIEREVLACMDRWGYRQIMTPTMEYYDTVGVASSTSDQKLFKLLNKRGTTMVLRSDLTAPIARVMSSLLKDEPLPVRLSYHANVFRAIEEEAGREAEFFQTGVELVGDDTPEADAEVIALAIESLKAAGVEKFKIAMGHMGYLNGLLQEVLPDRTEDQESLKQDLLNRDYVGYRNTIASLSLTEVQQDQLEGILKLRGGREIAGQALEISSNELARASIEHLSKVWEVLEAYDVSRHVLFDLTMLGDFSYYTGMTFEGYAAELGSPVASGGRYDKLLRQFGRAVPATGFALKTNRILDGVQGEEIVEELPILIRYTASHRKEGLAKASELRAQGHSVITSIIPDSANARDAEAPVASGSLLNRGYREVITLR
>NC_013406.1|WP_012818397.1|173516_174158_+|ATP-phosphoribosyltransferase
MAETLKVAMPKGRIYKKASALFRSAGLPIPLDVDETRKLVIPLPEAGMEFILAKPVDVPTYVEYGVADIGIVGKDVLMEENKDVYELLDLGIARCRMSVIGLPDWKPGIRQRVATKYPNVASQYFREQGQQVEVVKLNGSIELAPLIGLADRIVDMVETGQTLKENGLVEMTSIFEITSRLIANRVSYRMKNDEIQALCDRLQTVIMSEGANI
>NC_013406.1|WP_012818398.1|174272_175556_+|histidinol-dehydrogenase
MKVVSARDFELKRENDYGTPEQNEVVKAIVRDIRSEGDAALLRHTEQLDRVRLTAGQLRVTDEELKAAYDHVEPSFVKAIQAAADNIRAFHVKQKRNSWMDLQPDGSILGQIIRPLKRVGVYVPGGKAAYPSSVLMNVIPAQVAGVPEIVMVTPPATGGKDGINPYILVAAAEAGVTEIYRVGGAQAIAALAYGTETISPVDKICGPGNIYVALAKREVYGAVNIDSLAGPSEIAVLADEHADASYIAADLLSQAEHDEMASAILVTPSRNLGEAVAAEVERQLELLPRRDIARASVDSYGAVIVTESLQEGIEVINSLAPEHLEIVTEEPMAIVGQIENAGAIFLGPYSSEPVGDYFAGPNHIIPTNGTARFASPVDLDDFIKKSSLIYYSKEALLRDGEQIMELARREGLEGHARAIEIRLEQER

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_013406_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_013406_2

3001898-3001989

Orphan

Consensus_repeat	Method
AAGCATAGGCTCCACTTTGTGGGGCT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_013406_2

>merge|NC_013406|2|3001898-3001989|CRISPRCasFinder
AAGCATAGGCTCCACTTTGTGGGGCTTTGTTCTGGGGTCCCCGCAAAGTATTTGGAATAACCATCTAAGCATAGGCTCCACTTTGTGGGGCT

>NC_013406|2|2|3001898-3001989|CRISPRCasFinder
AAGCATAGGCTCCACTTTGTGGGGCT	TTGTTCTGGGGTCCCCGCAAAGTATTTGGAATAACCATCT
AAGCATAGGCTCCACTTTGTGGGGCT

Protein	Signature genes	Signature genes Name	Protein_function
NC_013406.1\|WP_041622150.1\|3000183_3001770_+\|response-regulator	unknown	unknown	gnl\|CDD\|227095
NC_013406.1\|WP_015734900.1\|2989448_2990621_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|226925
NC_013406.1\|WP_009593556.1\|2995111_2996233_+\|glycoside-hydrolase-family-88-protein	unknown	unknown	gnl\|CDD\|369381
NC_013406.1\|WP_015734914.1\|3011355_3012831_+\|spore-germination-protein	unknown	unknown	gnl\|CDD\|377020
NC_013406.1\|WP_015734917.1\|3014344_3015439_+\|endospore-germination-permease	unknown	unknown	gnl\|CDD\|281794
NC_013406.1\|WP_015734912.1\|3007949_3009209_+\|alpha-L-fucosidase	unknown	unknown	gnl\|CDD\|226195
NC_013406.1\|WP_015734909.1\|3003028_3003871_+\|carbohydrate-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223472
NC_013406.1\|WP_009593544.1\|2988599_2989139_-\|NAD(P)H-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|377026
NC_013406.1\|WP_015734902.1\|2991746_2991893_+\|hypothetical-protein	unknown	unknown	unknown
NC_013406.1\|WP_015734908.1\|3002095_3003016_+\|sugar-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224096
NC_013406.1\|WP_015734905.1\|2996222_2998391_+\|alginate-lyase-family-protein	unknown	unknown	gnl\|CDD\|379893
NC_013406.1\|WP_015734903.1\|2992343_2994254_+\|threonine--tRNA-ligase	unknown	unknown	gnl\|CDD\|183530
NC_013406.1\|WP_015734916.1\|3014101_3014323_+\|hypothetical-protein	unknown	unknown	unknown
NC_013406.1\|WP_015734910.1\|3004020_3005403_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270303
NC_013406.1\|WP_015734906.1\|2998459_3000184_+\|histidine-kinase	unknown	unknown	gnl\|CDD\|225519
NC_013406.1\|WP_015734901.1\|2990745_2991438_-\|DUF421-domain-containing-protein	unknown	unknown	gnl\|CDD\|225205
NC_013406.1\|WP_144374229.1\|3012893_3014105_+\|Ger(x)C-family-spore-germination-protein	unknown	unknown	gnl\|CDD\|274338
NC_013406.1\|WP_015734911.1\|3005525_3007877_+\|glycoside-hydrolase-family-95-protein	unknown	unknown	gnl\|CDD\|379625
NC_013406.1\|WP_083775430.1\|2994368_2994896_+\|ClbS/DfsB-family-four-helix-bundle-protein	unknown	unknown	gnl\|CDD\|377957
NC_013406.1\|WP_015734913.1\|3009244_3011104_+\|beta-galactosidase	unknown	unknown	gnl\|CDD\|366567

Protein	Function_ID	Function_description	E-value
NC_013406.1\|WP_041622150.1\|3000183_3001770_+\|response-regulator	gnl\|CDD\|227095	COG4753, COG4753, Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain [Signal transduction mechanisms].	1.24171e-48
NC_013406.1\|WP_015734900.1\|2989448_2990621_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|226925	COG4552, Eis, Predicted acetyltransferase involved in intracellular survival and related acetyltransferases [General function prediction only].	2.84537e-79
NC_013406.1\|WP_009593556.1\|2995111_2996233_+\|glycoside-hydrolase-family-88-protein	gnl\|CDD\|369381	pfam07470, Glyco_hydro_88, Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.	2.52804e-34
NC_013406.1\|WP_015734914.1\|3011355_3012831_+\|spore-germination-protein	gnl\|CDD\|377020	pfam03323, GerA, Bacillus/Clostridium GerA spore germination protein.	0
NC_013406.1\|WP_015734917.1\|3014344_3015439_+\|endospore-germination-permease	gnl\|CDD\|281794	pfam03845, Spore_permease, Spore germination protein.	2.99683e-45
NC_013406.1\|WP_015734909.1\|3003028_3003871_+\|carbohydrate-ABC-transporter-permease	gnl\|CDD\|223472	COG0395, UgpE, ABC-type sugar transport system, permease component [Carbohydrate transport and metabolism].	1.73073e-76
NC_013406.1\|WP_009593544.1\|2988599_2989139_-\|NAD(P)H-dependent-oxidoreductase	gnl\|CDD\|377026	pfam03358, FMN_red, NADPH-dependent FMN reductase.	2.86471e-33
NC_013406.1\|WP_015734912.1\|3007949_3009209_+\|alpha-L-fucosidase	gnl\|CDD\|226195	COG3669, COG3669, Alpha-L-fucosidase [Carbohydrate transport and metabolism].	2.21575e-76
NC_013406.1\|WP_015734908.1\|3002095_3003016_+\|sugar-ABC-transporter-permease	gnl\|CDD\|224096	COG1175, UgpA, ABC-type sugar transport systems, permease components [Carbohydrate transport and metabolism].	2.59722e-86
NC_013406.1\|WP_015734905.1\|2996222_2998391_+\|alginate-lyase-family-protein	gnl\|CDD\|379893	pfam16889, Hepar_II_III_N, Heparinase II/III N-terminus. This is the N-terminal domain of heparinase II/III proteins. It is a toroid-like domain.	1.64333e-53
NC_013406.1\|WP_015734903.1\|2992343_2994254_+\|threonine--tRNA-ligase	gnl\|CDD\|183530	PRK12444, PRK12444, threonyl-tRNA synthetase; Reviewed.	0
NC_013406.1\|WP_015734910.1\|3004020_3005403_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|270303	cd13585, PBP2_TMBP_like, The periplasmic-binding component of ABC transport systems specific for trehalose/maltose and similar oligosaccharides; possess type 2 periplasmic binding fold. This family includes the periplasmic trehalose/maltose-binding component of an ABC transport system and related proteins from archaea and bacteria. Members of this group belong to the type 2 periplasmic-binding fold superfamily. PBP2 is comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. The majority of PBP2 proteins function in the uptake of small soluble substrates in eubacteria and archaea. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	7.52815e-39
NC_013406.1\|WP_015734906.1\|2998459_3000184_+\|histidine-kinase	gnl\|CDD\|225519	COG2972, COG2972, Predicted signal transduction protein with a C-terminal ATPase domain [Signal transduction mechanisms].	1.97625e-39
NC_013406.1\|WP_015734901.1\|2990745_2991438_-\|DUF421-domain-containing-protein	gnl\|CDD\|225205	COG2323, COG2323, Predicted membrane protein [Function unknown].	2.24179e-48
NC_013406.1\|WP_144374229.1\|3012893_3014105_+\|Ger(x)C-family-spore-germination-protein	gnl\|CDD\|274338	TIGR02887, Spore_germination_protein_B3, germination protein, Ger(x)C family. Members of this protein family are restricted to endospore-forming members of the Firmicutes lineage of bacteria, including the genera Bacillus, Clostridium, Thermoanaerobacter, Carboxydothermus, etc. Members are nearly all predicted lipoproteins and belong to probable transport operons, some of which have been characterized as crucial to germination in response to alanine. Members typically have been gene symbols gerKC, gerAC, gerYC, etc. [Transport and binding proteins, Amino acids, peptides and amines, Cellular processes, Sporulation and germination].	1.12221e-86
NC_013406.1\|WP_015734911.1\|3005525_3007877_+\|glycoside-hydrolase-family-95-protein	gnl\|CDD\|379625	pfam14498, Glyco_hyd_65N_2, Glycosyl hydrolase family 65, N-terminal domain. This domain represents a domain found to the N-terminus of the glycosyl hydrolase 65 family catalytic domain.	3.39543e-77
NC_013406.1\|WP_083775430.1\|2994368_2994896_+\|ClbS/DfsB-family-four-helix-bundle-protein	gnl\|CDD\|377957	pfam08020, DUF1706, Protein of unknown function (DUF1706). This family contains many hypothetical proteins from bacteria and yeast.	2.02045e-74
NC_013406.1\|WP_015734913.1\|3009244_3011104_+\|beta-galactosidase	gnl\|CDD\|366567	pfam01301, Glyco_hydro_35, Glycosyl hydrolases family 35.	5.91085e-150

>NC_013406.1|WP_041622150.1|3000183_3001770_+|response-regulator
MYRVMLIDDDVPMLKVLQQMIDWEANNLQIAGSTYSSAKALHMFEEVRPDIVITDIGLPQKNGMELAEHFIRMKPEVRIIFLTCHEDFHYAQQAVKLQADDYLIKDQLTAEQLEQSLGKSMHLLKTRTGLIHREAASYNSQLFRQDLLQRVINGSPSESTLAYAGQIGISWTYPWFMLGLVTIRLSSFDQRFRKTELPLILYAVYNIAMELSESFEGITPFMEQGNIVILHNFRVNLARNASLHLHNYLQQLRYQCVHFLKIQPNVIAVSDKMELSSIGSIYQEILHGRCEFYENTDYTITEVSQIRSRWFQSAPQGFLDGYVSELERKLIKQDLEGIRCTLQKIAGTAKELSIDPGDFARDLSSMLRGIELMMSSLKFDEDLFAYLALSRTLDDMMELVERKLTQMTGTRQAGAGNHAHEPKLQVIQQYIDQHLDDNITSIDMARYLFLNPSYFSRYFKRMTGLTFTDYVHQYKMKMATKMLRMSGQNLESLAMGLGYSDRTYFSKVFKKYVGTTPSEYKAKYTARK
>NC_013406.1|WP_015734906.1|2998459_3000184_+|histidine-kinase
MFKFTFYKRIQLSFLLLIFIPLIAVSIISFVLIRNTMEEKLQLSNENVLNVMTDELSKTIDDVTFASHFIVNDTNVRNILKSFADTKRLATYQDYVHFRQIQDVFSLINSKPLNNNVRMYLVNRQHFVISSGTEDLTAINGSLDKLMERVDLSKPETLQWLGMAGGDSAGSGKSYYIARVIYDSREKRQVSVLLSAISDTYFNKLLGTIDFGKVALFDTNGEFIAGHSGLIPHHTETKGSVRTDRTILKSNWKLAYEASEKEWSGQISRTFYTGLAGVLLLFLVFSGMSILMAKRLHSPIHKLQRVVRQFGMGNLDVRLEVKGKDDIAELGQTLNTMLDQLQRLIHDIEQEQEQKRVMELEALFMQIRPHFLINTLNSIKCSLILTKDTLHSGIIDSLMSLLRAYLKVNEPATLREECKLLGHYVDIMKIRNEIPLHLEVDLEPETEGLILPKLILQPIVENAIVHGLVDHQTPRIEIRSRSSLDGIRIEITNNGTGADEEQLQCLNRRLRKPSEEQDGAYERVGLMNVVQRLRLTFGPEASLTLANLPHGGMSVTLCLPLSHHHGFLPEGEEE
>NC_013406.1|WP_015734905.1|2996222_2998391_+|alginate-lyase-family-protein
MNADAMEASANAVLKILNLKDPAMGSMQDADDQGHRHDLLCKLHQYFTCRRTPGWWMSGEDKQYTTDYVKQYCADELETVMKTAEEVVQQTFLFRFPWDMERSQIPVIFEGSVNWCHIPDQDAEWAYMLNRHRYWVALGQAYAMTGDEKYAEAFCRQLEDWIDRNPIPEEPTTDTLTWRPIEAGLRSANWIKALRYMIGSPSLTPLLLGKALISLHEHGDYLAASFTSWKHISNWGVLETCGLYHIALYFPEFKSSARWRELGEERLKETARLQIMVDGIHWEQSPTYHHEVLACYLDCVHLANLNGLELDGLFRHKVREMAEASLYWAKPNHRQPMLGDSDDSDIRSILTYAAWLFEDPVLRFGGYALPDYDHAWLFGVSGIRDYEAMVPAEPPSLSRAFPHSGHYTMRTGWGEDALYLYFHCGPLGGGHGHADMLHMDLHAFGRDLLTDLGRYNYSDHTPLRKALKESSAHNTTVVDGIGFTGVKDTWSFDRIAGPLGCRWISKPEFDYVEGAHDGYLYGSDPLYPRRRIIFIKPYFWLLIDSLACLEQHTFTQHFHFPHPPGEVRMEGESLICRTTTRGEANLFIIPVTADGLRGEVGEGVISREYNLLEPNANVAYSRTGKGCISIMQVLYPHRPGETALPRVRKVPVYRHTGERVHEGQAEACGIQLPGMEEEFILVVSHRAPSGHYDSYVVEGMQIFGEVVLMTLQGRKKQATVII
>NC_013406.1|WP_009593556.1|2995111_2996233_+|glycoside-hydrolase-family-88-protein
MWSNAIQDAVEKIRKNMDAFGARFPHVSRDGAYLLNDNDDWTNGFWSGLLWLCYEYTGDEAFRLGAKRTVEDFRRRFAEKKVLDHHDIGFLYSLSSKAEWIVEKDESARQLTLQAADLLLKRWRPSGGYIQAWGPEGDEQEGGRIIIDCLMNLPLLFWAGQQTGKSQYREIAIMQAEKTRRYLVRGDDSSYHTFFFDPHTGEPIGGATHQGYTNGSTWTRGQAWGVYGFALAYRYTGDHAYLDTSKRMAKYFLKHLPEDHVALWDFNAPVTAETYRDSSASAIVAAGLLELVGHLEEGDPDRAEFEQGLKDSMTSLVRHYSTIGQEAEGLLQHGSYHVRGGLSPDDFMIWGDYFYLEALIRLETGSKGYWYER
>NC_013406.1|WP_083775430.1|2994368_2994896_+|ClbS/DfsB-family-four-helix-bundle-protein
MKERVSLQTYPSKEAFIAEIRRTYMLFDQEFDAVPEDKKNHRIGEVDRTPQEMIAYQLGWLSLVMSWERDERAGIEVTTPAPDYKWNQLGALYQRFYQAYDGYSLVELRFMLKQRTDEWCEWINRLTEEELFRPGVRKWTVTSANWPMWKWLHINSVAPFKSFRTKIRKWKKFVA
>NC_013406.1|WP_015734903.1|2992343_2994254_+|threonine--tRNA-ligase
MSIVVTLQDGSKKEYPAQTTMFQIAESIHSGLKKNAVAAKADGKLVDLNQELREDAEVSIITLDSEDGLYVYRHSTAHLMAQAVKRLYGSESVHLGVGPVIEDGFYYDMDLGHSITADDLITIEREMQKIVQEDLPILRKEVGRKEAERIFQDDPYKMELIRELPEDEVISVYEQGEFVDLCRGPHLPSTGRIKAFKLMSVAGAYWRGDSDNKMLQRIYGTAFPKKSQLDEHLLLLEEAKKRDHRKLGKELGLFMFSEEAPGMPFFLPNGMIIRNELEQFARGLQFHRDYDEVRTPLMMNKRLWEMSGHWDHYKDNMYFTQVDETEYALKPMNCPGHMLVYKNSLHSYRELPIRISEFGQVHRHEFSGALNGMMRVRTFCQDDAHIFVRPDQIQEEIKQVIDFISRVYQVFGFEYTIELSTRPEDSMGSEELWEQAETSLQQVLDQLGLPYRINEGDGAFYGPKIDFHILDSLKRSWQCGTIQLDFQFPEKFDLSYIGEDNQKHRPVVIHRAVFGSIERFIGILTEHYGGAFPMWLAPVQVMIIPVSDHYIDYSLKVKKRLENAGIRVNVDVRNEKLGYKIREAGLLKTPYTLVLGEKEMDSDHVSVRKRGEGELGEIAIDQVIERLRNEIESKEY
>NC_013406.1|WP_015734902.1|2991746_2991893_+|hypothetical-protein
MKKGDIIIYACVIIGAGIGLTLHHAFPGVLVGLGIGYLVKMTLKDEES
>NC_013406.1|WP_015734901.1|2990745_2991438_-|DUF421-domain-containing-protein
MDMFIDLGVKLIISFFGLWIITFVTGRKTISQLTPLDFLSSLILSEIVGASLYDDKVKLSHLLFALALWTIMSFLFEKATTHFVKFGYLTEGRAVLLIDNGKLNQKLLDKYDMEYKQLLSMLRRQNIFSLTEVKYAILETDGSLSVMRKPEYEPPTAQDLGIEAKPDPFTVTVVDKGRLLEESMLGKHIEHNEIQSKAREQGFESLEDIAYAEYGDDGKLYVFSKKEVQD
>NC_013406.1|WP_015734900.1|2989448_2990621_+|GNAT-family-N-acetyltransferase
MELRQLRTDEFDISTKLSEYAFQYTLTPEQRESNQKHFKPERFWGIFDGEELQAKLTIIPLQVYLQGNTFAMGGIAGVATWPENRRQGHVSTLLKHALQEMKGKGQTLSFLHPFSIPFYRKFGWELFAEYHKYVIPVSKFPRKVEVPGRVVRDVNDIAVLDGMYQAYVSRYNGTLVREEAWWTRFVLQGDNHSVVYYSAEGKPTGYALYELKDKELVCDEFVFLNEEARSGLWTFFANHDSRIEQVTMTMVPTDDQLPYMLPDPRVTRETVPYFMARIVDLQSFVEQYAFEATQEAVLTIEVEDSAAPWNAGLWRLSMNGEGKAELSELPSDRGEQADLSTDIQTLSALFTGYKRPQALYSIHRLTGDAKAAALLETMIPAGQTYLMDFF
>NC_013406.1|WP_009593544.1|2988599_2989139_-|NAD(P)H-dependent-oxidoreductase
MSKLNIGIILGSTRQGRLSPQVGEWVKRIADERGDANYEIVDIADYKLPLLGEADATEQATAWNTKLASLDGFVFIVQEYNHSISGSLKNALDYAREAWNNKAAGIVSYGSVGGARAAEHLRGILGELSVADVRVHPALSLFTDFENGSVFKPADLHLVNLNGMLDQVLAWSGALKTLR
>NC_013406.1|WP_015734908.1|3002095_3003016_+|sugar-ABC-transporter-permease
MEAVQQPVPKSRRKFWTPKRKEALIGWLFLAPEIVGMLLLNVFALGFSLYLSLSDWDMLSGVQGIEFTGLDNYIKMFHDPTIIQAIKNNLIYMVLTVPIPIAIALVLSVLIHNSVFFKSYFKVAFFIPYISSIIAVAAVWSALFHPSLGPINQFLMELGISSPPKWLVDPKTSLLAISIISSWAGLGYTIIIYMAGLTNISNEIYEAADIDGAGAMKKFFAITVPMLRPTTFFLLITMLIGSFKVFDIIAFLTEGGPNNSSTVLVFRIYEEGFKYYNMGYASAISWLLFAIIGLITALTWKMRNEE
>NC_013406.1|WP_015734909.1|3003028_3003871_+|carbohydrate-ABC-transporter-permease
MYMQLLRKNMSKVVTTVIMGALSIVFLVPLIWMISAAFKYEKDVMRFPIQWIPEKVNLAYNFKMVWMGRVPFYDFYFNSFKIAIITTLITLIISSMAAYALTKIRFKGRNLVFMALLSFMIIPDQATLIPRFLLIRWFGLYNTHAAIIFMSMFSIYFTFLLRQFMIGISDEYLEAARIDGAGHLRTFASIMVPLCKPVLATVAIIKFIWTWNDYQNPLIFLLDKDLYTIPLGMTLFRDDYTNNYAIMMMAAVSAIIPLVIVFIALQKQVINGIALGGVKG
>NC_013406.1|WP_015734910.1|3004020_3005403_+|ABC-transporter-substrate-binding-protein
MKKKSKHRLSVILSTILASTLVLSGCGNSGSETGAGSNGGSGQTDKQVTVKYYNWDNEAQQAGTDAMLQEFMDQNPNIKVEHVVLVPGGSVEMLKKLDFLISSGEAIDVIQFPSLGGVLERATRGALAPLNEFYEQESLVPEDEYFVNAKVDDKYYGMQYTKSMNYVMLNKDALDEAGLEVPKFGWTWDDYREYSKKLTKGEGVDKRYGSYFHTWELYMNAPAQTMMKDPFVYEDGTTILSDPTYKYFFQLRKDMEETDKSAKPYSDVLAAKLNYRTEFFNEEAAMILTGNFTIADPGNTEQYPHDFKTAFAPVPVPPAGWEPKEYEGKYFTSGSMLAMGANSANKEASFKLMRFMTTADSDNRLEFSGYKKANNEELLTKLVAGKEDKYDMDSLKYTLFSDEIQYLDAAKVMMTATSELTKIIDDGFAKFMLSNEPIDEVQQWMVDEATKIINEKGVVK
>NC_013406.1|WP_015734911.1|3005525_3007877_+|glycoside-hydrolase-family-95-protein
MINETRKLVERRPAQVWTEAFPVGNGRLGAMVFGGVSTERIGLNEDSVWYGGPKQHDNPEAIEKLDDIRSLLRCGELREAEQLALTHFTNAPPYFGPYQPLGDLLLQFKSGTSEVNHYRRELNLRTGVASVSWEENGILYEREVFASAVHQVLVIRISSSEPAAIHLSARLSRRPFDGNIKRENERTLAMEGICGPDGVTYATVLQAHTIGGKCHTVGNYLDIQSADAVTLLLAAQTSFRCDDPYREALRQAESAVLLPYASLLEEHITDHCALLERVSLEIEAADTSIAPVSEESASEAEAVAVDRPTSERLQLYRQGGNDPGLEALFYQYGRYLMMASSRPGSLPANLQGIWNESFTPPWESDYHLNINLQMNYWIAETGNLPECHEPLFDFIDRLVINGRKTAASLYGARGFTAHASSNLWAESGLFGAWTPAIFWPMGGAWLALHLWEHYRYNLSESFLSERAYPVLKEASLFFLDFLVFDENGSLVTSPSLSPENSYINEKGQIGSLSSGPSMDSQMIYALLTACIEAAEILGLDKEWSRQWMDTRAKLPQPQIGRYGQVMEWAVDYEEFEPGHRHISHLFALHPGEQIIPHRMPELGKASRVTLERRLKYGGGHTGWSQAWIANFWTRLGEGEKAHDSLRELLAKAVHPNLFGDHPPFQIDANFGGAAAIQEMLLQSHGGEIRLLPALPSSWASGSVKGLRARGGYTVNIWWKEGKLEAAEIYSGHFRDCVLFSGYPLVILDSTNVPVPITCLRSASGYQYTFAAEKEETYQIVLRR
>NC_013406.1|WP_015734912.1|3007949_3009209_+|alpha-L-fucosidase
MNHDLKQHADNLVALPTPEQLAWQDLELGMFCHFGINTFCNQEWGEGKDAPSLFNPDRLDAKQWVRSAKEAGFRYFILTAKHHDGFCLWPTATTDYSVASSPWREGRGDVVKECADACREEGIGFGIYVSPWDRHEPSYADPQQYDDFYCRQLEELLSGYGPLVEIWFDGAGSEGREYDWPRIMELVKRYQPRAMIFNMGAPTIRWVGNEDGVAPYPCWNTADSSRGSMFSEESLKWLPETPGWVPAECDVPIRKDRWFWHPDEEHLLLSVDQLMDIYYRSVGHGATLLLNVAPDHHGLLPEADVRRLLEFGREIKSRFSHALAESSGSGKVVELSLPSACVIDHVVVMEDIAYGERVSQYVLDAFVDGEWLELTRGSAIGHKKIDAFAPVSAVKVRLRVLKSAASPRIKNMAVYHCGQ
>NC_013406.1|WP_015734913.1|3009244_3011104_+|beta-galactosidase
MGMLTWENGQYLLDGQPYRIISGAIHYFRVVPEYWEDRLLKLKACGFNTVETYIAWNVHEPQEGEFNFSGMADVASFIELAGKLGLHVIVRPSPFICAEWEFGGLPGWLLGYGEIRLRCSDPLYLSKVDHYYDELIPQLVPLLSTHGGPILAVQVENEYGSYGNDHAYLEYLREGLVRRGVDVLLFTSDGPTDEMLLGGTLSDVHATVNFGSRVEESFRKYREYRAEEPLMVMEFWNGWFDHWMEDHHVRDAADVAGVLDEMLEMGSSMNMYMFHGGTNFGFYSGANHIQAYEPTTTSYDYDAPLTEWGDKTEKYEAVRRVLSKHGFAPGCAFPEPVPKAAYGKVAMSEMAGLFTETNLQQLSEPIKSVCIQPMEKCGQSYGFIMYSTFIQGPRHGQQLHIQEVRDRAQVFLDGRPLGVVERWNSKPLDITVPADGARLDILVENMGRINYGPLIRDPKGITEGVRIDNQFLYDWTIRTLPLEPEKLSSLTYTPVTQEGQARQEEPSMPERGDAGLPGFYRGCFEVEEIGDTFLRFDGWTKGVAWINGFNLGRYWKAGPQKALYIPGPLLRKGENELVLFELHGRPECCEAELSDQPDLGQTAAVDEAVLNFVQEGEDK
>NC_013406.1|WP_015734914.1|3011355_3012831_+|spore-germination-protein
MMMKNLTPGEAPQENLPASLTLFIDDMKNRFGQSGDIIYRELQLGAIPSVMVYIEGMGDPRYLIEAIHADMPLFMNLPDQRPEERMKMLQELTITMGKVGEARTFQEVEKKLLSGNTIIFMDGTATSLYVGTETLKQRGVEEASSQSVVRGPREGFTESLRENTALVRRRIQSPKLRLEERTVGEHTNTQLAVMYMEGLCDVDVLNELRRRLDGIKLDSVLESNYIEEMIQDHRYSPFPTVYNSERPDVIASAVLEGRIAVFLEGTPFVLVVPALFVQLFQSSEDYYQRWDFASLVRLLRYLCFGIALLTPSLYIAITTFHQEMLPTNLLTSLIGQREGVPFPAFIEALIMEITFEILREAGIRLPKSIGQSVSIVGTLVIGQAAVEAGLVSAAMVIVVSMTAIANFALPAFNIGISVRILRFGLMGIAASFGLYGMIIGMIIIGLHLCSLQSMGVPYMTSFAPIRWRSQKDALLRLSRHSMKKYLTKSKT
>NC_013406.1|WP_144374229.1|3012893_3014105_+|Ger(x)C-family-spore-germination-protein
MLERKILLSVLLVLCLTFTPGCWSRKELNELAVVMALGIDTHENGYAITAQVLNSAEAGSKKGGSMGSLPAVTYKSVGKTIPDALQRMLSMAPRMPYLSHVRVLVFGEDLARSGLSDVLDYISRNHQLRTDFFMLVAKNGKAAEILEVVTPFEYVPANSLYTSILISEKKWAATGKVTLQQFVTELKRSGSDPVLSGVQLSGSLAEGQSMENVKQINPSTLLQHTGLGVFKGDRLVGWLGEPPSKAVNYVLNRVDTTTGFIACPDDGIVGFAVNRADTTLDVKLNADGTPAFSAELEIEADVNAVQCAIDISQPAVIDELEKDIEDKYNANIRKHIGLVQQRYGADVFGFGEVLHRKYPDVWKKYRDHWGESFKTMSIRVDTDVAIRRVGSIIQPLNQKVDEP
>NC_013406.1|WP_015734916.1|3014101_3014323_+|hypothetical-protein
MNWHWLFIFFLAVVLVTETRHLLKLRSIRDIIVFYAVWGVTLLALIGDMMEVPYLRPLDWIGALVQPLSGLIS
>NC_013406.1|WP_015734917.1|3014344_3015439_+|endospore-germination-permease
MIKYKDIAPRQFYILAFGLTIGTSILVTPSGLAHTAREDAWMASLFSLLINLLMVVLYIAIARLYPGQSIFEIHEKVLGKLLGKLFSLIYLFYFLILTGTLLGNLGFFLSSEMMPETPIEAIQILFLIAAVMCARMGIILLARVGELMFPWIVFLFMVLVLSLMPQIDWNHIKPMLEEGWMPVAKAGFHSSMFQELIVLMVFLPLVKGEKEGERALMRGAASGGLVLSITVLLSVLILGIEQTENSTFPAYALAKTINLGNFFQRVEGILITLWILTFFIKISLLYLSILQGMKTVFGLKDQNSLIYPLSVLFVIVAWNTYINTVYVADIIQNVWSSYALLHLIVIPIVLYLVGITRTKILSLK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_013406_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_013406_3

4809095-4815937

Orphan

Consensus_repeat	Method
GCTCCNGTTGCNCCNGTT	CRT

126 spacers

The CRISPR arrays of NC_013406_3

>merge|NC_013406|3|4809095-4815937|CRT
GCACCGGTTGCTCCTGTTACCCCCGTGGCTCCCGTTGCTCCCGTTGCTCCGGTTGCTCCGGTTGCTCCTGTTGCTCCCGTGGCTCCTCTTTCTCCTGTTGCACCCGTTACACCAGTTACTCCTGTTGCTCCGGTGGCTCCTGTTACCCCGGTTGCCCCTGTTACTCCAGTTGCTCCCGTGGCTCCTCTTTCCCCAGTCACACCTGTGGCTCCGGTTGCCCCTGTTACCCCGGTTGCTCCTGTTGCTCCCGTGGCCCCCGTTGCTCCTCTTTCTCCTGTTGCTCCTGTTGCTCCGGTTGCACCAGTTACTCCTGTTGCTCCCGTTGCTCCTGTTGCCCCTGTTACTCCGGTTGCTCCTGTTACCCCCGTTGCTCCTGTTGCTCCTGTTACCCCTGTTGCTCCTGTTGCACCAGTTATTCCTGTTGCTCCTCTTTCCCCAGTTACACCTGTTGCTCCTGTTGCTCCTGTTGCTCCTGTCGCTCCTGTTACCCCAGTTGCTCCCGTTGCTCCTGTTGCTCCCGTTGCTCCTGTTACTCCTGTGGCTCCTGTGGCTCCTGTGGCTCCTGTGGCTCCTCTGTCCCCAGTTACACCTGTTGCTCCCGTGGCCCCCGTTACTCCTCTTTCTCCTGTCGATCCCGTTGCTCCCGTGGCTCCCGTAACACCTGTTGCCCCCGTTGCTCCGGTGGCTCCCGTTGCTCCAGTCTCTCCAGTCTCTCCAGTGGTACCTGTTGCTCCCGTTGCTCCTGTCACTCCCGTTGCACCCGTTGCTCCGGTTGCACCAGTTATTCCTGTTGCTCCCGTTGCTCCTCTTTCCCCAGTTACACCTGTTGCTCCCGTTACTCCTCTTTCCCCAGTTACACCTGTTGCTCCTGTTGCTCCTGTTGCTCCTGTTGCTCCTGTTACCCCTGTTGCTCCAGTTGCTCCGGTGGCTCCCGTTGCTCCAGTCTCTCCAGTGGTACCTGTTGCTCCCGTTGCTCCTGTCACTCCCGTTGCACCCGTTGCTCCGGTTGCACCAGTTATTCCTGTTGCTCCCGTTGCTCCTCTTTCCCCAGTTACACCTGTTGCTCCCGTTGCTCCTGTCGCTCCGGTTACTCCTGTTGCACCTGTTTCACCTGTAGCTCCTGTTGCCCCAGTTACTCCCGTTGCTCCCGTTGCTCCTGTTGTTCCGGTTGCTCCTGTTACCCCGGCTGCTCCTGTTGCCCCAGTTTCTCCTGTTGCCCCAGTTTCTCCTGTTGCCCCTGGTACTCCAGTCGCTCCAGTTACCCCAGTTGCTCCTGTTACCCCTGTTGCTCCGGTTGCACCCGTCGCTCCCGTTGCACCAATTTCTCCTGTGGCTCCCGTGGCTCCTGTTACCCCTGTTGCTCCTGTTGCACCAGTTTCTCCTGCTGCCCCTGTCGCTCCTGTTGCTCCCGTTTCACCTGTTACCCCGGTTGCTCCGGTGGCTCCCGTTTCACCTGTTACCCCGGTTGCTCCGGTGGCTCCCGTAGCTCCTGTTACTCCTGCCGCTCCCGTAGCTCCTGTTACTCCTGCCGCTCCAGTGGCTCCTGTCGCTCCTGCTACCCCCGTTGCTCCTGTTGCACCAGTTTCTCCGGTTTCTCCTGTTGATCCTGTTTCCCCCGTCGCTCCTGTTACCCCCATTGCTCCTGTTGCACCAGTTTCTCCGGTTGCTCCGGTAGCTCCTGTCGCTCCCGTAGCTCCTGTTGCCCCTGTTACTCCCATTACCCCTGTTGCTCCTGTTGCACCCGTTTCTCCTGTTACTCCTGTTGCTCCCGCTTCTCCTGTTGCTCCTGTCGCTCCCGTTGCACCCGTTTCACCCGTTACACCTGTCGCTCCTGTTACTCCTGTTGCTCCTGTTGCTCCTGTTACCCCCGTTGCTCCTGTTGCTCCTGTTACCCCCGTTGCTCCTGTAGCTCCCGTTACTCCTACCGCTCCAGTAGCTCCTGTTACCCCTGTTGCTCCAGTATCTCCAGTTGCCCCTGTTACCCCCGTAGCTCCTGTTGCCCCTGTTACCCCCGTAGCTCCTGTAGCTCCCGTTACTCCTGCCGCTCCAGTAGCTCCTGTTACCCCTGTTGCTCCAGTATCTCCAGTTGCCCCTGTTACCCCCGTAGCTCCTGTTGCCCCTGTTGCTCCTGTTGCACCCGTTTCACCTGTAGCTCCTGTTGCTGTTGATCCGGTTGCTCCTGTTACCCCTTACCCCTGTTGCTCCCGTTGCTGCACCCGTTGTGCCTGTAGCTCCCGTTGCACCTGTTACTCCCGTTTCTCCTGTTGTTCCCGTTGCACCTGTTACCCCAATTGCTCCTGTTGCCCCAGTTGCTCCTGTTACACCCGTTTCTCCTGTCGCTCCCGTAGCTCCTGTTACCCCAGTTGCTCCAGTCTCTCCAGTGGTACCTGTTGCTCCCGTAGCTCCTATCACTCCCGTTGCACCCGTGGCTCCTGTTGCTCCGGTTGCACCAGTTATTCCTGTTGCTCCCGTTGCTCCTGTTGCACCAGTTACTCCTGTTGCTCCCGTGGCTCCCGTTGCTCCTGTTGTTCCGGTTGCTCCTGTTACCCCGGTTGCTCCTGTTACCCCGGCTGCTCCTGTTGCCCCAGTTTCTCCTGTTGCTCCTGTTACTCCAGTCGCTCCAGTTACCCCAGTTGCTCCTGTTACCCCTGTTGCTCCGGTTGCTCCGGTTATCCCCGTTGCTCCTGTCTCTCCGGTCGCTCCTGTTACCCCGGTTGCCCCTGTTTCTCCGGTTACTCCTGTTGCTCCTGTGGCCCCCGTTGCTCCTGTTGTTCCGGTTGCTCCTGTTACCCCAATTGCTCCTGTTGCCCCAGTTGCTCCTGTTACACCCGTTTCTCCTGTCGCTCCCGTAGCTCCTGTTACCCCAGTTGCTCCAGTCTCTCCAGTGGTACCTGTTACTCCCGTAGCTCCTATCACTCCCGTTGCACCCGTGGCTCCTGTTGCTCCGGTTGCACCAGTTATTCCTGTTGCTCCCGTTGCTCCTGTTGCACCAGTTACTCCTGTTGCTCCCGTGGCTCCCGTTGCTCCTGTTGTTCCGGTTGCTCCTGTTACCCCGGTTGCTCCTGTTACCCCGGCTGCTCCTGTTGCCCCAGTTTCTCCTGTTGCCCCTGTTACTCCAGTCGCTCCAGTTACCCCAGTTGCTCCTGTTACCCCTGTTGCTCCGGTTGCTCCGGTTATCCCCGTTGCTCCTGTCTCTCCGGTCGCTCCTGTTACCCCGGTTGCCCCTGTTTCTCCGGTTACTCCTGTTGCTCCTGTGGCCCCCGTTGCTCCTGTTGTTCCGGTTGCTCCTGTTACCCCAATTGCTCCTGTTGCCCCAGTTGCTCCTGTTACACCCGTTTCTCCTGTCGCTCCCGTAGCTCCTGTTACCCCAGTTGCTCCAGTCTCTCCAGTGGTACCTGTTGCTCCCGTAGCTCCTATCACTCCCGTTGCACCCGTGGCTCCTGTTGCTCCGGTTGCACCAGTTATTCCTGTTGCTCCCGTTGCTCCTGTTGCACCAGTTACTCCTGTTGCTCCCGTTGCTCCCGTTGCTCCTGTTGCTCCTGTTACTCCGGTTGCTCCTGTTGCTCCGGTAGCTCCTGTCGCTCCCGTAGCTCCTGTTGCTCCTGTTACTCCCATTACCCCTGTTGCTCCTGTTGCACCCGTTTCTCCTGTTACTCCTGTTGCTCCCGCTTCTCCTGTTGCTCCTGTCGCTCCCGTTGCACCCGTTTCACCCGTTACACCTGTCGCTCCTGTTACTCCTGTTGCTCCTGTTGCTCCTGTTACCCCCGTTGCTCCTGTTGCTCCTGTTACCCCCGTTGCTCCTGTAGCTCCCGTTACTCCTACCGCTCCAGTAGCTCCTGTTACCCCTGTTGCTCCAGTATCTCCAGTTGCCCCTGTTACCCCCGTAGCTCCTGTTGCCCCTGTTACCCCCGTAGCTCCTGTAGCTCCCGTTACTCCTGCCGCTCCAGTAGCTCCTGTTACCCCTGTTGCTCCAGTATCTCCAGTTGCCCCTGTTACCCCCGTAGCTCCTGTTGCCCCTGTTGCTCCTGTTGCTCCCGTTTCACCTGTAGCTCCTGTTGATCCGGTTGCTCCTGTTACCCCTGTTGCTCCTGTTACCCCGGCTGCTCCTGTTGCTCCAGTTTCTCCTGTTGCTCCTGTTACTCCAGTCGCTCCAGTTACCCCAGTTGCTCCTGTTACCCCTGTTGCTCCGGTTGCTCCGGTGATGCCCGTTGCTCCTGTCTCTCCGGTCGCTCCTGTTACCCCGGTTGCCCCTGTTTCTCCGGTTACTCCTGTTGCTCCTGTGGCCCCCGTTGCTCCTGTTGTTCCGGTTGCTCCTGTTACCCCAATTGCTCCTGTTGCCCCAGTTGCTCCTGTTACACCCGTTTCTCCTGTCGCTCCCGTAGCTCCTGTTACCCCAGTTGCTCCAGTCTCTCCAGTGGTACCTGTTACTCCCGTAGCTCCTATCACGCTCCCGTTGCTCCTGTTGTTCCGGTTGCTCCTGTTACCCCGGTTGCTCCTGTTACCCCGGCTGCTCCTGTTGCCCCAGTTTCTCCTGTTGCCCCTGTTACTCCAGTCGCTCCAGTTACCCCAGTTGCTCCTGTTACCCCTGTTGCTCCGGTTGCTCCGGTTATCCCCGTTGCTCCTGTCTCTCCGGTCGCTCCTGTTACCCCGGTTGCCCCTGTTTCTCCGGTTACTCCTGTTGCTCCTGTGGCCCCCGTTGCTCCTGTTGTTCCGGTTGCTCCTGTTACCCCAATTGCTCCTGTTGCCCCAGTTGCTCCTGTTACACCCGTTTCTCCTGTCGCTCCCGTAGCTCCTGTTACCCCAGTTGCTCCAGTCTCTCCAGTGGTACCTGTTGCTCCCGTAGCTCCTATCACTCCCGTTGCACCCGTGGCTCCTGTTGCTCCGGTTGCACCAGTTATTCCTGTTGCTCCCGTTGCTCCTGTTGCACCAGTTACTCCTGTTGCTCCCGTGGCTCCCGTTGCTCCTGTTGTTCCTGTTACCCCGGTTGCTCCTGTTACCCCGGCTGCTCCTGTTGCCCCAGTTTCTCCTGTTGCCCCTGTTACTCCAGTCGCTCCAGTTACCCCAGTTGCTCCTGTTACCCCTGTTGCTCCGGTTGCTCCGGTTATCCCCGTTGCTCCTGTCTCTCCGGTCGCTCCTGTTACCCCGGTTGCCCCTGTTTCTCCGGTTACTCCTGTTGCTCCTGTGGCCCCCGTTGCTCCTGTTGTTCCGGTTGCTCCTGTTACCCCGGCTGCTCCTGTTGCCCCAGTTTCTCCTGTGGCTCCCGTTGCACCAGTTACTCCTGTTGCTCCCGTTGCTCCCGTTGCTCCCGTTGCCCCCGTTGCTCCTCTTTCTCCTGTTGCTCCCGTTGCACCAGTTACTCCTGTTGCTCCGGTTGCACCAGTTACTCCTGTTGCCCCCGTTGCTCCGGTTGCTCCTGTTACCCCGGTTGCCCCTGTTTCTCCGGTTACTCCTGTCGCTCCGGTTGCACCCGTAACTCCCGTTGCTCCACTAACTCCCGTTGCACCCGTTTCACCTGTCGCTCCTGTTATTCCTGTTGCTCCGGTTGCCCCTGTTTCTCCGGTTACTCCTGTCGCTCCTGTTACCCCAGTTGCTCCCGTAGTTCCTGTTGCTCCCGTGGCTCCTGTTACTCCTGTTGCTCCGGTTGCTCCCGTAGCTCCCGTAGCTCCTGTTACTCCTGCCGCTCCTGTGGCACCTGTTACCCCAGTTGCTCCTGTCTCTCCGGTGGCTCCTGTTGCTCCCGTTGCTCCTCTTTCTCCTGTTGCTCCCGTTGCACCTGTTGCACCAGTTTCACCAGTTTCACCGGTCGCTCCCGTTGCACCCATTTCACCTGTAGCTCCTGTTGCACCAGTTACTCCTGTTGCTCCCGTGGCCCCCGTTGCTCTTCTTTCTCCTGTTGCTCCGGTTGCTCCCGTTGCTCCTGTTGCCCCAGTTACTCCAGTTGCACCCGTTGCTCCTGTCTCTCCGATGGCACCCGTTGCACCCGTGGCTCCTGTTGCACCCGTTGCTCCCGTCTCCCCAGTGGCTCCTGTTACTCCTGTTGCTCCTCTTTCTCCTGTTGCTCCGGTTGCTCCCGTTGCTCCTGTTGCCCCTGTTACTCCTGTTGCTCCTGTTGCCCCCGTAGTTCCTGTTACTCCTGTTGCTCCCGTTGCTCCGGTTGCACCAATTTCTCCTATTGCTCCCGTGGCTCCTGTTTCACCCGTTGCTCCCGTCTCCCCAGTGGCTCCTGTTACTCCTGTTACTCCTGTTGCCCCTGTTGCCCCAGTTACTCCAGTTGCACCCGTTGCTCCTGTTGCACCAGTTACTCCTGTTGCTCCCGTGGCCCCCGTTGCTCCTCTTTCTCCTGTTGCTCCGGTTGCTCCCGTTGCTCCTGTTGCCCCTGTTACTCCTGTTGCTCCTGTTGCCCCCGTAGTTCCTGTTACTCCTGTTGCTCCCGTTGCTCCGGTTGCACCAATTTCTCCTATTGCTCCCGTGGCTCCTGTTTCACCCGTTGCTCCCGTCTCCCCAGTGGCTCCTGTTACTCCTGTTACTCCTGTTGCTCCCGTGGCCCCCGTTGCTCCACTTTCTCCTGTTACCCCGGTTGCTCCCGTACCTGTCGCTCCTGCCGCTCCTGTTACTCCCGTTGCTCCGGTTGCACCCATGGCTCCTCTTTCTCCTGTTGCTCCTGTAACTCCCGTAGCTCCTGTTGCTCCCGTTTCACCTGTTGTTCCTACTCCAGTTGACCCTCTTGCCCCTCTTACCCCTACCGCTCCCGTCGCTCCAGTTGACCCTCTTGCACCTGCTGCTCCCGTTGACCCCGCTGCCCCAGGAACACCCGGTACTCCTTCGGAACCTGTAGCTCCAGTT

>NC_013406|3|1|4809095-4815937|CRT
GCACCGGTTGCTCCTGTT	ACCCCCGTGGCTCCCGTTGCTCCCGTTGCTCCGGTTGCTCCGGTTGCTCCTGTT
GCTCCCGTGGCTCCTCTT	TCTCCTGTTGCACCCGTTACACCAGTTACTCCTGTTGCTCCGGTGGCTCCTGTTACCCCGGTTGCCCCTGTTACTCCAGTT
GCTCCCGTGGCTCCTCTT	TCCCCAGTCACACCTGTGGCTCCGGTTGCCCCTGTTACCCCGGTTGCTCCTGTTGCTCCCGTG
GCCCCCGTTGCTCCTCTT	TCTCCTGTTGCTCCTGTTGCTCCGGTTGCACCAGTTACTCCTGTT
GCTCCCGTTGCTCCTGTT	GCCCCTGTTACTCCGGTTGCTCCTGTTACCCCCGTT
GCTCCTGTTGCTCCTGTT	ACCCCTGTTGCTCCTGTTGCACCAGTT
ATTCCTGTTGCTCCTCTT	TCCCCAGTTACACCTGTT
GCTCCTGTTGCTCCTGTT	GCTCCTGTCGCTCCTGTTACCCCAGTTGCTCCCGTT
GCTCCTGTTGCTCCCGTT	GCTCCTGTTACTCCTGTG
GCTCCTGTGGCTCCTGTG	GCTCCTGTGGCTCCTCTGTCCCCAGTT
ACACCTGTTGCTCCCGTG	GCCCCCGTTACTCCTCTTTCTCCTGTC
GATCCCGTTGCTCCCGTG	GCTCCCGTAACACCTGTT
GCCCCCGTTGCTCCGGTG	GCTCCCGTTGCTCCAGTCTCTCCAGTCTCTCCAGTGGTACCTGTT
GCTCCCGTTGCTCCTGTC	ACTCCCGTTGCACCCGTTGCTCCGGTTGCACCAGTTATTCCTGTT
GCTCCCGTTGCTCCTCTT	TCCCCAGTTACACCTGTT
GCTCCCGTTACTCCTCTT	TCCCCAGTTACACCTGTT
GCTCCTGTTGCTCCTGTT	GCTCCTGTTGCTCCTGTT
ACCCCTGTTGCTCCAGTT	GCTCCGGTGGCTCCCGTTGCTCCAGTCTCTCCAGTG
GTACCTGTTGCTCCCGTT	GCTCCTGTCACTCCCGTTGCACCCGTTGCTCCGGTTGCACCAGTT
ATTCCTGTTGCTCCCGTT	GCTCCTCTTTCCCCAGTT
ACACCTGTTGCTCCCGTT	GCTCCTGTCGCTCCGGTT
ACTCCTGTTGCACCTGTT	TCACCTGTAGCTCCTGTTGCCCCAGTT
ACTCCCGTTGCTCCCGTT	GCTCCTGTTGTTCCGGTTGCTCCTGTT
ACCCCGGCTGCTCCTGTT	GCCCCAGTTTCTCCTGTT
GCCCCAGTTTCTCCTGTT	GCCCCTGGTACTCCAGTCGCTCCAGTT
ACCCCAGTTGCTCCTGTT	ACCCCTGTTGCTCCGGTT
GCACCCGTCGCTCCCGTT	GCACCAATTTCTCCTGTG
GCTCCCGTGGCTCCTGTT	ACCCCTGTTGCTCCTGTTGCACCAGTTTCTCCTGCT
GCCCCTGTCGCTCCTGTT	GCTCCCGTTTCACCTGTTACCCCGGTT
GCTCCGGTGGCTCCCGTT	TCACCTGTTACCCCGGTT
GCTCCGGTGGCTCCCGTA	GCTCCTGTTACTCCTGCCGCTCCCGTAGCTCCTGTTACTCCTGCC
GCTCCAGTGGCTCCTGTC	GCTCCTGCTACCCCCGTT
GCTCCTGTTGCACCAGTT	TCTCCGGTTTCTCCTGTTGATCCTGTTTCCCCCGTCGCTCCTGTTACCCCCATT
GCTCCTGTTGCACCAGTT	TCTCCGGTTGCTCCGGTAGCTCCTGTCGCTCCCGTA
GCTCCTGTTGCCCCTGTT	ACTCCCATTACCCCTGTT
GCTCCTGTTGCACCCGTT	TCTCCTGTTACTCCTGTTGCTCCCGCTTCTCCTGTTGCTCCTGTC
GCTCCCGTTGCACCCGTT	TCACCCGTTACACCTGTCGCTCCTGTTACTCCTGTT
GCTCCTGTTGCTCCTGTT	ACCCCCGTTGCTCCTGTTGCTCCTGTTACCCCCGTT
GCTCCTGTAGCTCCCGTT	ACTCCTACCGCTCCAGTAGCTCCTGTTACCCCTGTT
GCTCCAGTATCTCCAGTT	GCCCCTGTTACCCCCGTAGCTCCTGTTGCCCCTGTTACCCCCGTA
GCTCCTGTAGCTCCCGTT	ACTCCTGCCGCTCCAGTAGCTCCTGTTACCCCTGTT
GCTCCAGTATCTCCAGTT	GCCCCTGTTACCCCCGTA
GCTCCTGTTGCCCCTGTT	GCTCCTGTTGCACCCGTTTCACCTGTAGCTCCTGTTGCTGTT
GATCCGGTTGCTCCTGTT	ACCCCTTACCCCTGTTGCTCCCGTTGCTGCACCCGTTGTGCCTGTA
GCTCCCGTTGCACCTGTT	ACTCCCGTTTCTCCTGTT
GTTCCCGTTGCACCTGTT	ACCCCAATTGCTCCTGTTGCCCCAGTTGCTCCTGTTACACCCGTTTCTCCTGTC
GCTCCCGTAGCTCCTGTT	ACCCCAGTTGCTCCAGTCTCTCCAGTGGTACCTGTT
GCTCCCGTAGCTCCTATC	ACTCCCGTTGCACCCGTGGCTCCTGTTGCTCCGGTTGCACCAGTTATTCCTGTT
GCTCCCGTTGCTCCTGTT	GCACCAGTTACTCCTGTTGCTCCCGTG
GCTCCCGTTGCTCCTGTT	GTTCCGGTTGCTCCTGTTACCCCGGTTGCTCCTGTTACCCCGGCTGCTCCTGTTGCCCCAGTT
TCTCCTGTTGCTCCTGTT	ACTCCAGTCGCTCCAGTT
ACCCCAGTTGCTCCTGTT	ACCCCTGTTGCTCCGGTTGCTCCGGTTATCCCCGTTGCTCCTGTCTCTCCGGTCGCTCCTGTT
ACCCCGGTTGCCCCTGTT	TCTCCGGTTACTCCTGTTGCTCCTGTG
GCCCCCGTTGCTCCTGTT	GTTCCGGTTGCTCCTGTTACCCCAATTGCTCCTGTT
GCCCCAGTTGCTCCTGTT	ACACCCGTTTCTCCTGTC
GCTCCCGTAGCTCCTGTT	ACCCCAGTTGCTCCAGTCTCTCCAGTGGTACCTGTT
ACTCCCGTAGCTCCTATC	ACTCCCGTTGCACCCGTGGCTCCTGTTGCTCCGGTTGCACCAGTTATTCCTGTT
GCTCCCGTTGCTCCTGTT	GCACCAGTTACTCCTGTTGCTCCCGTG
GCTCCCGTTGCTCCTGTT	GTTCCGGTTGCTCCTGTT
ACCCCGGTTGCTCCTGTT	ACCCCGGCTGCTCCTGTT
GCCCCAGTTTCTCCTGTT	GCCCCTGTTACTCCAGTCGCTCCAGTT
ACCCCAGTTGCTCCTGTT	ACCCCTGTTGCTCCGGTTGCTCCGGTT
ATCCCCGTTGCTCCTGTC	TCTCCGGTCGCTCCTGTT
ACCCCGGTTGCCCCTGTT	TCTCCGGTTACTCCTGTTGCTCCTGTG
GCCCCCGTTGCTCCTGTT	GTTCCGGTTGCTCCTGTTACCCCAATTGCTCCTGTT
GCCCCAGTTGCTCCTGTT	ACACCCGTTTCTCCTGTC
GCTCCCGTAGCTCCTGTT	ACCCCAGTTGCTCCAGTCTCTCCAGTGGTACCTGTT
GCTCCCGTAGCTCCTATC	ACTCCCGTTGCACCCGTGGCTCCTGTTGCTCCGGTTGCACCAGTTATTCCTGTT
GCTCCCGTTGCTCCTGTT	GCACCAGTTACTCCTGTTGCTCCCGTT
GCTCCCGTTGCTCCTGTT	GCTCCTGTTACTCCGGTTGCTCCTGTTGCTCCGGTAGCTCCTGTC
GCTCCCGTAGCTCCTGTT	GCTCCTGTTACTCCCATTACCCCTGTTGCTCCTGTT
GCACCCGTTTCTCCTGTT	ACTCCTGTTGCTCCCGCTTCTCCTGTTGCTCCTGTCGCTCCCGTT
GCACCCGTTTCACCCGTT	ACACCTGTCGCTCCTGTTACTCCTGTTGCTCCTGTT
GCTCCTGTTACCCCCGTT	GCTCCTGTTGCTCCTGTTACCCCCGTTGCTCCTGTAGCTCCCGTTACTCCTACCGCTCCAGTA
GCTCCTGTTACCCCTGTT	GCTCCAGTATCTCCAGTTGCCCCTGTTACCCCCGTA
GCTCCTGTTGCCCCTGTT	ACCCCCGTAGCTCCTGTAGCTCCCGTTACTCCTGCCGCTCCAGTA
GCTCCTGTTACCCCTGTT	GCTCCAGTATCTCCAGTTGCCCCTGTTACCCCCGTA
GCTCCTGTTGCCCCTGTT	GCTCCTGTTGCTCCCGTTTCACCTGTAGCTCCTGTTGATCCGGTT
GCTCCTGTTACCCCTGTT	GCTCCTGTTACCCCGGCTGCTCCTGTTGCTCCAGTTTCTCCTGTTGCTCCTGTTACTCCAGTC
GCTCCAGTTACCCCAGTT	GCTCCTGTTACCCCTGTTGCTCCGGTTGCTCCGGTGATGCCCGTTGCTCCTGTCTCTCCGGTC
GCTCCTGTTACCCCGGTT	GCCCCTGTTTCTCCGGTTACTCCTGTTGCTCCTGTGGCCCCCGTTGCTCCTGTTGTTCCGGTT
GCTCCTGTTACCCCAATT	GCTCCTGTTGCCCCAGTTGCTCCTGTTACACCCGTTTCTCCTGTCGCTCCCGTA
GCTCCTGTTACCCCAGTT	GCTCCAGTCTCTCCAGTGGTACCTGTTACTCCCGTAGCTCCTATCACGCTCCCGTTGCTCCTGTTGTTCCGGTT
GCTCCTGTTACCCCGGTT	GCTCCTGTTACCCCGGCTGCTCCTGTTGCCCCAGTTTCTCCTGTTGCCCCTGTTACTCCAGTCGCTCCAGTTACCCCAGTT
GCTCCTGTTACCCCTGTT	GCTCCGGTTGCTCCGGTTATCCCCGTTGCTCCTGTCTCTCCGGTCGCTCCTGTTACCCCGGTTGCCCCTGTT
TCTCCGGTTACTCCTGTT	GCTCCTGTGGCCCCCGTTGCTCCTGTTGTTCCGGTTGCTCCTGTTACCCCAATTGCTCCTGTT
GCCCCAGTTGCTCCTGTT	ACACCCGTTTCTCCTGTCGCTCCCGTAGCTCCTGTTACCCCAGTT
GCTCCAGTCTCTCCAGTG	GTACCTGTTGCTCCCGTAGCTCCTATCACTCCCGTTGCACCCGTG
GCTCCTGTTGCTCCGGTT	GCACCAGTTATTCCTGTT
GCTCCCGTTGCTCCTGTT	GCACCAGTTACTCCTGTTGCTCCCGTG
GCTCCCGTTGCTCCTGTT	GTTCCTGTTACCCCGGTTGCTCCTGTTACCCCGGCT
GCTCCTGTTGCCCCAGTT	TCTCCTGTTGCCCCTGTTACTCCAGTC
GCTCCAGTTACCCCAGTT	GCTCCTGTTACCCCTGTTGCTCCGGTT
GCTCCGGTTATCCCCGTT	GCTCCTGTCTCTCCGGTC
GCTCCTGTTACCCCGGTT	GCCCCTGTTTCTCCGGTTACTCCTGTT
GCTCCTGTGGCCCCCGTT	GCTCCTGTTGTTCCGGTTGCTCCTGTTACCCCGGCT
GCTCCTGTTGCCCCAGTT	TCTCCTGTGGCTCCCGTTGCACCAGTTACTCCTGTTGCTCCCGTTGCTCCCGTT
GCTCCCGTTGCCCCCGTT	GCTCCTCTTTCTCCTGTT
GCTCCCGTTGCACCAGTT	ACTCCTGTTGCTCCGGTTGCACCAGTTACTCCTGTT
GCCCCCGTTGCTCCGGTT	GCTCCTGTTACCCCGGTT
GCCCCTGTTTCTCCGGTT	ACTCCTGTCGCTCCGGTT
GCACCCGTAACTCCCGTT	GCTCCACTAACTCCCGTT
GCACCCGTTTCACCTGTC	GCTCCTGTTATTCCTGTT
GCTCCGGTTGCCCCTGTT	TCTCCGGTTACTCCTGTC
GCTCCTGTTACCCCAGTT	GCTCCCGTAGTTCCTGTTGCTCCCGTG
GCTCCTGTTACTCCTGTT	GCTCCGGTTGCTCCCGTAGCTCCCGTA
GCTCCTGTTACTCCTGCC	GCTCCTGTGGCACCTGTTACCCCAGTTGCTCCTGTCTCTCCGGTG
GCTCCTGTTGCTCCCGTT	GCTCCTCTTTCTCCTGTT
GCTCCCGTTGCACCTGTT	GCACCAGTTTCACCAGTTTCACCGGTC
GCTCCCGTTGCACCCATT	TCACCTGTAGCTCCTGTTGCACCAGTTACTCCTGTT
GCTCCCGTGGCCCCCGTT	GCTCTTCTTTCTCCTGTT
GCTCCGGTTGCTCCCGTT	GCTCCTGTTGCCCCAGTT
ACTCCAGTTGCACCCGTT	GCTCCTGTCTCTCCGATGGCACCCGTTGCACCCGTG
GCTCCTGTTGCACCCGTT	GCTCCCGTCTCCCCAGTGGCTCCTGTTACTCCTGTTGCTCCTCTTTCTCCTGTT
GCTCCGGTTGCTCCCGTT	GCTCCTGTTGCCCCTGTTACTCCTGTTGCTCCTGTTGCCCCCGTAGTTCCTGTT
ACTCCTGTTGCTCCCGTT	GCTCCGGTTGCACCAATTTCTCCTATTGCTCCCGTGGCTCCTGTTTCACCCGTTGCTCCCGTCTCCCCAGTGGCTCCTGTT
ACTCCTGTTACTCCTGTT	GCCCCTGTTGCCCCAGTTACTCCAGTTGCACCCGTTGCTCCTGTT
GCACCAGTTACTCCTGTT	GCTCCCGTGGCCCCCGTTGCTCCTCTTTCTCCTGTTGCTCCGGTTGCTCCCGTTGCTCCTGTT
GCCCCTGTTACTCCTGTT	GCTCCTGTTGCCCCCGTAGTTCCTGTT
ACTCCTGTTGCTCCCGTT	GCTCCGGTTGCACCAATT
TCTCCTATTGCTCCCGTG	GCTCCTGTTTCACCCGTTGCTCCCGTCTCCCCAGTG
GCTCCTGTTACTCCTGTT	ACTCCTGTTGCTCCCGTGGCCCCCGTT
GCTCCACTTTCTCCTGTT	ACCCCGGTTGCTCCCGTACCTGTCGCTCCTGCC
GCTCCTGTTACTCCCGTT	GCTCCGGTTGCACCCATGGCTCCTCTTTCTCCTGTTGCTCCTGTAACTCCCGTA
GCTCCTGTTGCTCCCGTT	TCACCTGTTGTTCCTACTCCAGTTGACCCTCTTGCCCCTCTTACCCCTACC
GCTCCCGTCGCTCCAGTT	GACCCTCTTGCACCTGCTGCTCCCGTTGACCCCGCTGCCCCAGGAACACCCGGTACTCCTTCG
GAACCTGTAGCTCCAGTT

Protein	Signature genes	Signature genes Name	Protein_function
NC_013406.1\|WP_162939111.1\|4808395_4808539_-\|hypothetical-protein	unknown	unknown	unknown
NC_013406.1\|WP_041622027.1\|4816971_4817790_-\|tRNA-(guanosine(37)-N1)-methyltransferase-TrmD	unknown	unknown	gnl\|CDD\|234581
NC_013406.1\|WP_036663956.1\|4807099_4807714_-\|signal-peptidase-I	unknown	unknown	gnl\|CDD\|274044
NC_013406.1\|WP_015736347.1\|4798561_4799446_-\|ROK-family-protein	unknown	unknown	gnl\|CDD\|366120
NC_013406.1\|WP_015736361.1\|4820898_4821546_-\|hemolysin-III-family-protein	unknown	unknown	gnl\|CDD\|185044
NC_013406.1\|WP_009594996.1\|4817793_4818315_-\|ribosome-maturation-factor-RimM	unknown	unknown	gnl\|CDD\|234650
NC_013406.1\|WP_015736348.1\|4799480_4800956_-\|glycoside-hydrolase-family-32-protein	unknown	unknown	gnl\|CDD\|350134
NC_013406.1\|WP_015736350.1\|4802698_4803580_-\|carbohydrate-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223472
NC_013406.1\|WP_015736360.1\|4819000_4820383_-\|signal-recognition-particle-protein	unknown	unknown	gnl\|CDD\|236780
NC_013406.1\|WP_015736362.1\|4822003_4823032_+\|glycosyltransferase	unknown	unknown	gnl\|CDD\|340856
NC_013406.1\|WP_009594991.1\|4820404_4820761_-\|putative-DNA-binding-protein	unknown	unknown	gnl\|CDD\|234647
NC_013406.1\|WP_015736352.1\|4805028_4806069_+\|LacI-family-DNA-binding-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380629
NC_013406.1\|WP_015736353.1\|4806171_4807038_-\|ribosome-biogenesis-GTPase-YlqF	unknown	unknown	gnl\|CDD\|236570
NC_013406.1\|WP_015736355.1\|4807816_4808161_-\|50S-ribosomal-protein-L19	unknown	unknown	gnl\|CDD\|235418
NC_013406.1\|WP_006211360.1\|4818427_4818658_-\|KH-domain-containing-protein	unknown	unknown	gnl\|CDD\|224750
NC_013406.1\|WP_015736364.1\|4824225_4825236_+\|polysaccharide-pyruvyl-transferase-family-protein	unknown	unknown	gnl\|CDD\|377253
NC_013406.1\|WP_081746333.1\|4803596_4804550_-\|sugar-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|226666
NC_013406.1\|WP_015736349.1\|4801039_4802641_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270299
NC_013406.1\|WP_006211361.1\|4818679_4818952_-\|30S-ribosomal-protein-S16	unknown	unknown	gnl\|CDD\|234588
NC_013406.1\|WP_015736363.1\|4823028_4824201_+\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|366154

Protein	Function_ID	Function_description	E-value
NC_013406.1\|WP_041622027.1\|4816971_4817790_-\|tRNA-(guanosine(37)-N1)-methyltransferase-TrmD	gnl\|CDD\|234581	PRK00026, trmD, tRNA (guanine-N(1)-)-methyltransferase; Reviewed.	7.1699e-161
NC_013406.1\|WP_009594996.1\|4817793_4818315_-\|ribosome-maturation-factor-RimM	gnl\|CDD\|234650	PRK00122, rimM, 16S rRNA-processing protein RimM; Provisional.	3.1034e-68
NC_013406.1\|WP_036663956.1\|4807099_4807714_-\|signal-peptidase-I	gnl\|CDD\|274044	TIGR02227, Inactive_signal_peptidase_IA., signal peptidase I, bacterial type. This model represents signal peptidase I from most bacteria. Eukaryotic sequences are likely organellar. Several bacteria have multiple paralogs, but these represent isozymes of signal peptidase I. Virtually all known bacteria may be presumed to A related model finds a simlar protein in many archaea and a few bacteria, as well as a microsomal (endoplasmic reticulum) protein in eukaryotes. [Protein fate, Protein and peptide secretion and trafficking].	1.80626e-47
NC_013406.1\|WP_015736347.1\|4798561_4799446_-\|ROK-family-protein	gnl\|CDD\|366120	pfam00480, ROK, ROK family.	3.17841e-72
NC_013406.1\|WP_015736361.1\|4820898_4821546_-\|hemolysin-III-family-protein	gnl\|CDD\|185044	PRK15087, PRK15087, hemolysin; Provisional.	4.89398e-66
NC_013406.1\|WP_015736348.1\|4799480_4800956_-\|glycoside-hydrolase-family-32-protein	gnl\|CDD\|350134	cd18622, GH32_Inu-like, glycoside hydrolase family 32 protein such as Aspergillus ficuum endo-inulinase (Inu2). This subfamily of glycosyl hydrolase family GH32 includes endo-inulinase (inu2, EC 3.2.1.7), exo-inulinase (Inu1, EC 3.2.1.80), invertase (EC 3.2.1.26), and levan fructotransferase (LftA, EC 4.2.2.16), among others. These enzymes cleave sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose, thus named invertase (EC 3.2.1.26). These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. These enzymes are predicted to display a 5-fold beta-propeller fold as found for GH43 and CH68. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.	1.24099e-162
NC_013406.1\|WP_015736350.1\|4802698_4803580_-\|carbohydrate-ABC-transporter-permease	gnl\|CDD\|223472	COG0395, UgpE, ABC-type sugar transport system, permease component [Carbohydrate transport and metabolism].	1.5816e-60
NC_013406.1\|WP_015736360.1\|4819000_4820383_-\|signal-recognition-particle-protein	gnl\|CDD\|236780	PRK10867, PRK10867, signal recognition particle protein; Provisional.	0
NC_013406.1\|WP_015736362.1\|4822003_4823032_+\|glycosyltransferase	gnl\|CDD\|340856	cd04950, GT4_TuaH-like, teichuronic acid biosynthesis glycosyltransferase TuaH and similar proteins. Members of this family may function in teichuronic acid biosynthesis/cell wall biogenesis. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.	1.09072e-49
NC_013406.1\|WP_009594991.1\|4820404_4820761_-\|putative-DNA-binding-protein	gnl\|CDD\|234647	PRK00118, PRK00118, putative DNA-binding protein; Validated.	1.48286e-37
NC_013406.1\|WP_015736352.1\|4805028_4806069_+\|LacI-family-DNA-binding-transcriptional-regulator	gnl\|CDD\|380629	cd19974, PBP1_LacI-like, ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors. This group includes the ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type 1 periplasmic binding protein-like fold. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding affinity of the repressor.	6.04169e-95
NC_013406.1\|WP_015736353.1\|4806171_4807038_-\|ribosome-biogenesis-GTPase-YlqF	gnl\|CDD\|236570	PRK09563, rbgA, GTPase YlqF; Reviewed.	5.42917e-157
NC_013406.1\|WP_015736355.1\|4807816_4808161_-\|50S-ribosomal-protein-L19	gnl\|CDD\|235418	PRK05338, rplS, 50S ribosomal protein L19; Provisional.	5.72634e-72
NC_013406.1\|WP_006211360.1\|4818427_4818658_-\|KH-domain-containing-protein	gnl\|CDD\|224750	COG1837, COG1837, Predicted RNA-binding protein (contains KH domain) [General function prediction only].	3.36516e-24
NC_013406.1\|WP_015736364.1\|4824225_4825236_+\|polysaccharide-pyruvyl-transferase-family-protein	gnl\|CDD\|377253	pfam04230, PS_pyruv_trans, Polysaccharide pyruvyl transferase. Pyruvyl-transferases involved in peptidoglycan-associated polymer biosynthesis. CsaB in Bacillus anthracis is necessary for the non-covalent anchoring of proteins containing an SLH (S-layer homology) domain to peptidoglycan-associated pyruvylated polysaccharides. WcaK and AmsJ are involved in the biosynthesis of colanic acid in Escherichia coli and of amylovoran in Erwinia amylovora.	7.17569e-21
NC_013406.1\|WP_081746333.1\|4803596_4804550_-\|sugar-ABC-transporter-permease	gnl\|CDD\|226666	COG4209, LplB, ABC-type polysaccharide transport system, permease component [Carbohydrate transport and metabolism].	1.6409e-124
NC_013406.1\|WP_015736349.1\|4801039_4802641_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|270299	cd13581, PBP2_AlgQ_like_2, Periplasmic-binding component of alginate-specific ABC uptake system-like; contains the type 2 periplasmic binding fold. This subgroup includes uncharacterized periplasmic-binding proteins that are closely related to high molecular weight (HMW) alginate bining proteins (AlgQ1 and AlgQ2) found in gram-negative soil bacteria. The HMW alginate uptake system is composed of a novel pit formed on the cell surface and a pit-dependent ATP-binding cassette (ABC) transporter in the inner membrane. The transportation of HMW alginate from the pit to the ABC transporter is mediated by periplasmic HMW alginate-binding proteins (AlgQ1 and AlgQ2). Alginate is an anionic polysaccharide that is made up of alpha-L-mannuronate and its 5'-epimer, alpha-L-guluronate. Alginate is present in the cell walls of brown seaweeds, where it forms a viscous gum by binding water. Alginate is also produced by two bacteria genera Pseudomonas and Azotobacter. AlgQ1 and AlgQ2 belong to the type 2 periplasmic-binding fold superfamily. PBP2 is comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. However, unlike other bacterial periplasmic-binding proteins that deliver small solutes to ABC transporters, AlgQ1/2 can bind a macromolecule and may have specificity for either sugar or a certain type of polysaccharide.	0
NC_013406.1\|WP_006211361.1\|4818679_4818952_-\|30S-ribosomal-protein-S16	gnl\|CDD\|234588	PRK00040, rpsP, 30S ribosomal protein S16; Reviewed.	8.28451e-46
NC_013406.1\|WP_015736363.1\|4823028_4824201_+\|glycosyltransferase-family-2-protein	gnl\|CDD\|366154	pfam00535, Glycos_transf_2, Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.	3.498e-25

>NC_013406.1|WP_162939111.1|4808395_4808539_-|hypothetical-protein
MTEHRQQQEAKIEETNHTEVQFQTVDDILEYYGKRHKGLHDSKESVN
>NC_013406.1|WP_015736355.1|4807816_4808161_-|50S-ribosomal-protein-L19
MNIVQAITQEQLRKDIPSFRPGDTLKVHVKVIEGTRERIQLFEGVVIKRRGGGISETFTVRKISYGVGVERTFPINSPKIDKIEVARRGKVRRAKLYYLRELRGKAARIKEIRR
>NC_013406.1|WP_036663956.1|4807099_4807714_-|signal-peptidase-I
MEKDQHQEAIETNVGKPAKKAKNELVEWLKALLIALVLVVLIRWLLFKPFIVQGPSMEPNFVSNQKLIVNEILYDIRKPERGEVIVFHVPDEGRDFIKRVIAVAGDTVKVEGDKVLVNGEPVNETYIQEAIDQAHAENRLYNNTDFPNSFVQDGVVPEGHVFVMGDNRSNSTDSRMIGYVPLGDIIGRADLIFWPIKDIGLINH
>NC_013406.1|WP_015736353.1|4806171_4807038_-|ribosome-biogenesis-GTPase-YlqF
MTIQWFPGHMTKARRQIQEKLKLIDAVIELIDARLPLSSRNPMIDEILQGKPRLVIMNKADLADPEVTRQWQAYFKEAGLTAFPVDASTGTGVKDIPNQIKLLLKEKIDKQIAKGMNPRAMRVLIVGIPNVGKSTLINRLAGRNIAETGDRPGVTKGQQWIKVAGGEMELLDTPGILWPKFEDQNVGYRLAVTGAIKEEILNVEDIAFFAIKYFANYYWETMSERFDLKERPTDLDNPDEIVAVMEAIGRKRGCIVSGGRVDLEKASSLFLRELRAGKLGRYSMESPY
>NC_013406.1|WP_015736352.1|4805028_4806069_+|LacI-family-DNA-binding-transcriptional-regulator
MTKEKVTIQDIADALGISRNTASKALNGSESIPDETRSKVIRKAIELKYKQFAFMETDNLLTKNPGNIALLTANLPSTSHFGSRLISGLEKRISAEGYNLSIHIVRDIDRSSRTLPNNFESSKVDGIICIELFDMEYSRELTSLGLPTVFIDCAADMFYPDLQADLLLMENEHSTCHMTKRLIEQGYASLGFIGDIQHCKSFNERWVGFNRALTEMGIRLDPEQCVLNPDREFFSESDWMEKRLKQMKPLPSAFVCANDFIAVNVMKALKNSHIAIPGDIAVCGFDNAPESRIVEPHLSTVHIYSDEMGIAAANMLLSRVKEPALPYQVTHIQTKPIFRASTEKTD
>NC_013406.1|WP_081746333.1|4803596_4804550_-|sugar-ABC-transporter-permease
MEPANQGAGVIKGRSSAGRTLAFVKKNYFLYILLAPALILTLIFKYVPMYGAVIAFKDFSPIKGILGSEWVGLKHFEKFIASPNFDVIFMNTLKLSFFGLIFSFPVPILLALMLNQVRKAAVKKNIQLFLYAPNFISVVVIVGMLFIFLSPTGPINQLVIWMTGSPLMFMSQPEYFRWIYILSDIWQGAGWASIIYVAALANVDPELHNAASLDGANLLQRIRHIDLPTIRPIMAIVFILAAGGIMSIGFEKAYLMQTSMNLPTSEIIATYVYKVGLQSGDYAYSAAVGLFNSVINVILLVTVNFIVRKLNEGEGLY
>NC_013406.1|WP_015736350.1|4802698_4803580_-|carbohydrate-ABC-transporter-permease
MAVKHSRFDRFLLSLNAIFLTLAVLVVVVPLVYIVVASFMDPTVLLNQGLSFKISDWSLEGYQMILSNPAMLRGFGNAVFYSTAFALLTVTVSVCAGYALSESRLAGRHFFMTLFIITIFFGGGLIPTYLLVRELGMLNTVWAVIIPGAVNVWNIILSRTFFKGVPNELKEAANVDGATDMKIFVRIVLPLSKPIIFVLALYAFVGQWNAFFDAMIYLDDPKLHPLQLVLRSILIQNQAAPGMISDQLAMAELKRLSEMIKYSAIVISSLPLLIMYPFFQKYFEKGVMVGSLK
>NC_013406.1|WP_015736349.1|4801039_4802641_-|ABC-transporter-substrate-binding-protein
MNTKRSKKHNRKKAVTLTALAAVLLLSGCGKGGEASNESPDGKVTLNVLTQSSPLAPADPNEKLINKRLEEKTGIHIKWKNYTSDVFAEKRNLAVASGDLPDAIFDAGYGDYDLLKLAKDGVIIPVEDLIEQHMPNLKKVLEQAPEYVNMITAPDGHIYSFPWIEELGSGKERIQSVDNFPWINVEWLDALGLDMPTTTEELKTVLKAFKTQDPNGNGQADEIPLSFINKPGGEDLTFLFASFGLGENWDHTVVTDDGKVVFTAAEEGYKEAIAFIHELYEEGLIDIEAFQQDWNTYLAKGKDHRYGMYFTWDKANITGMNDTYDLMPPLAGPTGEINVTRTNGIGLDRGRLVITSSNKKLEETAKWIDAMYEPLQSVQNNWGTYGDDTQQNIFELDEAKGMLKHLPLEGTAPVELRQKTSIAGPLAILDEYYGKYTTMPDDAAWRLKLMKDVMVPHMKAENTYPKVFFSIDELDRLSTIEADLFPYLERMRTEWYQNGKVDQEWDAYLKELDRLGLQEWLTIKQTGYDRNMK
>NC_013406.1|WP_015736348.1|4799480_4800956_-|glycoside-hydrolase-family-32-protein
MTNTEQQNYRNAYHFSPQKNWMNDPNGMVYFNGEYHLFYQHHPFGTTWGPMHWGHAVSRDLVSWEELPIALAPDEHGTIFSGSAVVDWNNSSGFFDGGPGLVAIFTHHHDVQGAQQMIQYQSLAYSKDEGRTWTKYDGNPVLSHDSYVDFRDPKVFWHEPSSQWVMIVACGQTVCLYRSSNLKEWVFASEFGEGIGFHDGVWECPDLFPLAAEDGEVRWVMLVSIGDDPAYVEGSRTQYFIGEFDGTTFMPDERSKGVVRWLDYGRDNYAGVSWSDIPAADGRRLFIGWMSNWKYANLTPTDGWRGAMTLVRELKLETLEGEVTVTQQPARELEAHRTELLSLHGIAVNEAAVRLAAVRLESCEILVRFDAAFSLGLRVRTGLGQETLVGWDAESAEVYVDRSRSGQADFHKDFPGKHSAQLKTSGSMLELRIFVDRSSVELFADRGQAVITDLIYPDPASTGITVFADDDRKVIESFHIYEVSSSGGQLK
>NC_013406.1|WP_015736347.1|4798561_4799446_-|ROK-family-protein
MRIGAMEAGGTKFVCGIGNENGIVEDRISFPTGQPEGTLSRAISYFHEHEVEAIGIGSFGPIDLKPDSPTYGYVTSTPKHGWSQIDVLGNMKSHMDIPYGWDTDVNAAALGEATWGAAKGLNSCVYYTVGTGIGLGLYAEGRLVHGLVHPEGGHVPVKRHPEDAFAGTCPYHGDCLEGLAAGPALEARWGLKGHLLPADHPAWEIEAYYIAQSITGLILTNSPEKIILGGGVMQQAQLYPLIRAEVRRNLNGYVLADEIVHDIEKYIVPPVLGTQSGLCGALALGIRAWQDSSS
>NC_013406.1|WP_041622027.1|4816971_4817790_-|tRNA-(guanosine(37)-N1)-methyltransferase-TrmD
MRIDVLTLFPEMFDGVFHSSILGKAAEKEIVNLNAINFRQYAGNKHGQVDDTPYGGGGGMVLKPDPIFAAVEDILASDPNEISNHGEGAHPAGEILAEITGAAKPPRVILMCPQGETFTQKKAEELSQEEHLVFICGHYEGYDERIREFLVTDELSIGDYVLTGGELPAMVVIDSVVRLLPGVLGNETSAVTDSFSTGLLEYPHYTRPAEFRGWKVPDILLSGHHANIDVWRREQALKRTWERRPELLEELELSKQDMVYLEKLRAQSGKAK
>NC_013406.1|WP_009594996.1|4817793_4818315_-|ribosome-maturation-factor-RimM
MSEKLYTVGKIVNTHGIRGEVKVMPHTDFADQRFAAKSKLYIVPDKGNKIEVTVETSRFHKNMYVLKFKELHGINEAEKYKGSLLKITEDLQEELPENEYYFHEIIGCKVMTDEEPAEELGTISEILTPGANDVWVVKTPKGKEILLPAIPDVVLDVDKESKLVRVHLMEGLL
>NC_013406.1|WP_006211360.1|4818427_4818658_-|KH-domain-containing-protein
MEELVRVIAKALVDHPEDVTVKTVEKEHLIVYELYVHPDDVGKVIGKQGRIAKSLRTVVTSAAVKMDKRVTVDIIS
>NC_013406.1|WP_006211361.1|4818679_4818952_-|30S-ribosomal-protein-S16
MAVRIRLKRMGAHKAPFYRVVVSDSRSPRDGRFIEEIGYYNPVAQPAEVKIDEEKALNWLQNGAQASDTVRNLLSKAGVMKKFHELKHQK
>NC_013406.1|WP_015736360.1|4819000_4820383_-|signal-recognition-particle-protein
MAFEGLTSRLQNVFSKLRGKGKVSEEDVTAAMREVRLALLEADVNFKVVKDFVSKVKEKAIGKEVMDSFTPGMVIIDIVNKELTELMGGSQAKLAKSNKPPTVIMMAGLQGAGKTTTSGKLAKLLQKQNSKPLLVAGDIYRPAAIKQLEVLGNQINVPVFSLGDKTSPVEIAKQGLQHAKDNGHDYVIIDTAGRLHVDEELMEELKQIHSVVNPDEVLLVVDAMTGQDAVNVAESFNQQLTLTGVVLTKLDGDTRGGAALSVKAVTGCPIKFAALGEKIDALEPFHPERMASRILGMGDMLSLIEKAQSNIDADKAKEMERKMRNAEFTFEDFLEQMDQVKKLGPLDQLMDMIPGMGKMKQAKDLKVDEKQMGRIEAIVHSMTTAEKQQPDIINHNRRKRIAAGSGTSLAEVNRLIKQFDEMRRVMKQFSDMMGPKGGKNKALKQLKGLTGGKGMKFPFR
>NC_013406.1|WP_009594991.1|4820404_4820761_-|putative-DNA-binding-protein
MSQENRLEKTNRINLLFDFYEQLLTEKQQTFLKYYFHDDFSLGEIAGEFEISRQAVYEHIKRAEQVLESYEEKLGLLSKHEARVRELDKFREMVETSDLDEHDKHVMTDMVERLKVWD
>NC_013406.1|WP_015736361.1|4820898_4821546_-|hemolysin-III-family-protein
MANTYTYPRREEIANAITHGIGAALSVAALVLLIVFSSLKGTAWHVVSFTIYGSTMLLLYLSSTLVHGLRDGKAKDFFEFMDHSSIYLFIAGTYTPFLLVAIRGPLGWSLFGIVWGIALFGVVFKAFFVKKFLFLSTIFYIAMGWLIVIAWNPLTAVVAPQGMNLLVLGGVLYTLGTIFYVWRGFPYHHAIWHLFVLAGSILHFFAILIYLLPIG
>NC_013406.1|WP_015736362.1|4822003_4823032_+|glycosyltransferase
MAVIIYPRTMNWSYMKQRPQQLMAQLGSLGHQVFFENLAPLDKEFKEIEPNVYLFTDTKTFLHKKLPALRKEHPIVVWTTWSKLRTRISTLFKPDITIYDCCDEFPHWAKYEPKMIDEADHVVCTAEVIHTRLSLAYPDKPLTLIPNGADSSFFHIPYSERPADLPPGPVVAYIGAWAYWVDHELFAKAALRFPNVQFVSIGAPYGSSGDYSKLPNVHILGEKPHQELKRYLTHIDVALIPFQYHPITLATNPVKAYEYMASGVRVLSTALPECIAMEPHVTTATTHDDFLGKLAAMLDRPDSAEHKLARIAYARENRWVERGLKADQVIRQAIMDKSMNAQ
>NC_013406.1|WP_015736363.1|4823028_4824201_+|glycosyltransferase-family-2-protein
MIPYATIRTQPFGYRSTDAASYRERVIQEVSGTDREWILWSCSLSFTHRGSSAPVPMPLHIPDHVVCICMSGAPIYWRRAWLLAALARWNDKLPAVRFLPYDLLPVDSSLTLHLKAAHHPPYQKELEYILPILSATRRQDSAAGPEGALSSKPPQQPEVSILMSIYNMKDTLGWSIRSVLAQTNENWELLIGDDGSEDESLKEACAFHDGRIRVITQSRNRGKAIMMNRLLTEAKGHYILELDGDDWLAPETVALLSKALDKNPDGLIATGRYGCWERTRQLGPLWRRNVDSGKLYSIYSPSFNRSHEHDHPLVPRMYRKSSLVAVDGWRNREDRFGRIFEDIDVTARVLKQSSPICVDALLYHRVVYGSSTSQRSRSLYEAWYQQTMQG
>NC_013406.1|WP_015736364.1|4824225_4825236_+|polysaccharide-pyruvyl-transferase-family-protein
MHIAASGYYGMGNFGDDLFLHTLRQVFHEHHVYPWNSRLDPRQTDAFIIGGGDLITPYSFNSYYFPPQLKGQPTWVYGVGIVDAYPEHTWPEEQVSAYREMISQAKRAVFRDERSSAIAKRAGFHRNVETAPDMVFGYRQPDIPVKRFSKRPTIGVVVFSYESFPMDNMTKLLAHLIAKGYHAVLIPVIHHPGNPYSDYNTCLQLQQKVRELTPGASIETLPFLMDIELTYSFIQSVDYLISFKLHPSLAALRGGKPVLALSTMGKVHSLLSSFHLGQYFTDYRQPLDALVDRTESFLKYGPGHVQQMMPLIRAAEKKSTASLLDLKNHIEEHNRW

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_013406_3	3.22\|4810202\|27\|NC_013406\|CRT	4810202-4810228	27	MN693869	Marine virus AFVG_250M793, complete genome	19301-19327	2	0.926
NC_013406_3	3.22\|4810202\|27\|NC_013406\|CRT	4810202-4810228	27	KY000079	Acinetobacter phage AM24, complete genome	50989-51015	2	0.926
NC_013406_3	3.23\|4810247\|27\|NC_013406\|CRT	4810247-4810273	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	131083-131109	2	0.926
NC_013406_3	3.23\|4810247\|27\|NC_013406\|CRT	4810247-4810273	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	251985-252011	2	0.926
NC_013406_3	3.23\|4810247\|27\|NC_013406\|CRT	4810247-4810273	27	NZ_CP014284	Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence	178944-178970	2	0.926
NC_013406_3	3.23\|4810247\|27\|NC_013406\|CRT	4810247-4810273	27	NZ_CP032609	Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence	270845-270871	2	0.926
NC_013406_3	3.23\|4810247\|27\|NC_013406\|CRT	4810247-4810273	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68782-68808	2	0.926
NC_013406_3	3.23\|4810247\|27\|NC_013406\|CRT	4810247-4810273	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68791-68817	2	0.926
NC_013406_3	3.23\|4810247\|27\|NC_013406\|CRT	4810247-4810273	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68800-68826	2	0.926
NC_013406_3	3.23\|4810247\|27\|NC_013406\|CRT	4810247-4810273	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68809-68835	2	0.926
NC_013406_3	3.23\|4810247\|27\|NC_013406\|CRT	4810247-4810273	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68818-68844	2	0.926
NC_013406_3	3.23\|4810247\|27\|NC_013406\|CRT	4810247-4810273	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68827-68853	2	0.926
NC_013406_3	3.23\|4810247\|27\|NC_013406\|CRT	4810247-4810273	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68836-68862	2	0.926
NC_013406_3	3.23\|4810247\|27\|NC_013406\|CRT	4810247-4810273	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68845-68871	2	0.926
NC_013406_3	3.23\|4810247\|27\|NC_013406\|CRT	4810247-4810273	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68854-68880	2	0.926
NC_013406_3	3.23\|4810247\|27\|NC_013406\|CRT	4810247-4810273	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68863-68889	2	0.926
NC_013406_3	3.23\|4810247\|27\|NC_013406\|CRT	4810247-4810273	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68917-68943	2	0.926
NC_013406_3	3.23\|4810247\|27\|NC_013406\|CRT	4810247-4810273	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90222-90248	2	0.926
NC_013406_3	3.23\|4810247\|27\|NC_013406\|CRT	4810247-4810273	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90231-90257	2	0.926
NC_013406_3	3.23\|4810247\|27\|NC_013406\|CRT	4810247-4810273	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90240-90266	2	0.926
NC_013406_3	3.23\|4810247\|27\|NC_013406\|CRT	4810247-4810273	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90249-90275	2	0.926
NC_013406_3	3.23\|4810247\|27\|NC_013406\|CRT	4810247-4810273	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90258-90284	2	0.926
NC_013406_3	3.23\|4810247\|27\|NC_013406\|CRT	4810247-4810273	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90267-90293	2	0.926
NC_013406_3	3.23\|4810247\|27\|NC_013406\|CRT	4810247-4810273	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130584-130610	2	0.926
NC_013406_3	3.23\|4810247\|27\|NC_013406\|CRT	4810247-4810273	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130593-130619	2	0.926
NC_013406_3	3.23\|4810247\|27\|NC_013406\|CRT	4810247-4810273	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130665-130691	2	0.926
NC_013406_3	3.23\|4810247\|27\|NC_013406\|CRT	4810247-4810273	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130674-130700	2	0.926
NC_013406_3	3.23\|4810247\|27\|NC_013406\|CRT	4810247-4810273	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130683-130709	2	0.926
NC_013406_3	3.23\|4810247\|27\|NC_013406\|CRT	4810247-4810273	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130692-130718	2	0.926
NC_013406_3	3.23\|4810247\|27\|NC_013406\|CRT	4810247-4810273	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130701-130727	2	0.926
NC_013406_3	3.23\|4810247\|27\|NC_013406\|CRT	4810247-4810273	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130710-130736	2	0.926
NC_013406_3	3.23\|4810247\|27\|NC_013406\|CRT	4810247-4810273	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130719-130745	2	0.926
NC_013406_3	3.23\|4810247\|27\|NC_013406\|CRT	4810247-4810273	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130728-130754	2	0.926
NC_013406_3	3.23\|4810247\|27\|NC_013406\|CRT	4810247-4810273	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130746-130772	2	0.926
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71167-71193	2	0.926
NC_013406_3	3.69\|4812585\|27\|NC_013406\|CRT	4812585-4812611	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321873-321899	2	0.926
NC_013406_3	3.69\|4812585\|27\|NC_013406\|CRT	4812585-4812611	27	NZ_CP014284	Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence	178908-178934	2	0.926
NC_013406_3	3.69\|4812585\|27\|NC_013406\|CRT	4812585-4812611	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	148-174	2	0.926
NC_013406_3	3.69\|4812585\|27\|NC_013406\|CRT	4812585-4812611	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	247-273	2	0.926
NC_013406_3	3.69\|4812585\|27\|NC_013406\|CRT	4812585-4812611	27	NZ_CP032609	Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence	270809-270835	2	0.926
NC_013406_3	3.69\|4812585\|27\|NC_013406\|CRT	4812585-4812611	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71176-71202	2	0.926
NC_013406_3	3.73\|4812810\|36\|NC_013406\|CRT	4812810-4812845	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73984-74019	2	0.944
NC_013406_3	3.93\|4814162\|27\|NC_013406\|CRT	4814162-4814188	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	251967-251993	2	0.926
NC_013406_3	3.93\|4814162\|27\|NC_013406\|CRT	4814162-4814188	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71176-71202	2	0.926
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	131092-131118	3	0.889
NC_013406_3	3.22\|4810202\|27\|NC_013406\|CRT	4810202-4810228	27	MN694697	Marine virus AFVG_250M792, complete genome	19467-19493	3	0.889
NC_013406_3	3.22\|4810202\|27\|NC_013406\|CRT	4810202-4810228	27	NC_027332	Acinetobacter phage YMC13/03/R2096, complete genome	43424-43450	3	0.889
NC_013406_3	3.22\|4810202\|27\|NC_013406\|CRT	4810202-4810228	27	MN694312	Marine virus AFVG_250M269, complete genome	21492-21518	3	0.889
NC_013406_3	3.23\|4810247\|27\|NC_013406\|CRT	4810247-4810273	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	131074-131100	3	0.889
NC_013406_3	3.23\|4810247\|27\|NC_013406\|CRT	4810247-4810273	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	72414-72440	3	0.889
NC_013406_3	3.23\|4810247\|27\|NC_013406\|CRT	4810247-4810273	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73975-74001	3	0.889
NC_013406_3	3.23\|4810247\|27\|NC_013406\|CRT	4810247-4810273	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90276-90302	3	0.889
NC_013406_3	3.23\|4810247\|27\|NC_013406\|CRT	4810247-4810273	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130602-130628	3	0.889
NC_013406_3	3.23\|4810247\|27\|NC_013406\|CRT	4810247-4810273	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	72486-72512	3	0.889
NC_013406_3	3.23\|4810247\|27\|NC_013406\|CRT	4810247-4810273	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130656-130682	3	0.889
NC_013406_3	3.23\|4810247\|27\|NC_013406\|CRT	4810247-4810273	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	139-165	3	0.889
NC_013406_3	3.23\|4810247\|27\|NC_013406\|CRT	4810247-4810273	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	238-264	3	0.889
NC_013406_3	3.23\|4810247\|27\|NC_013406\|CRT	4810247-4810273	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	364-390	3	0.889
NC_013406_3	3.23\|4810247\|27\|NC_013406\|CRT	4810247-4810273	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	409-435	3	0.889
NC_013406_3	3.23\|4810247\|27\|NC_013406\|CRT	4810247-4810273	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321738-321764	3	0.889
NC_013406_3	3.23\|4810247\|27\|NC_013406\|CRT	4810247-4810273	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321783-321809	3	0.889
NC_013406_3	3.23\|4810247\|27\|NC_013406\|CRT	4810247-4810273	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321882-321908	3	0.889
NC_013406_3	3.23\|4810247\|27\|NC_013406\|CRT	4810247-4810273	27	NZ_CP024167	Salmonella enterica subsp. enterica serovar Gaminara strain CFSAN070644 plasmid pCFSAN024441_02, complete sequence	15804-15830	3	0.889
NC_013406_3	3.23\|4810247\|27\|NC_013406\|CRT	4810247-4810273	27	NZ_CP024167	Salmonella enterica subsp. enterica serovar Gaminara strain CFSAN070644 plasmid pCFSAN024441_02, complete sequence	15786-15812	3	0.889
NC_013406_3	3.23\|4810247\|27\|NC_013406\|CRT	4810247-4810273	27	NZ_CP024167	Salmonella enterica subsp. enterica serovar Gaminara strain CFSAN070644 plasmid pCFSAN024441_02, complete sequence	15795-15821	3	0.889
NC_013406_3	3.23\|4810247\|27\|NC_013406\|CRT	4810247-4810273	27	MN693798	Marine virus AFVG_250M119, complete genome	11469-11495	3	0.889
NC_013406_3	3.36\|4810841\|45\|NC_013406\|CRT	4810841-4810885	45	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130611-130655	3	0.933
NC_013406_3	3.49\|4811577\|27\|NC_013406\|CRT	4811577-4811603	27	NZ_CP014284	Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence	178908-178934	3	0.889
NC_013406_3	3.49\|4811577\|27\|NC_013406\|CRT	4811577-4811603	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	148-174	3	0.889
NC_013406_3	3.49\|4811577\|27\|NC_013406\|CRT	4811577-4811603	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	247-273	3	0.889
NC_013406_3	3.49\|4811577\|27\|NC_013406\|CRT	4811577-4811603	27	NZ_CP032609	Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence	270809-270835	3	0.889
NC_013406_3	3.49\|4811577\|27\|NC_013406\|CRT	4811577-4811603	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321873-321899	3	0.889
NC_013406_3	3.49\|4811577\|27\|NC_013406\|CRT	4811577-4811603	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71176-71202	3	0.889
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	72735-72761	3	0.889
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130602-130628	3	0.889
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	103-129	3	0.889
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	175-201	3	0.889
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	202-228	3	0.889
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	274-300	3	0.889
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	301-327	3	0.889
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	328-354	3	0.889
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321819-321845	3	0.889
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321846-321872	3	0.889
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321918-321944	3	0.889
NC_013406_3	3.58\|4812081\|27\|NC_013406\|CRT	4812081-4812107	27	NZ_CP014284	Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence	178908-178934	3	0.889
NC_013406_3	3.58\|4812081\|27\|NC_013406\|CRT	4812081-4812107	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	148-174	3	0.889
NC_013406_3	3.58\|4812081\|27\|NC_013406\|CRT	4812081-4812107	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	247-273	3	0.889
NC_013406_3	3.58\|4812081\|27\|NC_013406\|CRT	4812081-4812107	27	NZ_CP032609	Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence	270809-270835	3	0.889
NC_013406_3	3.58\|4812081\|27\|NC_013406\|CRT	4812081-4812107	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321873-321899	3	0.889
NC_013406_3	3.58\|4812081\|27\|NC_013406\|CRT	4812081-4812107	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71176-71202	3	0.889
NC_013406_3	3.61\|4812198\|27\|NC_013406\|CRT	4812198-4812224	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71257-71283	3	0.889
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71212-71238	3	0.889
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73750-73776	3	0.889
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	251886-251912	3	0.889
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	251931-251957	3	0.889
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	251967-251993	3	0.889
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	252003-252029	3	0.889
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	454-480	3	0.889
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321693-321719	3	0.889
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	72735-72761	3	0.889
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130602-130628	3	0.889
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	103-129	3	0.889
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	175-201	3	0.889
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	202-228	3	0.889
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	274-300	3	0.889
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	301-327	3	0.889
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	328-354	3	0.889
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321819-321845	3	0.889
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321846-321872	3	0.889
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321918-321944	3	0.889
NC_013406_3	3.69\|4812585\|27\|NC_013406\|CRT	4812585-4812611	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71356-71382	3	0.889
NC_013406_3	3.90\|4814018\|27\|NC_013406\|CRT	4814018-4814044	27	NZ_CP014284	Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence	178908-178934	3	0.889
NC_013406_3	3.90\|4814018\|27\|NC_013406\|CRT	4814018-4814044	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	148-174	3	0.889
NC_013406_3	3.90\|4814018\|27\|NC_013406\|CRT	4814018-4814044	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	247-273	3	0.889
NC_013406_3	3.90\|4814018\|27\|NC_013406\|CRT	4814018-4814044	27	NZ_CP032609	Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence	270809-270835	3	0.889
NC_013406_3	3.90\|4814018\|27\|NC_013406\|CRT	4814018-4814044	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321873-321899	3	0.889
NC_013406_3	3.90\|4814018\|27\|NC_013406\|CRT	4814018-4814044	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71176-71202	3	0.889
NC_013406_3	3.93\|4814162\|27\|NC_013406\|CRT	4814162-4814188	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	328-354	3	0.889
NC_013406_3	3.93\|4814162\|27\|NC_013406\|CRT	4814162-4814188	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321819-321845	3	0.889
NC_013406_3	3.95\|4814243\|27\|NC_013406\|CRT	4814243-4814269	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71347-71373	3	0.889
NC_013406_3	3.106\|4814729\|27\|NC_013406\|CRT	4814729-4814755	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71158-71184	3	0.889
NC_013406_3	3.106\|4814729\|27\|NC_013406\|CRT	4814729-4814755	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73732-73758	3	0.889
NC_013406_3	3.106\|4814729\|27\|NC_013406\|CRT	4814729-4814755	27	MG209611	Aphanizomenon phage vB_AphaS-CL131, complete genome	32387-32413	3	0.889
NC_013406_3	3.106\|4814729\|27\|NC_013406\|CRT	4814729-4814755	27	KY421186	Flavobacterium phage FL-1, complete genome	26864-26890	3	0.889
NC_013406_3	3.119\|4815485\|27\|NC_013406\|CRT	4815485-4815511	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	133961-133987	3	0.889
NC_013406_3	3.122\|4815620\|27\|NC_013406\|CRT	4815620-4815646	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	85-111	3	0.889
NC_013406_3	3.122\|4815620\|27\|NC_013406\|CRT	4815620-4815646	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321936-321962	3	0.889
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	131083-131109	4	0.852
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	NC_018511	Bacillus thuringiensis HD-789 plasmid pBTHD789-5, complete sequence	1110-1136	4	0.852
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321792-321818	4	0.852
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321900-321926	4	0.852
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	NZ_CP009345	Bacillus thuringiensis HD1002 plasmid 6, complete sequence	2215-2241	4	0.852
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	121-147	4	0.852
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	220-246	4	0.852
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	355-381	4	0.852
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	NC_001446	Bacillus thuringiensis sv israelensis HI4 plasmid pTX14-3, complete sequence	3499-3525	4	0.852
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68872-68898	4	0.852
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68935-68961	4	0.852
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68782-68808	4	0.852
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68791-68817	4	0.852
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68800-68826	4	0.852
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68809-68835	4	0.852
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68818-68844	4	0.852
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68827-68853	4	0.852
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68836-68862	4	0.852
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68845-68871	4	0.852
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68854-68880	4	0.852
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68863-68889	4	0.852
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68926-68952	4	0.852
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71194-71220	4	0.852
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71374-71400	4	0.852
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90222-90248	4	0.852
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90231-90257	4	0.852
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90240-90266	4	0.852
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90249-90275	4	0.852
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90258-90284	4	0.852
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90267-90293	4	0.852
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130575-130601	4	0.852
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130584-130610	4	0.852
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130593-130619	4	0.852
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130602-130628	4	0.852
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130665-130691	4	0.852
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130674-130700	4	0.852
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130683-130709	4	0.852
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130692-130718	4	0.852
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130701-130727	4	0.852
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130710-130736	4	0.852
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130719-130745	4	0.852
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130728-130754	4	0.852
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130755-130781	4	0.852
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71167-71193	4	0.852
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	MN693798	Marine virus AFVG_250M119, complete genome	11469-11495	4	0.852
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	AP013524	Uncultured Mediterranean phage uvMED DNA, complete genome, group G3, isolate: uvMED-CGR-C7-MedDCM-OCT-S39-C15	37335-37361	4	0.852
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	NC_027332	Acinetobacter phage YMC13/03/R2096, complete genome	43424-43450	4	0.852
NC_013406_3	3.23\|4810247\|27\|NC_013406\|CRT	4810247-4810273	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71557-71583	4	0.852
NC_013406_3	3.23\|4810247\|27\|NC_013406\|CRT	4810247-4810273	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68773-68799	4	0.852
NC_013406_3	3.23\|4810247\|27\|NC_013406\|CRT	4810247-4810273	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68872-68898	4	0.852
NC_013406_3	3.23\|4810247\|27\|NC_013406\|CRT	4810247-4810273	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68935-68961	4	0.852
NC_013406_3	3.23\|4810247\|27\|NC_013406\|CRT	4810247-4810273	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130629-130655	4	0.852
NC_013406_3	3.23\|4810247\|27\|NC_013406\|CRT	4810247-4810273	27	NZ_CP053689	Arthrobacter citreus strain NEB 577 plasmid unnamed1, complete sequence	173365-173391	4	0.852
NC_013406_3	3.23\|4810247\|27\|NC_013406\|CRT	4810247-4810273	27	MF140423	Arthrobacter phage Nightmare, complete genome	2043-2069	4	0.852
NC_013406_3	3.23\|4810247\|27\|NC_013406\|CRT	4810247-4810273	27	KY421186	Flavobacterium phage FL-1, complete genome	26630-26656	4	0.852
NC_013406_3	3.23\|4810247\|27\|NC_013406\|CRT	4810247-4810273	27	KY421186	Flavobacterium phage FL-1, complete genome	26756-26782	4	0.852
NC_013406_3	3.25\|4810328\|27\|NC_013406\|CRT	4810328-4810354	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71257-71283	4	0.852
NC_013406_3	3.36\|4810841\|45\|NC_013406\|CRT	4810841-4810885	45	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130638-130682	4	0.911
NC_013406_3	3.37\|4810904\|36\|NC_013406\|CRT	4810904-4810939	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73993-74028	4	0.889
NC_013406_3	3.38\|4810958\|36\|NC_013406\|CRT	4810958-4810993	36	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321891-321926	4	0.889
NC_013406_3	3.38\|4810958\|36\|NC_013406\|CRT	4810958-4810993	36	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	121-156	4	0.889
NC_013406_3	3.38\|4810958\|36\|NC_013406\|CRT	4810958-4810993	36	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	220-255	4	0.889
NC_013406_3	3.49\|4811577\|27\|NC_013406\|CRT	4811577-4811603	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71356-71382	4	0.852
NC_013406_3	3.49\|4811577\|27\|NC_013406\|CRT	4811577-4811603	27	NZ_CP053933	Bacillus thuringiensis strain FDAARGOS_794 plasmid unnamed2, complete sequence	41414-41440	4	0.852
NC_013406_3	3.49\|4811577\|27\|NC_013406\|CRT	4811577-4811603	27	NZ_CP053936	Bacillus thuringiensis strain FDAARGOS_794 plasmid unnamed4, complete sequence	11740-11766	4	0.852
NC_013406_3	3.49\|4811577\|27\|NC_013406\|CRT	4811577-4811603	27	NZ_CP009718	Bacillus thuringiensis strain HD682 plasmid pBGN_2, complete sequence	15406-15432	4	0.852
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68782-68808	4	0.852
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68791-68817	4	0.852
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68800-68826	4	0.852
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68809-68835	4	0.852
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68818-68844	4	0.852
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68827-68853	4	0.852
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68836-68862	4	0.852
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68845-68871	4	0.852
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68854-68880	4	0.852
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68863-68889	4	0.852
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68908-68934	4	0.852
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73651-73677	4	0.852
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73732-73758	4	0.852
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90222-90248	4	0.852
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90231-90257	4	0.852
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90240-90266	4	0.852
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90249-90275	4	0.852
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90258-90284	4	0.852
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90267-90293	4	0.852
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90276-90302	4	0.852
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130584-130610	4	0.852
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130593-130619	4	0.852
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130629-130655	4	0.852
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130665-130691	4	0.852
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130674-130700	4	0.852
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130683-130709	4	0.852
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130692-130718	4	0.852
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130701-130727	4	0.852
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130710-130736	4	0.852
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130719-130745	4	0.852
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130728-130754	4	0.852
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130737-130763	4	0.852
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130764-130790	4	0.852
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130773-130799	4	0.852
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	130-156	4	0.852
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	148-174	4	0.852
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	229-255	4	0.852
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	247-273	4	0.852
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	337-363	4	0.852
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	364-390	4	0.852
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	400-426	4	0.852
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321747-321773	4	0.852
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321783-321809	4	0.852
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321810-321836	4	0.852
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321873-321899	4	0.852
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321891-321917	4	0.852
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	MN693798	Marine virus AFVG_250M119, complete genome	11469-11495	4	0.852
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	131083-131109	4	0.852
NC_013406_3	3.58\|4812081\|27\|NC_013406\|CRT	4812081-4812107	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71356-71382	4	0.852
NC_013406_3	3.58\|4812081\|27\|NC_013406\|CRT	4812081-4812107	27	NZ_CP053933	Bacillus thuringiensis strain FDAARGOS_794 plasmid unnamed2, complete sequence	41414-41440	4	0.852
NC_013406_3	3.58\|4812081\|27\|NC_013406\|CRT	4812081-4812107	27	NZ_CP053936	Bacillus thuringiensis strain FDAARGOS_794 plasmid unnamed4, complete sequence	11740-11766	4	0.852
NC_013406_3	3.58\|4812081\|27\|NC_013406\|CRT	4812081-4812107	27	NZ_CP009718	Bacillus thuringiensis strain HD682 plasmid pBGN_2, complete sequence	15406-15432	4	0.852
NC_013406_3	3.61\|4812198\|27\|NC_013406\|CRT	4812198-4812224	27	MN693968	Marine virus AFVG_250M909, complete genome	17701-17727	4	0.852
NC_013406_3	3.61\|4812198\|27\|NC_013406\|CRT	4812198-4812224	27	GU323708	Lactobacillus phage phiPYB5, complete genome	19246-19272	4	0.852
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68872-68898	4	0.852
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68935-68961	4	0.852
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68782-68808	4	0.852
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68791-68817	4	0.852
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68800-68826	4	0.852
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68809-68835	4	0.852
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68818-68844	4	0.852
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68827-68853	4	0.852
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68836-68862	4	0.852
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68845-68871	4	0.852
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68854-68880	4	0.852
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68863-68889	4	0.852
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68917-68943	4	0.852
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68926-68952	4	0.852
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71539-71565	4	0.852
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	72753-72779	4	0.852
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73912-73938	4	0.852
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73975-74001	4	0.852
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90222-90248	4	0.852
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90231-90257	4	0.852
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90240-90266	4	0.852
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90249-90275	4	0.852
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90258-90284	4	0.852
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90267-90293	4	0.852
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130575-130601	4	0.852
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130584-130610	4	0.852
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130593-130619	4	0.852
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130602-130628	4	0.852
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130665-130691	4	0.852
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130674-130700	4	0.852
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130683-130709	4	0.852
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130692-130718	4	0.852
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130701-130727	4	0.852
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130710-130736	4	0.852
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130719-130745	4	0.852
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130728-130754	4	0.852
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130746-130772	4	0.852
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130755-130781	4	0.852
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	251895-251921	4	0.852
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	251922-251948	4	0.852
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	251958-251984	4	0.852
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	251985-252011	4	0.852
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	121-147	4	0.852
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	220-246	4	0.852
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	355-381	4	0.852
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321792-321818	4	0.852
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321900-321926	4	0.852
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	MK962638	Achromobacter phage vB_AxyP_19-32_Axy21, complete genome	14666-14692	4	0.852
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	NC_047890	Escherichia phage PGT2, complete genome	23171-23197	4	0.852
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	JN882298	Escherichia phage phiKT, complete genome	18563-18589	4	0.852
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	131083-131109	4	0.852
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	MN693798	Marine virus AFVG_250M119, complete genome	11469-11495	4	0.852
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	KY421186	Flavobacterium phage FL-1, complete genome	26630-26656	4	0.852
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	KY421186	Flavobacterium phage FL-1, complete genome	26729-26755	4	0.852
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	KY421186	Flavobacterium phage FL-1, complete genome	26756-26782	4	0.852
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	KY421186	Flavobacterium phage FL-1, complete genome	26792-26818	4	0.852
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	KY421186	Flavobacterium phage FL-1, complete genome	26882-26908	4	0.852
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68782-68808	4	0.852
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68791-68817	4	0.852
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68800-68826	4	0.852
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68809-68835	4	0.852
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68818-68844	4	0.852
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68827-68853	4	0.852
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68836-68862	4	0.852
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68845-68871	4	0.852
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68854-68880	4	0.852
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68863-68889	4	0.852
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68908-68934	4	0.852
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73651-73677	4	0.852
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73732-73758	4	0.852
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90222-90248	4	0.852
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90231-90257	4	0.852
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90240-90266	4	0.852
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90249-90275	4	0.852
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90258-90284	4	0.852
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90267-90293	4	0.852
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90276-90302	4	0.852
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130584-130610	4	0.852
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130593-130619	4	0.852
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130629-130655	4	0.852
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130665-130691	4	0.852
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130674-130700	4	0.852
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130683-130709	4	0.852
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130692-130718	4	0.852
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130701-130727	4	0.852
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130710-130736	4	0.852
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130719-130745	4	0.852
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130728-130754	4	0.852
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130737-130763	4	0.852
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130764-130790	4	0.852
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130773-130799	4	0.852
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	130-156	4	0.852
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	148-174	4	0.852
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	229-255	4	0.852
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	247-273	4	0.852
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	337-363	4	0.852
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	364-390	4	0.852
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	400-426	4	0.852
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321747-321773	4	0.852
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321783-321809	4	0.852
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321810-321836	4	0.852
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321873-321899	4	0.852
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321891-321917	4	0.852
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	MN693798	Marine virus AFVG_250M119, complete genome	11469-11495	4	0.852
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	131083-131109	4	0.852
NC_013406_3	3.69\|4812585\|27\|NC_013406\|CRT	4812585-4812611	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321729-321755	4	0.852
NC_013406_3	3.69\|4812585\|27\|NC_013406\|CRT	4812585-4812611	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321819-321845	4	0.852
NC_013406_3	3.69\|4812585\|27\|NC_013406\|CRT	4812585-4812611	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321828-321854	4	0.852
NC_013406_3	3.69\|4812585\|27\|NC_013406\|CRT	4812585-4812611	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321855-321881	4	0.852
NC_013406_3	3.69\|4812585\|27\|NC_013406\|CRT	4812585-4812611	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	166-192	4	0.852
NC_013406_3	3.69\|4812585\|27\|NC_013406\|CRT	4812585-4812611	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	193-219	4	0.852
NC_013406_3	3.69\|4812585\|27\|NC_013406\|CRT	4812585-4812611	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	265-291	4	0.852
NC_013406_3	3.69\|4812585\|27\|NC_013406\|CRT	4812585-4812611	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	292-318	4	0.852
NC_013406_3	3.69\|4812585\|27\|NC_013406\|CRT	4812585-4812611	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	319-345	4	0.852
NC_013406_3	3.69\|4812585\|27\|NC_013406\|CRT	4812585-4812611	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	328-354	4	0.852
NC_013406_3	3.69\|4812585\|27\|NC_013406\|CRT	4812585-4812611	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	418-444	4	0.852
NC_013406_3	3.69\|4812585\|27\|NC_013406\|CRT	4812585-4812611	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73759-73785	4	0.852
NC_013406_3	3.69\|4812585\|27\|NC_013406\|CRT	4812585-4812611	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	72735-72761	4	0.852
NC_013406_3	3.69\|4812585\|27\|NC_013406\|CRT	4812585-4812611	27	NZ_CP004877	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence	163678-163704	4	0.852
NC_013406_3	3.69\|4812585\|27\|NC_013406\|CRT	4812585-4812611	27	NZ_CP053936	Bacillus thuringiensis strain FDAARGOS_794 plasmid unnamed4, complete sequence	11740-11766	4	0.852
NC_013406_3	3.69\|4812585\|27\|NC_013406\|CRT	4812585-4812611	27	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	576815-576841	4	0.852
NC_013406_3	3.69\|4812585\|27\|NC_013406\|CRT	4812585-4812611	27	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	213690-213716	4	0.852
NC_013406_3	3.69\|4812585\|27\|NC_013406\|CRT	4812585-4812611	27	NZ_CP004860	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence	183471-183497	4	0.852
NC_013406_3	3.69\|4812585\|27\|NC_013406\|CRT	4812585-4812611	27	NZ_CP053933	Bacillus thuringiensis strain FDAARGOS_794 plasmid unnamed2, complete sequence	41414-41440	4	0.852
NC_013406_3	3.69\|4812585\|27\|NC_013406\|CRT	4812585-4812611	27	NZ_CP007616	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence	194957-194983	4	0.852
NC_013406_3	3.69\|4812585\|27\|NC_013406\|CRT	4812585-4812611	27	NZ_CP009718	Bacillus thuringiensis strain HD682 plasmid pBGN_2, complete sequence	15406-15432	4	0.852
NC_013406_3	3.73\|4812810\|36\|NC_013406\|CRT	4812810-4812845	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68782-68817	4	0.889
NC_013406_3	3.73\|4812810\|36\|NC_013406\|CRT	4812810-4812845	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68791-68826	4	0.889
NC_013406_3	3.73\|4812810\|36\|NC_013406\|CRT	4812810-4812845	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68800-68835	4	0.889
NC_013406_3	3.73\|4812810\|36\|NC_013406\|CRT	4812810-4812845	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68809-68844	4	0.889
NC_013406_3	3.73\|4812810\|36\|NC_013406\|CRT	4812810-4812845	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68818-68853	4	0.889
NC_013406_3	3.73\|4812810\|36\|NC_013406\|CRT	4812810-4812845	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68827-68862	4	0.889
NC_013406_3	3.73\|4812810\|36\|NC_013406\|CRT	4812810-4812845	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68836-68871	4	0.889
NC_013406_3	3.73\|4812810\|36\|NC_013406\|CRT	4812810-4812845	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68845-68880	4	0.889
NC_013406_3	3.73\|4812810\|36\|NC_013406\|CRT	4812810-4812845	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68854-68889	4	0.889
NC_013406_3	3.73\|4812810\|36\|NC_013406\|CRT	4812810-4812845	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90222-90257	4	0.889
NC_013406_3	3.73\|4812810\|36\|NC_013406\|CRT	4812810-4812845	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90231-90266	4	0.889
NC_013406_3	3.73\|4812810\|36\|NC_013406\|CRT	4812810-4812845	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90240-90275	4	0.889
NC_013406_3	3.73\|4812810\|36\|NC_013406\|CRT	4812810-4812845	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90249-90284	4	0.889
NC_013406_3	3.73\|4812810\|36\|NC_013406\|CRT	4812810-4812845	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90258-90293	4	0.889
NC_013406_3	3.73\|4812810\|36\|NC_013406\|CRT	4812810-4812845	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130584-130619	4	0.889
NC_013406_3	3.73\|4812810\|36\|NC_013406\|CRT	4812810-4812845	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130593-130628	4	0.889
NC_013406_3	3.73\|4812810\|36\|NC_013406\|CRT	4812810-4812845	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130665-130700	4	0.889
NC_013406_3	3.73\|4812810\|36\|NC_013406\|CRT	4812810-4812845	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130674-130709	4	0.889
NC_013406_3	3.73\|4812810\|36\|NC_013406\|CRT	4812810-4812845	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130683-130718	4	0.889
NC_013406_3	3.73\|4812810\|36\|NC_013406\|CRT	4812810-4812845	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130692-130727	4	0.889
NC_013406_3	3.73\|4812810\|36\|NC_013406\|CRT	4812810-4812845	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130701-130736	4	0.889
NC_013406_3	3.73\|4812810\|36\|NC_013406\|CRT	4812810-4812845	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130710-130745	4	0.889
NC_013406_3	3.73\|4812810\|36\|NC_013406\|CRT	4812810-4812845	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130719-130754	4	0.889
NC_013406_3	3.73\|4812810\|36\|NC_013406\|CRT	4812810-4812845	36	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	103-138	4	0.889
NC_013406_3	3.73\|4812810\|36\|NC_013406\|CRT	4812810-4812845	36	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	175-210	4	0.889
NC_013406_3	3.73\|4812810\|36\|NC_013406\|CRT	4812810-4812845	36	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	202-237	4	0.889
NC_013406_3	3.73\|4812810\|36\|NC_013406\|CRT	4812810-4812845	36	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	274-309	4	0.889
NC_013406_3	3.73\|4812810\|36\|NC_013406\|CRT	4812810-4812845	36	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	301-336	4	0.889
NC_013406_3	3.73\|4812810\|36\|NC_013406\|CRT	4812810-4812845	36	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321837-321872	4	0.889
NC_013406_3	3.73\|4812810\|36\|NC_013406\|CRT	4812810-4812845	36	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321909-321944	4	0.889
NC_013406_3	3.90\|4814018\|27\|NC_013406\|CRT	4814018-4814044	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71356-71382	4	0.852
NC_013406_3	3.90\|4814018\|27\|NC_013406\|CRT	4814018-4814044	27	NZ_CP053933	Bacillus thuringiensis strain FDAARGOS_794 plasmid unnamed2, complete sequence	41414-41440	4	0.852
NC_013406_3	3.90\|4814018\|27\|NC_013406\|CRT	4814018-4814044	27	NZ_CP053936	Bacillus thuringiensis strain FDAARGOS_794 plasmid unnamed4, complete sequence	11740-11766	4	0.852
NC_013406_3	3.90\|4814018\|27\|NC_013406\|CRT	4814018-4814044	27	NZ_CP009718	Bacillus thuringiensis strain HD682 plasmid pBGN_2, complete sequence	15406-15432	4	0.852
NC_013406_3	3.91\|4814063\|36\|NC_013406\|CRT	4814063-4814098	36	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	251976-252011	4	0.889
NC_013406_3	3.93\|4814162\|27\|NC_013406\|CRT	4814162-4814188	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71266-71292	4	0.852
NC_013406_3	3.93\|4814162\|27\|NC_013406\|CRT	4814162-4814188	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71356-71382	4	0.852
NC_013406_3	3.93\|4814162\|27\|NC_013406\|CRT	4814162-4814188	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	72735-72761	4	0.852
NC_013406_3	3.93\|4814162\|27\|NC_013406\|CRT	4814162-4814188	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130656-130682	4	0.852
NC_013406_3	3.93\|4814162\|27\|NC_013406\|CRT	4814162-4814188	27	NC_015057	Granulicella tundricola MP5ACTX9 plasmid pACIX901, complete sequence	28058-28084	4	0.852
NC_013406_3	3.93\|4814162\|27\|NC_013406\|CRT	4814162-4814188	27	KX856662	Klebsiella phage KP-Rio/2015, complete genome	15807-15833	4	0.852
NC_013406_3	3.93\|4814162\|27\|NC_013406\|CRT	4814162-4814188	27	NZ_CP014284	Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence	179115-179141	4	0.852
NC_013406_3	3.93\|4814162\|27\|NC_013406\|CRT	4814162-4814188	27	NZ_CP032609	Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence	271016-271042	4	0.852
NC_013406_3	3.93\|4814162\|27\|NC_013406\|CRT	4814162-4814188	27	MT090077	Klebsiella phage CX1, complete genome	16247-16273	4	0.852
NC_013406_3	3.93\|4814162\|27\|NC_013406\|CRT	4814162-4814188	27	KF437907	Phormidium phage MIS-PhV1A, complete genome	8755-8781	4	0.852
NC_013406_3	3.95\|4814243\|27\|NC_013406\|CRT	4814243-4814269	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71530-71556	4	0.852
NC_013406_3	3.95\|4814243\|27\|NC_013406\|CRT	4814243-4814269	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73795-73821	4	0.852
NC_013406_3	3.105\|4814684\|27\|NC_013406\|CRT	4814684-4814710	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73966-73992	4	0.852
NC_013406_3	3.105\|4814684\|27\|NC_013406\|CRT	4814684-4814710	27	NC_019515	Bacillus phage BCD7, complete genome	58756-58782	4	0.852
NC_013406_3	3.106\|4814729\|27\|NC_013406\|CRT	4814729-4814755	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73597-73623	4	0.852
NC_013406_3	3.106\|4814729\|27\|NC_013406\|CRT	4814729-4814755	27	MG209611	Aphanizomenon phage vB_AphaS-CL131, complete genome	32378-32404	4	0.852
NC_013406_3	3.106\|4814729\|27\|NC_013406\|CRT	4814729-4814755	27	KY421186	Flavobacterium phage FL-1, complete genome	26693-26719	4	0.852
NC_013406_3	3.106\|4814729\|27\|NC_013406\|CRT	4814729-4814755	27	NZ_CP004875	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB95, complete sequence	76530-76556	4	0.852
NC_013406_3	3.106\|4814729\|27\|NC_013406\|CRT	4814729-4814755	27	NC_014025	Bacillus megaterium QM B1551 plasmid pBM500, complete sequence	52508-52534	4	0.852
NC_013406_3	3.106\|4814729\|27\|NC_013406\|CRT	4814729-4814755	27	NC_014025	Bacillus megaterium QM B1551 plasmid pBM500, complete sequence	52742-52768	4	0.852
NC_013406_3	3.106\|4814729\|27\|NC_013406\|CRT	4814729-4814755	27	NZ_CP019235	Bacillus thuringiensis strain YGd22-03 plasmid pYGD98, complete sequence	79847-79873	4	0.852
NC_013406_3	3.106\|4814729\|27\|NC_013406\|CRT	4814729-4814755	27	NZ_CP011357	Bacillus thuringiensis strain YC-10 plasmid pYC20, complete sequence	8166-8192	4	0.852
NC_013406_3	3.106\|4814729\|27\|NC_013406\|CRT	4814729-4814755	27	NZ_CP015155	Bacillus thuringiensis strain Bc601 plasmid pBTBC5, complete sequence	22785-22811	4	0.852
NC_013406_3	3.106\|4814729\|27\|NC_013406\|CRT	4814729-4814755	27	NZ_CP015156	Bacillus thuringiensis strain Bc601 plasmid pBTBC6, complete sequence	88687-88713	4	0.852
NC_013406_3	3.106\|4814729\|27\|NC_013406\|CRT	4814729-4814755	27	NZ_CP011358	Bacillus thuringiensis strain YC-10 plasmid pYC2226, complete sequence	20331-20357	4	0.852
NC_013406_3	3.106\|4814729\|27\|NC_013406\|CRT	4814729-4814755	27	NZ_CP013057	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-2, complete sequence	17317-17343	4	0.852
NC_013406_3	3.106\|4814729\|27\|NC_013406\|CRT	4814729-4814755	27	NZ_CP013058	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-3, complete sequence	81185-81211	4	0.852
NC_013406_3	3.106\|4814729\|27\|NC_013406\|CRT	4814729-4814755	27	KM974184	Pseudomonas phage YH6, complete genome	27590-27616	4	0.852
NC_013406_3	3.106\|4814729\|27\|NC_013406\|CRT	4814729-4814755	27	NZ_CP021356	Rhodococcus sp. S2-17 plasmid pRB29, complete sequence	58286-58312	4	0.852
NC_013406_3	3.106\|4814729\|27\|NC_013406\|CRT	4814729-4814755	27	NZ_CP046575	Rhodococcus sp. WAY2 plasmid pRWAY03, complete sequence	30740-30766	4	0.852
NC_013406_3	3.106\|4814729\|27\|NC_013406\|CRT	4814729-4814755	27	KT381879	Caulobacter phage Percy, complete genome	39740-39766	4	0.852
NC_013406_3	3.109\|4814873\|27\|NC_013406\|CRT	4814873-4814899	27	AP021851	Deinococcus grandis ATCC 43672 plasmid: pDEGR-2 DNA, complete genome	326033-326059	4	0.852
NC_013406_3	3.122\|4815620\|27\|NC_013406\|CRT	4815620-4815646	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	454-480	4	0.852
NC_013406_3	3.122\|4815620\|27\|NC_013406\|CRT	4815620-4815646	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321693-321719	4	0.852
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	131074-131100	5	0.815
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	132553-132579	5	0.815
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	134018-134044	5	0.815
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	134066-134092	5	0.815
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	NZ_CP011156	Bacillus cereus strain HN001 plasmid pRML01, complete sequence	127075-127101	5	0.815
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	236104-236130	5	0.815
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	AP014262	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S31-C59, * SEQUENCING IN PROGRESS *	17676-17702	5	0.815
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	MN693968	Marine virus AFVG_250M909, complete genome	17701-17727	5	0.815
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	AP013524	Uncultured Mediterranean phage uvMED DNA, complete genome, group G3, isolate: uvMED-CGR-C7-MedDCM-OCT-S39-C15	37371-37397	5	0.815
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	NZ_CP033971	Cupriavidus pauculus strain FDAARGOS_614 plasmid unnamed2, complete sequence	176816-176842	5	0.815
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	KT070867	Bacillus phage PBC2, complete genome	152574-152600	5	0.815
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	KT321315	Enterobacter phage phiEap-3, complete genome	158690-158716	5	0.815
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	MN101221	Klebsiella phage KOX8, complete genome	35664-35690	5	0.815
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	MN693189	Marine virus AFVG_25M326, complete genome	18861-18887	5	0.815
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	MN693869	Marine virus AFVG_250M793, complete genome	19301-19327	5	0.815
NC_013406_3	3.22\|4810202\|27\|NC_013406\|CRT	4810202-4810228	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	132553-132579	5	0.815
NC_013406_3	3.22\|4810202\|27\|NC_013406\|CRT	4810202-4810228	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	134018-134044	5	0.815
NC_013406_3	3.22\|4810202\|27\|NC_013406\|CRT	4810202-4810228	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	134066-134092	5	0.815
NC_013406_3	3.22\|4810202\|27\|NC_013406\|CRT	4810202-4810228	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	236104-236130	5	0.815
NC_013406_3	3.22\|4810202\|27\|NC_013406\|CRT	4810202-4810228	27	AP014262	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S31-C59, * SEQUENCING IN PROGRESS *	17676-17702	5	0.815
NC_013406_3	3.22\|4810202\|27\|NC_013406\|CRT	4810202-4810228	27	MK962638	Achromobacter phage vB_AxyP_19-32_Axy21, complete genome	14723-14749	5	0.815
NC_013406_3	3.22\|4810202\|27\|NC_013406\|CRT	4810202-4810228	27	KT070867	Bacillus phage PBC2, complete genome	152574-152600	5	0.815
NC_013406_3	3.22\|4810202\|27\|NC_013406\|CRT	4810202-4810228	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	126336-126362	5	0.815
NC_013406_3	3.22\|4810202\|27\|NC_013406\|CRT	4810202-4810228	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	126354-126380	5	0.815
NC_013406_3	3.22\|4810202\|27\|NC_013406\|CRT	4810202-4810228	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	126372-126398	5	0.815
NC_013406_3	3.22\|4810202\|27\|NC_013406\|CRT	4810202-4810228	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	126399-126425	5	0.815
NC_013406_3	3.22\|4810202\|27\|NC_013406\|CRT	4810202-4810228	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	126426-126452	5	0.815
NC_013406_3	3.22\|4810202\|27\|NC_013406\|CRT	4810202-4810228	27	MN694610	Marine virus AFVG_250M990, complete genome	16604-16630	5	0.815
NC_013406_3	3.23\|4810247\|27\|NC_013406\|CRT	4810247-4810273	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90213-90239	5	0.815
NC_013406_3	3.23\|4810247\|27\|NC_013406\|CRT	4810247-4810273	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130566-130592	5	0.815
NC_013406_3	3.23\|4810247\|27\|NC_013406\|CRT	4810247-4810273	27	NZ_CP053689	Arthrobacter citreus strain NEB 577 plasmid unnamed1, complete sequence	173230-173256	5	0.815
NC_013406_3	3.38\|4810958\|36\|NC_013406\|CRT	4810958-4810993	36	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321747-321782	5	0.861
NC_013406_3	3.38\|4810958\|36\|NC_013406\|CRT	4810958-4810993	36	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	391-426	5	0.861
NC_013406_3	3.49\|4811577\|27\|NC_013406\|CRT	4811577-4811603	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	94-120	5	0.815
NC_013406_3	3.49\|4811577\|27\|NC_013406\|CRT	4811577-4811603	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	166-192	5	0.815
NC_013406_3	3.49\|4811577\|27\|NC_013406\|CRT	4811577-4811603	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	193-219	5	0.815
NC_013406_3	3.49\|4811577\|27\|NC_013406\|CRT	4811577-4811603	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	265-291	5	0.815
NC_013406_3	3.49\|4811577\|27\|NC_013406\|CRT	4811577-4811603	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	292-318	5	0.815
NC_013406_3	3.49\|4811577\|27\|NC_013406\|CRT	4811577-4811603	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	319-345	5	0.815
NC_013406_3	3.49\|4811577\|27\|NC_013406\|CRT	4811577-4811603	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	328-354	5	0.815
NC_013406_3	3.49\|4811577\|27\|NC_013406\|CRT	4811577-4811603	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	418-444	5	0.815
NC_013406_3	3.49\|4811577\|27\|NC_013406\|CRT	4811577-4811603	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321729-321755	5	0.815
NC_013406_3	3.49\|4811577\|27\|NC_013406\|CRT	4811577-4811603	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321819-321845	5	0.815
NC_013406_3	3.49\|4811577\|27\|NC_013406\|CRT	4811577-4811603	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321828-321854	5	0.815
NC_013406_3	3.49\|4811577\|27\|NC_013406\|CRT	4811577-4811603	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321855-321881	5	0.815
NC_013406_3	3.49\|4811577\|27\|NC_013406\|CRT	4811577-4811603	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321927-321953	5	0.815
NC_013406_3	3.49\|4811577\|27\|NC_013406\|CRT	4811577-4811603	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	72735-72761	5	0.815
NC_013406_3	3.49\|4811577\|27\|NC_013406\|CRT	4811577-4811603	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73759-73785	5	0.815
NC_013406_3	3.49\|4811577\|27\|NC_013406\|CRT	4811577-4811603	27	NZ_CP004877	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence	163678-163704	5	0.815
NC_013406_3	3.49\|4811577\|27\|NC_013406\|CRT	4811577-4811603	27	NZ_CP004877	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence	163759-163785	5	0.815
NC_013406_3	3.49\|4811577\|27\|NC_013406\|CRT	4811577-4811603	27	NZ_CP012367	Enterococcus durans strain KLDS 6.0933 plasmid unnamed 1, complete sequence	48338-48364	5	0.815
NC_013406_3	3.49\|4811577\|27\|NC_013406\|CRT	4811577-4811603	27	NZ_CP012385	Enterococcus durans strain KLDS 6.0930 plasmid unnamed 1, complete sequence	50118-50144	5	0.815
NC_013406_3	3.49\|4811577\|27\|NC_013406\|CRT	4811577-4811603	27	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	576815-576841	5	0.815
NC_013406_3	3.49\|4811577\|27\|NC_013406\|CRT	4811577-4811603	27	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	576896-576922	5	0.815
NC_013406_3	3.49\|4811577\|27\|NC_013406\|CRT	4811577-4811603	27	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	213690-213716	5	0.815
NC_013406_3	3.49\|4811577\|27\|NC_013406\|CRT	4811577-4811603	27	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	213771-213797	5	0.815
NC_013406_3	3.49\|4811577\|27\|NC_013406\|CRT	4811577-4811603	27	NZ_CP007616	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence	194876-194902	5	0.815
NC_013406_3	3.49\|4811577\|27\|NC_013406\|CRT	4811577-4811603	27	NZ_CP007616	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence	194957-194983	5	0.815
NC_013406_3	3.49\|4811577\|27\|NC_013406\|CRT	4811577-4811603	27	NZ_CP004860	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence	183471-183497	5	0.815
NC_013406_3	3.49\|4811577\|27\|NC_013406\|CRT	4811577-4811603	27	NZ_CP004860	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence	183552-183578	5	0.815
NC_013406_3	3.49\|4811577\|27\|NC_013406\|CRT	4811577-4811603	27	NZ_CP053689	Arthrobacter citreus strain NEB 577 plasmid unnamed1, complete sequence	173149-173175	5	0.815
NC_013406_3	3.49\|4811577\|27\|NC_013406\|CRT	4811577-4811603	27	AP014420	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C24-MedDCM-OCT-S43-C167, * SEQUENCING IN PROGRESS *, 5 ordered pieces	10319-10345	5	0.815
NC_013406_3	3.49\|4811577\|27\|NC_013406\|CRT	4811577-4811603	27	JX181825	Salmonella phage STML-198, complete genome	50296-50322	5	0.815
NC_013406_3	3.49\|4811577\|27\|NC_013406\|CRT	4811577-4811603	27	NC_042044	Salmonella phage Melville, complete genome	7867-7893	5	0.815
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90285-90311	5	0.815
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130656-130682	5	0.815
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	131074-131100	5	0.815
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP004875	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB95, complete sequence	76485-76511	5	0.815
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP014284	Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence	178962-178988	5	0.815
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP014284	Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence	178908-178934	5	0.815
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP011357	Bacillus thuringiensis strain YC-10 plasmid pYC20, complete sequence	8121-8147	5	0.815
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP015155	Bacillus thuringiensis strain Bc601 plasmid pBTBC5, complete sequence	22740-22766	5	0.815
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP015156	Bacillus thuringiensis strain Bc601 plasmid pBTBC6, complete sequence	88642-88668	5	0.815
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP032609	Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence	270863-270889	5	0.815
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP032609	Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence	270809-270835	5	0.815
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP007616	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence	194714-194740	5	0.815
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	228656-228682	5	0.815
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP004877	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence	163921-163947	5	0.815
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	577058-577084	5	0.815
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP011358	Bacillus thuringiensis strain YC-10 plasmid pYC2226, complete sequence	20376-20402	5	0.815
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	213933-213959	5	0.815
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP013057	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-2, complete sequence	17362-17388	5	0.815
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP013058	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-3, complete sequence	81230-81256	5	0.815
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP004860	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence	183714-183740	5	0.815
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	KF437907	Phormidium phage MIS-PhV1A, complete genome	8755-8781	5	0.815
NC_013406_3	3.58\|4812081\|27\|NC_013406\|CRT	4812081-4812107	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	94-120	5	0.815
NC_013406_3	3.58\|4812081\|27\|NC_013406\|CRT	4812081-4812107	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	166-192	5	0.815
NC_013406_3	3.58\|4812081\|27\|NC_013406\|CRT	4812081-4812107	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	193-219	5	0.815
NC_013406_3	3.58\|4812081\|27\|NC_013406\|CRT	4812081-4812107	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	265-291	5	0.815
NC_013406_3	3.58\|4812081\|27\|NC_013406\|CRT	4812081-4812107	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	292-318	5	0.815
NC_013406_3	3.58\|4812081\|27\|NC_013406\|CRT	4812081-4812107	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	319-345	5	0.815
NC_013406_3	3.58\|4812081\|27\|NC_013406\|CRT	4812081-4812107	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	328-354	5	0.815
NC_013406_3	3.58\|4812081\|27\|NC_013406\|CRT	4812081-4812107	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	418-444	5	0.815
NC_013406_3	3.58\|4812081\|27\|NC_013406\|CRT	4812081-4812107	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321729-321755	5	0.815
NC_013406_3	3.58\|4812081\|27\|NC_013406\|CRT	4812081-4812107	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321819-321845	5	0.815
NC_013406_3	3.58\|4812081\|27\|NC_013406\|CRT	4812081-4812107	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321828-321854	5	0.815
NC_013406_3	3.58\|4812081\|27\|NC_013406\|CRT	4812081-4812107	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321855-321881	5	0.815
NC_013406_3	3.58\|4812081\|27\|NC_013406\|CRT	4812081-4812107	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321927-321953	5	0.815
NC_013406_3	3.58\|4812081\|27\|NC_013406\|CRT	4812081-4812107	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	72735-72761	5	0.815
NC_013406_3	3.58\|4812081\|27\|NC_013406\|CRT	4812081-4812107	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73759-73785	5	0.815
NC_013406_3	3.58\|4812081\|27\|NC_013406\|CRT	4812081-4812107	27	NZ_CP004877	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence	163678-163704	5	0.815
NC_013406_3	3.58\|4812081\|27\|NC_013406\|CRT	4812081-4812107	27	NZ_CP004877	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence	163759-163785	5	0.815
NC_013406_3	3.58\|4812081\|27\|NC_013406\|CRT	4812081-4812107	27	NZ_CP012367	Enterococcus durans strain KLDS 6.0933 plasmid unnamed 1, complete sequence	48338-48364	5	0.815
NC_013406_3	3.58\|4812081\|27\|NC_013406\|CRT	4812081-4812107	27	NZ_CP012385	Enterococcus durans strain KLDS 6.0930 plasmid unnamed 1, complete sequence	50118-50144	5	0.815
NC_013406_3	3.58\|4812081\|27\|NC_013406\|CRT	4812081-4812107	27	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	576815-576841	5	0.815
NC_013406_3	3.58\|4812081\|27\|NC_013406\|CRT	4812081-4812107	27	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	576896-576922	5	0.815
NC_013406_3	3.58\|4812081\|27\|NC_013406\|CRT	4812081-4812107	27	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	213690-213716	5	0.815
NC_013406_3	3.58\|4812081\|27\|NC_013406\|CRT	4812081-4812107	27	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	213771-213797	5	0.815
NC_013406_3	3.58\|4812081\|27\|NC_013406\|CRT	4812081-4812107	27	NZ_CP007616	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence	194876-194902	5	0.815
NC_013406_3	3.58\|4812081\|27\|NC_013406\|CRT	4812081-4812107	27	NZ_CP007616	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence	194957-194983	5	0.815
NC_013406_3	3.58\|4812081\|27\|NC_013406\|CRT	4812081-4812107	27	NZ_CP004860	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence	183471-183497	5	0.815
NC_013406_3	3.58\|4812081\|27\|NC_013406\|CRT	4812081-4812107	27	NZ_CP004860	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence	183552-183578	5	0.815
NC_013406_3	3.58\|4812081\|27\|NC_013406\|CRT	4812081-4812107	27	NZ_CP053689	Arthrobacter citreus strain NEB 577 plasmid unnamed1, complete sequence	173149-173175	5	0.815
NC_013406_3	3.58\|4812081\|27\|NC_013406\|CRT	4812081-4812107	27	AP014420	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C24-MedDCM-OCT-S43-C167, * SEQUENCING IN PROGRESS *, 5 ordered pieces	10319-10345	5	0.815
NC_013406_3	3.58\|4812081\|27\|NC_013406\|CRT	4812081-4812107	27	JX181825	Salmonella phage STML-198, complete genome	50296-50322	5	0.815
NC_013406_3	3.58\|4812081\|27\|NC_013406\|CRT	4812081-4812107	27	NC_042044	Salmonella phage Melville, complete genome	7867-7893	5	0.815
NC_013406_3	3.61\|4812198\|27\|NC_013406\|CRT	4812198-4812224	27	NZ_CP012367	Enterococcus durans strain KLDS 6.0933 plasmid unnamed 1, complete sequence	48338-48364	5	0.815
NC_013406_3	3.61\|4812198\|27\|NC_013406\|CRT	4812198-4812224	27	NZ_CP012385	Enterococcus durans strain KLDS 6.0930 plasmid unnamed 1, complete sequence	50118-50144	5	0.815
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73795-73821	5	0.815
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73633-73659	5	0.815
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	131074-131100	5	0.815
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	NZ_CP040345	Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence	416115-416141	5	0.815
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	KY421186	Flavobacterium phage FL-1, complete genome	26603-26629	5	0.815
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	KY421186	Flavobacterium phage FL-1, complete genome	26783-26809	5	0.815
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	KY421186	Flavobacterium phage FL-1, complete genome	26819-26845	5	0.815
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	KY421186	Flavobacterium phage FL-1, complete genome	26846-26872	5	0.815
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	MN693968	Marine virus AFVG_250M909, complete genome	17701-17727	5	0.815
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	MN855854	Siphoviridae sp. isolate 269, complete genome	2181-2207	5	0.815
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90285-90311	5	0.815
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130656-130682	5	0.815
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	131074-131100	5	0.815
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP004875	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB95, complete sequence	76485-76511	5	0.815
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP014284	Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence	178962-178988	5	0.815
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP014284	Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence	178908-178934	5	0.815
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP011357	Bacillus thuringiensis strain YC-10 plasmid pYC20, complete sequence	8121-8147	5	0.815
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP015155	Bacillus thuringiensis strain Bc601 plasmid pBTBC5, complete sequence	22740-22766	5	0.815
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP015156	Bacillus thuringiensis strain Bc601 plasmid pBTBC6, complete sequence	88642-88668	5	0.815
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP032609	Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence	270863-270889	5	0.815
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP032609	Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence	270809-270835	5	0.815
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP007616	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence	194714-194740	5	0.815
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	228656-228682	5	0.815
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP004877	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence	163921-163947	5	0.815
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	577058-577084	5	0.815
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP011358	Bacillus thuringiensis strain YC-10 plasmid pYC2226, complete sequence	20376-20402	5	0.815
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	213933-213959	5	0.815
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP013057	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-2, complete sequence	17362-17388	5	0.815
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP013058	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-3, complete sequence	81230-81256	5	0.815
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP004860	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence	183714-183740	5	0.815
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	KF437907	Phormidium phage MIS-PhV1A, complete genome	8755-8781	5	0.815
NC_013406_3	3.69\|4812585\|27\|NC_013406\|CRT	4812585-4812611	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321927-321953	5	0.815
NC_013406_3	3.69\|4812585\|27\|NC_013406\|CRT	4812585-4812611	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	94-120	5	0.815
NC_013406_3	3.69\|4812585\|27\|NC_013406\|CRT	4812585-4812611	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71566-71592	5	0.815
NC_013406_3	3.69\|4812585\|27\|NC_013406\|CRT	4812585-4812611	27	NZ_CP004877	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence	163759-163785	5	0.815
NC_013406_3	3.69\|4812585\|27\|NC_013406\|CRT	4812585-4812611	27	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	576896-576922	5	0.815
NC_013406_3	3.69\|4812585\|27\|NC_013406\|CRT	4812585-4812611	27	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	213771-213797	5	0.815
NC_013406_3	3.69\|4812585\|27\|NC_013406\|CRT	4812585-4812611	27	NZ_CP004860	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence	183552-183578	5	0.815
NC_013406_3	3.69\|4812585\|27\|NC_013406\|CRT	4812585-4812611	27	NZ_CP007616	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence	194876-194902	5	0.815
NC_013406_3	3.69\|4812585\|27\|NC_013406\|CRT	4812585-4812611	27	NZ_CP012367	Enterococcus durans strain KLDS 6.0933 plasmid unnamed 1, complete sequence	48338-48364	5	0.815
NC_013406_3	3.69\|4812585\|27\|NC_013406\|CRT	4812585-4812611	27	NZ_CP053689	Arthrobacter citreus strain NEB 577 plasmid unnamed1, complete sequence	173149-173175	5	0.815
NC_013406_3	3.69\|4812585\|27\|NC_013406\|CRT	4812585-4812611	27	NZ_CP012385	Enterococcus durans strain KLDS 6.0930 plasmid unnamed 1, complete sequence	50118-50144	5	0.815
NC_013406_3	3.69\|4812585\|27\|NC_013406\|CRT	4812585-4812611	27	AP014420	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C24-MedDCM-OCT-S43-C167, * SEQUENCING IN PROGRESS *, 5 ordered pieces	10319-10345	5	0.815
NC_013406_3	3.72\|4812747\|45\|NC_013406\|CRT	4812747-4812791	45	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130629-130673	5	0.889
NC_013406_3	3.73\|4812810\|36\|NC_013406\|CRT	4812810-4812845	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68863-68898	5	0.861
NC_013406_3	3.73\|4812810\|36\|NC_013406\|CRT	4812810-4812845	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130656-130691	5	0.861
NC_013406_3	3.73\|4812810\|36\|NC_013406\|CRT	4812810-4812845	36	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	131074-131109	5	0.861
NC_013406_3	3.90\|4814018\|27\|NC_013406\|CRT	4814018-4814044	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	94-120	5	0.815
NC_013406_3	3.90\|4814018\|27\|NC_013406\|CRT	4814018-4814044	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	166-192	5	0.815
NC_013406_3	3.90\|4814018\|27\|NC_013406\|CRT	4814018-4814044	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	193-219	5	0.815
NC_013406_3	3.90\|4814018\|27\|NC_013406\|CRT	4814018-4814044	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	265-291	5	0.815
NC_013406_3	3.90\|4814018\|27\|NC_013406\|CRT	4814018-4814044	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	292-318	5	0.815
NC_013406_3	3.90\|4814018\|27\|NC_013406\|CRT	4814018-4814044	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	319-345	5	0.815
NC_013406_3	3.90\|4814018\|27\|NC_013406\|CRT	4814018-4814044	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	328-354	5	0.815
NC_013406_3	3.90\|4814018\|27\|NC_013406\|CRT	4814018-4814044	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	418-444	5	0.815
NC_013406_3	3.90\|4814018\|27\|NC_013406\|CRT	4814018-4814044	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321729-321755	5	0.815
NC_013406_3	3.90\|4814018\|27\|NC_013406\|CRT	4814018-4814044	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321819-321845	5	0.815
NC_013406_3	3.90\|4814018\|27\|NC_013406\|CRT	4814018-4814044	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321828-321854	5	0.815
NC_013406_3	3.90\|4814018\|27\|NC_013406\|CRT	4814018-4814044	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321855-321881	5	0.815
NC_013406_3	3.90\|4814018\|27\|NC_013406\|CRT	4814018-4814044	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321927-321953	5	0.815
NC_013406_3	3.90\|4814018\|27\|NC_013406\|CRT	4814018-4814044	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	72735-72761	5	0.815
NC_013406_3	3.90\|4814018\|27\|NC_013406\|CRT	4814018-4814044	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73759-73785	5	0.815
NC_013406_3	3.90\|4814018\|27\|NC_013406\|CRT	4814018-4814044	27	NZ_CP004877	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence	163678-163704	5	0.815
NC_013406_3	3.90\|4814018\|27\|NC_013406\|CRT	4814018-4814044	27	NZ_CP004877	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence	163759-163785	5	0.815
NC_013406_3	3.90\|4814018\|27\|NC_013406\|CRT	4814018-4814044	27	NZ_CP012367	Enterococcus durans strain KLDS 6.0933 plasmid unnamed 1, complete sequence	48338-48364	5	0.815
NC_013406_3	3.90\|4814018\|27\|NC_013406\|CRT	4814018-4814044	27	NZ_CP012385	Enterococcus durans strain KLDS 6.0930 plasmid unnamed 1, complete sequence	50118-50144	5	0.815
NC_013406_3	3.90\|4814018\|27\|NC_013406\|CRT	4814018-4814044	27	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	576815-576841	5	0.815
NC_013406_3	3.90\|4814018\|27\|NC_013406\|CRT	4814018-4814044	27	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	576896-576922	5	0.815
NC_013406_3	3.90\|4814018\|27\|NC_013406\|CRT	4814018-4814044	27	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	213690-213716	5	0.815
NC_013406_3	3.90\|4814018\|27\|NC_013406\|CRT	4814018-4814044	27	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	213771-213797	5	0.815
NC_013406_3	3.90\|4814018\|27\|NC_013406\|CRT	4814018-4814044	27	NZ_CP007616	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence	194876-194902	5	0.815
NC_013406_3	3.90\|4814018\|27\|NC_013406\|CRT	4814018-4814044	27	NZ_CP007616	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence	194957-194983	5	0.815
NC_013406_3	3.90\|4814018\|27\|NC_013406\|CRT	4814018-4814044	27	NZ_CP004860	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence	183471-183497	5	0.815
NC_013406_3	3.90\|4814018\|27\|NC_013406\|CRT	4814018-4814044	27	NZ_CP004860	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence	183552-183578	5	0.815
NC_013406_3	3.90\|4814018\|27\|NC_013406\|CRT	4814018-4814044	27	NZ_CP053689	Arthrobacter citreus strain NEB 577 plasmid unnamed1, complete sequence	173149-173175	5	0.815
NC_013406_3	3.90\|4814018\|27\|NC_013406\|CRT	4814018-4814044	27	AP014420	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C24-MedDCM-OCT-S43-C167, * SEQUENCING IN PROGRESS *, 5 ordered pieces	10319-10345	5	0.815
NC_013406_3	3.90\|4814018\|27\|NC_013406\|CRT	4814018-4814044	27	JX181825	Salmonella phage STML-198, complete genome	50296-50322	5	0.815
NC_013406_3	3.90\|4814018\|27\|NC_013406\|CRT	4814018-4814044	27	NC_042044	Salmonella phage Melville, complete genome	7867-7893	5	0.815
NC_013406_3	3.91\|4814063\|36\|NC_013406\|CRT	4814063-4814098	36	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	251994-252029	5	0.861
NC_013406_3	3.92\|4814117\|27\|NC_013406\|CRT	4814117-4814143	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71347-71373	5	0.815
NC_013406_3	3.92\|4814117\|27\|NC_013406\|CRT	4814117-4814143	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130629-130655	5	0.815
NC_013406_3	3.93\|4814162\|27\|NC_013406\|CRT	4814162-4814188	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71311-71337	5	0.815
NC_013406_3	3.93\|4814162\|27\|NC_013406\|CRT	4814162-4814188	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68773-68799	5	0.815
NC_013406_3	3.106\|4814729\|27\|NC_013406\|CRT	4814729-4814755	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	72612-72638	5	0.815
NC_013406_3	3.106\|4814729\|27\|NC_013406\|CRT	4814729-4814755	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73552-73578	5	0.815
NC_013406_3	3.106\|4814729\|27\|NC_013406\|CRT	4814729-4814755	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73561-73587	5	0.815
NC_013406_3	3.106\|4814729\|27\|NC_013406\|CRT	4814729-4814755	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130566-130592	5	0.815
NC_013406_3	3.106\|4814729\|27\|NC_013406\|CRT	4814729-4814755	27	KY421186	Flavobacterium phage FL-1, complete genome	26810-26836	5	0.815
NC_013406_3	3.106\|4814729\|27\|NC_013406\|CRT	4814729-4814755	27	KY421186	Flavobacterium phage FL-1, complete genome	26837-26863	5	0.815
NC_013406_3	3.106\|4814729\|27\|NC_013406\|CRT	4814729-4814755	27	NZ_CP004875	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB95, complete sequence	76656-76682	5	0.815
NC_013406_3	3.106\|4814729\|27\|NC_013406\|CRT	4814729-4814755	27	NC_014025	Bacillus megaterium QM B1551 plasmid pBM500, complete sequence	52418-52444	5	0.815
NC_013406_3	3.106\|4814729\|27\|NC_013406\|CRT	4814729-4814755	27	NZ_CP019235	Bacillus thuringiensis strain YGd22-03 plasmid pYGD98, complete sequence	79271-79297	5	0.815
NC_013406_3	3.106\|4814729\|27\|NC_013406\|CRT	4814729-4814755	27	NZ_CP019235	Bacillus thuringiensis strain YGd22-03 plasmid pYGD98, complete sequence	79457-79483	5	0.815
NC_013406_3	3.106\|4814729\|27\|NC_013406\|CRT	4814729-4814755	27	NZ_CP011357	Bacillus thuringiensis strain YC-10 plasmid pYC20, complete sequence	8292-8318	5	0.815
NC_013406_3	3.106\|4814729\|27\|NC_013406\|CRT	4814729-4814755	27	NZ_CP015155	Bacillus thuringiensis strain Bc601 plasmid pBTBC5, complete sequence	22911-22937	5	0.815
NC_013406_3	3.106\|4814729\|27\|NC_013406\|CRT	4814729-4814755	27	NZ_CP015156	Bacillus thuringiensis strain Bc601 plasmid pBTBC6, complete sequence	88813-88839	5	0.815
NC_013406_3	3.106\|4814729\|27\|NC_013406\|CRT	4814729-4814755	27	NZ_CP011358	Bacillus thuringiensis strain YC-10 plasmid pYC2226, complete sequence	20205-20231	5	0.815
NC_013406_3	3.106\|4814729\|27\|NC_013406\|CRT	4814729-4814755	27	NZ_CP013057	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-2, complete sequence	17191-17217	5	0.815
NC_013406_3	3.106\|4814729\|27\|NC_013406\|CRT	4814729-4814755	27	NZ_CP013058	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-3, complete sequence	81059-81085	5	0.815
NC_013406_3	3.106\|4814729\|27\|NC_013406\|CRT	4814729-4814755	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	454-480	5	0.815
NC_013406_3	3.106\|4814729\|27\|NC_013406\|CRT	4814729-4814755	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321693-321719	5	0.815
NC_013406_3	3.106\|4814729\|27\|NC_013406\|CRT	4814729-4814755	27	KM389380	UNVERIFIED: Pseudomonas phage PEV31 clone contig00008 genomic sequence	2044-2070	5	0.815
NC_013406_3	3.106\|4814729\|27\|NC_013406\|CRT	4814729-4814755	27	KP994390	Pseudomonas phage YH30, complete genome	52414-52440	5	0.815
NC_013406_3	3.106\|4814729\|27\|NC_013406\|CRT	4814729-4814755	27	MH356729	Pseudomonas phage LP14, complete genome	46987-47013	5	0.815
NC_013406_3	3.106\|4814729\|27\|NC_013406\|CRT	4814729-4814755	27	KM389219	UNVERIFIED: Pseudomonas phage PEV32 clone contig00001 genomic sequence	8232-8258	5	0.815
NC_013406_3	3.106\|4814729\|27\|NC_013406\|CRT	4814729-4814755	27	MN693279	Marine virus AFVG_25M346, complete genome	16385-16411	5	0.815
NC_013406_3	3.106\|4814729\|27\|NC_013406\|CRT	4814729-4814755	27	MK450421	Streptomyces phage Vash, complete genome	15113-15139	5	0.815
NC_013406_3	3.106\|4814729\|27\|NC_013406\|CRT	4814729-4814755	27	MN553584	UNVERIFIED: Pseudomonas phage 4phiC20-2 clone 7, complete genome	41479-41505	5	0.815
NC_013406_3	3.106\|4814729\|27\|NC_013406\|CRT	4814729-4814755	27	KR054032	Pseudomonas phage DL64, complete genome	44581-44607	5	0.815
NC_013406_3	3.106\|4814729\|27\|NC_013406\|CRT	4814729-4814755	27	KM411960	Pseudomonas phage phi176, complete genome	25356-25382	5	0.815
NC_013406_3	3.106\|4814729\|27\|NC_013406\|CRT	4814729-4814755	27	JX194238	Pseudomonas phage PA26, complete genome	25269-25295	5	0.815
NC_013406_3	3.106\|4814729\|27\|NC_013406\|CRT	4814729-4814755	27	HG962375	Pseudomonas phage vB_PaeP_C2-10_Ab09, complete genome	25042-25068	5	0.815
NC_013406_3	3.106\|4814729\|27\|NC_013406\|CRT	4814729-4814755	27	MN906996	Pseudomonas phage LY218, complete genome	25366-25392	5	0.815
NC_013406_3	3.106\|4814729\|27\|NC_013406\|CRT	4814729-4814755	27	KR052142	Pseudomonas phage vB_PaeP_MAG4, complete genome	25310-25336	5	0.815
NC_013406_3	3.106\|4814729\|27\|NC_013406\|CRT	4814729-4814755	27	MF490236	Pseudomonas phage vB_PaeP_PYO2, complete genome	25066-25092	5	0.815
NC_013406_3	3.106\|4814729\|27\|NC_013406\|CRT	4814729-4814755	27	KM411958	Pseudomonas phage RWG, complete genome	25020-25046	5	0.815
NC_013406_3	3.106\|4814729\|27\|NC_013406\|CRT	4814729-4814755	27	KX171210	Pseudomonas phage vB_Pae1396P-5, complete genome	25252-25278	5	0.815
NC_013406_3	3.106\|4814729\|27\|NC_013406\|CRT	4814729-4814755	27	NC_013692	Pseudomonas phage LIT1, complete genome	25083-25109	5	0.815
NC_013406_3	3.106\|4814729\|27\|NC_013406\|CRT	4814729-4814755	27	KM411959	Pseudomonas phage Pa2, complete genome	25369-25395	5	0.815
NC_013406_3	3.106\|4814729\|27\|NC_013406\|CRT	4814729-4814755	27	FN422399	Pseudomonas phage LIT1 complete genome	25083-25109	5	0.815
NC_013406_3	3.106\|4814729\|27\|NC_013406\|CRT	4814729-4814755	27	NC_031063	Pseudomonas phage PEV2, complete genome	25066-25092	5	0.815
NC_013406_3	3.106\|4814729\|27\|NC_013406\|CRT	4814729-4814755	27	KX171209	Pseudomonas phage vB_Pae575P-3, complete genome	25253-25279	5	0.815
NC_013406_3	3.106\|4814729\|27\|NC_013406\|CRT	4814729-4814755	27	MF490238	Pseudomonas phage vB_PaeP_DEV, complete genome	25066-25092	5	0.815
NC_013406_3	3.109\|4814873\|27\|NC_013406\|CRT	4814873-4814899	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	86995-87021	5	0.815
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	134399-134425	6	0.778
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	233078-233104	6	0.778
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	MN694353	Marine virus AFVG_250M583, complete genome	40851-40877	6	0.778
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	NZ_CP053689	Arthrobacter citreus strain NEB 577 plasmid unnamed1, complete sequence	173149-173175	6	0.778
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	NZ_AP017969	Fusobacterium varium strain Fv113-g1 plasmid pFV113-g1-1, complete sequence	27817-27843	6	0.778
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	GU943063	Uncultured phage MedDCM-OCT-S05-C139 genomic sequence	12525-12551	6	0.778
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	NC_028998	Phormidium phage MIS-PhV1B, complete genome	7430-7456	6	0.778
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	AP014445	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C39-MedDCM-OCT-S35-C62, * SEQUENCING IN PROGRESS *, 4 ordered pieces	24373-24399	6	0.778
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	KF437907	Phormidium phage MIS-PhV1A, complete genome	8746-8772	6	0.778
NC_013406_3	3.22\|4810202\|27\|NC_013406\|CRT	4810202-4810228	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	132466-132492	6	0.778
NC_013406_3	3.22\|4810202\|27\|NC_013406\|CRT	4810202-4810228	27	MN694706	Marine virus AFVG_250M574, complete genome	28963-28989	6	0.778
NC_013406_3	3.23\|4810247\|27\|NC_013406\|CRT	4810247-4810273	27	NC_028998	Phormidium phage MIS-PhV1B, complete genome	7520-7546	6	0.778
NC_013406_3	3.23\|4810247\|27\|NC_013406\|CRT	4810247-4810273	27	MG945746	UNVERIFIED: Microviridae sp. isolate 2702-1801, complete genome	3540-3566	6	0.778
NC_013406_3	3.25\|4810328\|27\|NC_013406\|CRT	4810328-4810354	27	JQ807239	Environmental Halophage eHP-18, partial genome	10996-11022	6	0.778
NC_013406_3	3.49\|4811577\|27\|NC_013406\|CRT	4811577-4811603	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71566-71592	6	0.778
NC_013406_3	3.49\|4811577\|27\|NC_013406\|CRT	4811577-4811603	27	NZ_CP004875	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB95, complete sequence	77079-77105	6	0.778
NC_013406_3	3.49\|4811577\|27\|NC_013406\|CRT	4811577-4811603	27	NZ_CP004875	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB95, complete sequence	77232-77258	6	0.778
NC_013406_3	3.49\|4811577\|27\|NC_013406\|CRT	4811577-4811603	27	NZ_CP004877	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence	163606-163632	6	0.778
NC_013406_3	3.49\|4811577\|27\|NC_013406\|CRT	4811577-4811603	27	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	576743-576769	6	0.778
NC_013406_3	3.49\|4811577\|27\|NC_013406\|CRT	4811577-4811603	27	NZ_CP011357	Bacillus thuringiensis strain YC-10 plasmid pYC20, complete sequence	8715-8741	6	0.778
NC_013406_3	3.49\|4811577\|27\|NC_013406\|CRT	4811577-4811603	27	NZ_CP011357	Bacillus thuringiensis strain YC-10 plasmid pYC20, complete sequence	8868-8894	6	0.778
NC_013406_3	3.49\|4811577\|27\|NC_013406\|CRT	4811577-4811603	27	NZ_CP011358	Bacillus thuringiensis strain YC-10 plasmid pYC2226, complete sequence	19629-19655	6	0.778
NC_013406_3	3.49\|4811577\|27\|NC_013406\|CRT	4811577-4811603	27	NZ_CP011358	Bacillus thuringiensis strain YC-10 plasmid pYC2226, complete sequence	19782-19808	6	0.778
NC_013406_3	3.49\|4811577\|27\|NC_013406\|CRT	4811577-4811603	27	NZ_CP015155	Bacillus thuringiensis strain Bc601 plasmid pBTBC5, complete sequence	23334-23360	6	0.778
NC_013406_3	3.49\|4811577\|27\|NC_013406\|CRT	4811577-4811603	27	NZ_CP015155	Bacillus thuringiensis strain Bc601 plasmid pBTBC5, complete sequence	23487-23513	6	0.778
NC_013406_3	3.49\|4811577\|27\|NC_013406\|CRT	4811577-4811603	27	NZ_CP015156	Bacillus thuringiensis strain Bc601 plasmid pBTBC6, complete sequence	39-65	6	0.778
NC_013406_3	3.49\|4811577\|27\|NC_013406\|CRT	4811577-4811603	27	NZ_CP015156	Bacillus thuringiensis strain Bc601 plasmid pBTBC6, complete sequence	89236-89262	6	0.778
NC_013406_3	3.49\|4811577\|27\|NC_013406\|CRT	4811577-4811603	27	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	213618-213644	6	0.778
NC_013406_3	3.49\|4811577\|27\|NC_013406\|CRT	4811577-4811603	27	NZ_CP013057	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-2, complete sequence	16615-16641	6	0.778
NC_013406_3	3.49\|4811577\|27\|NC_013406\|CRT	4811577-4811603	27	NZ_CP013057	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-2, complete sequence	16768-16794	6	0.778
NC_013406_3	3.49\|4811577\|27\|NC_013406\|CRT	4811577-4811603	27	NZ_CP013058	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-3, complete sequence	80483-80509	6	0.778
NC_013406_3	3.49\|4811577\|27\|NC_013406\|CRT	4811577-4811603	27	NZ_CP013058	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-3, complete sequence	80636-80662	6	0.778
NC_013406_3	3.49\|4811577\|27\|NC_013406\|CRT	4811577-4811603	27	NZ_CP007616	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence	195029-195055	6	0.778
NC_013406_3	3.49\|4811577\|27\|NC_013406\|CRT	4811577-4811603	27	NZ_CP004860	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence	183399-183425	6	0.778
NC_013406_3	3.49\|4811577\|27\|NC_013406\|CRT	4811577-4811603	27	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	228764-228790	6	0.778
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68773-68799	6	0.778
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68872-68898	6	0.778
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68935-68961	6	0.778
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71566-71592	6	0.778
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90213-90239	6	0.778
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	373-399	6	0.778
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321774-321800	6	0.778
NC_013406_3	3.53\|4811820\|27\|NC_013406\|CRT	4811820-4811846	27	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	472791-472817	6	0.778
NC_013406_3	3.58\|4812081\|27\|NC_013406\|CRT	4812081-4812107	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71566-71592	6	0.778
NC_013406_3	3.58\|4812081\|27\|NC_013406\|CRT	4812081-4812107	27	NZ_CP004875	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB95, complete sequence	77079-77105	6	0.778
NC_013406_3	3.58\|4812081\|27\|NC_013406\|CRT	4812081-4812107	27	NZ_CP004875	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB95, complete sequence	77232-77258	6	0.778
NC_013406_3	3.58\|4812081\|27\|NC_013406\|CRT	4812081-4812107	27	NZ_CP004877	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence	163606-163632	6	0.778
NC_013406_3	3.58\|4812081\|27\|NC_013406\|CRT	4812081-4812107	27	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	576743-576769	6	0.778
NC_013406_3	3.58\|4812081\|27\|NC_013406\|CRT	4812081-4812107	27	NZ_CP011357	Bacillus thuringiensis strain YC-10 plasmid pYC20, complete sequence	8715-8741	6	0.778
NC_013406_3	3.58\|4812081\|27\|NC_013406\|CRT	4812081-4812107	27	NZ_CP011357	Bacillus thuringiensis strain YC-10 plasmid pYC20, complete sequence	8868-8894	6	0.778
NC_013406_3	3.58\|4812081\|27\|NC_013406\|CRT	4812081-4812107	27	NZ_CP011358	Bacillus thuringiensis strain YC-10 plasmid pYC2226, complete sequence	19629-19655	6	0.778
NC_013406_3	3.58\|4812081\|27\|NC_013406\|CRT	4812081-4812107	27	NZ_CP011358	Bacillus thuringiensis strain YC-10 plasmid pYC2226, complete sequence	19782-19808	6	0.778
NC_013406_3	3.58\|4812081\|27\|NC_013406\|CRT	4812081-4812107	27	NZ_CP015155	Bacillus thuringiensis strain Bc601 plasmid pBTBC5, complete sequence	23334-23360	6	0.778
NC_013406_3	3.58\|4812081\|27\|NC_013406\|CRT	4812081-4812107	27	NZ_CP015155	Bacillus thuringiensis strain Bc601 plasmid pBTBC5, complete sequence	23487-23513	6	0.778
NC_013406_3	3.58\|4812081\|27\|NC_013406\|CRT	4812081-4812107	27	NZ_CP015156	Bacillus thuringiensis strain Bc601 plasmid pBTBC6, complete sequence	39-65	6	0.778
NC_013406_3	3.58\|4812081\|27\|NC_013406\|CRT	4812081-4812107	27	NZ_CP015156	Bacillus thuringiensis strain Bc601 plasmid pBTBC6, complete sequence	89236-89262	6	0.778
NC_013406_3	3.58\|4812081\|27\|NC_013406\|CRT	4812081-4812107	27	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	213618-213644	6	0.778
NC_013406_3	3.58\|4812081\|27\|NC_013406\|CRT	4812081-4812107	27	NZ_CP013057	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-2, complete sequence	16615-16641	6	0.778
NC_013406_3	3.58\|4812081\|27\|NC_013406\|CRT	4812081-4812107	27	NZ_CP013057	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-2, complete sequence	16768-16794	6	0.778
NC_013406_3	3.58\|4812081\|27\|NC_013406\|CRT	4812081-4812107	27	NZ_CP013058	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-3, complete sequence	80483-80509	6	0.778
NC_013406_3	3.58\|4812081\|27\|NC_013406\|CRT	4812081-4812107	27	NZ_CP013058	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-3, complete sequence	80636-80662	6	0.778
NC_013406_3	3.58\|4812081\|27\|NC_013406\|CRT	4812081-4812107	27	NZ_CP007616	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence	195029-195055	6	0.778
NC_013406_3	3.58\|4812081\|27\|NC_013406\|CRT	4812081-4812107	27	NZ_CP004860	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence	183399-183425	6	0.778
NC_013406_3	3.58\|4812081\|27\|NC_013406\|CRT	4812081-4812107	27	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	228764-228790	6	0.778
NC_013406_3	3.61\|4812198\|27\|NC_013406\|CRT	4812198-4812224	27	GU943063	Uncultured phage MedDCM-OCT-S05-C139 genomic sequence	12525-12551	6	0.778
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	NZ_CP014284	Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence	178872-178898	6	0.778
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	NZ_CP032609	Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence	270773-270799	6	0.778
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	NZ_CP053689	Arthrobacter citreus strain NEB 577 plasmid unnamed1, complete sequence	173149-173175	6	0.778
NC_013406_3	3.62\|4812243\|27\|NC_013406\|CRT	4812243-4812269	27	GU943063	Uncultured phage MedDCM-OCT-S05-C139 genomic sequence	12525-12551	6	0.778
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68773-68799	6	0.778
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68872-68898	6	0.778
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68935-68961	6	0.778
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71566-71592	6	0.778
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90213-90239	6	0.778
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	373-399	6	0.778
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321774-321800	6	0.778
NC_013406_3	3.64\|4812324\|27\|NC_013406\|CRT	4812324-4812350	27	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	472791-472817	6	0.778
NC_013406_3	3.69\|4812585\|27\|NC_013406\|CRT	4812585-4812611	27	NZ_CP004877	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence	163606-163632	6	0.778
NC_013406_3	3.69\|4812585\|27\|NC_013406\|CRT	4812585-4812611	27	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	576743-576769	6	0.778
NC_013406_3	3.69\|4812585\|27\|NC_013406\|CRT	4812585-4812611	27	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	213618-213644	6	0.778
NC_013406_3	3.69\|4812585\|27\|NC_013406\|CRT	4812585-4812611	27	NZ_CP004860	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence	183399-183425	6	0.778
NC_013406_3	3.69\|4812585\|27\|NC_013406\|CRT	4812585-4812611	27	NZ_CP007616	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence	195029-195055	6	0.778
NC_013406_3	3.69\|4812585\|27\|NC_013406\|CRT	4812585-4812611	27	NZ_CP011358	Bacillus thuringiensis strain YC-10 plasmid pYC2226, complete sequence	19629-19655	6	0.778
NC_013406_3	3.69\|4812585\|27\|NC_013406\|CRT	4812585-4812611	27	NZ_CP011358	Bacillus thuringiensis strain YC-10 plasmid pYC2226, complete sequence	19782-19808	6	0.778
NC_013406_3	3.69\|4812585\|27\|NC_013406\|CRT	4812585-4812611	27	NZ_CP013057	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-2, complete sequence	16615-16641	6	0.778
NC_013406_3	3.69\|4812585\|27\|NC_013406\|CRT	4812585-4812611	27	NZ_CP013057	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-2, complete sequence	16768-16794	6	0.778
NC_013406_3	3.69\|4812585\|27\|NC_013406\|CRT	4812585-4812611	27	NZ_CP013058	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-3, complete sequence	80483-80509	6	0.778
NC_013406_3	3.69\|4812585\|27\|NC_013406\|CRT	4812585-4812611	27	NZ_CP013058	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-3, complete sequence	80636-80662	6	0.778
NC_013406_3	3.69\|4812585\|27\|NC_013406\|CRT	4812585-4812611	27	JX181825	Salmonella phage STML-198, complete genome	50296-50322	6	0.778
NC_013406_3	3.69\|4812585\|27\|NC_013406\|CRT	4812585-4812611	27	NC_042044	Salmonella phage Melville, complete genome	7867-7893	6	0.778
NC_013406_3	3.69\|4812585\|27\|NC_013406\|CRT	4812585-4812611	27	NZ_CP004875	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB95, complete sequence	77079-77105	6	0.778
NC_013406_3	3.69\|4812585\|27\|NC_013406\|CRT	4812585-4812611	27	NZ_CP004875	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB95, complete sequence	77232-77258	6	0.778
NC_013406_3	3.69\|4812585\|27\|NC_013406\|CRT	4812585-4812611	27	NZ_CP011357	Bacillus thuringiensis strain YC-10 plasmid pYC20, complete sequence	8715-8741	6	0.778
NC_013406_3	3.69\|4812585\|27\|NC_013406\|CRT	4812585-4812611	27	NZ_CP011357	Bacillus thuringiensis strain YC-10 plasmid pYC20, complete sequence	8868-8894	6	0.778
NC_013406_3	3.69\|4812585\|27\|NC_013406\|CRT	4812585-4812611	27	NZ_CP015155	Bacillus thuringiensis strain Bc601 plasmid pBTBC5, complete sequence	23334-23360	6	0.778
NC_013406_3	3.69\|4812585\|27\|NC_013406\|CRT	4812585-4812611	27	NZ_CP015155	Bacillus thuringiensis strain Bc601 plasmid pBTBC5, complete sequence	23487-23513	6	0.778
NC_013406_3	3.69\|4812585\|27\|NC_013406\|CRT	4812585-4812611	27	NZ_CP015156	Bacillus thuringiensis strain Bc601 plasmid pBTBC6, complete sequence	39-65	6	0.778
NC_013406_3	3.69\|4812585\|27\|NC_013406\|CRT	4812585-4812611	27	NZ_CP015156	Bacillus thuringiensis strain Bc601 plasmid pBTBC6, complete sequence	89236-89262	6	0.778
NC_013406_3	3.69\|4812585\|27\|NC_013406\|CRT	4812585-4812611	27	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	228764-228790	6	0.778
NC_013406_3	3.73\|4812810\|36\|NC_013406\|CRT	4812810-4812845	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68773-68808	6	0.833
NC_013406_3	3.90\|4814018\|27\|NC_013406\|CRT	4814018-4814044	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71566-71592	6	0.778
NC_013406_3	3.90\|4814018\|27\|NC_013406\|CRT	4814018-4814044	27	NZ_CP004875	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB95, complete sequence	77079-77105	6	0.778
NC_013406_3	3.90\|4814018\|27\|NC_013406\|CRT	4814018-4814044	27	NZ_CP004875	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB95, complete sequence	77232-77258	6	0.778
NC_013406_3	3.90\|4814018\|27\|NC_013406\|CRT	4814018-4814044	27	NZ_CP004877	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence	163606-163632	6	0.778
NC_013406_3	3.90\|4814018\|27\|NC_013406\|CRT	4814018-4814044	27	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	576743-576769	6	0.778
NC_013406_3	3.90\|4814018\|27\|NC_013406\|CRT	4814018-4814044	27	NZ_CP011357	Bacillus thuringiensis strain YC-10 plasmid pYC20, complete sequence	8715-8741	6	0.778
NC_013406_3	3.90\|4814018\|27\|NC_013406\|CRT	4814018-4814044	27	NZ_CP011357	Bacillus thuringiensis strain YC-10 plasmid pYC20, complete sequence	8868-8894	6	0.778
NC_013406_3	3.90\|4814018\|27\|NC_013406\|CRT	4814018-4814044	27	NZ_CP011358	Bacillus thuringiensis strain YC-10 plasmid pYC2226, complete sequence	19629-19655	6	0.778
NC_013406_3	3.90\|4814018\|27\|NC_013406\|CRT	4814018-4814044	27	NZ_CP011358	Bacillus thuringiensis strain YC-10 plasmid pYC2226, complete sequence	19782-19808	6	0.778
NC_013406_3	3.90\|4814018\|27\|NC_013406\|CRT	4814018-4814044	27	NZ_CP015155	Bacillus thuringiensis strain Bc601 plasmid pBTBC5, complete sequence	23334-23360	6	0.778
NC_013406_3	3.90\|4814018\|27\|NC_013406\|CRT	4814018-4814044	27	NZ_CP015155	Bacillus thuringiensis strain Bc601 plasmid pBTBC5, complete sequence	23487-23513	6	0.778
NC_013406_3	3.90\|4814018\|27\|NC_013406\|CRT	4814018-4814044	27	NZ_CP015156	Bacillus thuringiensis strain Bc601 plasmid pBTBC6, complete sequence	39-65	6	0.778
NC_013406_3	3.90\|4814018\|27\|NC_013406\|CRT	4814018-4814044	27	NZ_CP015156	Bacillus thuringiensis strain Bc601 plasmid pBTBC6, complete sequence	89236-89262	6	0.778
NC_013406_3	3.90\|4814018\|27\|NC_013406\|CRT	4814018-4814044	27	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	213618-213644	6	0.778
NC_013406_3	3.90\|4814018\|27\|NC_013406\|CRT	4814018-4814044	27	NZ_CP013057	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-2, complete sequence	16615-16641	6	0.778
NC_013406_3	3.90\|4814018\|27\|NC_013406\|CRT	4814018-4814044	27	NZ_CP013057	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-2, complete sequence	16768-16794	6	0.778
NC_013406_3	3.90\|4814018\|27\|NC_013406\|CRT	4814018-4814044	27	NZ_CP013058	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-3, complete sequence	80483-80509	6	0.778
NC_013406_3	3.90\|4814018\|27\|NC_013406\|CRT	4814018-4814044	27	NZ_CP013058	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-3, complete sequence	80636-80662	6	0.778
NC_013406_3	3.90\|4814018\|27\|NC_013406\|CRT	4814018-4814044	27	NZ_CP007616	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence	195029-195055	6	0.778
NC_013406_3	3.90\|4814018\|27\|NC_013406\|CRT	4814018-4814044	27	NZ_CP004860	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence	183399-183425	6	0.778
NC_013406_3	3.90\|4814018\|27\|NC_013406\|CRT	4814018-4814044	27	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	228764-228790	6	0.778
NC_013406_3	3.93\|4814162\|27\|NC_013406\|CRT	4814162-4814188	27	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90213-90239	6	0.778
NC_013406_3	3.109\|4814873\|27\|NC_013406\|CRT	4814873-4814899	27	NC_003905	Proteus vulgaris plasmid Rts1 DNA, complete sequence	36831-36857	6	0.778
NC_013406_3	3.109\|4814873\|27\|NC_013406\|CRT	4814873-4814899	27	NZ_CP028385	Providencia heimbachae strain 99101 plasmid unnamed, complete sequence	213292-213318	6	0.778
NC_013406_3	3.109\|4814873\|27\|NC_013406\|CRT	4814873-4814899	27	MK493321	Cyanophage S-RIM4 isolate RW_11_0999, complete genome	69213-69239	6	0.778
NC_013406_3	3.109\|4814873\|27\|NC_013406\|CRT	4814873-4814899	27	KU885990	Roseobacter phage RD-1410Ws-07, partial genome	39896-39922	6	0.778
NC_013406_3	3.109\|4814873\|27\|NC_013406\|CRT	4814873-4814899	27	KU885988	Dinoroseobacter phage DS-1410Ws-06, partial genome	41304-41330	6	0.778
NC_013406_3	3.119\|4815485\|27\|NC_013406\|CRT	4815485-4815511	27	NZ_CP038621	Arsenophonus nasoniae strain FIN plasmid pArsFIN9, complete sequence	18570-18596	6	0.778
NC_013406_3	3.5\|4809428\|36\|NC_013406\|CRT	4809428-4809463	36	NZ_CP011358	Bacillus thuringiensis strain YC-10 plasmid pYC2226, complete sequence	19557-19592	7	0.806
NC_013406_3	3.5\|4809428\|36\|NC_013406\|CRT	4809428-4809463	36	NZ_CP013057	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-2, complete sequence	16543-16578	7	0.806
NC_013406_3	3.5\|4809428\|36\|NC_013406\|CRT	4809428-4809463	36	NZ_CP013058	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-3, complete sequence	80411-80446	7	0.806
NC_013406_3	3.5\|4809428\|36\|NC_013406\|CRT	4809428-4809463	36	NZ_CP004875	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB95, complete sequence	77295-77330	7	0.806
NC_013406_3	3.5\|4809428\|36\|NC_013406\|CRT	4809428-4809463	36	NZ_CP011357	Bacillus thuringiensis strain YC-10 plasmid pYC20, complete sequence	8931-8966	7	0.806
NC_013406_3	3.5\|4809428\|36\|NC_013406\|CRT	4809428-4809463	36	NZ_CP015155	Bacillus thuringiensis strain Bc601 plasmid pBTBC5, complete sequence	23550-23585	7	0.806
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	132466-132492	7	0.741
NC_013406_3	3.6\|4809482\|27\|NC_013406\|CRT	4809482-4809508	27	NC_041878	Pectobacterium phage CBB, complete genome	164068-164094	7	0.741
NC_013406_3	3.11\|4809698\|27\|NC_013406\|CRT	4809698-4809724	27	MN693012	Marine virus AFVG_117M3, complete genome	4490-4516	7	0.741
NC_013406_3	3.73\|4812810\|36\|NC_013406\|CRT	4812810-4812845	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130773-130808	7	0.806
NC_013406_3	3.73\|4812810\|36\|NC_013406\|CRT	4812810-4812845	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90213-90248	7	0.806
NC_013406_3	3.73\|4812810\|36\|NC_013406\|CRT	4812810-4812845	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90276-90311	7	0.806
NC_013406_3	3.4\|4809365\|45\|NC_013406\|CRT	4809365-4809409	45	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	131083-131127	8	0.822
NC_013406_3	3.5\|4809428\|36\|NC_013406\|CRT	4809428-4809463	36	NZ_CP015156	Bacillus thuringiensis strain Bc601 plasmid pBTBC6, complete sequence	102-137	8	0.778
NC_013406_3	3.73\|4812810\|36\|NC_013406\|CRT	4812810-4812845	36	MN693798	Marine virus AFVG_250M119, complete genome	11460-11495	8	0.778
NC_013406_3	3.96\|4814288\|36\|NC_013406\|CRT	4814288-4814323	36	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	72405-72440	8	0.778
NC_013406_3	3.96\|4814288\|36\|NC_013406\|CRT	4814288-4814323	36	NZ_CP024167	Salmonella enterica subsp. enterica serovar Gaminara strain CFSAN070644 plasmid pCFSAN024441_02, complete sequence	15795-15830	8	0.778
NC_013406_3	3.110\|4814918\|36\|NC_013406\|CRT	4814918-4814953	36	AP014476	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, * SEQUENCING IN PROGRESS *, 2 ordered pieces	17964-17999	8	0.778
NC_013406_3	3.110\|4814918\|36\|NC_013406\|CRT	4814918-4814953	36	AP013564	Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5-MedDCM-OCT-S33-C6, * SEQUENCING IN PROGRESS *, 4 ordered pieces	8529-8564	8	0.778
NC_013406_3	3.110\|4814918\|36\|NC_013406\|CRT	4814918-4814953	36	AP013944	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, * SEQUENCING IN PROGRESS *	8359-8394	8	0.778
NC_013406_3	3.110\|4814918\|36\|NC_013406\|CRT	4814918-4814953	36	AP013943	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S40-C165, * SEQUENCING IN PROGRESS *	9203-9238	8	0.778
NC_013406_3	3.110\|4814918\|36\|NC_013406\|CRT	4814918-4814953	36	AP013942	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, * SEQUENCING IN PROGRESS *	15564-15599	8	0.778
NC_013406_3	3.110\|4814918\|36\|NC_013406\|CRT	4814918-4814953	36	AP013945	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, * SEQUENCING IN PROGRESS *	3828-3863	8	0.778
NC_013406_3	3.4\|4809365\|45\|NC_013406\|CRT	4809365-4809409	45	KF437907	Phormidium phage MIS-PhV1A, complete genome	8737-8781	10	0.778
NC_013406_3	3.70\|4812630\|45\|NC_013406\|CRT	4812630-4812674	45	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90204-90248	10	0.778
NC_013406_3	3.70\|4812630\|45\|NC_013406\|CRT	4812630-4812674	45	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68764-68808	11	0.756
NC_013406_3	3.99\|4814450\|36\|NC_013406\|CRT	4814450-4814485	36	NZ_CP012367	Enterococcus durans strain KLDS 6.0933 plasmid unnamed 1, complete sequence	54499-54534	12	0.667
NC_013406_3	3.99\|4814450\|36\|NC_013406\|CRT	4814450-4814485	36	NZ_CP012385	Enterococcus durans strain KLDS 6.0930 plasmid unnamed 1, complete sequence	43946-43981	12	0.667
NC_013406_3	3.99\|4814450\|36\|NC_013406\|CRT	4814450-4814485	36	LC383633	Staphylococcus aureus SI1 plasmid pWSI1 DNA, complete sequence	15279-15314	12	0.667
NC_013406_3	3.99\|4814450\|36\|NC_013406\|CRT	4814450-4814485	36	NC_010077	Staphylococcus aureus plasmid EDINA, complete sequence	15263-15298	12	0.667
NC_013406_3	3.99\|4814450\|36\|NC_013406\|CRT	4814450-4814485	36	NC_018952	Staphylococcus aureus plasmid pWBG747, complete sequence	9958-9993	12	0.667
NC_013406_3	3.99\|4814450\|36\|NC_013406\|CRT	4814450-4814485	36	NZ_CP014063	Staphylococcus aureus strain FDAARGOS_159 plasmid unnamed, complete sequence	23568-23603	12	0.667
NC_013406_3	3.99\|4814450\|36\|NC_013406\|CRT	4814450-4814485	36	NC_013326	Staphylococcus aureus plasmid pWBG746, complete sequence	24805-24840	12	0.667
NC_013406_3	3.99\|4814450\|36\|NC_013406\|CRT	4814450-4814485	36	NC_013348	Staphylococcus aureus plasmid pSK156, complete sequence	8391-8426	12	0.667
NC_013406_3	3.99\|4814450\|36\|NC_013406\|CRT	4814450-4814485	36	NZ_AP020312	Staphylococcus aureus strain KUH140013 plasmid p01KUH140013, complete sequence	15201-15236	12	0.667
NC_013406_3	3.99\|4814450\|36\|NC_013406\|CRT	4814450-4814485	36	NZ_AP014922	Staphylococcus aureus strain JH4899 plasmid pJSA01, complete sequence	15284-15319	12	0.667
NC_013406_1	1.1\|163368\|60\|NC_013406\|CRISPRCasFinder	163368-163427	60	NZ_CP054613	Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence	1583788-1583847	13	0.783
NC_013406_1	1.1\|163368\|60\|NC_013406\|CRISPRCasFinder	163368-163427	60	NZ_CP054613	Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence	900668-900727	13	0.783
NC_013406_1	1.1\|163368\|60\|NC_013406\|CRISPRCasFinder	163368-163427	60	NZ_CP054613	Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence	2547774-2547833	14	0.767
NC_013406_1	1.1\|163368\|60\|NC_013406\|CRISPRCasFinder	163368-163427	60	NZ_CP054613	Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence	1553592-1553651	14	0.767
NC_013406_1	1.1\|163368\|60\|NC_013406\|CRISPRCasFinder	163368-163427	60	NZ_CP016544	Planococcus donghaensis strain DSM 22276 plasmid pPD76, complete sequence	7380-7439	15	0.75
NC_013406_1	1.1\|163368\|60\|NC_013406\|CRISPRCasFinder	163368-163427	60	NZ_CP033045	Bacillus foraminis strain Bac44 plasmid unnamed, complete sequence	484370-484429	15	0.75
NC_013406_1	1.1\|163368\|60\|NC_013406\|CRISPRCasFinder	163368-163427	60	NZ_CP033045	Bacillus foraminis strain Bac44 plasmid unnamed, complete sequence	485380-485439	15	0.75
NC_013406_1	1.1\|163368\|60\|NC_013406\|CRISPRCasFinder	163368-163427	60	NZ_CP024037	Bacillus aryabhattai strain K13 plasmid unnamed2	9189-9248	16	0.733
NC_013406_1	1.1\|163368\|60\|NC_013406\|CRISPRCasFinder	163368-163427	60	NZ_CP026740	Bacillus megaterium strain YC4-R4 plasmid unnamed4	69534-69593	16	0.733
NC_013406_1	1.1\|163368\|60\|NC_013406\|CRISPRCasFinder	163368-163427	60	CP041516	Bacillus aryabhattai strain KNU10 plasmid unnamed, complete sequence	16629-16688	16	0.733
NC_013406_1	1.1\|163368\|60\|NC_013406\|CRISPRCasFinder	163368-163427	60	NC_017139	Bacillus megaterium WSH-002 plasmid WSH-002_p1, complete sequence	88-147	16	0.733
NC_013406_1	1.1\|163368\|60\|NC_013406\|CRISPRCasFinder	163368-163427	60	NC_004604	Bacillus megaterium QM B1551 plasmid pBM400, complete sequence	47657-47716	16	0.733
NC_013406_1	1.1\|163368\|60\|NC_013406\|CRISPRCasFinder	163368-163427	60	NZ_CP010587	Bacillus megaterium Q3 plasmid p1, complete sequence	2068-2127	16	0.733
NC_013406_1	1.1\|163368\|60\|NC_013406\|CRISPRCasFinder	163368-163427	60	NZ_CP023319	Bacillus megaterium strain A plasmid p2, complete sequence	553-612	16	0.733
NC_013406_1	1.1\|163368\|60\|NC_013406\|CRISPRCasFinder	163368-163427	60	NZ_CP041068	Bacillus megaterium strain KNU-01 plasmid pKNU_01_4, complete sequence	37432-37491	16	0.733
NC_013406_1	1.1\|163368\|60\|NC_013406\|CRISPRCasFinder	163368-163427	60	CP031730	Stenotrophomonas rhizophila strain GA1 plasmid unnamed1, complete sequence	312640-312699	19	0.683

1. spacer 3.22|4810202|27|NC_013406|CRT matches to MN693869 (Marine virus AFVG_250M793, complete genome) position: , mismatch: 2, identity: 0.926

tcacctgtagctcctgttgccccagtt	CRISPR spacer
tcacctgtagctcctgttgctccagtg	Protospacer
********************.*****

2. spacer 3.22|4810202|27|NC_013406|CRT matches to KY000079 (Acinetobacter phage AM24, complete genome) position: , mismatch: 2, identity: 0.926

tcacctgtagctcctgttgccccagtt	CRISPR spacer
gcacctgtagctcctgtggccccagtt	Protospacer
 **************** *********

3. spacer 3.23|4810247|27|NC_013406|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 2, identity: 0.926

gctcctgttgttccggttgctcctgtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
**********.*** ************

4. spacer 3.23|4810247|27|NC_013406|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.926

gctcctgttgttccggttgctcctgtt	CRISPR spacer
gctcctgttgccccggttgctcctgtt	Protospacer
**********..***************

5. spacer 3.23|4810247|27|NC_013406|CRT matches to NZ_CP014284 (Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence) position: , mismatch: 2, identity: 0.926

gctcctgttgttccggttgctcctgtt	CRISPR spacer
gctcctgttggtccggttgatcctgtt	Protospacer
********** ******** *******

6. spacer 3.23|4810247|27|NC_013406|CRT matches to NZ_CP032609 (Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence) position: , mismatch: 2, identity: 0.926

gctcctgttgttccggttgctcctgtt	CRISPR spacer
gctcctgttggtccggttgatcctgtt	Protospacer
********** ******** *******

7. spacer 3.23|4810247|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.926

gctcctgttgttccggttgctcctgtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
**********.*** ************

8. spacer 3.23|4810247|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.926

gctcctgttgttccggttgctcctgtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
**********.*** ************

9. spacer 3.23|4810247|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.926

gctcctgttgttccggttgctcctgtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
**********.*** ************

10. spacer 3.23|4810247|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.926

gctcctgttgttccggttgctcctgtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
**********.*** ************

11. spacer 3.23|4810247|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.926

gctcctgttgttccggttgctcctgtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
**********.*** ************

12. spacer 3.23|4810247|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.926

gctcctgttgttccggttgctcctgtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
**********.*** ************

13. spacer 3.23|4810247|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.926

gctcctgttgttccggttgctcctgtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
**********.*** ************

14. spacer 3.23|4810247|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.926

gctcctgttgttccggttgctcctgtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
**********.*** ************

15. spacer 3.23|4810247|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.926

gctcctgttgttccggttgctcctgtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
**********.*** ************

16. spacer 3.23|4810247|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.926

gctcctgttgttccggttgctcctgtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
**********.*** ************

17. spacer 3.23|4810247|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.926

gctcctgttgttccggttgctcctgtt	CRISPR spacer
gctcctgttgctcccgttgctcctgtt	Protospacer
**********.*** ************

18. spacer 3.23|4810247|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.926

gctcctgttgttccggttgctcctgtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
**********.*** ************

19. spacer 3.23|4810247|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.926

gctcctgttgttccggttgctcctgtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
**********.*** ************

20. spacer 3.23|4810247|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.926

gctcctgttgttccggttgctcctgtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
**********.*** ************

21. spacer 3.23|4810247|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.926

gctcctgttgttccggttgctcctgtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
**********.*** ************

22. spacer 3.23|4810247|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.926

gctcctgttgttccggttgctcctgtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
**********.*** ************

23. spacer 3.23|4810247|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.926

gctcctgttgttccggttgctcctgtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
**********.*** ************

24. spacer 3.23|4810247|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.926

gctcctgttgttccggttgctcctgtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
**********.*** ************

25. spacer 3.23|4810247|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.926

gctcctgttgttccggttgctcctgtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
**********.*** ************

26. spacer 3.23|4810247|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.926

gctcctgttgttccggttgctcctgtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
**********.*** ************

27. spacer 3.23|4810247|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.926

gctcctgttgttccggttgctcctgtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
**********.*** ************

28. spacer 3.23|4810247|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.926

gctcctgttgttccggttgctcctgtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
**********.*** ************

29. spacer 3.23|4810247|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.926

gctcctgttgttccggttgctcctgtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
**********.*** ************

30. spacer 3.23|4810247|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.926

gctcctgttgttccggttgctcctgtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
**********.*** ************

31. spacer 3.23|4810247|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.926

gctcctgttgttccggttgctcctgtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
**********.*** ************

32. spacer 3.23|4810247|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.926

gctcctgttgttccggttgctcctgtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
**********.*** ************

33. spacer 3.23|4810247|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.926

gctcctgttgttccggttgctcctgtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
**********.*** ************

34. spacer 3.23|4810247|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.926

gctcctgttgttccggttgctcctgtt	CRISPR spacer
gctcctgttgctcccgttgctcctgtt	Protospacer
**********.*** ************

35. spacer 3.62|4812243|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.926

acccctgttgctccggttgctccggtt	CRISPR spacer
acccctgttgctccggttgctcccatt	Protospacer
*********************** .**

36. spacer 3.69|4812585|27|NC_013406|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 2, identity: 0.926

gcaccagttactcctgttgctcccgtt	CRISPR spacer
gctcccgttactcctgttgctcccgtt	Protospacer
** ** *********************

37. spacer 3.69|4812585|27|NC_013406|CRT matches to NZ_CP014284 (Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence) position: , mismatch: 2, identity: 0.926

gcaccagttactcctgttgctcccgtt	CRISPR spacer
gcaccggttactcctgttggtcccgtt	Protospacer
*****.************* *******

38. spacer 3.69|4812585|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 2, identity: 0.926

gcaccagttactcctgttgctcccgtt	CRISPR spacer
gctcccgttactcctgttgctcccgtt	Protospacer
** ** *********************

39. spacer 3.69|4812585|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 2, identity: 0.926

gcaccagttactcctgttgctcccgtt	CRISPR spacer
gctcccgttactcctgttgctcccgtt	Protospacer
** ** *********************

40. spacer 3.69|4812585|27|NC_013406|CRT matches to NZ_CP032609 (Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence) position: , mismatch: 2, identity: 0.926

gcaccagttactcctgttgctcccgtt	CRISPR spacer
gcaccggttactcctgttggtcccgtt	Protospacer
*****.************* *******

41. spacer 3.69|4812585|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.926

gcaccagttactcctgttgctcccgtt	CRISPR spacer
gcaccagttacccctgttgctccggtt	Protospacer
***********.*********** ***

42. spacer 3.73|4812810|36|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.944

acacctgtcgctcctgttactcctgttgctcctgtt	CRISPR spacer
acacctgtcgctcctgtttctcctgttgctcccgtt	Protospacer
****************** *************.***

43. spacer 3.93|4814162|27|NC_013406|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.926

gctcctgttacccctgttgctccggtt	CRISPR spacer
gctcctgttgccccggttgctccggtt	Protospacer
*********.**** ************

44. spacer 3.93|4814162|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.926

gctcctgttacccctgttgctccggtt	CRISPR spacer
gcaccagttacccctgttgctccggtt	Protospacer
** ** *********************

45. spacer 3.6|4809482|27|NC_013406|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 3, identity: 0.889

acccctgttgctcctgttgcaccagtt	CRISPR spacer
gctcctgttgctcctgttgcaccagct	Protospacer
.*.**********************.*

46. spacer 3.22|4810202|27|NC_013406|CRT matches to MN694697 (Marine virus AFVG_250M792, complete genome) position: , mismatch: 3, identity: 0.889

tcacctgtagctcctgttgccccagtt	CRISPR spacer
tcacctgtagctcctgttgctcctgtg	Protospacer
********************.** **

47. spacer 3.22|4810202|27|NC_013406|CRT matches to NC_027332 (Acinetobacter phage YMC13/03/R2096, complete genome) position: , mismatch: 3, identity: 0.889

tcacctgtagctcctgttgccccagtt	CRISPR spacer
gcacctgtagctcctgtggcaccagtt	Protospacer
 **************** ** ******

48. spacer 3.22|4810202|27|NC_013406|CRT matches to MN694312 (Marine virus AFVG_250M269, complete genome) position: , mismatch: 3, identity: 0.889

tcacctgtagctcctgttgccccagtt	CRISPR spacer
gcgcctgtagctcctgtagccccagtt	Protospacer
 *.************** *********

49. spacer 3.23|4810247|27|NC_013406|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 3, identity: 0.889

gctcctgttgttccggttgctcctgtt	CRISPR spacer
ggtcctgttgctcctgttgctcctgtt	Protospacer
* ********.*** ************

50. spacer 3.23|4810247|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.889

gctcctgttgttccggttgctcctgtt	CRISPR spacer
gctcctgtcgttcccgttgctcctgtc	Protospacer
********.***** ***********.

51. spacer 3.23|4810247|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.889

gctcctgttgttccggttgctcctgtt	CRISPR spacer
tctcctgttgctcccgttgctcctgtt	Protospacer
 *********.*** ************

52. spacer 3.23|4810247|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.889

gctcctgttgttccggttgctcctgtt	CRISPR spacer
actcctgttgctcctgttgctcctgtt	Protospacer
.*********.*** ************

53. spacer 3.23|4810247|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.889

gctcctgttgttccggttgctcctgtt	CRISPR spacer
tctcctgttgctcctgttgctcctgtt	Protospacer
 *********.*** ************

54. spacer 3.23|4810247|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.889

gctcctgttgttccggttgctcctgtt	CRISPR spacer
gttcctgtcgttcccgttgctcctgtt	Protospacer
*.******.***** ************

55. spacer 3.23|4810247|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.889

gctcctgttgttccggttgctcctgtt	CRISPR spacer
gctcctgttgctcctgttgctcctgct	Protospacer
**********.*** **********.*

56. spacer 3.23|4810247|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 3, identity: 0.889

gctcctgttgttccggttgctcctgtt	CRISPR spacer
actcctgttgctcccgttgctcctgtt	Protospacer
.*********.*** ************

57. spacer 3.23|4810247|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 3, identity: 0.889

gctcctgttgttccggttgctcctgtt	CRISPR spacer
actcctgttgctcccgttgctcctgtt	Protospacer
.*********.*** ************

58. spacer 3.23|4810247|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 3, identity: 0.889

gctcctgttgttccggttgctcctgtt	CRISPR spacer
actcctgttgctcctgttgctcctgtt	Protospacer
.*********.*** ************

59. spacer 3.23|4810247|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 3, identity: 0.889

gctcctgttgttccggttgctcctgtt	CRISPR spacer
actcctgttgctcccgttgctcctgtt	Protospacer
.*********.*** ************

60. spacer 3.23|4810247|27|NC_013406|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 3, identity: 0.889

gctcctgttgttccggttgctcctgtt	CRISPR spacer
actcctgttgctcccgttgctcctgtt	Protospacer
.*********.*** ************

61. spacer 3.23|4810247|27|NC_013406|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 3, identity: 0.889

gctcctgttgttccggttgctcctgtt	CRISPR spacer
actcctgttgctcctgttgctcctgtt	Protospacer
.*********.*** ************

62. spacer 3.23|4810247|27|NC_013406|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 3, identity: 0.889

gctcctgttgttccggttgctcctgtt	CRISPR spacer
actcctgttgctcccgttgctcctgtt	Protospacer
.*********.*** ************

63. spacer 3.23|4810247|27|NC_013406|CRT matches to NZ_CP024167 (Salmonella enterica subsp. enterica serovar Gaminara strain CFSAN070644 plasmid pCFSAN024441_02, complete sequence) position: , mismatch: 3, identity: 0.889

gctcctgttgttccggttgctcctgtt	CRISPR spacer
tctcctgttgttcctgttgttcctgtt	Protospacer
 ************* ****.*******

64. spacer 3.23|4810247|27|NC_013406|CRT matches to NZ_CP024167 (Salmonella enterica subsp. enterica serovar Gaminara strain CFSAN070644 plasmid pCFSAN024441_02, complete sequence) position: , mismatch: 3, identity: 0.889

gctcctgttgttccggttgctcctgtt	CRISPR spacer
gttcctgttgttcctgttgttcctgtt	Protospacer
*.************ ****.*******

65. spacer 3.23|4810247|27|NC_013406|CRT matches to NZ_CP024167 (Salmonella enterica subsp. enterica serovar Gaminara strain CFSAN070644 plasmid pCFSAN024441_02, complete sequence) position: , mismatch: 3, identity: 0.889

gctcctgttgttccggttgctcctgtt	CRISPR spacer
gttcctgttgttcctgttgttcctgtt	Protospacer
*.************ ****.*******

66. spacer 3.23|4810247|27|NC_013406|CRT matches to MN693798 (Marine virus AFVG_250M119, complete genome) position: , mismatch: 3, identity: 0.889

gctcctgttgttccggttgctcctgtt	CRISPR spacer
cctcctgttgctcctgttgctcctgtt	Protospacer
 *********.*** ************

67. spacer 3.36|4810841|45|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.933

tctcctgttactcctgttgctcccgcttctcctgttgctcctgtc	CRISPR spacer
tctcctgttgctcctgttgctcctgcttctcctgttgctcctgtt	Protospacer
*********.*************.********************.

68. spacer 3.49|4811577|27|NC_013406|CRT matches to NZ_CP014284 (Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence) position: , mismatch: 3, identity: 0.889

gcaccagttactcctgttgctcccgtg	CRISPR spacer
gcaccggttactcctgttggtcccgtt	Protospacer
*****.************* ******

69. spacer 3.49|4811577|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 3, identity: 0.889

gcaccagttactcctgttgctcccgtg	CRISPR spacer
gctcccgttactcctgttgctcccgtt	Protospacer
** ** ********************

70. spacer 3.49|4811577|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 3, identity: 0.889

gcaccagttactcctgttgctcccgtg	CRISPR spacer
gctcccgttactcctgttgctcccgtt	Protospacer
** ** ********************

71. spacer 3.49|4811577|27|NC_013406|CRT matches to NZ_CP032609 (Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence) position: , mismatch: 3, identity: 0.889

gcaccagttactcctgttgctcccgtg	CRISPR spacer
gcaccggttactcctgttggtcccgtt	Protospacer
*****.************* ******

72. spacer 3.49|4811577|27|NC_013406|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 3, identity: 0.889

gcaccagttactcctgttgctcccgtg	CRISPR spacer
gctcccgttactcctgttgctcccgtt	Protospacer
** ** ********************

73. spacer 3.49|4811577|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.889

gcaccagttactcctgttgctcccgtg	CRISPR spacer
gcaccagttacccctgttgctccggtt	Protospacer
***********.*********** **

74. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.889

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctccggttactcctgttgctcctgct	Protospacer
 ************************.

75. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.889

tctccggttactcctgttgctcctgtg	CRISPR spacer
tctcctgttgctcctgttgctcctgtt	Protospacer
***** ***.****************

76. spacer 3.53|4811820|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 3, identity: 0.889

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcccgttactcctgttgctcctgtt	Protospacer
 **** ********************

77. spacer 3.53|4811820|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 3, identity: 0.889

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcccgttactcctgttgctcctgtt	Protospacer
 **** ********************

78. spacer 3.53|4811820|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 3, identity: 0.889

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcccgttactcctgttgctcctgtt	Protospacer
 **** ********************

79. spacer 3.53|4811820|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 3, identity: 0.889

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcccgttactcctgttgctcctgtt	Protospacer
 **** ********************

80. spacer 3.53|4811820|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 3, identity: 0.889

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcccgttactcctgttgctcctgtt	Protospacer
 **** ********************

81. spacer 3.53|4811820|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 3, identity: 0.889

tctccggttactcctgttgctcctgtg	CRISPR spacer
actcctgttactcctgttgctcctgtt	Protospacer
 **** ********************

82. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 3, identity: 0.889

tctccggttactcctgttgctcctgtg	CRISPR spacer
actcctgttactcctgttgctcctgtt	Protospacer
 **** ********************

83. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 3, identity: 0.889

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcccgttactcctgttgctcctgtt	Protospacer
 **** ********************

84. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 3, identity: 0.889

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcccgttactcctgttgctcctgtt	Protospacer
 **** ********************

85. spacer 3.58|4812081|27|NC_013406|CRT matches to NZ_CP014284 (Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence) position: , mismatch: 3, identity: 0.889

gcaccagttactcctgttgctcccgtg	CRISPR spacer
gcaccggttactcctgttggtcccgtt	Protospacer
*****.************* ******

86. spacer 3.58|4812081|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 3, identity: 0.889

gcaccagttactcctgttgctcccgtg	CRISPR spacer
gctcccgttactcctgttgctcccgtt	Protospacer
** ** ********************

87. spacer 3.58|4812081|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 3, identity: 0.889

gcaccagttactcctgttgctcccgtg	CRISPR spacer
gctcccgttactcctgttgctcccgtt	Protospacer
** ** ********************

88. spacer 3.58|4812081|27|NC_013406|CRT matches to NZ_CP032609 (Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence) position: , mismatch: 3, identity: 0.889

gcaccagttactcctgttgctcccgtg	CRISPR spacer
gcaccggttactcctgttggtcccgtt	Protospacer
*****.************* ******

89. spacer 3.58|4812081|27|NC_013406|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 3, identity: 0.889

gcaccagttactcctgttgctcccgtg	CRISPR spacer
gctcccgttactcctgttgctcccgtt	Protospacer
** ** ********************

90. spacer 3.58|4812081|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.889

gcaccagttactcctgttgctcccgtg	CRISPR spacer
gcaccagttacccctgttgctccggtt	Protospacer
***********.*********** **

91. spacer 3.61|4812198|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.889

gcccctgttactccagtcgctccagtt	CRISPR spacer
aaccctgttactccggtcgctccagtt	Protospacer
. ************.************

92. spacer 3.62|4812243|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.889

acccctgttgctccggttgctccggtt	CRISPR spacer
atacctgttgctccggtcgctccggtt	Protospacer
*. **************.*********

93. spacer 3.62|4812243|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.889

acccctgttgctccggttgctccggtt	CRISPR spacer
attcctgttgctcccgttgctccggtt	Protospacer
*..*********** ************

94. spacer 3.62|4812243|27|NC_013406|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.889

acccctgttgctccggttgctccggtt	CRISPR spacer
gccccggttgctcccgttgctccggtt	Protospacer
.**** ******** ************

95. spacer 3.62|4812243|27|NC_013406|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.889

acccctgttgctccggttgctccggtt	CRISPR spacer
cctccagttgctccggttgctccggtt	Protospacer
 *.** *********************

96. spacer 3.62|4812243|27|NC_013406|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.889

acccctgttgctccggttgctccggtt	CRISPR spacer
gctcctgttgccccggttgctccggtt	Protospacer
.*.********.***************

97. spacer 3.62|4812243|27|NC_013406|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.889

acccctgttgctccggttgctccggtt	CRISPR spacer
gcccctgttgccccggttgctcctgtt	Protospacer
.**********.*********** ***

98. spacer 3.62|4812243|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 3, identity: 0.889

acccctgttgctccggttgctccggtt	CRISPR spacer
ccccctgttgctcccgttgctcccgtt	Protospacer
 ************* ******** ***

99. spacer 3.62|4812243|27|NC_013406|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 3, identity: 0.889

acccctgttgctccggttgctccggtt	CRISPR spacer
ccccctgttgctcccgttgctcccgtt	Protospacer
 ************* ******** ***

100. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.889

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctccggttactcctgttgctcctgct	Protospacer
 ************************.

101. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.889

tctccggttactcctgttgctcctgtg	CRISPR spacer
tctcctgttgctcctgttgctcctgtt	Protospacer
***** ***.****************

102. spacer 3.64|4812324|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 3, identity: 0.889

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcccgttactcctgttgctcctgtt	Protospacer
 **** ********************

103. spacer 3.64|4812324|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 3, identity: 0.889

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcccgttactcctgttgctcctgtt	Protospacer
 **** ********************

104. spacer 3.64|4812324|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 3, identity: 0.889

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcccgttactcctgttgctcctgtt	Protospacer
 **** ********************

105. spacer 3.64|4812324|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 3, identity: 0.889

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcccgttactcctgttgctcctgtt	Protospacer
 **** ********************

106. spacer 3.64|4812324|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 3, identity: 0.889

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcccgttactcctgttgctcctgtt	Protospacer
 **** ********************

107. spacer 3.64|4812324|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 3, identity: 0.889

tctccggttactcctgttgctcctgtg	CRISPR spacer
actcctgttactcctgttgctcctgtt	Protospacer
 **** ********************

108. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 3, identity: 0.889

tctccggttactcctgttgctcctgtg	CRISPR spacer
actcctgttactcctgttgctcctgtt	Protospacer
 **** ********************

109. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 3, identity: 0.889

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcccgttactcctgttgctcctgtt	Protospacer
 **** ********************

110. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 3, identity: 0.889

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcccgttactcctgttgctcctgtt	Protospacer
 **** ********************

111. spacer 3.69|4812585|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.889

gcaccagttactcctgttgctcccgtt	CRISPR spacer
tcaccagttacccctgttgctcctgtt	Protospacer
 **********.***********.***

112. spacer 3.90|4814018|27|NC_013406|CRT matches to NZ_CP014284 (Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence) position: , mismatch: 3, identity: 0.889

gcaccagttactcctgttgctcccgtg	CRISPR spacer
gcaccggttactcctgttggtcccgtt	Protospacer
*****.************* ******

113. spacer 3.90|4814018|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 3, identity: 0.889

gcaccagttactcctgttgctcccgtg	CRISPR spacer
gctcccgttactcctgttgctcccgtt	Protospacer
** ** ********************

114. spacer 3.90|4814018|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 3, identity: 0.889

gcaccagttactcctgttgctcccgtg	CRISPR spacer
gctcccgttactcctgttgctcccgtt	Protospacer
** ** ********************

115. spacer 3.90|4814018|27|NC_013406|CRT matches to NZ_CP032609 (Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence) position: , mismatch: 3, identity: 0.889

gcaccagttactcctgttgctcccgtg	CRISPR spacer
gcaccggttactcctgttggtcccgtt	Protospacer
*****.************* ******

116. spacer 3.90|4814018|27|NC_013406|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 3, identity: 0.889

gcaccagttactcctgttgctcccgtg	CRISPR spacer
gctcccgttactcctgttgctcccgtt	Protospacer
** ** ********************

117. spacer 3.90|4814018|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.889

gcaccagttactcctgttgctcccgtg	CRISPR spacer
gcaccagttacccctgttgctccggtt	Protospacer
***********.*********** **

118. spacer 3.93|4814162|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 3, identity: 0.889

gctcctgttacccctgttgctccggtt	CRISPR spacer
actcctgttactcctgttgctcctgtt	Protospacer
.**********.*********** ***

119. spacer 3.93|4814162|27|NC_013406|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 3, identity: 0.889

gctcctgttacccctgttgctccggtt	CRISPR spacer
actcctgttactcctgttgctcctgtt	Protospacer
.**********.*********** ***

120. spacer 3.95|4814243|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.889

gcccctgtttctccggttactcctgtt	CRISPR spacer
acccctgttgctcctgttactcctgtt	Protospacer
.******** **** ************

121. spacer 3.106|4814729|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.889

gctccggttgctcccgtagctcccgta	CRISPR spacer
gctccggttgctcccattgctcccgtt	Protospacer
***************.* ********

122. spacer 3.106|4814729|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.889

gctccggttgctcccgtagctcccgta	CRISPR spacer
gctccggttactcccgttgctcccgtt	Protospacer
*********.******* ********

123. spacer 3.106|4814729|27|NC_013406|CRT matches to MG209611 (Aphanizomenon phage vB_AphaS-CL131, complete genome) position: , mismatch: 3, identity: 0.889

gctccggttgctcccgtagctcccgta	CRISPR spacer
gctcccgttgctcccgttgctcccgtt	Protospacer
***** *********** ********

124. spacer 3.106|4814729|27|NC_013406|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 3, identity: 0.889

gctccggttgctcccgtagctcccgta	CRISPR spacer
gctccggttgcttccgttgctcccgtt	Protospacer
************.**** ********

125. spacer 3.119|4815485|27|NC_013406|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 3, identity: 0.889

gctcctgttgcccccgtagttcctgtt	CRISPR spacer
ggtcctgttgcccccgttggtcctgtt	Protospacer
* *************** * *******

126. spacer 3.122|4815620|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 3, identity: 0.889

actcctgttgctcccgtggcccccgtt	CRISPR spacer
gctcctgttgctcccgtcggccccgtt	Protospacer
.**************** * *******

127. spacer 3.122|4815620|27|NC_013406|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 3, identity: 0.889

actcctgttgctcccgtggcccccgtt	CRISPR spacer
gctcctgttgctcccgtcggccccgtt	Protospacer
.**************** * *******

128. spacer 3.6|4809482|27|NC_013406|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctcctgttgcaccagtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
.*.***************** ** ***

129. spacer 3.6|4809482|27|NC_013406|CRT matches to NC_018511 (Bacillus thuringiensis HD-789 plasmid pBTHD789-5, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctcctgttgcaccagtt	CRISPR spacer
ggccctgttggtcctgttgcaccagct	Protospacer
. ******** **************.*

130. spacer 3.6|4809482|27|NC_013406|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctcctgttgcaccagtt	CRISPR spacer
gctcctgttgctcctgttgctcccgtt	Protospacer
.*.***************** ** ***

131. spacer 3.6|4809482|27|NC_013406|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctcctgttgcaccagtt	CRISPR spacer
gctcctgttgctcctgttgctcccgtt	Protospacer
.*.***************** ** ***

132. spacer 3.6|4809482|27|NC_013406|CRT matches to NZ_CP009345 (Bacillus thuringiensis HD1002 plasmid 6, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctcctgttgcaccagtt	CRISPR spacer
ggccctgttggtcctgttgcaccagct	Protospacer
. ******** **************.*

133. spacer 3.6|4809482|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctcctgttgcaccagtt	CRISPR spacer
gctcctgttgctcctgttgctcccgtt	Protospacer
.*.***************** ** ***

134. spacer 3.6|4809482|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctcctgttgcaccagtt	CRISPR spacer
gctcctgttgctcctgttgctcccgtt	Protospacer
.*.***************** ** ***

135. spacer 3.6|4809482|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctcctgttgcaccagtt	CRISPR spacer
gctcctgttgctcctgttgctcccgtt	Protospacer
.*.***************** ** ***

136. spacer 3.6|4809482|27|NC_013406|CRT matches to NC_001446 (Bacillus thuringiensis sv israelensis HI4 plasmid pTX14-3, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctcctgttgcaccagtt	CRISPR spacer
ggccctgttggtcctgttgcaccagct	Protospacer
. ******** **************.*

137. spacer 3.6|4809482|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctcctgttgcaccagtt	CRISPR spacer
ggccctgttgctcctgttgctcctgtt	Protospacer
. ****************** ** ***

138. spacer 3.6|4809482|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctcctgttgcaccagtt	CRISPR spacer
ggccctgttgctcctgttgctcctgtt	Protospacer
. ****************** ** ***

139. spacer 3.6|4809482|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctcctgttgcaccagtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
.*.***************** ** ***

140. spacer 3.6|4809482|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctcctgttgcaccagtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
.*.***************** ** ***

141. spacer 3.6|4809482|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctcctgttgcaccagtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
.*.***************** ** ***

142. spacer 3.6|4809482|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctcctgttgcaccagtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
.*.***************** ** ***

143. spacer 3.6|4809482|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctcctgttgcaccagtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
.*.***************** ** ***

144. spacer 3.6|4809482|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctcctgttgcaccagtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
.*.***************** ** ***

145. spacer 3.6|4809482|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctcctgttgcaccagtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
.*.***************** ** ***

146. spacer 3.6|4809482|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctcctgttgcaccagtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
.*.***************** ** ***

147. spacer 3.6|4809482|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctcctgttgcaccagtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
.*.***************** ** ***

148. spacer 3.6|4809482|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctcctgttgcaccagtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
.*.***************** ** ***

149. spacer 3.6|4809482|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctcctgttgcaccagtt	CRISPR spacer
gctcctgttgctcctgttgctcccgtt	Protospacer
.*.***************** ** ***

150. spacer 3.6|4809482|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctcctgttgcaccagtt	CRISPR spacer
gctccggttgctcccgttgcaccagtt	Protospacer
.*.** ********.************

151. spacer 3.6|4809482|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctcctgttgcaccagtt	CRISPR spacer
gctcccgttgctcctgtttcaccagtt	Protospacer
.*.**.************ ********

152. spacer 3.6|4809482|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctcctgttgcaccagtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
.*.***************** ** ***

153. spacer 3.6|4809482|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctcctgttgcaccagtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
.*.***************** ** ***

154. spacer 3.6|4809482|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctcctgttgcaccagtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
.*.***************** ** ***

155. spacer 3.6|4809482|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctcctgttgcaccagtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
.*.***************** ** ***

156. spacer 3.6|4809482|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctcctgttgcaccagtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
.*.***************** ** ***

157. spacer 3.6|4809482|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctcctgttgcaccagtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
.*.***************** ** ***

158. spacer 3.6|4809482|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctcctgttgcaccagtt	CRISPR spacer
gctcctgttgctcctgttgctcccgtt	Protospacer
.*.***************** ** ***

159. spacer 3.6|4809482|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctcctgttgcaccagtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
.*.***************** ** ***

160. spacer 3.6|4809482|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctcctgttgcaccagtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
.*.***************** ** ***

161. spacer 3.6|4809482|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctcctgttgcaccagtt	CRISPR spacer
tctcctgttgctcctgttgctcctgtt	Protospacer
 *.***************** ** ***

162. spacer 3.6|4809482|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctcctgttgcaccagtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
.*.***************** ** ***

163. spacer 3.6|4809482|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctcctgttgcaccagtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
.*.***************** ** ***

164. spacer 3.6|4809482|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctcctgttgcaccagtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
.*.***************** ** ***

165. spacer 3.6|4809482|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctcctgttgcaccagtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
.*.***************** ** ***

166. spacer 3.6|4809482|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctcctgttgcaccagtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
.*.***************** ** ***

167. spacer 3.6|4809482|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctcctgttgcaccagtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
.*.***************** ** ***

168. spacer 3.6|4809482|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctcctgttgcaccagtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
.*.***************** ** ***

169. spacer 3.6|4809482|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctcctgttgcaccagtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
.*.***************** ** ***

170. spacer 3.6|4809482|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctcctgttgcaccagtt	CRISPR spacer
gctcctgttgctcctgttgctcccgtt	Protospacer
.*.***************** ** ***

171. spacer 3.6|4809482|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctcctgttgcaccagtt	CRISPR spacer
acccctgttgctccggttgctcccatt	Protospacer
************** ***** ** .**

172. spacer 3.6|4809482|27|NC_013406|CRT matches to MN693798 (Marine virus AFVG_250M119, complete genome) position: , mismatch: 4, identity: 0.852

acccctgttgctcctgttgcaccagtt	CRISPR spacer
cctcctgttgctcctgttgctcctgtt	Protospacer
 *.***************** ** ***

173. spacer 3.6|4809482|27|NC_013406|CRT matches to AP013524 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G3, isolate: uvMED-CGR-C7-MedDCM-OCT-S39-C15) position: , mismatch: 4, identity: 0.852

acccctgttgctcctgttgcaccagtt	CRISPR spacer
gcgcctgctgctcctgttgcacctgtt	Protospacer
.* ****.*************** ***

174. spacer 3.6|4809482|27|NC_013406|CRT matches to NC_027332 (Acinetobacter phage YMC13/03/R2096, complete genome) position: , mismatch: 4, identity: 0.852

acccctgttgctcctgttgcaccagtt	CRISPR spacer
gcacctgtagctcctgtggcaccagtt	Protospacer
.* ***** ******** *********

175. spacer 3.23|4810247|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

gctcctgttgttccggttgctcctgtt	CRISPR spacer
actcctgttgctccagttgctcctgtc	Protospacer
.*********.***.***********.

176. spacer 3.23|4810247|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

gctcctgttgttccggttgctcctgtt	CRISPR spacer
gctcctgttgctcctgttgctcctcct	Protospacer
**********.*** ********* .*

177. spacer 3.23|4810247|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

gctcctgttgttccggttgctcctgtt	CRISPR spacer
ggccctgttgctcctgttgctcctgtt	Protospacer
* .*******.*** ************

178. spacer 3.23|4810247|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

gctcctgttgttccggttgctcctgtt	CRISPR spacer
ggccctgttgctcctgttgctcctgtt	Protospacer
* .*******.*** ************

179. spacer 3.23|4810247|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

gctcctgttgttccggttgctcctgtt	CRISPR spacer
tctcctgttgctcctgttgctcctgct	Protospacer
 *********.*** **********.*

180. spacer 3.23|4810247|27|NC_013406|CRT matches to NZ_CP053689 (Arthrobacter citreus strain NEB 577 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.852

gctcctgttgttccggttgctcctgtt	CRISPR spacer
gatcccgttattccggttgctcctgta	Protospacer
* ***.***.****************

181. spacer 3.23|4810247|27|NC_013406|CRT matches to MF140423 (Arthrobacter phage Nightmare, complete genome) position: , mismatch: 4, identity: 0.852

gctcctgttgttccggttgctcctgtt	CRISPR spacer
gctcctgttgttccggctcctccggct	Protospacer
****************.* **** *.*

182. spacer 3.23|4810247|27|NC_013406|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 4, identity: 0.852

gctcctgttgttccggttgctcctgtt	CRISPR spacer
gctcctattgctccggttgctccgatt	Protospacer
******.***.************ .**

183. spacer 3.23|4810247|27|NC_013406|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 4, identity: 0.852

gctcctgttgttccggttgctcctgtt	CRISPR spacer
gctcctattgctccggttgctccgatt	Protospacer
******.***.************ .**

184. spacer 3.25|4810328|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

gcccctggtactccagtcgctccagtt	CRISPR spacer
aaccctgttactccggtcgctccagtt	Protospacer
. ***** ******.************

185. spacer 3.36|4810841|45|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.911

tctcctgttactcctgttgctcccgcttctcctgttgctcctgtc	CRISPR spacer
gctcctgttgctcctgttgctcctgcttctcctgttgctcctgtt	Protospacer
 ********.*************.********************.

186. spacer 3.37|4810904|36|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.889

-tcacccgttacacctgtcgctcctgttactcctgtt	CRISPR spacer
gttacctg-tacacctgtcgctcctgtttctcctgtt	Protospacer
 *.***.* ******************* ********

187. spacer 3.38|4810958|36|NC_013406|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 4, identity: 0.889

acccccgttgctcctgttgctcctgttacccccgtt	CRISPR spacer
gctcccgttgctcctgttgctcctgttgctcccgtt	Protospacer
.*.************************.*.******

188. spacer 3.38|4810958|36|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 4, identity: 0.889

acccccgttgctcctgttgctcctgttacccccgtt	CRISPR spacer
gctcccgttgctcctgttgctcctgttgctcccgtt	Protospacer
.*.************************.*.******

189. spacer 3.38|4810958|36|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 4, identity: 0.889

acccccgttgctcctgttgctcctgttacccccgtt	CRISPR spacer
gctcccgttgctcctgttgctcctgttgctcccgtt	Protospacer
.*.************************.*.******

190. spacer 3.49|4811577|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

gcaccagttactcctgttgctcccgtg	CRISPR spacer
tcaccagttacccctgttgctcctgtt	Protospacer
 **********.***********.**

191. spacer 3.49|4811577|27|NC_013406|CRT matches to NZ_CP053933 (Bacillus thuringiensis strain FDAARGOS_794 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.852

gcaccagttactcctgttgctcccgtg	CRISPR spacer
ggacctgttattcctgttgctcccgtc	Protospacer
* *** ****.***************

192. spacer 3.49|4811577|27|NC_013406|CRT matches to NZ_CP053936 (Bacillus thuringiensis strain FDAARGOS_794 plasmid unnamed4, complete sequence) position: , mismatch: 4, identity: 0.852

gcaccagttactcctgttgctcccgtg	CRISPR spacer
ggacctgttattcctgttgctcccgtc	Protospacer
* *** ****.***************

193. spacer 3.49|4811577|27|NC_013406|CRT matches to NZ_CP009718 (Bacillus thuringiensis strain HD682 plasmid pBGN_2, complete sequence) position: , mismatch: 4, identity: 0.852

gcaccagttactcctgttgctcccgtg	CRISPR spacer
ggacctgttattcctgttgctcccgtc	Protospacer
* *** ****.***************

194. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

195. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

196. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

197. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

198. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

199. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

200. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

201. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

202. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

203. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

204. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcccgttgctcctgttgctcctgtc	Protospacer
 **** ***.****************

205. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctccggttactcctgtcgctcccgtt	Protospacer
 ****************.*****.**

206. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctccggttactcccgttgctcccgtt	Protospacer
 *************.********.**

207. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

208. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

209. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

210. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

211. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

212. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

213. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
actcctgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

214. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

215. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

216. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
tctcctgttgctcctgttgctcctgct	Protospacer
***** ***.***************.

217. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

218. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

219. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

220. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

221. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

222. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

223. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

224. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

225. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcccgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

226. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
actcccgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

227. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcctgttactcccgttgctcctgtt	Protospacer
 **** ********.***********

228. spacer 3.53|4811820|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcccgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

229. spacer 3.53|4811820|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcccgttactcctgttgctcccgtt	Protospacer
 **** *****************.**

230. spacer 3.53|4811820|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcccgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

231. spacer 3.53|4811820|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcccgttactcctgttgctcccgtt	Protospacer
 **** *****************.**

232. spacer 3.53|4811820|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcccgttactcctgttactcctgtt	Protospacer
 **** ************.*******

233. spacer 3.53|4811820|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
actcctgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

234. spacer 3.53|4811820|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcccgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

235. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcccgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

236. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
actcctgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

237. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcccgttactcctgttactcctgtt	Protospacer
 **** ************.*******

238. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcccgttactcctgttgctcccgtt	Protospacer
 **** *****************.**

239. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcccgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

240. spacer 3.53|4811820|27|NC_013406|CRT matches to MN693798 (Marine virus AFVG_250M119, complete genome) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
cctcctgttgctcctgttgctcctgtt	Protospacer
.**** ***.****************

241. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

242. spacer 3.58|4812081|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

gcaccagttactcctgttgctcccgtg	CRISPR spacer
tcaccagttacccctgttgctcctgtt	Protospacer
 **********.***********.**

243. spacer 3.58|4812081|27|NC_013406|CRT matches to NZ_CP053933 (Bacillus thuringiensis strain FDAARGOS_794 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.852

gcaccagttactcctgttgctcccgtg	CRISPR spacer
ggacctgttattcctgttgctcccgtc	Protospacer
* *** ****.***************

244. spacer 3.58|4812081|27|NC_013406|CRT matches to NZ_CP053936 (Bacillus thuringiensis strain FDAARGOS_794 plasmid unnamed4, complete sequence) position: , mismatch: 4, identity: 0.852

gcaccagttactcctgttgctcccgtg	CRISPR spacer
ggacctgttattcctgttgctcccgtc	Protospacer
* *** ****.***************

245. spacer 3.58|4812081|27|NC_013406|CRT matches to NZ_CP009718 (Bacillus thuringiensis strain HD682 plasmid pBGN_2, complete sequence) position: , mismatch: 4, identity: 0.852

gcaccagttactcctgttgctcccgtg	CRISPR spacer
ggacctgttattcctgttgctcccgtc	Protospacer
* *** ****.***************

246. spacer 3.61|4812198|27|NC_013406|CRT matches to MN693968 (Marine virus AFVG_250M909, complete genome) position: , mismatch: 4, identity: 0.852

gcccctgttactccagtcgctccagtt	CRISPR spacer
gaacctgttgctccagttgctccagtt	Protospacer
*  ******.*******.*********

247. spacer 3.61|4812198|27|NC_013406|CRT matches to GU323708 (Lactobacillus phage phiPYB5, complete genome) position: , mismatch: 4, identity: 0.852

gcccctgttactccagtcgctccagtt	CRISPR spacer
ggccctgttgctccagtcggtccagta	Protospacer
* *******.********* ******

248. spacer 3.62|4812243|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctccggttgctccggtt	CRISPR spacer
ggccctgttgctcctgttgctcctgtt	Protospacer
. ************ ******** ***

249. spacer 3.62|4812243|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctccggttgctccggtt	CRISPR spacer
ggccctgttgctcctgttgctcctgtt	Protospacer
. ************ ******** ***

250. spacer 3.62|4812243|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctccggttgctccggtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
.*.*********** ******** ***

251. spacer 3.62|4812243|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctccggttgctccggtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
.*.*********** ******** ***

252. spacer 3.62|4812243|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctccggttgctccggtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
.*.*********** ******** ***

253. spacer 3.62|4812243|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctccggttgctccggtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
.*.*********** ******** ***

254. spacer 3.62|4812243|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctccggttgctccggtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
.*.*********** ******** ***

255. spacer 3.62|4812243|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctccggttgctccggtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
.*.*********** ******** ***

256. spacer 3.62|4812243|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctccggttgctccggtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
.*.*********** ******** ***

257. spacer 3.62|4812243|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctccggttgctccggtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
.*.*********** ******** ***

258. spacer 3.62|4812243|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctccggttgctccggtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
.*.*********** ******** ***

259. spacer 3.62|4812243|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctccggttgctccggtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
.*.*********** ******** ***

260. spacer 3.62|4812243|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctccggttgctccggtt	CRISPR spacer
gctcctgttgctcccgttgctcctgtt	Protospacer
.*.*********** ******** ***

261. spacer 3.62|4812243|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctccggttgctccggtt	CRISPR spacer
gctcctgttgctcctgttgctcccgtt	Protospacer
.*.*********** ******** ***

262. spacer 3.62|4812243|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctccggttgctccggtt	CRISPR spacer
gctcctgtcactccggttgctccggtt	Protospacer
.*.*****..*****************

263. spacer 3.62|4812243|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctccggttgctccggtt	CRISPR spacer
gctcctgttgcacccgttgctccggtt	Protospacer
.*.******** ** ************

264. spacer 3.62|4812243|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctccggttgctccggtt	CRISPR spacer
gctcctgtttctcccgttgctccggtt	Protospacer
.*.****** **** ************

265. spacer 3.62|4812243|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctccggttgctccggtt	CRISPR spacer
tctcctgttgctcccgttgctcctgtt	Protospacer
 *.*********** ******** ***

266. spacer 3.62|4812243|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctccggttgctccggtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
.*.*********** ******** ***

267. spacer 3.62|4812243|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctccggttgctccggtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
.*.*********** ******** ***

268. spacer 3.62|4812243|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctccggttgctccggtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
.*.*********** ******** ***

269. spacer 3.62|4812243|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctccggttgctccggtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
.*.*********** ******** ***

270. spacer 3.62|4812243|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctccggttgctccggtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
.*.*********** ******** ***

271. spacer 3.62|4812243|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctccggttgctccggtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
.*.*********** ******** ***

272. spacer 3.62|4812243|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctccggttgctccggtt	CRISPR spacer
gctcctgttgctcctgttgctcccgtt	Protospacer
.*.*********** ******** ***

273. spacer 3.62|4812243|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctccggttgctccggtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
.*.*********** ******** ***

274. spacer 3.62|4812243|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctccggttgctccggtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
.*.*********** ******** ***

275. spacer 3.62|4812243|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctccggttgctccggtt	CRISPR spacer
tctcctgttgctcctgttgctcctgtt	Protospacer
 *.*********** ******** ***

276. spacer 3.62|4812243|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctccggttgctccggtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
.*.*********** ******** ***

277. spacer 3.62|4812243|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctccggttgctccggtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
.*.*********** ******** ***

278. spacer 3.62|4812243|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctccggttgctccggtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
.*.*********** ******** ***

279. spacer 3.62|4812243|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctccggttgctccggtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
.*.*********** ******** ***

280. spacer 3.62|4812243|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctccggttgctccggtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
.*.*********** ******** ***

281. spacer 3.62|4812243|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctccggttgctccggtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
.*.*********** ******** ***

282. spacer 3.62|4812243|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctccggttgctccggtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
.*.*********** ******** ***

283. spacer 3.62|4812243|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctccggttgctccggtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
.*.*********** ******** ***

284. spacer 3.62|4812243|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctccggttgctccggtt	CRISPR spacer
gctcctgttgctcccgttgctcctgtt	Protospacer
.*.*********** ******** ***

285. spacer 3.62|4812243|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctccggttgctccggtt	CRISPR spacer
gctcctgttgctcctgttgctcccgtt	Protospacer
.*.*********** ******** ***

286. spacer 3.62|4812243|27|NC_013406|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctccggttgctccggtt	CRISPR spacer
gctcctgttgccccggttgctcccgtt	Protospacer
.*.********.*********** ***

287. spacer 3.62|4812243|27|NC_013406|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctccggttgctccggtt	CRISPR spacer
gctccggttgctccggttgccccggtt	Protospacer
.*.** **************.******

288. spacer 3.62|4812243|27|NC_013406|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctccggttgctccggtt	CRISPR spacer
gccccggttgctccggttgctcctgct	Protospacer
.**** ***************** *.*

289. spacer 3.62|4812243|27|NC_013406|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctccggttgctccggtt	CRISPR spacer
gctcctgttgccccggttgctcctgtt	Protospacer
.*.********.*********** ***

290. spacer 3.62|4812243|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctccggttgctccggtt	CRISPR spacer
gctcctgttgctcctgttgctcccgtt	Protospacer
.*.*********** ******** ***

291. spacer 3.62|4812243|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctccggttgctccggtt	CRISPR spacer
gctcctgttgctcctgttgctcccgtt	Protospacer
.*.*********** ******** ***

292. spacer 3.62|4812243|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctccggttgctccggtt	CRISPR spacer
gctcctgttgctcctgttgctcccgtt	Protospacer
.*.*********** ******** ***

293. spacer 3.62|4812243|27|NC_013406|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctccggttgctccggtt	CRISPR spacer
gctcctgttgctcctgttgctcccgtt	Protospacer
.*.*********** ******** ***

294. spacer 3.62|4812243|27|NC_013406|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctccggttgctccggtt	CRISPR spacer
gctcctgttgctcctgttgctcccgtt	Protospacer
.*.*********** ******** ***

295. spacer 3.62|4812243|27|NC_013406|CRT matches to MK962638 (Achromobacter phage vB_AxyP_19-32_Axy21, complete genome) position: , mismatch: 4, identity: 0.852

acccctgttgctccggttgctccggtt	CRISPR spacer
ccggctgttgctccggttgctccggtg	Protospacer
 *  **********************

296. spacer 3.62|4812243|27|NC_013406|CRT matches to NC_047890 (Escherichia phage PGT2, complete genome) position: , mismatch: 4, identity: 0.852

acccctgttgctccggttgctccggtt	CRISPR spacer
gcccctgtagctccggctgctccggtg	Protospacer
.******* *******.*********

297. spacer 3.62|4812243|27|NC_013406|CRT matches to JN882298 (Escherichia phage phiKT, complete genome) position: , mismatch: 4, identity: 0.852

acccctgttgctccggttgctccggtt	CRISPR spacer
gcccctgtagctccggctgctccggtg	Protospacer
.******* *******.*********

298. spacer 3.62|4812243|27|NC_013406|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 4, identity: 0.852

acccctgttgctccggttgctccggtt	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
.*.*********** ******** ***

299. spacer 3.62|4812243|27|NC_013406|CRT matches to MN693798 (Marine virus AFVG_250M119, complete genome) position: , mismatch: 4, identity: 0.852

acccctgttgctccggttgctccggtt	CRISPR spacer
cctcctgttgctcctgttgctcctgtt	Protospacer
 *.*********** ******** ***

300. spacer 3.62|4812243|27|NC_013406|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 4, identity: 0.852

acccctgttgctccggttgctccggtt	CRISPR spacer
gctcctattgctccggttgctccgatt	Protospacer
.*.***.*****************.**

301. spacer 3.62|4812243|27|NC_013406|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 4, identity: 0.852

acccctgttgctccggttgctccggtt	CRISPR spacer
gctccggttgctccgattgctccggtt	Protospacer
.*.** *********.***********

302. spacer 3.62|4812243|27|NC_013406|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 4, identity: 0.852

acccctgttgctccggttgctccggtt	CRISPR spacer
gctcctattgctccggttgctccgatt	Protospacer
.*.***.*****************.**

303. spacer 3.62|4812243|27|NC_013406|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 4, identity: 0.852

acccctgttgctccggttgctccggtt	CRISPR spacer
gctccggttgctccgattgctccggtt	Protospacer
.*.** *********.***********

304. spacer 3.62|4812243|27|NC_013406|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 4, identity: 0.852

acccctgttgctccggttgctccggtt	CRISPR spacer
gctcccgttgctcccgttgctccggtt	Protospacer
.*.**.******** ************

305. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

306. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

307. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

308. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

309. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

310. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

311. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

312. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

313. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

314. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

315. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcccgttgctcctgttgctcctgtc	Protospacer
 **** ***.****************

316. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctccggttactcctgtcgctcccgtt	Protospacer
 ****************.*****.**

317. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctccggttactcccgttgctcccgtt	Protospacer
 *************.********.**

318. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

319. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

320. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

321. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

322. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

323. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

324. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
actcctgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

325. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

326. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

327. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
tctcctgttgctcctgttgctcctgct	Protospacer
***** ***.***************.

328. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

329. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

330. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

331. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

332. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

333. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

334. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

335. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

336. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcccgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

337. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
actcccgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

338. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcctgttactcccgttgctcctgtt	Protospacer
 **** ********.***********

339. spacer 3.64|4812324|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcccgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

340. spacer 3.64|4812324|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcccgttactcctgttgctcccgtt	Protospacer
 **** *****************.**

341. spacer 3.64|4812324|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcccgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

342. spacer 3.64|4812324|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcccgttactcctgttgctcccgtt	Protospacer
 **** *****************.**

343. spacer 3.64|4812324|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcccgttactcctgttactcctgtt	Protospacer
 **** ************.*******

344. spacer 3.64|4812324|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
actcctgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

345. spacer 3.64|4812324|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcccgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

346. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcccgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

347. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
actcctgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

348. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcccgttactcctgttactcctgtt	Protospacer
 **** ************.*******

349. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcccgttactcctgttgctcccgtt	Protospacer
 **** *****************.**

350. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcccgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

351. spacer 3.64|4812324|27|NC_013406|CRT matches to MN693798 (Marine virus AFVG_250M119, complete genome) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
cctcctgttgctcctgttgctcctgtt	Protospacer
.**** ***.****************

352. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 4, identity: 0.852

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcctgttgctcctgttgctcctgtt	Protospacer
 **** ***.****************

353. spacer 3.69|4812585|27|NC_013406|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 4, identity: 0.852

gcaccagttactcctgttgctcccgtt	CRISPR spacer
ggccccgtcactcctgttgctcccgtt	Protospacer
*  ** **.******************

354. spacer 3.69|4812585|27|NC_013406|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 4, identity: 0.852

gcaccagttactcctgttgctcccgtt	CRISPR spacer
actcctgttactcctgttgctcctgtt	Protospacer
.* ** *****************.***

355. spacer 3.69|4812585|27|NC_013406|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 4, identity: 0.852

gcaccagttactcctgttgctcccgtt	CRISPR spacer
actcctgttgctcctgttgctcccgtt	Protospacer
.* ** ***.*****************

356. spacer 3.69|4812585|27|NC_013406|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 4, identity: 0.852

gcaccagttactcctgttgctcccgtt	CRISPR spacer
actcctgttgctcctgttgctcccgtt	Protospacer
.* ** ***.*****************

357. spacer 3.69|4812585|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 4, identity: 0.852

gcaccagttactcctgttgctcccgtt	CRISPR spacer
actcctgttgctcctgttgctcccgtt	Protospacer
.* ** ***.*****************

358. spacer 3.69|4812585|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 4, identity: 0.852

gcaccagttactcctgttgctcccgtt	CRISPR spacer
actcctgttgctcctgttgctcccgtt	Protospacer
.* ** ***.*****************

359. spacer 3.69|4812585|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 4, identity: 0.852

gcaccagttactcctgttgctcccgtt	CRISPR spacer
actcctgttgctcctgttgctcccgtt	Protospacer
.* ** ***.*****************

360. spacer 3.69|4812585|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 4, identity: 0.852

gcaccagttactcctgttgctcccgtt	CRISPR spacer
actcctgttgctcctgttgctcccgtt	Protospacer
.* ** ***.*****************

361. spacer 3.69|4812585|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 4, identity: 0.852

gcaccagttactcctgttgctcccgtt	CRISPR spacer
actcctgttgctcctgttgctcccgtt	Protospacer
.* ** ***.*****************

362. spacer 3.69|4812585|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 4, identity: 0.852

gcaccagttactcctgttgctcccgtt	CRISPR spacer
actcctgttactcctgttgctcctgtt	Protospacer
.* ** *****************.***

363. spacer 3.69|4812585|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 4, identity: 0.852

gcaccagttactcctgttgctcccgtt	CRISPR spacer
ggccccgtcactcctgttgctcccgtt	Protospacer
*  ** **.******************

364. spacer 3.69|4812585|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

gcaccagttactcctgttgctcccgtt	CRISPR spacer
actcctgttattcctgttgctcccgtt	Protospacer
.* ** ****.****************

365. spacer 3.69|4812585|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

gcaccagttactcctgttgctcccgtt	CRISPR spacer
gctccggttactcctgttgctcctgct	Protospacer
** **.*****************.*.*

366. spacer 3.69|4812585|27|NC_013406|CRT matches to NZ_CP004877 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence) position: , mismatch: 4, identity: 0.852

gcaccagttactcctgttgctcccgtt	CRISPR spacer
ggtcccgttactcctgttggtcccgtt	Protospacer
*  ** ************* *******

367. spacer 3.69|4812585|27|NC_013406|CRT matches to NZ_CP053936 (Bacillus thuringiensis strain FDAARGOS_794 plasmid unnamed4, complete sequence) position: , mismatch: 4, identity: 0.852

gcaccagttactcctgttgctcccgtt	CRISPR spacer
ggacctgttattcctgttgctcccgtc	Protospacer
* *** ****.***************.

368. spacer 3.69|4812585|27|NC_013406|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 4, identity: 0.852

gcaccagttactcctgttgctcccgtt	CRISPR spacer
ggtcccgttactcctgttggtcccgtt	Protospacer
*  ** ************* *******

369. spacer 3.69|4812585|27|NC_013406|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 4, identity: 0.852

gcaccagttactcctgttgctcccgtt	CRISPR spacer
ggtcccgttactcctgttggtcccgtt	Protospacer
*  ** ************* *******

370. spacer 3.69|4812585|27|NC_013406|CRT matches to NZ_CP004860 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence) position: , mismatch: 4, identity: 0.852

gcaccagttactcctgttgctcccgtt	CRISPR spacer
ggtcccgttactcctgttggtcccgtt	Protospacer
*  ** ************* *******

371. spacer 3.69|4812585|27|NC_013406|CRT matches to NZ_CP053933 (Bacillus thuringiensis strain FDAARGOS_794 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.852

gcaccagttactcctgttgctcccgtt	CRISPR spacer
ggacctgttattcctgttgctcccgtc	Protospacer
* *** ****.***************.

372. spacer 3.69|4812585|27|NC_013406|CRT matches to NZ_CP007616 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence) position: , mismatch: 4, identity: 0.852

gcaccagttactcctgttgctcccgtt	CRISPR spacer
ggtcccgttactcctgttggtcccgtt	Protospacer
*  ** ************* *******

373. spacer 3.69|4812585|27|NC_013406|CRT matches to NZ_CP009718 (Bacillus thuringiensis strain HD682 plasmid pBGN_2, complete sequence) position: , mismatch: 4, identity: 0.852

gcaccagttactcctgttgctcccgtt	CRISPR spacer
ggacctgttattcctgttgctcccgtc	Protospacer
* *** ****.***************.

374. spacer 3.73|4812810|36|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.889

acacctgtcgctcctgttactcctgttgctcctgtt	CRISPR spacer
gctcctgttgctcctgttgctcctgttgctcctgtt	Protospacer
.* *****.*********.*****************

375. spacer 3.73|4812810|36|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.889

acacctgtcgctcctgttactcctgttgctcctgtt	CRISPR spacer
gctcctgttgctcctgttgctcctgttgctcctgtt	Protospacer
.* *****.*********.*****************

376. spacer 3.73|4812810|36|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.889

acacctgtcgctcctgttactcctgttgctcctgtt	CRISPR spacer
gctcctgttgctcctgttgctcctgttgctcctgtt	Protospacer
.* *****.*********.*****************

377. spacer 3.73|4812810|36|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.889

acacctgtcgctcctgttactcctgttgctcctgtt	CRISPR spacer
gctcctgttgctcctgttgctcctgttgctcctgtt	Protospacer
.* *****.*********.*****************

378. spacer 3.73|4812810|36|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.889

acacctgtcgctcctgttactcctgttgctcctgtt	CRISPR spacer
gctcctgttgctcctgttgctcctgttgctcctgtt	Protospacer
.* *****.*********.*****************

379. spacer 3.73|4812810|36|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.889

acacctgtcgctcctgttactcctgttgctcctgtt	CRISPR spacer
gctcctgttgctcctgttgctcctgttgctcctgtt	Protospacer
.* *****.*********.*****************

380. spacer 3.73|4812810|36|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.889

acacctgtcgctcctgttactcctgttgctcctgtt	CRISPR spacer
gctcctgttgctcctgttgctcctgttgctcctgtt	Protospacer
.* *****.*********.*****************

381. spacer 3.73|4812810|36|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.889

acacctgtcgctcctgttactcctgttgctcctgtt	CRISPR spacer
gctcctgttgctcctgttgctcctgttgctcctgtt	Protospacer
.* *****.*********.*****************

382. spacer 3.73|4812810|36|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.889

acacctgtcgctcctgttactcctgttgctcctgtt	CRISPR spacer
gctcctgttgctcctgttgctcctgttgctcctgtt	Protospacer
.* *****.*********.*****************

383. spacer 3.73|4812810|36|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.889

acacctgtcgctcctgttactcctgttgctcctgtt	CRISPR spacer
gctcctgttgctcctgttgctcctgttgctcctgtt	Protospacer
.* *****.*********.*****************

384. spacer 3.73|4812810|36|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.889

acacctgtcgctcctgttactcctgttgctcctgtt	CRISPR spacer
gctcctgttgctcctgttgctcctgttgctcctgtt	Protospacer
.* *****.*********.*****************

385. spacer 3.73|4812810|36|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.889

acacctgtcgctcctgttactcctgttgctcctgtt	CRISPR spacer
gctcctgttgctcctgttgctcctgttgctcctgtt	Protospacer
.* *****.*********.*****************

386. spacer 3.73|4812810|36|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.889

acacctgtcgctcctgttactcctgttgctcctgtt	CRISPR spacer
gctcctgttgctcctgttgctcctgttgctcctgtt	Protospacer
.* *****.*********.*****************

387. spacer 3.73|4812810|36|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.889

acacctgtcgctcctgttactcctgttgctcctgtt	CRISPR spacer
gctcctgttgctcctgttgctcctgttgctcctgtt	Protospacer
.* *****.*********.*****************

388. spacer 3.73|4812810|36|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.889

acacctgtcgctcctgttactcctgttgctcctgtt	CRISPR spacer
gctcctgttgctcctgttgctcctgttgctcctgtt	Protospacer
.* *****.*********.*****************

389. spacer 3.73|4812810|36|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.889

acacctgtcgctcctgttactcctgttgctcctgtt	CRISPR spacer
tctcctgttgctcctgttgctcctgttgctcctgtt	Protospacer
 * *****.*********.*****************

390. spacer 3.73|4812810|36|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.889

acacctgtcgctcctgttactcctgttgctcctgtt	CRISPR spacer
gctcctgttgctcctgttgctcctgttgctcctgtt	Protospacer
.* *****.*********.*****************

391. spacer 3.73|4812810|36|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.889

acacctgtcgctcctgttactcctgttgctcctgtt	CRISPR spacer
gctcctgttgctcctgttgctcctgttgctcctgtt	Protospacer
.* *****.*********.*****************

392. spacer 3.73|4812810|36|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.889

acacctgtcgctcctgttactcctgttgctcctgtt	CRISPR spacer
gctcctgttgctcctgttgctcctgttgctcctgtt	Protospacer
.* *****.*********.*****************

393. spacer 3.73|4812810|36|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.889

acacctgtcgctcctgttactcctgttgctcctgtt	CRISPR spacer
gctcctgttgctcctgttgctcctgttgctcctgtt	Protospacer
.* *****.*********.*****************

394. spacer 3.73|4812810|36|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.889

acacctgtcgctcctgttactcctgttgctcctgtt	CRISPR spacer
gctcctgttgctcctgttgctcctgttgctcctgtt	Protospacer
.* *****.*********.*****************

395. spacer 3.73|4812810|36|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.889

acacctgtcgctcctgttactcctgttgctcctgtt	CRISPR spacer
gctcctgttgctcctgttgctcctgttgctcctgtt	Protospacer
.* *****.*********.*****************

396. spacer 3.73|4812810|36|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.889

acacctgtcgctcctgttactcctgttgctcctgtt	CRISPR spacer
gctcctgttgctcctgttgctcctgttgctcctgtt	Protospacer
.* *****.*********.*****************

397. spacer 3.73|4812810|36|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 4, identity: 0.889

acacctgtcgctcctgttactcctgttgctcctgtt	CRISPR spacer
gctcctgttgctcccgttactcctgttgctcctgtt	Protospacer
.* *****.*****.*********************

398. spacer 3.73|4812810|36|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 4, identity: 0.889

acacctgtcgctcctgttactcctgttgctcctgtt	CRISPR spacer
gctcctgttgctcccgttactcctgttgctcctgtt	Protospacer
.* *****.*****.*********************

399. spacer 3.73|4812810|36|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 4, identity: 0.889

acacctgtcgctcctgttactcctgttgctcctgtt	CRISPR spacer
gctcctgttgctcccgttactcctgttgctcctgtt	Protospacer
.* *****.*****.*********************

400. spacer 3.73|4812810|36|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 4, identity: 0.889

acacctgtcgctcctgttactcctgttgctcctgtt	CRISPR spacer
gctcctgttgctcccgttactcctgttgctcctgtt	Protospacer
.* *****.*****.*********************

401. spacer 3.73|4812810|36|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 4, identity: 0.889

acacctgtcgctcctgttactcctgttgctcctgtt	CRISPR spacer
gctcctgttgctcccgttactcctgttgctcctgtt	Protospacer
.* *****.*****.*********************

402. spacer 3.73|4812810|36|NC_013406|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 4, identity: 0.889

acacctgtcgctcctgttactcctgttgctcctgtt	CRISPR spacer
gctcctgttgctcccgttactcctgttgctcctgtt	Protospacer
.* *****.*****.*********************

403. spacer 3.73|4812810|36|NC_013406|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 4, identity: 0.889

acacctgtcgctcctgttactcctgttgctcctgtt	CRISPR spacer
gctcctgttgctcccgttactcctgttgctcctgtt	Protospacer
.* *****.*****.*********************

404. spacer 3.90|4814018|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

gcaccagttactcctgttgctcccgtg	CRISPR spacer
tcaccagttacccctgttgctcctgtt	Protospacer
 **********.***********.**

405. spacer 3.90|4814018|27|NC_013406|CRT matches to NZ_CP053933 (Bacillus thuringiensis strain FDAARGOS_794 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.852

gcaccagttactcctgttgctcccgtg	CRISPR spacer
ggacctgttattcctgttgctcccgtc	Protospacer
* *** ****.***************

406. spacer 3.90|4814018|27|NC_013406|CRT matches to NZ_CP053936 (Bacillus thuringiensis strain FDAARGOS_794 plasmid unnamed4, complete sequence) position: , mismatch: 4, identity: 0.852

gcaccagttactcctgttgctcccgtg	CRISPR spacer
ggacctgttattcctgttgctcccgtc	Protospacer
* *** ****.***************

407. spacer 3.90|4814018|27|NC_013406|CRT matches to NZ_CP009718 (Bacillus thuringiensis strain HD682 plasmid pBGN_2, complete sequence) position: , mismatch: 4, identity: 0.852

gcaccagttactcctgttgctcccgtg	CRISPR spacer
ggacctgttattcctgttgctcccgtc	Protospacer
* *** ****.***************

408. spacer 3.91|4814063|36|NC_013406|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.889

gttcctgttaccccggttgctcctgttaccccggct	CRISPR spacer
gctcctgttgccccggttgctcctgttgccccggtt	Protospacer
*.*******.*****************.******.*

409. spacer 3.93|4814162|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

gctcctgttacccctgttgctccggtt	CRISPR spacer
actcctgttaaccctgttactccggtc	Protospacer
.********* *******.*******.

410. spacer 3.93|4814162|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

gctcctgttacccctgttgctccggtt	CRISPR spacer
tcaccagttacccctgttgctcctgtt	Protospacer
 * ** ***************** ***

411. spacer 3.93|4814162|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

gctcctgttacccctgttgctccggtt	CRISPR spacer
gctccggttactcctgttgctcctgct	Protospacer
***** *****.*********** *.*

412. spacer 3.93|4814162|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

gctcctgttacccctgttgctccggtt	CRISPR spacer
gctcctgttgctcctgttgctcctgct	Protospacer
*********.*.*********** *.*

413. spacer 3.93|4814162|27|NC_013406|CRT matches to NC_015057 (Granulicella tundricola MP5ACTX9 plasmid pACIX901, complete sequence) position: , mismatch: 4, identity: 0.852

gctcctgttacccctgttgctccggtt	CRISPR spacer
gctcctgttgcccctgttgcgccggca	Protospacer
*********.********** ****.

414. spacer 3.93|4814162|27|NC_013406|CRT matches to KX856662 (Klebsiella phage KP-Rio/2015, complete genome) position: , mismatch: 4, identity: 0.852

gctcctgttacccctgttgctccggtt	CRISPR spacer
gctcctgctacccctgctgctccggca	Protospacer
*******.********.********.

415. spacer 3.93|4814162|27|NC_013406|CRT matches to NZ_CP014284 (Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence) position: , mismatch: 4, identity: 0.852

gctcctgttacccctgttgctccggtt	CRISPR spacer
ggtcccgttaccccggttgctccggtg	Protospacer
* ***.******** ***********

416. spacer 3.93|4814162|27|NC_013406|CRT matches to NZ_CP032609 (Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence) position: , mismatch: 4, identity: 0.852

gctcctgttacccctgttgctccggtt	CRISPR spacer
ggtcccgttaccccggttgctccggtg	Protospacer
* ***.******** ***********

417. spacer 3.93|4814162|27|NC_013406|CRT matches to MT090077 (Klebsiella phage CX1, complete genome) position: , mismatch: 4, identity: 0.852

gctcctgttacccctgttgctccggtt	CRISPR spacer
gctcctgctacccctgtggctcctgct	Protospacer
*******.********* ***** *.*

418. spacer 3.93|4814162|27|NC_013406|CRT matches to KF437907 (Phormidium phage MIS-PhV1A, complete genome) position: , mismatch: 4, identity: 0.852

gctcctgttacccctgttgctccggtt	CRISPR spacer
gctcctgttgctcctgttgctcctttt	Protospacer
*********.*.***********  **

419. spacer 3.95|4814243|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

gcccctgtttctccggttactcctgtt	CRISPR spacer
actccggttgctccggttactcctgtt	Protospacer
.*.** *** *****************

420. spacer 3.95|4814243|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

gcccctgtttctccggttactcctgtt	CRISPR spacer
gttcctgttgctccggttactcccgtt	Protospacer
*..****** *************.***

421. spacer 3.105|4814684|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

gctcccgtagttcctgttgctcccgtg	CRISPR spacer
gctcccgttgctcctgttgctcccatt	Protospacer
******** *.*************.*

422. spacer 3.105|4814684|27|NC_013406|CRT matches to NC_019515 (Bacillus phage BCD7, complete genome) position: , mismatch: 4, identity: 0.852

gctcccgtagttcctgttgctcc-cgtg	CRISPR spacer
gctcccgtagttcctaatgctccacgc-	Protospacer
***************. ****** **.

423. spacer 3.106|4814729|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.852

gctccggttgctcccgtagctcccgta	CRISPR spacer
actccggctgctcccgttgctcccgtc	Protospacer
.******.********* ********

424. spacer 3.106|4814729|27|NC_013406|CRT matches to MG209611 (Aphanizomenon phage vB_AphaS-CL131, complete genome) position: , mismatch: 4, identity: 0.852

gctccggttgctcccgtagctcccgta	CRISPR spacer
gctcccgttgctcccgttgctcctata	Protospacer
***** *********** *****..**

425. spacer 3.106|4814729|27|NC_013406|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 4, identity: 0.852

gctccggttgctcccgtagctcccgta	CRISPR spacer
gctccggttgctcccgttgctccgatt	Protospacer
***************** ***** .*

426. spacer 3.106|4814729|27|NC_013406|CRT matches to NZ_CP004875 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB95, complete sequence) position: , mismatch: 4, identity: 0.852

gctccggttgctcccgtagctcccgta	CRISPR spacer
agtccggttggtcccgtatctcccgta	Protospacer
. ******** ******* ********

427. spacer 3.106|4814729|27|NC_013406|CRT matches to NC_014025 (Bacillus megaterium QM B1551 plasmid pBM500, complete sequence) position: , mismatch: 4, identity: 0.852

gctccggttgctcccgtagctcccgta	CRISPR spacer
actccggtagctccggtagctcccgtg	Protospacer
.******* ***** ***********.

428. spacer 3.106|4814729|27|NC_013406|CRT matches to NC_014025 (Bacillus megaterium QM B1551 plasmid pBM500, complete sequence) position: , mismatch: 4, identity: 0.852

gctccggttgctcccgtagctcccgta	CRISPR spacer
actccggtagctccggtagctcccgtg	Protospacer
.******* ***** ***********.

429. spacer 3.106|4814729|27|NC_013406|CRT matches to NZ_CP019235 (Bacillus thuringiensis strain YGd22-03 plasmid pYGD98, complete sequence) position: , mismatch: 4, identity: 0.852

gctccggttgctcccgtagctcccgta	CRISPR spacer
actccggttgctcctgtaggtcccgtc	Protospacer
.*************.**** ******

430. spacer 3.106|4814729|27|NC_013406|CRT matches to NZ_CP011357 (Bacillus thuringiensis strain YC-10 plasmid pYC20, complete sequence) position: , mismatch: 4, identity: 0.852

gctccggttgctcccgtagctcccgta	CRISPR spacer
agtccggttggtcccgtatctcccgta	Protospacer
. ******** ******* ********

431. spacer 3.106|4814729|27|NC_013406|CRT matches to NZ_CP015155 (Bacillus thuringiensis strain Bc601 plasmid pBTBC5, complete sequence) position: , mismatch: 4, identity: 0.852

gctccggttgctcccgtagctcccgta	CRISPR spacer
agtccggttggtcccgtatctcccgta	Protospacer
. ******** ******* ********

432. spacer 3.106|4814729|27|NC_013406|CRT matches to NZ_CP015156 (Bacillus thuringiensis strain Bc601 plasmid pBTBC6, complete sequence) position: , mismatch: 4, identity: 0.852

gctccggttgctcccgtagctcccgta	CRISPR spacer
agtccggttggtcccgtatctcccgta	Protospacer
. ******** ******* ********

433. spacer 3.106|4814729|27|NC_013406|CRT matches to NZ_CP011358 (Bacillus thuringiensis strain YC-10 plasmid pYC2226, complete sequence) position: , mismatch: 4, identity: 0.852

gctccggttgctcccgtagctcccgta	CRISPR spacer
agtccggttggtcccgtatctcccgta	Protospacer
. ******** ******* ********

434. spacer 3.106|4814729|27|NC_013406|CRT matches to NZ_CP013057 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-2, complete sequence) position: , mismatch: 4, identity: 0.852

gctccggttgctcccgtagctcccgta	CRISPR spacer
agtccggttggtcccgtatctcccgta	Protospacer
. ******** ******* ********

435. spacer 3.106|4814729|27|NC_013406|CRT matches to NZ_CP013058 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-3, complete sequence) position: , mismatch: 4, identity: 0.852

gctccggttgctcccgtagctcccgta	CRISPR spacer
agtccggttggtcccgtatctcccgta	Protospacer
. ******** ******* ********

436. spacer 3.106|4814729|27|NC_013406|CRT matches to KM974184 (Pseudomonas phage YH6, complete genome) position: , mismatch: 4, identity: 0.852

gctccggttgctcccgtagctcccgta	CRISPR spacer
gagccggttgctcccgtcgctcccgtc	Protospacer
*  ************** ********

437. spacer 3.106|4814729|27|NC_013406|CRT matches to NZ_CP021356 (Rhodococcus sp. S2-17 plasmid pRB29, complete sequence) position: , mismatch: 4, identity: 0.852

gctccggttgctcccgtagctcccgta	CRISPR spacer
ggtcccgttgctcccgttgctcccgtt	Protospacer
* *** *********** ********

438. spacer 3.106|4814729|27|NC_013406|CRT matches to NZ_CP046575 (Rhodococcus sp. WAY2 plasmid pRWAY03, complete sequence) position: , mismatch: 4, identity: 0.852

gctccggttgctcccgtagctcccgta	CRISPR spacer
ggtcccgttgctcccgttgctcccgtt	Protospacer
* *** *********** ********

439. spacer 3.106|4814729|27|NC_013406|CRT matches to KT381879 (Caulobacter phage Percy, complete genome) position: , mismatch: 4, identity: 0.852

gctccggttgctcccgtagctcccgta	CRISPR spacer
gttccggtagctcccgtagctcccctg	Protospacer
*.****** *************** *.

440. spacer 3.109|4814873|27|NC_013406|CRT matches to AP021851 (Deinococcus grandis ATCC 43672 plasmid: pDEGR-2 DNA, complete genome) position: , mismatch: 4, identity: 0.852

gcaccagtttcaccagtttcaccggtc	CRISPR spacer
gcaccggtttcacctgtttcaccggct	Protospacer
*****.******** **********..

441. spacer 3.122|4815620|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 4, identity: 0.852

actcctgttgctcccgtggcccccgtt	CRISPR spacer
ccccctgttgctcccgttgctcccgtt	Protospacer
 *.************** **.******

442. spacer 3.122|4815620|27|NC_013406|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 4, identity: 0.852

actcctgttgctcccgtggcccccgtt	CRISPR spacer
ccccctgttgctcccgttgctcccgtt	Protospacer
 *.************** **.******

443. spacer 3.6|4809482|27|NC_013406|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 5, identity: 0.815

acccctgttgctcctgttgcaccagtt	CRISPR spacer
ggtcctgttgctcctgttgctcctgtt	Protospacer
. .***************** ** ***

444. spacer 3.6|4809482|27|NC_013406|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 5, identity: 0.815

acccctgttgctcctgttgcaccagtt	CRISPR spacer
ggtcctgttgctcctgttgcccctgtt	Protospacer
. .***************** ** ***

445. spacer 3.6|4809482|27|NC_013406|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 5, identity: 0.815

acccctgttgctcctgttgcaccagtt	CRISPR spacer
ggtcccgttgctcctgttgccccagtt	Protospacer
. .**.************** ******

446. spacer 3.6|4809482|27|NC_013406|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 5, identity: 0.815

acccctgttgctcctgttgcaccagtt	CRISPR spacer
ggtcctgttggtcctgttgccccagtt	Protospacer
. .******* ********* ******

447. spacer 3.6|4809482|27|NC_013406|CRT matches to NZ_CP011156 (Bacillus cereus strain HN001 plasmid pRML01, complete sequence) position: , mismatch: 5, identity: 0.815

acccctgttgctcctgttgcaccagtt	CRISPR spacer
ggacctgttgctcctgttggaccagta	Protospacer
.  **************** ******

448. spacer 3.6|4809482|27|NC_013406|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 5, identity: 0.815

acccctgttgctcctgttgcaccagtt	CRISPR spacer
ggtcctgttggtcctgttgccccagtt	Protospacer
. .******* ********* ******

449. spacer 3.6|4809482|27|NC_013406|CRT matches to AP014262 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S31-C59, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

acccctgttgctcctgttgcaccagtt	CRISPR spacer
gttcctgaagctcctgttgcaccagtt	Protospacer
...****  ******************

450. spacer 3.6|4809482|27|NC_013406|CRT matches to MN693968 (Marine virus AFVG_250M909, complete genome) position: , mismatch: 5, identity: 0.815

acccctgttgctcctgttgcaccagtt	CRISPR spacer
gaacctgttgctccagttgctccagtt	Protospacer
.  *********** ***** ******

451. spacer 3.6|4809482|27|NC_013406|CRT matches to AP013524 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G3, isolate: uvMED-CGR-C7-MedDCM-OCT-S39-C15) position: , mismatch: 5, identity: 0.815

acccctgttgctcctgttgcaccagtt	CRISPR spacer
gcacctgctgctcctgttgcaccagca	Protospacer
.* ****.*****************.

452. spacer 3.6|4809482|27|NC_013406|CRT matches to NZ_CP033971 (Cupriavidus pauculus strain FDAARGOS_614 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

acccctgttgctcctgttgcaccagtt	CRISPR spacer
cacgctgctgcacctgttgcaccagtt	Protospacer
  * ***.*** ***************

453. spacer 3.6|4809482|27|NC_013406|CRT matches to KT070867 (Bacillus phage PBC2, complete genome) position: , mismatch: 5, identity: 0.815

acccctgttgctcctgttgcaccagtt	CRISPR spacer
gcgcctttagctcctgttgcaccagta	Protospacer
.* *** * *****************

454. spacer 3.6|4809482|27|NC_013406|CRT matches to KT321315 (Enterobacter phage phiEap-3, complete genome) position: , mismatch: 5, identity: 0.815

acccctgttgctcctgttgcaccagtt	CRISPR spacer
gctccggttgcacctgttgcaccagta	Protospacer
.*.** ***** **************

455. spacer 3.6|4809482|27|NC_013406|CRT matches to MN101221 (Klebsiella phage KOX8, complete genome) position: , mismatch: 5, identity: 0.815

acccctgttgctcctgttgcaccagtt	CRISPR spacer
gctccggttgcgcctgttgcaccagta	Protospacer
.*.** ***** **************

456. spacer 3.6|4809482|27|NC_013406|CRT matches to MN693189 (Marine virus AFVG_25M326, complete genome) position: , mismatch: 5, identity: 0.815

acccctgttgctcctgttgcaccagtt	CRISPR spacer
gcacctgttgctccagtagcaccagta	Protospacer
.* *********** ** ********

457. spacer 3.6|4809482|27|NC_013406|CRT matches to MN693869 (Marine virus AFVG_250M793, complete genome) position: , mismatch: 5, identity: 0.815

acccctgttgctcctgttgcaccagtt	CRISPR spacer
tcacctgtagctcctgttgctccagtg	Protospacer
 * ***** *********** *****

458. spacer 3.22|4810202|27|NC_013406|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 5, identity: 0.815

tcacctgtagctcctgttgccccagtt	CRISPR spacer
ggtcctgttgctcctgttgcccctgtt	Protospacer
   ***** ************** ***

459. spacer 3.22|4810202|27|NC_013406|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 5, identity: 0.815

tcacctgtagctcctgttgccccagtt	CRISPR spacer
ggtcccgttgctcctgttgccccagtt	Protospacer
   **.** ******************

460. spacer 3.22|4810202|27|NC_013406|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 5, identity: 0.815

tcacctgtagctcctgttgccccagtt	CRISPR spacer
ggtcctgttggtcctgttgccccagtt	Protospacer
   ***** * ****************

461. spacer 3.22|4810202|27|NC_013406|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 5, identity: 0.815

tcacctgtagctcctgttgccccagtt	CRISPR spacer
ggtcctgttggtcctgttgccccagtt	Protospacer
   ***** * ****************

462. spacer 3.22|4810202|27|NC_013406|CRT matches to AP014262 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S31-C59, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

tcacctgtagctcctgttgccccagtt	CRISPR spacer
gttcctgaagctcctgttgcaccagtt	Protospacer
 . **** ************ ******

463. spacer 3.22|4810202|27|NC_013406|CRT matches to MK962638 (Achromobacter phage vB_AxyP_19-32_Axy21, complete genome) position: , mismatch: 5, identity: 0.815

tcacctgtagctcctgttgccccagtt	CRISPR spacer
gcgcctgtcgctcctgttgccccggtg	Protospacer
 *.***** **************.**

464. spacer 3.22|4810202|27|NC_013406|CRT matches to KT070867 (Bacillus phage PBC2, complete genome) position: , mismatch: 5, identity: 0.815

tcacctgtagctcctgttgccccagtt	CRISPR spacer
gcgcctttagctcctgttgcaccagta	Protospacer
 *.*** ************* *****

465. spacer 3.22|4810202|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

tcacctgtagctcctgttgccccagtt	CRISPR spacer
gcccctgtagctcctgtagcccctgta	Protospacer
 * ************** ***** **

466. spacer 3.22|4810202|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

tcacctgtagctcctgttgccccagtt	CRISPR spacer
gcccctgtagctcctgtagcccctgta	Protospacer
 * ************** ***** **

467. spacer 3.22|4810202|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

tcacctgtagctcctgttgccccagtt	CRISPR spacer
actcctgtagctcctgtagcccctgta	Protospacer
 * ************** ***** **

468. spacer 3.22|4810202|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

tcacctgtagctcctgttgccccagtt	CRISPR spacer
gctcctgtagctcctgtagcccctgta	Protospacer
 * ************** ***** **

469. spacer 3.22|4810202|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

tcacctgtagctcctgttgccccagtt	CRISPR spacer
gctcctgtagctcctgtagcccctgta	Protospacer
 * ************** ***** **

470. spacer 3.22|4810202|27|NC_013406|CRT matches to MN694610 (Marine virus AFVG_250M990, complete genome) position: , mismatch: 5, identity: 0.815

tcacctgtagctcctgttgccccagtt	CRISPR spacer
actcctgtagctccgggtgccccagtg	Protospacer
 * *********** * *********

471. spacer 3.23|4810247|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

gctcctgttgttccggttgctcctgtt	CRISPR spacer
gctcctgttgctcctgttgctcctcca	Protospacer
**********.*** ********* .

472. spacer 3.23|4810247|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

gctcctgttgttccggttgctcctgtt	CRISPR spacer
gctcctgttgctcccgttgctcctaaa	Protospacer
**********.*** *********.

473. spacer 3.23|4810247|27|NC_013406|CRT matches to NZ_CP053689 (Arthrobacter citreus strain NEB 577 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

gctcctgttgttccggttgctcctgtt	CRISPR spacer
attcctgttgggccggttgctcctgtc	Protospacer
..********  **************.

474. spacer 3.38|4810958|36|NC_013406|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 5, identity: 0.861

acccccgttgctcctgttgctcctgttacccccgtt	CRISPR spacer
gctcccgttgctcctgttgctcctgttggccccgtc	Protospacer
.*.************************. ******.

475. spacer 3.38|4810958|36|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 5, identity: 0.861

acccccgttgctcctgttgctcctgttacccccgtt	CRISPR spacer
gctcccgttgctcctgttgctcctgttggccccgtc	Protospacer
.*.************************. ******.

476. spacer 3.49|4811577|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
actcctgttgctcctgttgctcccgtc	Protospacer
.* ** ***.****************

477. spacer 3.49|4811577|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
actcctgttgctcctgttgctcccgtt	Protospacer
.* ** ***.****************

478. spacer 3.49|4811577|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
actcctgttgctcctgttgctcccgtt	Protospacer
.* ** ***.****************

479. spacer 3.49|4811577|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
actcctgttgctcctgttgctcccgtt	Protospacer
.* ** ***.****************

480. spacer 3.49|4811577|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
actcctgttgctcctgttgctcccgtt	Protospacer
.* ** ***.****************

481. spacer 3.49|4811577|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
actcctgttgctcctgttgctcccgtt	Protospacer
.* ** ***.****************

482. spacer 3.49|4811577|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
actcctgttactcctgttgctcctgtt	Protospacer
.* ** *****************.**

483. spacer 3.49|4811577|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
ggccccgtcactcctgttgctcccgtt	Protospacer
*  ** **.*****************

484. spacer 3.49|4811577|27|NC_013406|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
ggccccgtcactcctgttgctcccgtt	Protospacer
*  ** **.*****************

485. spacer 3.49|4811577|27|NC_013406|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
actcctgttactcctgttgctcctgtt	Protospacer
.* ** *****************.**

486. spacer 3.49|4811577|27|NC_013406|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
actcctgttgctcctgttgctcccgtt	Protospacer
.* ** ***.****************

487. spacer 3.49|4811577|27|NC_013406|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
actcctgttgctcctgttgctcccgtt	Protospacer
.* ** ***.****************

488. spacer 3.49|4811577|27|NC_013406|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
actcctgttgctcctgttgctcccgtc	Protospacer
.* ** ***.****************

489. spacer 3.49|4811577|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
gctccggttactcctgttgctcctgct	Protospacer
** **.*****************.*.

490. spacer 3.49|4811577|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
actcctgttattcctgttgctcccgtt	Protospacer
.* ** ****.***************

491. spacer 3.49|4811577|27|NC_013406|CRT matches to NZ_CP004877 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
ggtcccgttactcctgttggtcccgtt	Protospacer
*  ** ************* ******

492. spacer 3.49|4811577|27|NC_013406|CRT matches to NZ_CP004877 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
ggtcccgttactcctgttggtcccgta	Protospacer
*  ** ************* ******.

493. spacer 3.49|4811577|27|NC_013406|CRT matches to NZ_CP012367 (Enterococcus durans strain KLDS 6.0933 plasmid unnamed 1, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
actccagttactccagttgctccagtc	Protospacer
.* *********** ******** **

494. spacer 3.49|4811577|27|NC_013406|CRT matches to NZ_CP012385 (Enterococcus durans strain KLDS 6.0930 plasmid unnamed 1, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
actccagttactccagttgctccagtc	Protospacer
.* *********** ******** **

495. spacer 3.49|4811577|27|NC_013406|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
ggtcccgttactcctgttggtcccgtt	Protospacer
*  ** ************* ******

496. spacer 3.49|4811577|27|NC_013406|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
ggtcccgttactcctgttggtcccgta	Protospacer
*  ** ************* ******.

497. spacer 3.49|4811577|27|NC_013406|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
ggtcccgttactcctgttggtcccgtt	Protospacer
*  ** ************* ******

498. spacer 3.49|4811577|27|NC_013406|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
ggtcccgttactcctgttggtcccgta	Protospacer
*  ** ************* ******.

499. spacer 3.49|4811577|27|NC_013406|CRT matches to NZ_CP007616 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
ggtcccgttactcctgttggtcccgta	Protospacer
*  ** ************* ******.

500. spacer 3.49|4811577|27|NC_013406|CRT matches to NZ_CP007616 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
ggtcccgttactcctgttggtcccgtt	Protospacer
*  ** ************* ******

501. spacer 3.49|4811577|27|NC_013406|CRT matches to NZ_CP004860 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
ggtcccgttactcctgttggtcccgtt	Protospacer
*  ** ************* ******

502. spacer 3.49|4811577|27|NC_013406|CRT matches to NZ_CP004860 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
ggtcccgttactcctgttggtcccgta	Protospacer
*  ** ************* ******.

503. spacer 3.49|4811577|27|NC_013406|CRT matches to NZ_CP053689 (Arthrobacter citreus strain NEB 577 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
gggcctgttgctcctgttgctcccgtc	Protospacer
* .** ***.****************

504. spacer 3.49|4811577|27|NC_013406|CRT matches to AP014420 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C24-MedDCM-OCT-S43-C167, *** SEQUENCING IN PROGRESS ***, 5 ordered pieces) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
ccacctgttgctcctgttgctcccata	Protospacer
 **** ***.**************.*.

505. spacer 3.49|4811577|27|NC_013406|CRT matches to JX181825 (Salmonella phage STML-198, complete genome) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
tcaccagatactccttttgctcccaag	Protospacer
 ****** ******* ********. *

506. spacer 3.49|4811577|27|NC_013406|CRT matches to NC_042044 (Salmonella phage Melville, complete genome) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
tcaccagatactccttttgctcccaag	Protospacer
 ****** ******* ********. *

507. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

tctccggttactcctgttgctcctgtg	CRISPR spacer
ggaccggatactcctgttgctcctgtt	Protospacer
   **** ******************

508. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcctgttgctcctgttgctcctgct	Protospacer
 **** ***.***************.

509. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 5, identity: 0.815

tctccggttactcctgttgctcctgtg	CRISPR spacer
ggtcctgttgctcctgttgctcctgtt	Protospacer
  *** ***.****************

510. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP004875 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB95, complete sequence) position: , mismatch: 5, identity: 0.815

tctccggttactcctgttgctcctgtg	CRISPR spacer
agtccggttggtcctgttgctcctgtt	Protospacer
  *******. ***************

511. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP014284 (Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence) position: , mismatch: 5, identity: 0.815

tctccggttactcctgttgctcctgtg	CRISPR spacer
gatcccgttactcctgtggctcctgtt	Protospacer
  *** *********** ********

512. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP014284 (Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence) position: , mismatch: 5, identity: 0.815

tctccggttactcctgttgctcctgtg	CRISPR spacer
gcaccggttactcctgttggtcccgtt	Protospacer
 * **************** ***.**

513. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP011357 (Bacillus thuringiensis strain YC-10 plasmid pYC20, complete sequence) position: , mismatch: 5, identity: 0.815

tctccggttactcctgttgctcctgtg	CRISPR spacer
agtccggttggtcctgttgctcctgtt	Protospacer
  *******. ***************

514. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP015155 (Bacillus thuringiensis strain Bc601 plasmid pBTBC5, complete sequence) position: , mismatch: 5, identity: 0.815

tctccggttactcctgttgctcctgtg	CRISPR spacer
agtccggttggtcctgttgctcctgtt	Protospacer
  *******. ***************

515. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP015156 (Bacillus thuringiensis strain Bc601 plasmid pBTBC6, complete sequence) position: , mismatch: 5, identity: 0.815

tctccggttactcctgttgctcctgtg	CRISPR spacer
agtccggttggtcctgttgctcctgtt	Protospacer
  *******. ***************

516. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP032609 (Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence) position: , mismatch: 5, identity: 0.815

tctccggttactcctgttgctcctgtg	CRISPR spacer
gatcccgttactcctgtggctcctgtt	Protospacer
  *** *********** ********

517. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP032609 (Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence) position: , mismatch: 5, identity: 0.815

tctccggttactcctgttgctcctgtg	CRISPR spacer
gcaccggttactcctgttggtcccgtt	Protospacer
 * **************** ***.**

518. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP007616 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence) position: , mismatch: 5, identity: 0.815

tctccggttactcctgttgctcctgtg	CRISPR spacer
ggtccggttggtcctgttgctcctgtt	Protospacer
  *******. ***************

519. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 5, identity: 0.815

tctccggttactcctgttgctcctgtg	CRISPR spacer
ggtccggttggtcctgttgctcctgtt	Protospacer
  *******. ***************

520. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP004877 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence) position: , mismatch: 5, identity: 0.815

tctccggttactcctgttgctcctgtg	CRISPR spacer
ggtccggttggtcctgttgctcctgtt	Protospacer
  *******. ***************

521. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 5, identity: 0.815

tctccggttactcctgttgctcctgtg	CRISPR spacer
ggtccggttggtcctgttgctcctgtt	Protospacer
  *******. ***************

522. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP011358 (Bacillus thuringiensis strain YC-10 plasmid pYC2226, complete sequence) position: , mismatch: 5, identity: 0.815

tctccggttactcctgttgctcctgtg	CRISPR spacer
agtccggttggtcctgttgctcctgtt	Protospacer
  *******. ***************

523. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 5, identity: 0.815

tctccggttactcctgttgctcctgtg	CRISPR spacer
ggtccggttggtcctgttgctcctgtt	Protospacer
  *******. ***************

524. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP013057 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-2, complete sequence) position: , mismatch: 5, identity: 0.815

tctccggttactcctgttgctcctgtg	CRISPR spacer
agtccggttggtcctgttgctcctgtt	Protospacer
  *******. ***************

525. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP013058 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-3, complete sequence) position: , mismatch: 5, identity: 0.815

tctccggttactcctgttgctcctgtg	CRISPR spacer
agtccggttggtcctgttgctcctgtt	Protospacer
  *******. ***************

526. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP004860 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence) position: , mismatch: 5, identity: 0.815

tctccggttactcctgttgctcctgtg	CRISPR spacer
ggtccggttggtcctgttgctcctgtt	Protospacer
  *******. ***************

527. spacer 3.53|4811820|27|NC_013406|CRT matches to KF437907 (Phormidium phage MIS-PhV1A, complete genome) position: , mismatch: 5, identity: 0.815

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcctgttgctcctgttgctcctttt	Protospacer
 **** ***.************** *

528. spacer 3.58|4812081|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
actcctgttgctcctgttgctcccgtc	Protospacer
.* ** ***.****************

529. spacer 3.58|4812081|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
actcctgttgctcctgttgctcccgtt	Protospacer
.* ** ***.****************

530. spacer 3.58|4812081|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
actcctgttgctcctgttgctcccgtt	Protospacer
.* ** ***.****************

531. spacer 3.58|4812081|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
actcctgttgctcctgttgctcccgtt	Protospacer
.* ** ***.****************

532. spacer 3.58|4812081|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
actcctgttgctcctgttgctcccgtt	Protospacer
.* ** ***.****************

533. spacer 3.58|4812081|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
actcctgttgctcctgttgctcccgtt	Protospacer
.* ** ***.****************

534. spacer 3.58|4812081|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
actcctgttactcctgttgctcctgtt	Protospacer
.* ** *****************.**

535. spacer 3.58|4812081|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
ggccccgtcactcctgttgctcccgtt	Protospacer
*  ** **.*****************

536. spacer 3.58|4812081|27|NC_013406|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
ggccccgtcactcctgttgctcccgtt	Protospacer
*  ** **.*****************

537. spacer 3.58|4812081|27|NC_013406|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
actcctgttactcctgttgctcctgtt	Protospacer
.* ** *****************.**

538. spacer 3.58|4812081|27|NC_013406|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
actcctgttgctcctgttgctcccgtt	Protospacer
.* ** ***.****************

539. spacer 3.58|4812081|27|NC_013406|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
actcctgttgctcctgttgctcccgtt	Protospacer
.* ** ***.****************

540. spacer 3.58|4812081|27|NC_013406|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
actcctgttgctcctgttgctcccgtc	Protospacer
.* ** ***.****************

541. spacer 3.58|4812081|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
gctccggttactcctgttgctcctgct	Protospacer
** **.*****************.*.

542. spacer 3.58|4812081|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
actcctgttattcctgttgctcccgtt	Protospacer
.* ** ****.***************

543. spacer 3.58|4812081|27|NC_013406|CRT matches to NZ_CP004877 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
ggtcccgttactcctgttggtcccgtt	Protospacer
*  ** ************* ******

544. spacer 3.58|4812081|27|NC_013406|CRT matches to NZ_CP004877 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
ggtcccgttactcctgttggtcccgta	Protospacer
*  ** ************* ******.

545. spacer 3.58|4812081|27|NC_013406|CRT matches to NZ_CP012367 (Enterococcus durans strain KLDS 6.0933 plasmid unnamed 1, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
actccagttactccagttgctccagtc	Protospacer
.* *********** ******** **

546. spacer 3.58|4812081|27|NC_013406|CRT matches to NZ_CP012385 (Enterococcus durans strain KLDS 6.0930 plasmid unnamed 1, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
actccagttactccagttgctccagtc	Protospacer
.* *********** ******** **

547. spacer 3.58|4812081|27|NC_013406|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
ggtcccgttactcctgttggtcccgtt	Protospacer
*  ** ************* ******

548. spacer 3.58|4812081|27|NC_013406|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
ggtcccgttactcctgttggtcccgta	Protospacer
*  ** ************* ******.

549. spacer 3.58|4812081|27|NC_013406|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
ggtcccgttactcctgttggtcccgtt	Protospacer
*  ** ************* ******

550. spacer 3.58|4812081|27|NC_013406|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
ggtcccgttactcctgttggtcccgta	Protospacer
*  ** ************* ******.

551. spacer 3.58|4812081|27|NC_013406|CRT matches to NZ_CP007616 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
ggtcccgttactcctgttggtcccgta	Protospacer
*  ** ************* ******.

552. spacer 3.58|4812081|27|NC_013406|CRT matches to NZ_CP007616 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
ggtcccgttactcctgttggtcccgtt	Protospacer
*  ** ************* ******

553. spacer 3.58|4812081|27|NC_013406|CRT matches to NZ_CP004860 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
ggtcccgttactcctgttggtcccgtt	Protospacer
*  ** ************* ******

554. spacer 3.58|4812081|27|NC_013406|CRT matches to NZ_CP004860 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
ggtcccgttactcctgttggtcccgta	Protospacer
*  ** ************* ******.

555. spacer 3.58|4812081|27|NC_013406|CRT matches to NZ_CP053689 (Arthrobacter citreus strain NEB 577 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
gggcctgttgctcctgttgctcccgtc	Protospacer
* .** ***.****************

556. spacer 3.58|4812081|27|NC_013406|CRT matches to AP014420 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C24-MedDCM-OCT-S43-C167, *** SEQUENCING IN PROGRESS ***, 5 ordered pieces) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
ccacctgttgctcctgttgctcccata	Protospacer
 **** ***.**************.*.

557. spacer 3.58|4812081|27|NC_013406|CRT matches to JX181825 (Salmonella phage STML-198, complete genome) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
tcaccagatactccttttgctcccaag	Protospacer
 ****** ******* ********. *

558. spacer 3.58|4812081|27|NC_013406|CRT matches to NC_042044 (Salmonella phage Melville, complete genome) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
tcaccagatactccttttgctcccaag	Protospacer
 ****** ******* ********. *

559. spacer 3.61|4812198|27|NC_013406|CRT matches to NZ_CP012367 (Enterococcus durans strain KLDS 6.0933 plasmid unnamed 1, complete sequence) position: , mismatch: 5, identity: 0.815

gcccctgttactccagtcgctccagtt	CRISPR spacer
actccagttactccagttgctccagtc	Protospacer
.*.** ***********.********.

560. spacer 3.61|4812198|27|NC_013406|CRT matches to NZ_CP012385 (Enterococcus durans strain KLDS 6.0930 plasmid unnamed 1, complete sequence) position: , mismatch: 5, identity: 0.815

gcccctgttactccagtcgctccagtt	CRISPR spacer
actccagttactccagttgctccagtc	Protospacer
.*.** ***********.********.

561. spacer 3.62|4812243|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

acccctgttgctccggttgctccggtt	CRISPR spacer
gttcctgttgctccggttactcccgtt	Protospacer
...***************.**** ***

562. spacer 3.62|4812243|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

acccctgttgctccggttgctccggtt	CRISPR spacer
gctcccgttgctcccgttgctccggtc	Protospacer
.*.**.******** ***********.

563. spacer 3.62|4812243|27|NC_013406|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 5, identity: 0.815

acccctgttgctccggttgctccggtt	CRISPR spacer
ggtcctgttgctcctgttgctcctgtt	Protospacer
. .*********** ******** ***

564. spacer 3.62|4812243|27|NC_013406|CRT matches to NZ_CP040345 (Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

acccctgttgctccggttgctccggtt	CRISPR spacer
gaacctgttgctcccgttggtccggtt	Protospacer
.  *********** **** *******

565. spacer 3.62|4812243|27|NC_013406|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 5, identity: 0.815

acccctgttgctccggttgctccggtt	CRISPR spacer
gcttccgttgctccgattgctccggtt	Protospacer
.*..*.*********.***********

566. spacer 3.62|4812243|27|NC_013406|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 5, identity: 0.815

acccctgttgctccggttgctccggtt	CRISPR spacer
gcttccgttgctccggttgctccgatt	Protospacer
.*..*.******************.**

567. spacer 3.62|4812243|27|NC_013406|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 5, identity: 0.815

acccctgttgctccggttgctccggtt	CRISPR spacer
gcttccgttgctccgattgctccggtt	Protospacer
.*..*.*********.***********

568. spacer 3.62|4812243|27|NC_013406|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 5, identity: 0.815

acccctgttgctccggttgctccggtt	CRISPR spacer
gcttccgttgctccgattgctccggtt	Protospacer
.*..*.*********.***********

569. spacer 3.62|4812243|27|NC_013406|CRT matches to MN693968 (Marine virus AFVG_250M909, complete genome) position: , mismatch: 5, identity: 0.815

acccctgttgctccggttgctccggtt	CRISPR spacer
gaacctgttgctccagttgctccagtt	Protospacer
.  ***********.********.***

570. spacer 3.62|4812243|27|NC_013406|CRT matches to MN855854 (Siphoviridae sp. isolate 269, complete genome) position: , mismatch: 5, identity: 0.815

acccctgttgctccggttgctccggtt	CRISPR spacer
gcacctgttgctccggtggctcctgtg	Protospacer
.* ************** ***** **

571. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

tctccggttactcctgttgctcctgtg	CRISPR spacer
ggaccggatactcctgttgctcctgtt	Protospacer
   **** ******************

572. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcctgttgctcctgttgctcctgct	Protospacer
 **** ***.***************.

573. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 5, identity: 0.815

tctccggttactcctgttgctcctgtg	CRISPR spacer
ggtcctgttgctcctgttgctcctgtt	Protospacer
  *** ***.****************

574. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP004875 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB95, complete sequence) position: , mismatch: 5, identity: 0.815

tctccggttactcctgttgctcctgtg	CRISPR spacer
agtccggttggtcctgttgctcctgtt	Protospacer
  *******. ***************

575. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP014284 (Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence) position: , mismatch: 5, identity: 0.815

tctccggttactcctgttgctcctgtg	CRISPR spacer
gatcccgttactcctgtggctcctgtt	Protospacer
  *** *********** ********

576. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP014284 (Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence) position: , mismatch: 5, identity: 0.815

tctccggttactcctgttgctcctgtg	CRISPR spacer
gcaccggttactcctgttggtcccgtt	Protospacer
 * **************** ***.**

577. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP011357 (Bacillus thuringiensis strain YC-10 plasmid pYC20, complete sequence) position: , mismatch: 5, identity: 0.815

tctccggttactcctgttgctcctgtg	CRISPR spacer
agtccggttggtcctgttgctcctgtt	Protospacer
  *******. ***************

578. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP015155 (Bacillus thuringiensis strain Bc601 plasmid pBTBC5, complete sequence) position: , mismatch: 5, identity: 0.815

tctccggttactcctgttgctcctgtg	CRISPR spacer
agtccggttggtcctgttgctcctgtt	Protospacer
  *******. ***************

579. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP015156 (Bacillus thuringiensis strain Bc601 plasmid pBTBC6, complete sequence) position: , mismatch: 5, identity: 0.815

tctccggttactcctgttgctcctgtg	CRISPR spacer
agtccggttggtcctgttgctcctgtt	Protospacer
  *******. ***************

580. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP032609 (Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence) position: , mismatch: 5, identity: 0.815

tctccggttactcctgttgctcctgtg	CRISPR spacer
gatcccgttactcctgtggctcctgtt	Protospacer
  *** *********** ********

581. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP032609 (Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence) position: , mismatch: 5, identity: 0.815

tctccggttactcctgttgctcctgtg	CRISPR spacer
gcaccggttactcctgttggtcccgtt	Protospacer
 * **************** ***.**

582. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP007616 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence) position: , mismatch: 5, identity: 0.815

tctccggttactcctgttgctcctgtg	CRISPR spacer
ggtccggttggtcctgttgctcctgtt	Protospacer
  *******. ***************

583. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 5, identity: 0.815

tctccggttactcctgttgctcctgtg	CRISPR spacer
ggtccggttggtcctgttgctcctgtt	Protospacer
  *******. ***************

584. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP004877 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence) position: , mismatch: 5, identity: 0.815

tctccggttactcctgttgctcctgtg	CRISPR spacer
ggtccggttggtcctgttgctcctgtt	Protospacer
  *******. ***************

585. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 5, identity: 0.815

tctccggttactcctgttgctcctgtg	CRISPR spacer
ggtccggttggtcctgttgctcctgtt	Protospacer
  *******. ***************

586. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP011358 (Bacillus thuringiensis strain YC-10 plasmid pYC2226, complete sequence) position: , mismatch: 5, identity: 0.815

tctccggttactcctgttgctcctgtg	CRISPR spacer
agtccggttggtcctgttgctcctgtt	Protospacer
  *******. ***************

587. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 5, identity: 0.815

tctccggttactcctgttgctcctgtg	CRISPR spacer
ggtccggttggtcctgttgctcctgtt	Protospacer
  *******. ***************

588. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP013057 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-2, complete sequence) position: , mismatch: 5, identity: 0.815

tctccggttactcctgttgctcctgtg	CRISPR spacer
agtccggttggtcctgttgctcctgtt	Protospacer
  *******. ***************

589. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP013058 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-3, complete sequence) position: , mismatch: 5, identity: 0.815

tctccggttactcctgttgctcctgtg	CRISPR spacer
agtccggttggtcctgttgctcctgtt	Protospacer
  *******. ***************

590. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP004860 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence) position: , mismatch: 5, identity: 0.815

tctccggttactcctgttgctcctgtg	CRISPR spacer
ggtccggttggtcctgttgctcctgtt	Protospacer
  *******. ***************

591. spacer 3.64|4812324|27|NC_013406|CRT matches to KF437907 (Phormidium phage MIS-PhV1A, complete genome) position: , mismatch: 5, identity: 0.815

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcctgttgctcctgttgctcctttt	Protospacer
 **** ***.************** *

592. spacer 3.69|4812585|27|NC_013406|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtt	CRISPR spacer
actcctgttgctcctgttgctcccgtc	Protospacer
.* ** ***.****************.

593. spacer 3.69|4812585|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtt	CRISPR spacer
actcctgttgctcctgttgctcccgtc	Protospacer
.* ** ***.****************.

594. spacer 3.69|4812585|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtt	CRISPR spacer
aagcccgttactcctgttgctccagtt	Protospacer
. .** ***************** ***

595. spacer 3.69|4812585|27|NC_013406|CRT matches to NZ_CP004877 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtt	CRISPR spacer
ggtcccgttactcctgttggtcccgta	Protospacer
*  ** ************* ******

596. spacer 3.69|4812585|27|NC_013406|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtt	CRISPR spacer
ggtcccgttactcctgttggtcccgta	Protospacer
*  ** ************* ******

597. spacer 3.69|4812585|27|NC_013406|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtt	CRISPR spacer
ggtcccgttactcctgttggtcccgta	Protospacer
*  ** ************* ******

598. spacer 3.69|4812585|27|NC_013406|CRT matches to NZ_CP004860 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtt	CRISPR spacer
ggtcccgttactcctgttggtcccgta	Protospacer
*  ** ************* ******

599. spacer 3.69|4812585|27|NC_013406|CRT matches to NZ_CP007616 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtt	CRISPR spacer
ggtcccgttactcctgttggtcccgta	Protospacer
*  ** ************* ******

600. spacer 3.69|4812585|27|NC_013406|CRT matches to NZ_CP012367 (Enterococcus durans strain KLDS 6.0933 plasmid unnamed 1, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtt	CRISPR spacer
actccagttactccagttgctccagtc	Protospacer
.* *********** ******** **.

601. spacer 3.69|4812585|27|NC_013406|CRT matches to NZ_CP053689 (Arthrobacter citreus strain NEB 577 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtt	CRISPR spacer
gggcctgttgctcctgttgctcccgtc	Protospacer
* .** ***.****************.

602. spacer 3.69|4812585|27|NC_013406|CRT matches to NZ_CP012385 (Enterococcus durans strain KLDS 6.0930 plasmid unnamed 1, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtt	CRISPR spacer
actccagttactccagttgctccagtc	Protospacer
.* *********** ******** **.

603. spacer 3.69|4812585|27|NC_013406|CRT matches to AP014420 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C24-MedDCM-OCT-S43-C167, *** SEQUENCING IN PROGRESS ***, 5 ordered pieces) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtt	CRISPR spacer
ccacctgttgctcctgttgctcccata	Protospacer
 **** ***.**************.*

604. spacer 3.72|4812747|45|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.889

actcctgttgctcccgcttctcctgttgctcctgtcgctcccgtt	CRISPR spacer
gctcctgttgctcctgcttctcctgttgctcctgttgctcctgct	Protospacer
.*************.********************.*****.*.*

605. spacer 3.73|4812810|36|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.861

acacctgtcgctcctgttactcctgttgctcctgtt	CRISPR spacer
ggccctgttgctcctgttgctcctgttgctcctgtt	Protospacer
.  *****.*********.*****************

606. spacer 3.73|4812810|36|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.861

acacctgtcgctcctgttactcctgttgctcctgtt	CRISPR spacer
gctcctgttgctcctgttgctcctgttgctcctgct	Protospacer
.* *****.*********.***************.*

607. spacer 3.73|4812810|36|NC_013406|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 5, identity: 0.861

acacctgtcgctcctgttactcctgttgctcctgtt	CRISPR spacer
ggtcctgttgctcctgttgctcctgttgctcctgtt	Protospacer
.  *****.*********.*****************

608. spacer 3.90|4814018|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
actcctgttgctcctgttgctcccgtc	Protospacer
.* ** ***.****************

609. spacer 3.90|4814018|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
actcctgttgctcctgttgctcccgtt	Protospacer
.* ** ***.****************

610. spacer 3.90|4814018|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
actcctgttgctcctgttgctcccgtt	Protospacer
.* ** ***.****************

611. spacer 3.90|4814018|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
actcctgttgctcctgttgctcccgtt	Protospacer
.* ** ***.****************

612. spacer 3.90|4814018|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
actcctgttgctcctgttgctcccgtt	Protospacer
.* ** ***.****************

613. spacer 3.90|4814018|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
actcctgttgctcctgttgctcccgtt	Protospacer
.* ** ***.****************

614. spacer 3.90|4814018|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
actcctgttactcctgttgctcctgtt	Protospacer
.* ** *****************.**

615. spacer 3.90|4814018|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
ggccccgtcactcctgttgctcccgtt	Protospacer
*  ** **.*****************

616. spacer 3.90|4814018|27|NC_013406|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
ggccccgtcactcctgttgctcccgtt	Protospacer
*  ** **.*****************

617. spacer 3.90|4814018|27|NC_013406|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
actcctgttactcctgttgctcctgtt	Protospacer
.* ** *****************.**

618. spacer 3.90|4814018|27|NC_013406|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
actcctgttgctcctgttgctcccgtt	Protospacer
.* ** ***.****************

619. spacer 3.90|4814018|27|NC_013406|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
actcctgttgctcctgttgctcccgtt	Protospacer
.* ** ***.****************

620. spacer 3.90|4814018|27|NC_013406|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
actcctgttgctcctgttgctcccgtc	Protospacer
.* ** ***.****************

621. spacer 3.90|4814018|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
gctccggttactcctgttgctcctgct	Protospacer
** **.*****************.*.

622. spacer 3.90|4814018|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
actcctgttattcctgttgctcccgtt	Protospacer
.* ** ****.***************

623. spacer 3.90|4814018|27|NC_013406|CRT matches to NZ_CP004877 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
ggtcccgttactcctgttggtcccgtt	Protospacer
*  ** ************* ******

624. spacer 3.90|4814018|27|NC_013406|CRT matches to NZ_CP004877 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
ggtcccgttactcctgttggtcccgta	Protospacer
*  ** ************* ******.

625. spacer 3.90|4814018|27|NC_013406|CRT matches to NZ_CP012367 (Enterococcus durans strain KLDS 6.0933 plasmid unnamed 1, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
actccagttactccagttgctccagtc	Protospacer
.* *********** ******** **

626. spacer 3.90|4814018|27|NC_013406|CRT matches to NZ_CP012385 (Enterococcus durans strain KLDS 6.0930 plasmid unnamed 1, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
actccagttactccagttgctccagtc	Protospacer
.* *********** ******** **

627. spacer 3.90|4814018|27|NC_013406|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
ggtcccgttactcctgttggtcccgtt	Protospacer
*  ** ************* ******

628. spacer 3.90|4814018|27|NC_013406|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
ggtcccgttactcctgttggtcccgta	Protospacer
*  ** ************* ******.

629. spacer 3.90|4814018|27|NC_013406|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
ggtcccgttactcctgttggtcccgtt	Protospacer
*  ** ************* ******

630. spacer 3.90|4814018|27|NC_013406|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
ggtcccgttactcctgttggtcccgta	Protospacer
*  ** ************* ******.

631. spacer 3.90|4814018|27|NC_013406|CRT matches to NZ_CP007616 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
ggtcccgttactcctgttggtcccgta	Protospacer
*  ** ************* ******.

632. spacer 3.90|4814018|27|NC_013406|CRT matches to NZ_CP007616 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
ggtcccgttactcctgttggtcccgtt	Protospacer
*  ** ************* ******

633. spacer 3.90|4814018|27|NC_013406|CRT matches to NZ_CP004860 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
ggtcccgttactcctgttggtcccgtt	Protospacer
*  ** ************* ******

634. spacer 3.90|4814018|27|NC_013406|CRT matches to NZ_CP004860 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
ggtcccgttactcctgttggtcccgta	Protospacer
*  ** ************* ******.

635. spacer 3.90|4814018|27|NC_013406|CRT matches to NZ_CP053689 (Arthrobacter citreus strain NEB 577 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
gggcctgttgctcctgttgctcccgtc	Protospacer
* .** ***.****************

636. spacer 3.90|4814018|27|NC_013406|CRT matches to AP014420 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C24-MedDCM-OCT-S43-C167, *** SEQUENCING IN PROGRESS ***, 5 ordered pieces) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
ccacctgttgctcctgttgctcccata	Protospacer
 **** ***.**************.*.

637. spacer 3.90|4814018|27|NC_013406|CRT matches to JX181825 (Salmonella phage STML-198, complete genome) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
tcaccagatactccttttgctcccaag	Protospacer
 ****** ******* ********. *

638. spacer 3.90|4814018|27|NC_013406|CRT matches to NC_042044 (Salmonella phage Melville, complete genome) position: , mismatch: 5, identity: 0.815

gcaccagttactcctgttgctcccgtg	CRISPR spacer
tcaccagatactccttttgctcccaag	Protospacer
 ****** ******* ********. *

639. spacer 3.91|4814063|36|NC_013406|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.861

gttcctgttaccccggttgctcctgttaccccggct	CRISPR spacer
gcccctgttgccccggttgctcctgttgccccggtt	Protospacer
*..******.*****************.******.*

640. spacer 3.92|4814117|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

tctcctgttgcccctgttactccagtc	CRISPR spacer
acccctgttgctcctgttactcctgtt	Protospacer
 *.********.*********** **.

641. spacer 3.92|4814117|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

tctcctgttgcccctgttactccagtc	CRISPR spacer
tctcctgttgctcctgttgctcctgct	Protospacer
***********.******.**** *..

642. spacer 3.93|4814162|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

gctcctgttacccctgttgctccggtt	CRISPR spacer
attcctgttaaccctgttactccggtc	Protospacer
..******** *******.*******.

643. spacer 3.93|4814162|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

gctcctgttacccctgttgctccggtt	CRISPR spacer
gctcctgttgctcctgttgctcctcct	Protospacer
*********.*.***********  .*

644. spacer 3.106|4814729|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

gctccggttgctcccgtagctcccgta	CRISPR spacer
gctccgattgctcccgttgctcctgct	Protospacer
******.********** *****.*.

645. spacer 3.106|4814729|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

gctccggttgctcccgtagctcccgta	CRISPR spacer
gctcccgttgctcccgttgctcctttt	Protospacer
***** *********** *****. *

646. spacer 3.106|4814729|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

gctccggttgctcccgtagctcccgta	CRISPR spacer
ggaccggtcgctcccgttgctcccgtt	Protospacer
*  *****.******** ********

647. spacer 3.106|4814729|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.815

gctccggttgctcccgtagctcccgta	CRISPR spacer
gctcctgttgctcccgttgctcctaaa	Protospacer
***** *********** *****.. *

648. spacer 3.106|4814729|27|NC_013406|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 5, identity: 0.815

gctccggttgctcccgtagctcccgta	CRISPR spacer
gctccggttgcttccgttgctccgatt	Protospacer
************.**** ***** .*

649. spacer 3.106|4814729|27|NC_013406|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 5, identity: 0.815

gctccggttgctcccgtagctcccgta	CRISPR spacer
gctccggttgcttccgttgctccgatt	Protospacer
************.**** ***** .*

650. spacer 3.106|4814729|27|NC_013406|CRT matches to NZ_CP004875 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB95, complete sequence) position: , mismatch: 5, identity: 0.815

gctccggttgctcccgtagctcccgta	CRISPR spacer
agtccggttggtcccgtatctcccgtt	Protospacer
. ******** ******* *******

651. spacer 3.106|4814729|27|NC_013406|CRT matches to NC_014025 (Bacillus megaterium QM B1551 plasmid pBM500, complete sequence) position: , mismatch: 5, identity: 0.815

gctccggttgctcccgtagctcccgta	CRISPR spacer
attccggtagctccggtagctcccgtg	Protospacer
..****** ***** ***********.

652. spacer 3.106|4814729|27|NC_013406|CRT matches to NZ_CP019235 (Bacillus thuringiensis strain YGd22-03 plasmid pYGD98, complete sequence) position: , mismatch: 5, identity: 0.815

gctccggttgctcccgtagctcccgta	CRISPR spacer
gaaccggttgctcctgtaggtcccgtt	Protospacer
*  ***********.**** ******

653. spacer 3.106|4814729|27|NC_013406|CRT matches to NZ_CP019235 (Bacillus thuringiensis strain YGd22-03 plasmid pYGD98, complete sequence) position: , mismatch: 5, identity: 0.815

gctccggttgctcccgtagctcccgta	CRISPR spacer
gaaccggttgctcctgtaggtcccgtc	Protospacer
*  ***********.**** ******

654. spacer 3.106|4814729|27|NC_013406|CRT matches to NZ_CP011357 (Bacillus thuringiensis strain YC-10 plasmid pYC20, complete sequence) position: , mismatch: 5, identity: 0.815

gctccggttgctcccgtagctcccgta	CRISPR spacer
agtccggttggtcccgtatctcccgtt	Protospacer
. ******** ******* *******

655. spacer 3.106|4814729|27|NC_013406|CRT matches to NZ_CP015155 (Bacillus thuringiensis strain Bc601 plasmid pBTBC5, complete sequence) position: , mismatch: 5, identity: 0.815

gctccggttgctcccgtagctcccgta	CRISPR spacer
agtccggttggtcccgtatctcccgtt	Protospacer
. ******** ******* *******

656. spacer 3.106|4814729|27|NC_013406|CRT matches to NZ_CP015156 (Bacillus thuringiensis strain Bc601 plasmid pBTBC6, complete sequence) position: , mismatch: 5, identity: 0.815

gctccggttgctcccgtagctcccgta	CRISPR spacer
agtccggttggtcccgtatctcccgtt	Protospacer
. ******** ******* *******

657. spacer 3.106|4814729|27|NC_013406|CRT matches to NZ_CP011358 (Bacillus thuringiensis strain YC-10 plasmid pYC2226, complete sequence) position: , mismatch: 5, identity: 0.815

gctccggttgctcccgtagctcccgta	CRISPR spacer
agtccggttggtcccgtatctcccgtt	Protospacer
. ******** ******* *******

658. spacer 3.106|4814729|27|NC_013406|CRT matches to NZ_CP013057 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-2, complete sequence) position: , mismatch: 5, identity: 0.815

gctccggttgctcccgtagctcccgta	CRISPR spacer
agtccggttggtcccgtatctcccgtt	Protospacer
. ******** ******* *******

659. spacer 3.106|4814729|27|NC_013406|CRT matches to NZ_CP013058 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-3, complete sequence) position: , mismatch: 5, identity: 0.815

gctccggttgctcccgtagctcccgta	CRISPR spacer
agtccggttggtcccgtatctcccgtt	Protospacer
. ******** ******* *******

660. spacer 3.106|4814729|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 5, identity: 0.815

gctccggttgctcccgtagctcccgta	CRISPR spacer
ccccctgttgctcccgttgctcccgtt	Protospacer
 *.** *********** ********

661. spacer 3.106|4814729|27|NC_013406|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 5, identity: 0.815

gctccggttgctcccgtagctcccgta	CRISPR spacer
ccccctgttgctcccgttgctcccgtt	Protospacer
 *.** *********** ********

662. spacer 3.106|4814729|27|NC_013406|CRT matches to KM389380 (UNVERIFIED: Pseudomonas phage PEV31 clone contig00008 genomic sequence) position: , mismatch: 5, identity: 0.815

gctccggttgctcccgtagctcccgta	CRISPR spacer
gagccggctgctcccgtcgctcccgtc	Protospacer
*  ****.********* ********

663. spacer 3.106|4814729|27|NC_013406|CRT matches to KP994390 (Pseudomonas phage YH30, complete genome) position: , mismatch: 5, identity: 0.815

gctccggttgctcccgtagctcccgta	CRISPR spacer
gagccggctgctcccgtcgctcccgtc	Protospacer
*  ****.********* ********

664. spacer 3.106|4814729|27|NC_013406|CRT matches to MH356729 (Pseudomonas phage LP14, complete genome) position: , mismatch: 5, identity: 0.815

gctccggttgctcccgtagctcccgta	CRISPR spacer
gagccggctgctcccgtcgctcccgtc	Protospacer
*  ****.********* ********

665. spacer 3.106|4814729|27|NC_013406|CRT matches to KM389219 (UNVERIFIED: Pseudomonas phage PEV32 clone contig00001 genomic sequence) position: , mismatch: 5, identity: 0.815

gctccggttgctcccgtagctcccgta	CRISPR spacer
gagccggctgctcccgtcgctcccgtc	Protospacer
*  ****.********* ********

666. spacer 3.106|4814729|27|NC_013406|CRT matches to MN693279 (Marine virus AFVG_25M346, complete genome) position: , mismatch: 5, identity: 0.815

gctccggttgctcccgtagctcccgta	CRISPR spacer
ggacctgttgctccagtagctcccgtt	Protospacer
*  ** ******** ***********

667. spacer 3.106|4814729|27|NC_013406|CRT matches to MK450421 (Streptomyces phage Vash, complete genome) position: , mismatch: 5, identity: 0.815

gctccggttgctcccgtagctcccgta	CRISPR spacer
gagccggttgcacccgtagcgcccgtg	Protospacer
*  ******** ******** *****.

668. spacer 3.106|4814729|27|NC_013406|CRT matches to MN553584 (UNVERIFIED: Pseudomonas phage 4phiC20-2 clone 7, complete genome) position: , mismatch: 5, identity: 0.815

gctccggttgctcccgtagctcccgta	CRISPR spacer
gagccggctgctcccgtcgctcccgtc	Protospacer
*  ****.********* ********

669. spacer 3.106|4814729|27|NC_013406|CRT matches to KR054032 (Pseudomonas phage DL64, complete genome) position: , mismatch: 5, identity: 0.815

gctccggttgctcccgtagctcccgta	CRISPR spacer
gagccggctgctcccgtcgctcccgtc	Protospacer
*  ****.********* ********

670. spacer 3.106|4814729|27|NC_013406|CRT matches to KM411960 (Pseudomonas phage phi176, complete genome) position: , mismatch: 5, identity: 0.815

gctccggttgctcccgtagctcccgta	CRISPR spacer
gagccggctgctcccgtcgctcccgtc	Protospacer
*  ****.********* ********

671. spacer 3.106|4814729|27|NC_013406|CRT matches to JX194238 (Pseudomonas phage PA26, complete genome) position: , mismatch: 5, identity: 0.815

gctccggttgctcccgtagctcccgta	CRISPR spacer
gagccggctgctcccgtcgctcccgtc	Protospacer
*  ****.********* ********

672. spacer 3.106|4814729|27|NC_013406|CRT matches to HG962375 (Pseudomonas phage vB_PaeP_C2-10_Ab09, complete genome) position: , mismatch: 5, identity: 0.815

gctccggttgctcccgtagctcccgta	CRISPR spacer
gagccggctgctcccgtcgctcccgtc	Protospacer
*  ****.********* ********

673. spacer 3.106|4814729|27|NC_013406|CRT matches to MN906996 (Pseudomonas phage LY218, complete genome) position: , mismatch: 5, identity: 0.815

gctccggttgctcccgtagctcccgta	CRISPR spacer
gagccggctgctcccgtcgctcccgtc	Protospacer
*  ****.********* ********

674. spacer 3.106|4814729|27|NC_013406|CRT matches to KR052142 (Pseudomonas phage vB_PaeP_MAG4, complete genome) position: , mismatch: 5, identity: 0.815

gctccggttgctcccgtagctcccgta	CRISPR spacer
gagccggctgctcccgtcgctcccgtc	Protospacer
*  ****.********* ********

675. spacer 3.106|4814729|27|NC_013406|CRT matches to MF490236 (Pseudomonas phage vB_PaeP_PYO2, complete genome) position: , mismatch: 5, identity: 0.815

gctccggttgctcccgtagctcccgta	CRISPR spacer
gagccggctgctcccgtcgctcccgtc	Protospacer
*  ****.********* ********

676. spacer 3.106|4814729|27|NC_013406|CRT matches to KM411958 (Pseudomonas phage RWG, complete genome) position: , mismatch: 5, identity: 0.815

gctccggttgctcccgtagctcccgta	CRISPR spacer
gagccggctgctcccgtcgctcccgtc	Protospacer
*  ****.********* ********

677. spacer 3.106|4814729|27|NC_013406|CRT matches to KX171210 (Pseudomonas phage vB_Pae1396P-5, complete genome) position: , mismatch: 5, identity: 0.815

gctccggttgctcccgtagctcccgta	CRISPR spacer
gagccggctgctcccgtcgctcccgtc	Protospacer
*  ****.********* ********

678. spacer 3.106|4814729|27|NC_013406|CRT matches to NC_013692 (Pseudomonas phage LIT1, complete genome) position: , mismatch: 5, identity: 0.815

gctccggttgctcccgtagctcccgta	CRISPR spacer
gagccggctgctcccgtcgctcccgtc	Protospacer
*  ****.********* ********

679. spacer 3.106|4814729|27|NC_013406|CRT matches to KM411959 (Pseudomonas phage Pa2, complete genome) position: , mismatch: 5, identity: 0.815

gctccggttgctcccgtagctcccgta	CRISPR spacer
gagccggctgctcccgtcgctcccgtc	Protospacer
*  ****.********* ********

680. spacer 3.106|4814729|27|NC_013406|CRT matches to FN422399 (Pseudomonas phage LIT1 complete genome) position: , mismatch: 5, identity: 0.815

gctccggttgctcccgtagctcccgta	CRISPR spacer
gagccggctgctcccgtcgctcccgtc	Protospacer
*  ****.********* ********

681. spacer 3.106|4814729|27|NC_013406|CRT matches to NC_031063 (Pseudomonas phage PEV2, complete genome) position: , mismatch: 5, identity: 0.815

gctccggttgctcccgtagctcccgta	CRISPR spacer
gagccggctgctcccgtcgctcccgtc	Protospacer
*  ****.********* ********

682. spacer 3.106|4814729|27|NC_013406|CRT matches to KX171209 (Pseudomonas phage vB_Pae575P-3, complete genome) position: , mismatch: 5, identity: 0.815

gctccggttgctcccgtagctcccgta	CRISPR spacer
gagccggctgctcccgtcgctcccgtc	Protospacer
*  ****.********* ********

683. spacer 3.106|4814729|27|NC_013406|CRT matches to MF490238 (Pseudomonas phage vB_PaeP_DEV, complete genome) position: , mismatch: 5, identity: 0.815

gctccggttgctcccgtagctcccgta	CRISPR spacer
gagccggctgctcccgtcgctcccgtc	Protospacer
*  ****.********* ********

684. spacer 3.109|4814873|27|NC_013406|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 5, identity: 0.815

gcaccagtttcaccagtttcaccggtc	CRISPR spacer
gcaccagttgcaccagtatcacctttg	Protospacer
********* ******* *****  *

685. spacer 3.6|4809482|27|NC_013406|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 6, identity: 0.778

acccctgttgctcctgttgcaccagtt	CRISPR spacer
ggtcctgttggtcctgttggaccagtc	Protospacer
. .******* ******** ******.

686. spacer 3.6|4809482|27|NC_013406|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 6, identity: 0.778

acccctgttgctcctgttgcaccagtt	CRISPR spacer
ggccctgttggtcctgttgcgccagca	Protospacer
. ******** *********.****.

687. spacer 3.6|4809482|27|NC_013406|CRT matches to MN694353 (Marine virus AFVG_250M583, complete genome) position: , mismatch: 6, identity: 0.778

acccctgttgctcctgttgcaccagtt	CRISPR spacer
gtagctgttgctcctgttgcaccatta	Protospacer
..  ******************** *

688. spacer 3.6|4809482|27|NC_013406|CRT matches to NZ_CP053689 (Arthrobacter citreus strain NEB 577 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.778

acccctgttgctcctgttgcaccagtt	CRISPR spacer
gggcctgttgctcctgttgctcccgtc	Protospacer
.  ***************** ** **.

689. spacer 3.6|4809482|27|NC_013406|CRT matches to NZ_AP017969 (Fusobacterium varium strain Fv113-g1 plasmid pFV113-g1-1, complete sequence) position: , mismatch: 6, identity: 0.778

acccctgttgctcctgttgcaccagtt	CRISPR spacer
gtttcttttgctcctgttccaccagtt	Protospacer
....** *********** ********

690. spacer 3.6|4809482|27|NC_013406|CRT matches to GU943063 (Uncultured phage MedDCM-OCT-S05-C139 genomic sequence) position: , mismatch: 6, identity: 0.778

acccctgttgctcctgttgcaccagtt	CRISPR spacer
ctacctgttgctccagttgctccagta	Protospacer
 . *********** ***** *****

691. spacer 3.6|4809482|27|NC_013406|CRT matches to NC_028998 (Phormidium phage MIS-PhV1B, complete genome) position: , mismatch: 6, identity: 0.778

acccctgttgctcctgttgcaccagtt	CRISPR spacer
gctcctgttgctccagttgcaccaaca	Protospacer
.*.*********** *********..

692. spacer 3.6|4809482|27|NC_013406|CRT matches to AP014445 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C39-MedDCM-OCT-S35-C62, *** SEQUENCING IN PROGRESS ***, 4 ordered pieces) position: , mismatch: 6, identity: 0.778

acccctgttgctcctgttgcaccagtt	CRISPR spacer
tcttctgttgctcctgttgcacctgga	Protospacer
 *..******************* *

693. spacer 3.6|4809482|27|NC_013406|CRT matches to KF437907 (Phormidium phage MIS-PhV1A, complete genome) position: , mismatch: 6, identity: 0.778

acccctgttgctcctgttgcaccagtt	CRISPR spacer
gctcctgttgctccttttgcaccaaca	Protospacer
.*.************ ********..

694. spacer 3.22|4810202|27|NC_013406|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 6, identity: 0.778

tcacctgtagctcctgttgccccagtt	CRISPR spacer
ggacctgttgctcctgttgccccaccc	Protospacer
  ****** *************** ..

695. spacer 3.22|4810202|27|NC_013406|CRT matches to MN694706 (Marine virus AFVG_250M574, complete genome) position: , mismatch: 6, identity: 0.778

tcacctgtagctcctgttgccccagtt	CRISPR spacer
ccacctgtagctcctgttcccctacaa	Protospacer
.***************** ***.*

696. spacer 3.23|4810247|27|NC_013406|CRT matches to NC_028998 (Phormidium phage MIS-PhV1B, complete genome) position: , mismatch: 6, identity: 0.778

gctcctgttgttccggttgctcctgtt	CRISPR spacer
gctcctgttgctccagttgctccaaca	Protospacer
**********.***.******** ..

697. spacer 3.23|4810247|27|NC_013406|CRT matches to MG945746 (UNVERIFIED: Microviridae sp. isolate 2702-1801, complete genome) position: , mismatch: 6, identity: 0.778

gctcctgttgttccggttgctcctgtt	CRISPR spacer
ggtttgtctgttccggttgctcctgtt	Protospacer
* *..  .*******************

698. spacer 3.25|4810328|27|NC_013406|CRT matches to JQ807239 (Environmental Halophage eHP-18, partial genome) position: , mismatch: 6, identity: 0.778

gcccctggtactccagtcgctccagtt	CRISPR spacer
caacctcgtcctccagtcgctccagta	Protospacer
   *** ** ****************

699. spacer 3.49|4811577|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtg	CRISPR spacer
aagcccgttactcctgttgctccagtt	Protospacer
. .** ***************** **

700. spacer 3.49|4811577|27|NC_013406|CRT matches to NZ_CP004875 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB95, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtg	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******.

701. spacer 3.49|4811577|27|NC_013406|CRT matches to NZ_CP004875 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB95, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtg	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******.

702. spacer 3.49|4811577|27|NC_013406|CRT matches to NZ_CP004877 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtg	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******.

703. spacer 3.49|4811577|27|NC_013406|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtg	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******.

704. spacer 3.49|4811577|27|NC_013406|CRT matches to NZ_CP011357 (Bacillus thuringiensis strain YC-10 plasmid pYC20, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtg	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******.

705. spacer 3.49|4811577|27|NC_013406|CRT matches to NZ_CP011357 (Bacillus thuringiensis strain YC-10 plasmid pYC20, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtg	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******.

706. spacer 3.49|4811577|27|NC_013406|CRT matches to NZ_CP011358 (Bacillus thuringiensis strain YC-10 plasmid pYC2226, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtg	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******.

707. spacer 3.49|4811577|27|NC_013406|CRT matches to NZ_CP011358 (Bacillus thuringiensis strain YC-10 plasmid pYC2226, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtg	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******.

708. spacer 3.49|4811577|27|NC_013406|CRT matches to NZ_CP015155 (Bacillus thuringiensis strain Bc601 plasmid pBTBC5, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtg	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******.

709. spacer 3.49|4811577|27|NC_013406|CRT matches to NZ_CP015155 (Bacillus thuringiensis strain Bc601 plasmid pBTBC5, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtg	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******.

710. spacer 3.49|4811577|27|NC_013406|CRT matches to NZ_CP015156 (Bacillus thuringiensis strain Bc601 plasmid pBTBC6, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtg	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******.

711. spacer 3.49|4811577|27|NC_013406|CRT matches to NZ_CP015156 (Bacillus thuringiensis strain Bc601 plasmid pBTBC6, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtg	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******.

712. spacer 3.49|4811577|27|NC_013406|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtg	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******.

713. spacer 3.49|4811577|27|NC_013406|CRT matches to NZ_CP013057 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-2, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtg	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******.

714. spacer 3.49|4811577|27|NC_013406|CRT matches to NZ_CP013057 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-2, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtg	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******.

715. spacer 3.49|4811577|27|NC_013406|CRT matches to NZ_CP013058 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-3, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtg	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******.

716. spacer 3.49|4811577|27|NC_013406|CRT matches to NZ_CP013058 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-3, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtg	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******.

717. spacer 3.49|4811577|27|NC_013406|CRT matches to NZ_CP007616 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtg	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******.

718. spacer 3.49|4811577|27|NC_013406|CRT matches to NZ_CP004860 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtg	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******.

719. spacer 3.49|4811577|27|NC_013406|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtg	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******.

720. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.778

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcctgttgctcctgttgctcctcct	Protospacer
 **** ***.************** .

721. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.778

tctccggttactcctgttgctcctgtg	CRISPR spacer
ggccctgttgctcctgttgctcctgtt	Protospacer
  .** ***.****************

722. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.778

tctccggttactcctgttgctcctgtg	CRISPR spacer
ggccctgttgctcctgttgctcctgtt	Protospacer
  .** ***.****************

723. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.778

tctccggttactcctgttgctcctgtg	CRISPR spacer
aagcccgttactcctgttgctccagtt	Protospacer
   ** ***************** **

724. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.778

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcctgttgctcctgttgctcctcca	Protospacer
 **** ***.************** ..

725. spacer 3.53|4811820|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 6, identity: 0.778

tctccggttactcctgttgctcctgtg	CRISPR spacer
ggccccgtcactcctgttgctcctgtt	Protospacer
  .** **.*****************

726. spacer 3.53|4811820|27|NC_013406|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 6, identity: 0.778

tctccggttactcctgttgctcctgtg	CRISPR spacer
ggccccgtcactcctgttgctcctgtt	Protospacer
  .** **.*****************

727. spacer 3.53|4811820|27|NC_013406|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.778

tctccggttactcctgttgctcctgtg	CRISPR spacer
ggacctgttactcccgttgctcctgtt	Protospacer
   ** ********.***********

728. spacer 3.58|4812081|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtg	CRISPR spacer
aagcccgttactcctgttgctccagtt	Protospacer
. .** ***************** **

729. spacer 3.58|4812081|27|NC_013406|CRT matches to NZ_CP004875 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB95, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtg	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******.

730. spacer 3.58|4812081|27|NC_013406|CRT matches to NZ_CP004875 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB95, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtg	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******.

731. spacer 3.58|4812081|27|NC_013406|CRT matches to NZ_CP004877 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtg	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******.

732. spacer 3.58|4812081|27|NC_013406|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtg	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******.

733. spacer 3.58|4812081|27|NC_013406|CRT matches to NZ_CP011357 (Bacillus thuringiensis strain YC-10 plasmid pYC20, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtg	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******.

734. spacer 3.58|4812081|27|NC_013406|CRT matches to NZ_CP011357 (Bacillus thuringiensis strain YC-10 plasmid pYC20, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtg	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******.

735. spacer 3.58|4812081|27|NC_013406|CRT matches to NZ_CP011358 (Bacillus thuringiensis strain YC-10 plasmid pYC2226, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtg	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******.

736. spacer 3.58|4812081|27|NC_013406|CRT matches to NZ_CP011358 (Bacillus thuringiensis strain YC-10 plasmid pYC2226, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtg	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******.

737. spacer 3.58|4812081|27|NC_013406|CRT matches to NZ_CP015155 (Bacillus thuringiensis strain Bc601 plasmid pBTBC5, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtg	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******.

738. spacer 3.58|4812081|27|NC_013406|CRT matches to NZ_CP015155 (Bacillus thuringiensis strain Bc601 plasmid pBTBC5, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtg	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******.

739. spacer 3.58|4812081|27|NC_013406|CRT matches to NZ_CP015156 (Bacillus thuringiensis strain Bc601 plasmid pBTBC6, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtg	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******.

740. spacer 3.58|4812081|27|NC_013406|CRT matches to NZ_CP015156 (Bacillus thuringiensis strain Bc601 plasmid pBTBC6, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtg	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******.

741. spacer 3.58|4812081|27|NC_013406|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtg	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******.

742. spacer 3.58|4812081|27|NC_013406|CRT matches to NZ_CP013057 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-2, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtg	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******.

743. spacer 3.58|4812081|27|NC_013406|CRT matches to NZ_CP013057 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-2, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtg	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******.

744. spacer 3.58|4812081|27|NC_013406|CRT matches to NZ_CP013058 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-3, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtg	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******.

745. spacer 3.58|4812081|27|NC_013406|CRT matches to NZ_CP013058 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-3, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtg	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******.

746. spacer 3.58|4812081|27|NC_013406|CRT matches to NZ_CP007616 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtg	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******.

747. spacer 3.58|4812081|27|NC_013406|CRT matches to NZ_CP004860 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtg	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******.

748. spacer 3.58|4812081|27|NC_013406|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtg	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******.

749. spacer 3.61|4812198|27|NC_013406|CRT matches to GU943063 (Uncultured phage MedDCM-OCT-S05-C139 genomic sequence) position: , mismatch: 6, identity: 0.778

gcccctgttactccagtcgctccagtt	CRISPR spacer
ctacctgttgctccagttgctccagta	Protospacer
 . ******.*******.********

750. spacer 3.62|4812243|27|NC_013406|CRT matches to NZ_CP014284 (Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence) position: , mismatch: 6, identity: 0.778

acccctgttgctccggttgctccggtt	CRISPR spacer
gatcctgttgatccggttggtccggta	Protospacer
. .******* ******** ******

751. spacer 3.62|4812243|27|NC_013406|CRT matches to NZ_CP032609 (Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence) position: , mismatch: 6, identity: 0.778

acccctgttgctccggttgctccggtt	CRISPR spacer
gatcctgttgatccggttggtccggta	Protospacer
. .******* ******** ******

752. spacer 3.62|4812243|27|NC_013406|CRT matches to NZ_CP053689 (Arthrobacter citreus strain NEB 577 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.778

acccctgttgctccggttgctccggtt	CRISPR spacer
gggcctgttgctcctgttgctcccgtc	Protospacer
.  *********** ******** **.

753. spacer 3.62|4812243|27|NC_013406|CRT matches to GU943063 (Uncultured phage MedDCM-OCT-S05-C139 genomic sequence) position: , mismatch: 6, identity: 0.778

acccctgttgctccggttgctccggtt	CRISPR spacer
ctacctgttgctccagttgctccagta	Protospacer
 . ***********.********.**

754. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.778

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcctgttgctcctgttgctcctcct	Protospacer
 **** ***.************** .

755. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.778

tctccggttactcctgttgctcctgtg	CRISPR spacer
ggccctgttgctcctgttgctcctgtt	Protospacer
  .** ***.****************

756. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.778

tctccggttactcctgttgctcctgtg	CRISPR spacer
ggccctgttgctcctgttgctcctgtt	Protospacer
  .** ***.****************

757. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.778

tctccggttactcctgttgctcctgtg	CRISPR spacer
aagcccgttactcctgttgctccagtt	Protospacer
   ** ***************** **

758. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.778

tctccggttactcctgttgctcctgtg	CRISPR spacer
gctcctgttgctcctgttgctcctcca	Protospacer
 **** ***.************** ..

759. spacer 3.64|4812324|27|NC_013406|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 6, identity: 0.778

tctccggttactcctgttgctcctgtg	CRISPR spacer
ggccccgtcactcctgttgctcctgtt	Protospacer
  .** **.*****************

760. spacer 3.64|4812324|27|NC_013406|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 6, identity: 0.778

tctccggttactcctgttgctcctgtg	CRISPR spacer
ggccccgtcactcctgttgctcctgtt	Protospacer
  .** **.*****************

761. spacer 3.64|4812324|27|NC_013406|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.778

tctccggttactcctgttgctcctgtg	CRISPR spacer
ggacctgttactcccgttgctcctgtt	Protospacer
   ** ********.***********

762. spacer 3.69|4812585|27|NC_013406|CRT matches to NZ_CP004877 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtt	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******

763. spacer 3.69|4812585|27|NC_013406|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtt	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******

764. spacer 3.69|4812585|27|NC_013406|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtt	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******

765. spacer 3.69|4812585|27|NC_013406|CRT matches to NZ_CP004860 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtt	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******

766. spacer 3.69|4812585|27|NC_013406|CRT matches to NZ_CP007616 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtt	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******

767. spacer 3.69|4812585|27|NC_013406|CRT matches to NZ_CP011358 (Bacillus thuringiensis strain YC-10 plasmid pYC2226, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtt	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******

768. spacer 3.69|4812585|27|NC_013406|CRT matches to NZ_CP011358 (Bacillus thuringiensis strain YC-10 plasmid pYC2226, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtt	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******

769. spacer 3.69|4812585|27|NC_013406|CRT matches to NZ_CP013057 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-2, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtt	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******

770. spacer 3.69|4812585|27|NC_013406|CRT matches to NZ_CP013057 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-2, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtt	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******

771. spacer 3.69|4812585|27|NC_013406|CRT matches to NZ_CP013058 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-3, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtt	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******

772. spacer 3.69|4812585|27|NC_013406|CRT matches to NZ_CP013058 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-3, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtt	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******

773. spacer 3.69|4812585|27|NC_013406|CRT matches to JX181825 (Salmonella phage STML-198, complete genome) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtt	CRISPR spacer
tcaccagatactccttttgctcccaag	Protospacer
 ****** ******* ********.

774. spacer 3.69|4812585|27|NC_013406|CRT matches to NC_042044 (Salmonella phage Melville, complete genome) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtt	CRISPR spacer
tcaccagatactccttttgctcccaag	Protospacer
 ****** ******* ********.

775. spacer 3.69|4812585|27|NC_013406|CRT matches to NZ_CP004875 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB95, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtt	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******

776. spacer 3.69|4812585|27|NC_013406|CRT matches to NZ_CP004875 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB95, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtt	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******

777. spacer 3.69|4812585|27|NC_013406|CRT matches to NZ_CP011357 (Bacillus thuringiensis strain YC-10 plasmid pYC20, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtt	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******

778. spacer 3.69|4812585|27|NC_013406|CRT matches to NZ_CP011357 (Bacillus thuringiensis strain YC-10 plasmid pYC20, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtt	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******

779. spacer 3.69|4812585|27|NC_013406|CRT matches to NZ_CP015155 (Bacillus thuringiensis strain Bc601 plasmid pBTBC5, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtt	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******

780. spacer 3.69|4812585|27|NC_013406|CRT matches to NZ_CP015155 (Bacillus thuringiensis strain Bc601 plasmid pBTBC5, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtt	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******

781. spacer 3.69|4812585|27|NC_013406|CRT matches to NZ_CP015156 (Bacillus thuringiensis strain Bc601 plasmid pBTBC6, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtt	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******

782. spacer 3.69|4812585|27|NC_013406|CRT matches to NZ_CP015156 (Bacillus thuringiensis strain Bc601 plasmid pBTBC6, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtt	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******

783. spacer 3.69|4812585|27|NC_013406|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtt	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******

784. spacer 3.73|4812810|36|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.833

acacctgtcgctcctgttactcctgttgctcctgtt	CRISPR spacer
gctcctgttgctcctgttgctcctgttgctcctcct	Protospacer
.* *****.*********.************** .*

785. spacer 3.90|4814018|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtg	CRISPR spacer
aagcccgttactcctgttgctccagtt	Protospacer
. .** ***************** **

786. spacer 3.90|4814018|27|NC_013406|CRT matches to NZ_CP004875 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB95, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtg	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******.

787. spacer 3.90|4814018|27|NC_013406|CRT matches to NZ_CP004875 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB95, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtg	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******.

788. spacer 3.90|4814018|27|NC_013406|CRT matches to NZ_CP004877 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtg	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******.

789. spacer 3.90|4814018|27|NC_013406|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtg	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******.

790. spacer 3.90|4814018|27|NC_013406|CRT matches to NZ_CP011357 (Bacillus thuringiensis strain YC-10 plasmid pYC20, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtg	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******.

791. spacer 3.90|4814018|27|NC_013406|CRT matches to NZ_CP011357 (Bacillus thuringiensis strain YC-10 plasmid pYC20, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtg	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******.

792. spacer 3.90|4814018|27|NC_013406|CRT matches to NZ_CP011358 (Bacillus thuringiensis strain YC-10 plasmid pYC2226, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtg	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******.

793. spacer 3.90|4814018|27|NC_013406|CRT matches to NZ_CP011358 (Bacillus thuringiensis strain YC-10 plasmid pYC2226, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtg	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******.

794. spacer 3.90|4814018|27|NC_013406|CRT matches to NZ_CP015155 (Bacillus thuringiensis strain Bc601 plasmid pBTBC5, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtg	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******.

795. spacer 3.90|4814018|27|NC_013406|CRT matches to NZ_CP015155 (Bacillus thuringiensis strain Bc601 plasmid pBTBC5, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtg	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******.

796. spacer 3.90|4814018|27|NC_013406|CRT matches to NZ_CP015156 (Bacillus thuringiensis strain Bc601 plasmid pBTBC6, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtg	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******.

797. spacer 3.90|4814018|27|NC_013406|CRT matches to NZ_CP015156 (Bacillus thuringiensis strain Bc601 plasmid pBTBC6, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtg	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******.

798. spacer 3.90|4814018|27|NC_013406|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtg	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******.

799. spacer 3.90|4814018|27|NC_013406|CRT matches to NZ_CP013057 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-2, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtg	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******.

800. spacer 3.90|4814018|27|NC_013406|CRT matches to NZ_CP013057 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-2, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtg	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******.

801. spacer 3.90|4814018|27|NC_013406|CRT matches to NZ_CP013058 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-3, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtg	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******.

802. spacer 3.90|4814018|27|NC_013406|CRT matches to NZ_CP013058 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-3, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtg	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******.

803. spacer 3.90|4814018|27|NC_013406|CRT matches to NZ_CP007616 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtg	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******.

804. spacer 3.90|4814018|27|NC_013406|CRT matches to NZ_CP004860 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtg	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******.

805. spacer 3.90|4814018|27|NC_013406|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagttactcctgttgctcccgtg	CRISPR spacer
agtcccgttactcctgttggtcccgta	Protospacer
.  ** ************* ******.

806. spacer 3.93|4814162|27|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.778

gctcctgttacccctgttgctccggtt	CRISPR spacer
gctcctgttgctcctgttgctcctcca	Protospacer
*********.*.***********  .

807. spacer 3.109|4814873|27|NC_013406|CRT matches to NC_003905 (Proteus vulgaris plasmid Rts1 DNA, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagtttcaccagtttcaccggtc	CRISPR spacer
tcaccagttgcaccagtttcactttcc	Protospacer
 ******** ************.  .*

808. spacer 3.109|4814873|27|NC_013406|CRT matches to NZ_CP028385 (Providencia heimbachae strain 99101 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.778

gcaccagtttcaccagtttcaccggtc	CRISPR spacer
tcaccagttgcaccagtttcactttcc	Protospacer
 ******** ************.  .*

809. spacer 3.109|4814873|27|NC_013406|CRT matches to MK493321 (Cyanophage S-RIM4 isolate RW_11_0999, complete genome) position: , mismatch: 6, identity: 0.778

gcaccagtttcaccagtttcaccggtc	CRISPR spacer
gttacagtttcaccagtttcaccagaa	Protospacer
*.  *******************.*

810. spacer 3.109|4814873|27|NC_013406|CRT matches to KU885990 (Roseobacter phage RD-1410Ws-07, partial genome) position: , mismatch: 6, identity: 0.778

gcaccagtttcaccagtttcaccggtc	CRISPR spacer
tcgttggtttcacgagtttcaccggtc	Protospacer
 *....******* *************

811. spacer 3.109|4814873|27|NC_013406|CRT matches to KU885988 (Dinoroseobacter phage DS-1410Ws-06, partial genome) position: , mismatch: 6, identity: 0.778

gcaccagtttcaccagtttcaccggtc	CRISPR spacer
tcgttggtttcacgagtttcaccggtc	Protospacer
 *....******* *************

812. spacer 3.119|4815485|27|NC_013406|CRT matches to NZ_CP038621 (Arsenophonus nasoniae strain FIN plasmid pArsFIN9, complete sequence) position: , mismatch: 6, identity: 0.778

gctcctgttgcccccgtagttcctgtt	CRISPR spacer
gctcctgttgcccccgtaatttacgag	Protospacer
******************.**. .*

813. spacer 3.5|4809428|36|NC_013406|CRT matches to NZ_CP011358 (Bacillus thuringiensis strain YC-10 plasmid pYC2226, complete sequence) position: , mismatch: 7, identity: 0.806

gcccctgttactccggttgctcctgttacccccgtt	CRISPR spacer
ggtcctgttactccggttggtcctgttactccgatc	Protospacer
* .**************** *********.** .*.

814. spacer 3.5|4809428|36|NC_013406|CRT matches to NZ_CP013057 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-2, complete sequence) position: , mismatch: 7, identity: 0.806

gcccctgttactccggttgctcctgttacccccgtt	CRISPR spacer
ggtcctgttactccggttggtcctgttactccgatc	Protospacer
* .**************** *********.** .*.

815. spacer 3.5|4809428|36|NC_013406|CRT matches to NZ_CP013058 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-3, complete sequence) position: , mismatch: 7, identity: 0.806

gcccctgttactccggttgctcctgttacccccgtt	CRISPR spacer
ggtcctgttactccggttggtcctgttactccgatc	Protospacer
* .**************** *********.** .*.

816. spacer 3.5|4809428|36|NC_013406|CRT matches to NZ_CP004875 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB95, complete sequence) position: , mismatch: 7, identity: 0.806

gcccctgttactccggttgctcctgttacccccgtt	CRISPR spacer
ggtcctgttactccggttggtcctgttactccgatc	Protospacer
* .**************** *********.** .*.

817. spacer 3.5|4809428|36|NC_013406|CRT matches to NZ_CP011357 (Bacillus thuringiensis strain YC-10 plasmid pYC20, complete sequence) position: , mismatch: 7, identity: 0.806

gcccctgttactccggttgctcctgttacccccgtt	CRISPR spacer
ggtcctgttactccggttggtcctgttactccgatc	Protospacer
* .**************** *********.** .*.

818. spacer 3.5|4809428|36|NC_013406|CRT matches to NZ_CP015155 (Bacillus thuringiensis strain Bc601 plasmid pBTBC5, complete sequence) position: , mismatch: 7, identity: 0.806

gcccctgttactccggttgctcctgttacccccgtt	CRISPR spacer
ggtcctgttactccggttggtcctgttactccgatc	Protospacer
* .**************** *********.** .*.

819. spacer 3.6|4809482|27|NC_013406|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 7, identity: 0.741

acccctgttgctcctgttgcaccagtt	CRISPR spacer
ggacctgttgctcctgttgccccaccc	Protospacer
.  ***************** *** ..

820. spacer 3.6|4809482|27|NC_013406|CRT matches to NC_041878 (Pectobacterium phage CBB, complete genome) position: , mismatch: 7, identity: 0.741

acccctgttgctcctgttgcaccagtt	CRISPR spacer
aatgatgttgctcctgttgcaccaacg	Protospacer
* .  *******************..

821. spacer 3.11|4809698|27|NC_013406|CRT matches to MN693012 (Marine virus AFVG_117M3, complete genome) position: , mismatch: 7, identity: 0.741

gcccccgttactcctctttctcctgtc	CRISPR spacer
ctgaaagttactcctctttctcctgtt	Protospacer
 .    ********************.

822. spacer 3.73|4812810|36|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.806

acacctgtcgctcctgttactcctgttgctcctgtt	CRISPR spacer
gataatgttgctcctgttactcccgttgctcctgtt	Protospacer
.    ***.**************.************

823. spacer 3.73|4812810|36|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.806

acacctgtcgctcctgttactcctgttgctcctgtt	CRISPR spacer
gctcctgttgctcctgttgctcctgttgctcctcca	Protospacer
.* *****.*********.************** .

824. spacer 3.73|4812810|36|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.806

acacctgtcgctcctgttactcctgttgctcctgtt	CRISPR spacer
ggaccggatactcctgttgctcctgttgctcctgtt	Protospacer
. *** * ..********.*****************

825. spacer 3.4|4809365|45|NC_013406|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 8, identity: 0.822

tctcctgttgctcctgttgctccggttgcaccagttactcctgtt---	CRISPR spacer
gctcctgttgctcctgttgctcctgttgcaccag---ctccagggcca	Protospacer
 ********************** **********   **** *

826. spacer 3.5|4809428|36|NC_013406|CRT matches to NZ_CP015156 (Bacillus thuringiensis strain Bc601 plasmid pBTBC6, complete sequence) position: , mismatch: 8, identity: 0.778

gcccctgttactccggttgctcctgttacccccgtt	CRISPR spacer
tgtcctgttactccggttggtcctgttactccgatc	Protospacer
  .**************** *********.** .*.

827. spacer 3.73|4812810|36|NC_013406|CRT matches to MN693798 (Marine virus AFVG_250M119, complete genome) position: , mismatch: 8, identity: 0.778

acacctgtcgctcctgttactcctgttgctcctgtt	CRISPR spacer
cctcctgttgctcctgttgctcctgttgctacggca	Protospacer
 * *****.*********.*********** * *.

828. spacer 3.96|4814288|36|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.778

gctcctgttgttccggttgctcctgttaccccggct	CRISPR spacer
gctcctgtcgttcccgttgctcctgtctcacccgtc	Protospacer
********.***** ***********. * ** *..

829. spacer 3.96|4814288|36|NC_013406|CRT matches to NZ_CP024167 (Salmonella enterica subsp. enterica serovar Gaminara strain CFSAN070644 plasmid pCFSAN024441_02, complete sequence) position: , mismatch: 8, identity: 0.778

gctcctgttgttccggttgctcctgttaccccggct	CRISPR spacer
tctcctgttgttcctgttgttcctgttgttcctgtt	Protospacer
 ************* ****.*******...** *.*

830. spacer 3.110|4814918|36|NC_013406|CRT matches to AP014476 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, *** SEQUENCING IN PROGRESS ***, 2 ordered pieces) position: , mismatch: 8, identity: 0.778

tcacctgtagctcctgttgcaccagttactcctgtt	CRISPR spacer
gcaccagtagcacctgttgcaccagttggaccttgt	Protospacer
 **** ***** ***************.  ***  *

831. spacer 3.110|4814918|36|NC_013406|CRT matches to AP013564 (Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5-MedDCM-OCT-S33-C6, *** SEQUENCING IN PROGRESS ***, 4 ordered pieces) position: , mismatch: 8, identity: 0.778

tcacctgtagctcctgttgcaccagttactcctgtt	CRISPR spacer
gcaccagtagcacctgttgcaccagttggaccttgt	Protospacer
 **** ***** ***************.  ***  *

832. spacer 3.110|4814918|36|NC_013406|CRT matches to AP013944 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 8, identity: 0.778

tcacctgtagctcctgttgcaccagttactcctgtt	CRISPR spacer
gcaccagtagcacctgttgcaccagttggaccttgt	Protospacer
 **** ***** ***************.  ***  *

833. spacer 3.110|4814918|36|NC_013406|CRT matches to AP013943 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S40-C165, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 8, identity: 0.778

tcacctgtagctcctgttgcaccagttactcctgtt	CRISPR spacer
gcaccagtagcacctgttgcaccagttggaccttgt	Protospacer
 **** ***** ***************.  ***  *

834. spacer 3.110|4814918|36|NC_013406|CRT matches to AP013942 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 8, identity: 0.778

tcacctgtagctcctgttgcaccagttactcctgtt	CRISPR spacer
gcaccagtagcacctgttgcaccagttggaccttgt	Protospacer
 **** ***** ***************.  ***  *

835. spacer 3.110|4814918|36|NC_013406|CRT matches to AP013945 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 8, identity: 0.778

tcacctgtagctcctgttgcaccagttactcctgtt	CRISPR spacer
gcaccagtagcacctgttgcaccagttggaccttgt	Protospacer
 **** ***** ***************.  ***  *

836. spacer 3.4|4809365|45|NC_013406|CRT matches to KF437907 (Phormidium phage MIS-PhV1A, complete genome) position: , mismatch: 10, identity: 0.778

tctcctgttgctcctgttgctccggttgcaccagttactcctgtt	CRISPR spacer
gctcctgttgctcctgttgctccttttgcaccaacagcacccgta	Protospacer
 **********************  ********.. .* **.**

837. spacer 3.70|4812630|45|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 10, identity: 0.778

gctcctgttactccggttgctcctgttgctccggtagctcctgtc	CRISPR spacer
gctcctgttgctcctgttgctcctgttgctcctccagcaggtccc	Protospacer
*********.**** *****************  .***   * .*

838. spacer 3.70|4812630|45|NC_013406|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 11, identity: 0.756

gctcctgttactccggttgctcctgttgctccggtagctcctgtc	CRISPR spacer
gctcctgttgctcctgttgctcctgttgctcctcctgctggtcct	Protospacer
*********.**** *****************  . ***  * ..

839. spacer 3.99|4814450|36|NC_013406|CRT matches to NZ_CP012367 (Enterococcus durans strain KLDS 6.0933 plasmid unnamed 1, complete sequence) position: , mismatch: 12, identity: 0.667

actcctgttgctccggttgcaccagttactcctgtt	CRISPR spacer
ctctaaaatgctccggtagcaccagatactcctgcc	Protospacer
 ...  . ********* ******* ********..

840. spacer 3.99|4814450|36|NC_013406|CRT matches to NZ_CP012385 (Enterococcus durans strain KLDS 6.0930 plasmid unnamed 1, complete sequence) position: , mismatch: 12, identity: 0.667

actcctgttgctccggttgcaccagttactcctgtt	CRISPR spacer
ctctaaaatgctccggtagcaccagatactcctgcc	Protospacer
 ...  . ********* ******* ********..

841. spacer 3.99|4814450|36|NC_013406|CRT matches to LC383633 (Staphylococcus aureus SI1 plasmid pWSI1 DNA, complete sequence) position: , mismatch: 12, identity: 0.667

actcctgttgctccggttgcaccagttactcctgtt	CRISPR spacer
ctctaaaatgctccggtagcaccagatactcctgcc	Protospacer
 ...  . ********* ******* ********..

842. spacer 3.99|4814450|36|NC_013406|CRT matches to NC_010077 (Staphylococcus aureus plasmid EDINA, complete sequence) position: , mismatch: 12, identity: 0.667

actcctgttgctccggttgcaccagttactcctgtt	CRISPR spacer
ctctaaaatgctccggtagcaccagatactcctgcc	Protospacer
 ...  . ********* ******* ********..

843. spacer 3.99|4814450|36|NC_013406|CRT matches to NC_018952 (Staphylococcus aureus plasmid pWBG747, complete sequence) position: , mismatch: 12, identity: 0.667

actcctgttgctccggttgcaccagttactcctgtt	CRISPR spacer
ctctaaaatgctccggtagcaccagatactcctgcc	Protospacer
 ...  . ********* ******* ********..

844. spacer 3.99|4814450|36|NC_013406|CRT matches to NZ_CP014063 (Staphylococcus aureus strain FDAARGOS_159 plasmid unnamed, complete sequence) position: , mismatch: 12, identity: 0.667

actcctgttgctccggttgcaccagttactcctgtt	CRISPR spacer
ctctaaaatgctccggtagcaccagatactcctgcc	Protospacer
 ...  . ********* ******* ********..

845. spacer 3.99|4814450|36|NC_013406|CRT matches to NC_013326 (Staphylococcus aureus plasmid pWBG746, complete sequence) position: , mismatch: 12, identity: 0.667

actcctgttgctccggttgcaccagttactcctgtt	CRISPR spacer
ctctaaaatgctccggtagcaccagatactcctgcc	Protospacer
 ...  . ********* ******* ********..

846. spacer 3.99|4814450|36|NC_013406|CRT matches to NC_013348 (Staphylococcus aureus plasmid pSK156, complete sequence) position: , mismatch: 12, identity: 0.667

actcctgttgctccggttgcaccagttactcctgtt	CRISPR spacer
ctctaaaatgctccggtagcaccagatactcctgcc	Protospacer
 ...  . ********* ******* ********..

847. spacer 3.99|4814450|36|NC_013406|CRT matches to NZ_AP020312 (Staphylococcus aureus strain KUH140013 plasmid p01KUH140013, complete sequence) position: , mismatch: 12, identity: 0.667

actcctgttgctccggttgcaccagttactcctgtt	CRISPR spacer
ctctaaaatgctccggtagcaccagatactcctgcc	Protospacer
 ...  . ********* ******* ********..

848. spacer 3.99|4814450|36|NC_013406|CRT matches to NZ_AP014922 (Staphylococcus aureus strain JH4899 plasmid pJSA01, complete sequence) position: , mismatch: 12, identity: 0.667

actcctgttgctccggttgcaccagttactcctgtt	CRISPR spacer
ctctaaaatgctccggtagcaccagatactcctgcc	Protospacer
 ...  . ********* ******* ********..

849. spacer 1.1|163368|60|NC_013406|CRISPRCasFinder matches to NZ_CP054613 (Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence) position: , mismatch: 13, identity: 0.783

-----gctaccatacatacctggaggcttagctcagctgggagagcatctgccttacaag	CRISPR spacer
tacgggtcaccat-----catggaggcttagctcagctgggagagcatctgccttacaag	Protospacer
     *..*****     * ****************************************

850. spacer 1.1|163368|60|NC_013406|CRISPRCasFinder matches to NZ_CP054613 (Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence) position: , mismatch: 13, identity: 0.783

---gctaccatacatacctggaggcttagctcagctgggagagcatctgccttacaagca	CRISPR spacer
aaaagtcgcttaca---acggaggcttagctcagctgggagagcatctgccttacaagca	Protospacer
   . *  * ****    .*****************************************

851. spacer 1.1|163368|60|NC_013406|CRISPRCasFinder matches to NZ_CP054613 (Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence) position: , mismatch: 14, identity: 0.767

-----gctaccatacatacctggaggcttagctcagctgggagagcatctgccttacaag	CRISPR spacer
tacgggtcaccat-----tatggaggcttagctcagctgggagagcatctgccttacaag	Protospacer
     *..*****     . ****************************************

852. spacer 1.1|163368|60|NC_013406|CRISPRCasFinder matches to NZ_CP054613 (Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence) position: , mismatch: 14, identity: 0.767

-----gctaccatacatacctggaggcttagctcagctgggagagcatctgccttacaag	CRISPR spacer
tacgggtcaccat-----tatggaggcttagctcagctgggagagcatctgccttacaag	Protospacer
     *..*****     . ****************************************

853. spacer 1.1|163368|60|NC_013406|CRISPRCasFinder matches to NZ_CP016544 (Planococcus donghaensis strain DSM 22276 plasmid pPD76, complete sequence) position: , mismatch: 15, identity: 0.75

-----gctaccatacatacctggaggcttagctcagctgggagagcatctgccttacaag	CRISPR spacer
taggggtcaccat-----tttggaggattagctcagctgggagagcatctgccttacaag	Protospacer
     *..*****     ..****** *********************************

854. spacer 1.1|163368|60|NC_013406|CRISPRCasFinder matches to NZ_CP033045 (Bacillus foraminis strain Bac44 plasmid unnamed, complete sequence) position: , mismatch: 15, identity: 0.75

------gctaccatacatacctggaggcttagctcagctgggagagcatctgccttacaa	CRISPR spacer
gtaggggtcaccata------tggaggattagctcagctgggagagcatctgccttacaa	Protospacer
      *..******      ****** ********************************

855. spacer 1.1|163368|60|NC_013406|CRISPRCasFinder matches to NZ_CP033045 (Bacillus foraminis strain Bac44 plasmid unnamed, complete sequence) position: , mismatch: 15, identity: 0.75

-----gctaccatacatacctggaggcttagctcagctgggagagcatctgccttacaag	CRISPR spacer
taggggtcacca-----aaatggaggattagctcagctgggagagcatctgccttacaag	Protospacer
     *..****     *  ****** *********************************

856. spacer 1.1|163368|60|NC_013406|CRISPRCasFinder matches to NZ_CP024037 (Bacillus aryabhattai strain K13 plasmid unnamed2) position: , mismatch: 16, identity: 0.733

gctaccatacata-----cctggaggcttagctcagctgggagagcatctgccttacaag	CRISPR spacer
-----cttatatagattctttggaggattagctcagctgggagagcacctgccttacaag	Protospacer
     * **.***     ..****** ********************.************

857. spacer 1.1|163368|60|NC_013406|CRISPRCasFinder matches to NZ_CP026740 (Bacillus megaterium strain YC4-R4 plasmid unnamed4) position: , mismatch: 16, identity: 0.733

gctaccatacata-----cctggaggcttagctcagctgggagagcatctgccttacaag	CRISPR spacer
-----cttatatagattctttggaggattagctcagctgggagagcacctgccttacaag	Protospacer
     * **.***     ..****** ********************.************

858. spacer 1.1|163368|60|NC_013406|CRISPRCasFinder matches to CP041516 (Bacillus aryabhattai strain KNU10 plasmid unnamed, complete sequence) position: , mismatch: 16, identity: 0.733

gctaccataca----tacctggaggcttagctcagctgggagagcatctgccttacaagc	CRISPR spacer
----ttatatagatttttttggaggattagctcagctgggagagcacctgccttacaagc	Protospacer
    ..***.*    * ..****** ********************.*************

859. spacer 1.1|163368|60|NC_013406|CRISPRCasFinder matches to NC_017139 (Bacillus megaterium WSH-002 plasmid WSH-002_p1, complete sequence) position: , mismatch: 16, identity: 0.733

gctaccatacata-----cctggaggcttagctcagctgggagagcatctgccttacaag	CRISPR spacer
-----cttatatagattctttggaggattagctcagctgggagagcacctgccttacaag	Protospacer
     * **.***     ..****** ********************.************

860. spacer 1.1|163368|60|NC_013406|CRISPRCasFinder matches to NC_004604 (Bacillus megaterium QM B1551 plasmid pBM400, complete sequence) position: , mismatch: 16, identity: 0.733

gctaccataca----tacctggaggcttagctcagctgggagagcatctgccttacaagc	CRISPR spacer
----ttatatagatttttttggaggattagctcagctgggagagcacctgccttacaagc	Protospacer
    ..***.*    * ..****** ********************.*************

861. spacer 1.1|163368|60|NC_013406|CRISPRCasFinder matches to NZ_CP010587 (Bacillus megaterium Q3 plasmid p1, complete sequence) position: , mismatch: 16, identity: 0.733

gctaccatacata-----cctggaggcttagctcagctgggagagcatctgccttacaag	CRISPR spacer
-----cttatatagattctttggaggattagctcagctgggagagcacctgccttacaag	Protospacer
     * **.***     ..****** ********************.************

862. spacer 1.1|163368|60|NC_013406|CRISPRCasFinder matches to NZ_CP023319 (Bacillus megaterium strain A plasmid p2, complete sequence) position: , mismatch: 16, identity: 0.733

gctaccatacata-----cctggaggcttagctcagctgggagagcatctgccttacaag	CRISPR spacer
-----cttatatagattctttggaggattagctcagctgggagagcacctgccttacaag	Protospacer
     * **.***     ..****** ********************.************

863. spacer 1.1|163368|60|NC_013406|CRISPRCasFinder matches to NZ_CP041068 (Bacillus megaterium strain KNU-01 plasmid pKNU_01_4, complete sequence) position: , mismatch: 16, identity: 0.733

gctaccataca----tacctggaggcttagctcagctgggagagcatctgccttacaagc	CRISPR spacer
----ttatatagatttttttggaggattagctcagctgggagagcacctgccttacaagc	Protospacer
    ..***.*    * ..****** ********************.*************

864. spacer 1.1|163368|60|NC_013406|CRISPRCasFinder matches to CP031730 (Stenotrophomonas rhizophila strain GA1 plasmid unnamed1, complete sequence) position: , mismatch: 19, identity: 0.683

gctaccatacatacc--------tggaggcttagctcagctgggagagcatctgccttac	CRISPR spacer
--------atacacctgtttctatggaggattagctcagctgggagagcatctgccttac	Protospacer
        *.*.***        ****** ******************************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

200962 : 208094

Bacillus_phage(50.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009593644.1\|200962_201871_+	RNase adapter RapZ	A0A0R8VB27	Thermobifida_phage	5.6e-08	31.1
WP_175320789.1\|201928_202870_+	uridine diphosphate-N-acetylglucosamine-binding protein YvcK	A1IMD5	Streptococcus_phage	2.7e-53	41.2
WP_009593666.1\|202875_203805_+	DNA-binding protein WhiA	Q7AWZ3	Streptococcus_phage	1.6e-55	39.2
WP_006207570.1\|203906_204176_+	HPr family phosphocarrier protein	NA	NA	NA	NA
WP_012818429.1\|204499_206296_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.4e-172	62.1
WP_012818430.1\|206334_207015_+	response regulator transcription factor	W8CYM9	Bacillus_phage	9.8e-82	66.4
WP_012818431.1\|207014_208094_+	HAMP domain-containing protein	W8CYF6	Bacillus_phage	3.0e-85	50.2

DBSCAN-SWA_2

1105976 : 1114897

Synechococcus_phage(42.86%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009592336.1\|1105976_1107272_+	adenylosuccinate lyase	A0A1B3B081	Gordonia_phage	3.1e-20	34.3
WP_012819093.1\|1107498_1108389_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0M4JBD3	Mollivirus	1.9e-37	33.5
WP_012819094.1\|1108438_1108684_+	phosphoribosylformylglycinamidine synthase subunit PurS	A0A0E3FJ99	Synechococcus_phage	2.4e-06	36.4
WP_012819095.1\|1108688_1109378_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_012819096.1\|1109355_1111599_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	7.5e-163	43.2
WP_009592356.1\|1111583_1113062_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	2.1e-52	33.8
WP_012819097.1\|1113245_1114286_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	5.3e-71	47.2
WP_012819098.1\|1114285_1114897_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	4.3e-20	34.3

DBSCAN-SWA_3

2492519 : 2501917

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009595227.1\|2492519_2492951_+	peptidylprolyl isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	5.5e-22	43.5
WP_015734490.1\|2493026_2493428_-	acyl-CoA thioesterase	NA	NA	NA	NA
WP_036665720.1\|2494080_2495181_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	1.2e-60	37.3
WP_015734492.1\|2495204_2495873_+	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	3.8e-38	38.9
WP_015734493.1\|2495923_2497162_+	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	2.5e-120	53.8
WP_009595158.1\|2497419_2497887_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	3.8e-45	60.9
WP_015734494.1\|2497952_2498744_+	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	1.7e-08	33.0
WP_015734495.1\|2498712_2499318_+	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	2.4e-15	31.4
WP_015734496.1\|2499510_2500191_+	DUF2953 domain-containing protein	NA	NA	NA	NA
WP_009595256.1\|2500163_2500613_+	GerW family sporulation protein	NA	NA	NA	NA
WP_015734497.1\|2500732_2501917_+	D-alanyl-D-alanine carboxypeptidase	A0A1P8VVG5	Erythrobacter_phage	5.4e-11	34.3

DBSCAN-SWA_4

6047473 : 6071587

Clostridium_phage(28.57%)

tail,holin,plate,portal

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015737346.1\|6047473_6048259_-	glucosaminidase domain-containing protein	A0A0K2CP65	Brevibacillus_phage	7.4e-49	64.7
WP_015737347.1\|6048245_6048698_-\|holin	phage holin family protein	R9TMD4	Paenibacillus_phage	5.4e-44	61.3
WP_015737348.1\|6048988_6049126_-	XkdX family protein	NA	NA	NA	NA
WP_015737349.1\|6049145_6049727_-	hypothetical protein	NA	NA	NA	NA
WP_015737350.1\|6049739_6052370_-	hypothetical protein	R4JDZ8	Bacillus_phage	5.7e-21	30.9
WP_015737351.1\|6052370_6052916_-	YmfQ family protein	A0A0A7RUW8	Clostridium_phage	4.1e-22	35.6
WP_015737352.1\|6052912_6053971_-\|plate	baseplate J/gp47 family protein	S6AVU3	Thermus_phage	3.1e-82	45.9
WP_015737353.1\|6053963_6054377_-	DUF2634 domain-containing protein	A0A0A7RTU4	Clostridium_phage	2.4e-27	45.5
WP_015737354.1\|6054373_6054670_-	DUF2577 domain-containing protein	A0A0A7RTJ2	Clostridium_phage	7.4e-18	45.2
WP_015737355.1\|6054676_6055642_-	hypothetical protein	S5MNC9	Brevibacillus_phage	3.5e-93	52.5
WP_015737356.1\|6055654_6056374_-	LysM peptidoglycan-binding domain-containing protein	S6BFJ4	Thermus_phage	3.0e-41	40.1
WP_015737357.1\|6056375_6058358_-	hypothetical protein	A0A0A7S0K9	Clostridium_phage	5.6e-61	30.8
WP_015737358.1\|6058552_6058975_-\|portal	phage portal protein	A0A0A7RTY8	Clostridium_phage	6.6e-12	37.4
WP_009594586.1\|6059004_6059463_-\|tail	phage tail tube protein	A0A0K2CNG3	Brevibacillus_phage	4.9e-45	56.4
WP_015737359.1\|6059464_6060784_-\|tail	phage tail sheath family protein	S5MNC1	Brevibacillus_phage	5.6e-118	50.6
WP_015737360.1\|6060784_6060958_-	hypothetical protein	NA	NA	NA	NA
WP_015737361.1\|6060954_6061392_-	hypothetical protein	NA	NA	NA	NA
WP_015737362.1\|6061495_6061675_-	hypothetical protein	NA	NA	NA	NA
WP_041622059.1\|6061687_6061930_-	hypothetical protein	NA	NA	NA	NA
WP_015737363.1\|6061950_6062400_-	hypothetical protein	NA	NA	NA	NA
WP_015737364.1\|6062411_6063389_-	kelch repeat-containing protein	NA	NA	NA	NA
WP_015737365.1\|6063407_6064412_-	hypothetical protein	NA	NA	NA	NA
WP_049788828.1\|6064415_6064982_-	YmfQ family protein	A0A0A7RUW8	Clostridium_phage	1.0e-28	43.4
WP_015737367.1\|6064989_6066144_-\|plate	baseplate J/gp47 family protein	S6AVU3	Thermus_phage	1.4e-40	33.9
WP_015737368.1\|6066143_6066602_-	DUF2634 domain-containing protein	A0A0N7ACH4	Bacillus_phage	3.7e-24	38.3
WP_015737369.1\|6066594_6066984_-	hypothetical protein	A0A0N7ACD3	Bacillus_phage	7.4e-10	34.7
WP_015737370.1\|6066976_6067954_-	hypothetical protein	A0A0N6W8H4	Bacillus_phage	7.7e-80	48.3
WP_015737371.1\|6067950_6068595_-	LysM peptidoglycan-binding domain-containing protein	A0A0N7ACF7	Bacillus_phage	2.0e-36	44.6
WP_015737372.1\|6068660_6070433_-	hypothetical protein	NA	NA	NA	NA
WP_015737374.1\|6070608_6071043_-	hypothetical protein	A0A2H4J883	uncultured_Caudovirales_phage	8.8e-20	41.3
WP_009594594.1\|6071179_6071587_-\|tail	phage tail tube protein	A0A2H4J032	uncultured_Caudovirales_phage	1.7e-41	59.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_013406

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection