CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NC_009445	Bradyrhizobium sp. ORS 278, complete genome	4 crisprs	csa3,WYL,cas3,DEDDh,RT	1	2	3	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_009445_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_009445_1

476627-476693

Orphan

Consensus_repeat	Method
ACCTTCCAACCCCCCTACCAACC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_009445_1

>merge|NC_009445|1|476627-476693|CRISPRCasFinder
ACCTTCCAACCCCCCTACCAACCGGTTTTTTCACCTTCCAACCCCCATGCCGACGCCACTACCAACC

>NC_009445|1|1|476627-476693|CRISPRCasFinder
ACCTTCCAACCCCCCTACCAACC	GGTTTTTTCACCTTCCAACCC
CCATGCCGACGCCACTACCAACC

Protein	Signature genes	Signature genes Name	Protein_function
NC_009445.1\|WP_050781077.1\|474398_474758_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224507
NC_009445.1\|WP_011923680.1\|474754_475033_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|235828
NC_009445.1\|WP_011923686.1\|479573_482600_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|237537
NC_009445.1\|WP_011923673.1\|465096_465891_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|223377
NC_009445.1\|WP_041756004.1\|466000_466903_+\|HNH-endonuclease	unknown	unknown	gnl\|CDD\|225973
NC_009445.1\|WP_085972762.1\|467040_467268_+\|DUF2892-domain-containing-protein	unknown	unknown	gnl\|CDD\|378561
NC_009445.1\|WP_011923678.1\|473017_473821_+\|hypothetical-protein	unknown	unknown	unknown
NC_009445.1\|WP_011923693.1\|486028_486274_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|376540
NC_009445.1\|WP_041756013.1\|483534_484248_-\|hypothetical-protein	unknown	unknown	unknown
NC_009445.1\|WP_041756006.1\|471655_472927_+\|integrase-arm-type-DNA-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|271177
NC_009445.1\|WP_011923685.1\|478190_479555_+\|hypothetical-protein	unknown	unknown	unknown
NC_009445.1\|WP_041757272.1\|484425_484647_+\|hypothetical-protein	unknown	unknown	unknown
NC_009445.1\|WP_041756016.1\|486351_486696_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|369353
NC_009445.1\|WP_041756015.1\|485709_485958_-\|hypothetical-protein	unknown	unknown	unknown
NC_009445.1\|WP_011923675.1\|467681_469013_+\|hypothetical-protein	unknown	unknown	unknown
NC_009445.1\|WP_173363477.1\|477618_477789_+\|hypothetical-protein	unknown	unknown	unknown
NC_009445.1\|WP_157872499.1\|469480_469828_+\|hypothetical-protein	unknown	unknown	unknown
NC_009445.1\|WP_011923681.1\|475029_475476_+\|hypothetical-protein	unknown	unknown	unknown
NC_009445.1\|WP_011923691.1\|484719_485664_+\|hypothetical-protein	unknown	unknown	unknown
NC_009445.1\|WP_011923683.1\|476935_477310_+\|DNA-binding-protein	unknown	unknown	gnl\|CDD\|378935

Protein	Function_ID	Function_description	E-value
NC_009445.1\|WP_050781077.1\|474398_474758_+\|hypothetical-protein	gnl\|CDD\|224507	COG1591, COG1591, Holliday junction resolvase - archaeal type [DNA replication, recombination, and repair].	7.67732e-06
NC_009445.1\|WP_011923680.1\|474754_475033_+\|hypothetical-protein	gnl\|CDD\|235828	PRK06556, PRK06556, vitamin B12-dependent ribonucleotide reductase; Validated.	9.78584e-07
NC_009445.1\|WP_011923686.1\|479573_482600_+\|hypothetical-protein	gnl\|CDD\|237537	PRK13875, PRK13875, conjugal transfer protein TrbL; Provisional.	0.00407081
NC_009445.1\|WP_041756016.1\|486351_486696_+\|hypothetical-protein	gnl\|CDD\|369353	pfam07410, Phage_Gp111, Streptococcus thermophilus bacteriophage Gp111 protein. This family consists of several Streptococcus thermophilus bacteriophage Gp111 proteins of around 110 residues in length. The function of this family is unknown.	0.00131066
NC_009445.1\|WP_041756006.1\|471655_472927_+\|integrase-arm-type-DNA-binding-domain-containing-protein	gnl\|CDD\|271177	cd00796, INT_Rci_Hp1_C, Shufflon-specific DNA recombinase Rci and Bacteriophage Hp1_like integrase, C-terminal catalytic domain. Rci protein is a tyrosine recombinase specifically involved in Shufflon type of DNA rearrangement in bacteria. The shufflon of plasmid R64 consists of four invertible DNA segments which are separated and flanked by seven 19-bp repeat sequences. RCI recombinase facilitates the site-specific recombination between any inverted repeats results in an inversion of the DNA segment(s) either independently or in groups. HP1 integrase promotes site-specific recombination of the HP1 genome into that of Haemophilus influenza. Bacteriophage Hp1_like integrases are tyrosine based site specific recombinases. They belong to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism is essentially identical and involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	3.5214e-15
NC_009445.1\|WP_011923673.1\|465096_465891_+\|SDR-family-oxidoreductase	gnl\|CDD\|223377	COG0300, DltE, Short-chain dehydrogenases of various substrate specificities [General function prediction only].	1.38673e-93
NC_009445.1\|WP_041756004.1\|466000_466903_+\|HNH-endonuclease	gnl\|CDD\|225973	COG3440, COG3440, Predicted restriction endonuclease [Defense mechanisms].	3.74751e-18
NC_009445.1\|WP_085972762.1\|467040_467268_+\|DUF2892-domain-containing-protein	gnl\|CDD\|378561	pfam11127, DUF2892, Protein of unknown function (DUF2892). This family is conserved in bacteria. The function is not known.	0.000191478
NC_009445.1\|WP_011923693.1\|486028_486274_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|376540	pfam01381, HTH_3, Helix-turn-helix. This large family of DNA binding helix-turn helix proteins includes Cro and CI. Within Neisseria gonorrhoeae NGO_0477, the full protein fold incorporates a helix-turn-helix motif, but the function of this member is unlikely to be that of a DNA-binding regulator, the function of most other members, so is not necessarily characteristic of the whole family.	0.000214174
NC_009445.1\|WP_011923683.1\|476935_477310_+\|DNA-binding-protein	gnl\|CDD\|378935	pfam12728, HTH_17, Helix-turn-helix domain. This domain is a DNA-binding helix-turn-helix domain.	0.00621305

>NC_009445.1|WP_011923681.1|475029_475476_+|hypothetical-protein
MMLASDIQQLAIGVAVSLADAPFAELEAQSTQLAEMALEGFLTKQQASDIAFTAAKAAGLVHRHGPDVVQETISEGFNMAVLAPIEAPPIVPKIPAKRPYQTPESTIAAFWYTVHNEDEATLRQWLLDHPADAPYLRKLWEARCCKSK
>NC_009445.1|WP_011923680.1|474754_475033_+|hypothetical-protein
MRERLPNRRGSLAFEFNHEGYKYRASIGRFDDGRLAEIFLDTGLIDTPLQQNAENAAMLASLLLQHGAKVADIVHSVSGPVAVALAQAEAFS
>NC_009445.1|WP_050781077.1|474398_474758_+|hypothetical-protein
MSKSQIESLKKSKGGRRSRDKGNRAERAITKFLQHRGFAAERVPLSGSAGGSFVGDITILLLGVDRCAEVKVRADGFRVLYGWLEGRDLLIVKADRAEPLVVLPLRFAAEIAAKAEGNR
>NC_009445.1|WP_011923678.1|473017_473821_+|hypothetical-protein
MSTHDSGILPFRGRRLARLNLIAKQAPRNRKRIAIAKRARLRRSAIEKQDRLGRIARFAETQRTCRRWISLGETLDWLTERSVIRAGRPNSEEPTAYRFMTALLNALFTHRFSSKIGENWAPRVFMLDASQKLGRLGFGDIAAAADTTMYRDPHIARAFVSCLWVRREDLLSVFNERGWEVPAWLSTVPAKAKTTSRSTATKRIAEAEILPMFEKWRRQQPTGYIPTRDEDIEHMRQYGVSRERVRELRKSFPSRERGEKKCSRTDP
>NC_009445.1|WP_041756006.1|471655_472927_+|integrase-arm-type-DNA-binding-domain-containing-protein
MAKLTKRAVDAAETSGADLFIWDDELPGFGLRVKKSGAKSFLVQYRNANGRSRRLTIGRFGVLTVEEARKEAKLALGNVVRGSDPAEARKLARGAMTIQDLAREYLEKAERGLILTRGGKGKSETTLYTDRGRVERHIIPLIGKRTIKDFTASDAGRFLRDVIAGKSATDVKTEKKRGRAIVTGGKGTAARTAGLLGGIFSYAVAEGYRPDNPVSGLRRPKDETREWRLDDEGYRRLGKALETAEANGAHWQRVLACRAAALTGCRLDEIQGLLKSELDTKGMALRLGDSKTGKSVRPIGSAAVAVLVAASDKSKSKYVFPSITSDAKHHTGLTRWLQDIAGKAVPGITSHGLRHSYSSTAEDLGFSIPTIKALIGHSRASVTEGYIHKIDSALLAAADRIASHIDNAMTGRSTEKVVQLRQA
>NC_009445.1|WP_157872499.1|469480_469828_+|hypothetical-protein
MRLAAPESTGREEKKIAQPRMLGPFDGSIFPCHTGAMGHRQKCKGSHTPSTGSLPEDLRDYAQPVQRRRVRSAKALQTGCKVRDDWPDEVPVTLTEVEVFEAWFGELLDELFGPF
>NC_009445.1|WP_011923675.1|467681_469013_+|hypothetical-protein
MIYVGQREFIIPTPLWAALPLAAVGYVAVDLAWQSWPSPTDLARVGQTTDCFLYTIARFASAYLAAFLVVDIASRSRTPWYGLFLLIPFAHLVAAYVIADLIVQPLTWLGTAILLGAFAAAAVPRGPAGSEMLALVFGALAVVPLLAALAALFVTLASRIVARLPLLTPDARRDLWPNMAAAMVWLPGGMAVGMAPRVLGYVMPRPAALLAALVLALASICLHLRLVHGVRREQMPHGNRLRTWLAAAVCCSALVLLAPNPIQYFSLVLVMPGYIRPVMPNLSGLYIDHVRPAFRAIGMLPTPVIEVAGYRVDVPFNDRTTMMEPTEATGGYDFVRITLPADYGVTTVKHVPSVAILRAKAIRLSDLFWSERHGDLEQAARAAQPGQEVVVRRESGFKREVGLRSDAYPELEFWLRSVDPATSWEAAEQALRRFLQQRLRRVN
>NC_009445.1|WP_085972762.1|467040_467268_+|DUF2892-domain-containing-protein
MRTVLGVSTAIVALDALSGPGAWLLAAAGLGFAVTGAVGHCPACATHLDLPSGASRLTVGTNITTASIRPAVTWL
>NC_009445.1|WP_041756004.1|466000_466903_+|HNH-endonuclease
MSYCVFMHRTDSIYDDSPAEQYQFPKQYLGRAEGSVGDWIVYLEPTKVAATRGYFAIARVERIIPDPKASGMYLALIQPGSYLEFVNAVPFSELDGPIERGLRNEAGRLSGRAQAAVRPISPQDFQRIIERGLDDHDPILPRVPDVVHPPDGFAEEQSPVVVEQLRERIQRLTSRVLRDRLFRTIVLRAYGERCAITGLKLINGGGRAEVNAAHIRPVEANGPDLVTNGLALSGTVHWMFDRGLISLSDDLAILLSRQINDADRIRGFINPSGFAFSPERAGDRPHPHFLQWHREHCFKH
>NC_009445.1|WP_011923673.1|465096_465891_+|SDR-family-oxidoreductase
MTSQTKGAVLITGASSGIGAVYAERFAARGHDLILVARNQDRLNAIADKLTARHGVKVKTLVADLTARDDLARVEAVLKSDASITHLVNNAGFGSAAPLAKADVDEMERMVAINVTAPLRLTYAAVPQFVARQQGTIINIASIVAIGPEVLNGVYGGTKSFVLAFSQSLRKELAGTGVHVQVVLPGATGTEFWDIAGLPASNLPKEWVMSAADLVDAALRGLDRGEFATVPSLADGAEFDAWEAARQTMLPHLSSAAVAERYRA
>NC_009445.1|WP_011923683.1|476935_477310_+|DNA-binding-protein
MTVFAAPKSRTSQPANPVGAQALGKLKILEPFNGLEAISVPEASRATGVPETTLRRWTREHGLGRRVGGHVRPWTLSRIALAMHLAGDRDALAAYHLGIRQEESVARYYRNEGLARLLRLPAFN
>NC_009445.1|WP_173363477.1|477618_477789_+|hypothetical-protein
MTEEMKIVQFRAPDRLSRVIDEAASRNFQTKSEYIRQSIVEKLRADGVQFDMVARS
>NC_009445.1|WP_011923685.1|478190_479555_+|hypothetical-protein
MAPRTTFVNLSDGLQNMSLWDQAFADTGLLGTIPCTATGTNAFILTPIASLFPPNILAYQAGLQFSFVVPSTTSGPVTAAVGLLSALAVNRSDGSQASTGDLVQNRVAVIQFNTATSAFDLVSVEGKSVLTDATQALTNKTFNGNTWTAGSGTITINGSKTLTLNNTIAFSGTDATTITFQGTDTYVGRGTTDTLSNKTIDTAAPNTVKINGNTLTAASGVATITFPNSTDTLVGRATTDTLTNKTIAAGSNTVTGLGVSNLGGFTGSPTNANFARGDGTWAAPASSNYVLLNTLTASASAALSDTSSLTNAYSAYDLVFINLVPATNAVTLQLQIQSAGVFQNTSYLTLVWGIATTNFTPSTGAPTTFIPLSNTNDVGNTGAGVSGTIRIYNPSATTFPKAVSGMMFNNSGGVNSRAALTSGYWNSNAAVTGVQIQFSSGNITSGTIKIYGAS
>NC_009445.1|WP_011923686.1|479573_482600_+|hypothetical-protein
MSFADVIASIDSGAEPDTSKRPPRAISKGGFRDVVRSIDNVFDQFDGYSSKKKSGSNPFDKYDELPSREVKGKNPFDKYDVSSPKQATSSSLGWNAVSGLNEGIANTLGAPADAIAKGLNSDIHDINSVFGTNIRPIEDPFGGSKSIRRGMSRLGIATGETVEANNAAERIARGAGEGAGSLVAGAAELAVVNKLFKLAEGAPQIYKALEGLFGGPTPATAATGAAVGAGAAAGAEAAPEGYKGVGSLAGGLAGGVVPAAARVAWEGGKFAVNAAAQAARPFTKAGQEQLAGQTLRGSSSNPYQVMNNLENGPNELVAGSKPTTFQQTGDMGLGQLERRVRTNNPDDFLQRAAEQNSARRGAIEGVQATGNPTAVSAHFRGMRESLDRVTEAEVGNATNLRNQATAELGGMGREEGYGAAMRAPAQEARDAAKEAENRLWEAVDPHRDLTMPAGPIANTARNVQGAMTRSAKPMTGEERDIFEVAQSYGPNTPFQEVKDLRSRISTAMFQELRTNGRTPVYARLSQLRRSVEESIDGAIERQVRLDQRAVAQGRLPAEDTIGARLQREATEWARTRQAGEVVGSGVGGMGPRREGSVSAAFGTEVPNRLRNAEGNSRVQEASPLDEAAAERLRAASAATRERAATFDQGATGNVLRPGARAGEYRTPDSLVPSKVFHPGANGGEDVRHFVAAVGEDRAIPIIADYAASSLRRAAVRPDGSVDTAKALAWAKQHDAALAELPPAIRSRFANPGRAEEVLAQASAARKEQLETFDRSAIAKVMGTESGDVVRQVGSVFEKQNAAAQMGELVRNARGNPSAMEGLRRSVVEYIQSKYIGNTEAATSEQALINANAFQTFIKNKADVLGKVFTPDEIGNLRAVAQDIQRANRSINATKLPGGSNTAQDLANAAPQGSILNKLAVEAGAAAAGHAVTNSISGGVFGWLGTRIASSLRDAGISHVDDLIKEAMLHPELARELMKKAPAQPTGGGVERIVKTLKRISVAVASNIK
>NC_009445.1|WP_041756013.1|483534_484248_-|hypothetical-protein
MLKVLITVLFSIVPLSFAHADSCKSINDNVKRLACYDTPTGLEYVIREVEQNPQAVASIVAAAFALVSGVGGPLVTLLIGRRQAAAAQTSADAANLTARTVGFRELAKVRLDWLKALRDNLSEYHSILMTSEDPDPDLEGEAAKEAREKDEADDRRLSYLGTQLDLLLNQKKPLQKALWGISDEILALDTKEERQARDQALVEAARAVLDFEWQKIKREMRGETSQVHPAVDRGIRL
>NC_009445.1|WP_041757272.1|484425_484647_+|hypothetical-protein
MPDELSVFGFVDEIEIEESAAVVVEQIDEEITVSIASVVSVNFQLTPEQTMELSRALAIAAEKAAEFLASDEN
>NC_009445.1|WP_011923691.1|484719_485664_+|hypothetical-protein
MPKSTGTMSDEVAAQVLQALRSGQTLFSICGGRPKNGERYPRITYYEPYRAYCAAKPEYAREANALLAKSTAAANARKGMSKSFKLRTHCLRGHALTLDNLYFKSTNGTRQCKACTLASIGRGGPVTKQQIEKVRRAVLTGMNISDITRSNGKRKPILSFAQLKRVRIECDNLNRFIIENVHSWRSRKALIGPMGIARLDGRMAQIIRLPRRADEIEIYEFRPGDFEWLYGLTPWTWPKFAREEIVGDLFLELSERLIHRDDIPGRVKFYVAKHNRDYPSVSHGDLRSPLSLDAPIFEDGNMTRADTIVRGLWD
>NC_009445.1|WP_041756015.1|485709_485958_-|hypothetical-protein
MTINFEYDLDEIVQMAGKPITLAGALRRMPDQVGPLAVLYRDAGKQPALFDAEQIQDLLDKHRSELEAGNPQGHREADKYDN
>NC_009445.1|WP_011923693.1|486028_486274_-|helix-turn-helix-domain-containing-protein
MISIEQIRAARGLLGWSQTQLAEASGRSLPTIKRLEREDGDGPAVSNDVRADVEAALEKAGVEFIPENGGGAGVRLKKRKR
>NC_009445.1|WP_041756016.1|486351_486696_+|hypothetical-protein
MSKSASPVNGGAMPKIDRSAVMRRAWAIFREVYKYPQIKFSDIGRNCFAWALRKAWAEAREAARLSAIPAQERQDCISCLNALIERAGFIDSGPAWRRTVTAYRDEIRQLETAI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_009445_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_009445_2

955816-955917

Orphan

Consensus_repeat	Method
TCAACGACGGCACGATCGAGATC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_009445_2

>merge|NC_009445|2|955816-955917|CRISPRCasFinder
TCGAGGACAGCACGATCGCGGGCGGCGGCCTCGTCAACCGCGGCATTGTGCATGTCGAGACCGCGGACGCGACCACGTTCGACAGCGTCACGATCGACAATG

>NC_009445|2|2|955816-955917|CRISPRCasFinder
TCGAGGACAGCACGATCGCGGGC	GGCGGCCTCGTCAACCGCGGCATTGTGCATGTCGAGACCGCGGACGCGACCACGT
TCGACAGCGTCACGATCGACAATG

Protein	Signature genes	Signature genes Name	Protein_function
NC_009445.1\|WP_011924074.1\|963204_964878_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173860
NC_009445.1\|WP_011924072.1\|958899_961134_+\|adenylate/guanylate-cyclase-domain-containing-protein	unknown	unknown	gnl\|CDD\|215016
NC_009445.1\|WP_011924065.1\|944266_945808_-\|peptide-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173880
NC_009445.1\|WP_011924067.1\|947297_947942_+\|winged-helix-DNA-binding-protein	unknown	unknown	gnl\|CDD\|227918
NC_009445.1\|WP_011924077.1\|967078_968128_+\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|236898
NC_009445.1\|WP_011924075.1\|965008_965962_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223674
NC_009445.1\|WP_011924066.1\|945897_947142_-\|dienelactone-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|223489
NC_009445.1\|WP_011924062.1\|941476_942352_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|223521
NC_009445.1\|WP_041756081.1\|961414_963010_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173860
NC_009445.1\|WP_011924080.1\|970070_971051_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|223521
NC_009445.1\|WP_011924081.1\|971175_971445_+\|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein	unknown	unknown	gnl\|CDD\|225170
NC_009445.1\|WP_041756079.1\|942348_943239_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224094
NC_009445.1\|WP_011924069.1\|949546_951022_+\|amidase	unknown	unknown	gnl\|CDD\|223232
NC_009445.1\|WP_083794822.1\|951042_951780_-\|transglutaminase-like-cysteine-peptidase	unknown	unknown	gnl\|CDD\|368714
NC_009445.1\|WP_011924061.1\|940619_941480_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224048
NC_009445.1\|WP_041756082.1\|965964_966867_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224094
NC_009445.1\|WP_011924078.1\|968156_968354_+\|hypothetical-protein	unknown	unknown	unknown
NC_009445.1\|WP_011924079.1\|968350_969763_+\|Asp-tRNA(Asn)/Glu-tRNA(Gln)-amidotransferase-GatCAB-subunit-A	unknown	unknown	gnl\|CDD\|223232
NC_009445.1\|WP_011924064.1\|943244_944252_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223674
NC_009445.1\|WP_011924060.1\|939906_940623_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|181335

Protein	Function_ID	Function_description	E-value
NC_009445.1\|WP_011924074.1\|963204_964878_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|173860	cd08495, PBP2_NikA_DppA_OppA_like_8, The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	0
NC_009445.1\|WP_011924072.1\|958899_961134_+\|adenylate/guanylate-cyclase-domain-containing-protein	gnl\|CDD\|215016	smart01080, CHASE2, CHASE2 is an extracellular sensory domain, which is present in various classes of transmembrane receptors that are parts of signal transduction pathways in bacteria. Specifically, CHASE2 domains are found in histidine kinases, adenylate cyclases, serine/threonine kinases and predicted diguanylate cyclases/phosphodiesterases. Environmental factors that are recognised by CHASE2 domains are not known at this time.	5.07214e-75
NC_009445.1\|WP_011924065.1\|944266_945808_-\|peptide-ABC-transporter-substrate-binding-protein	gnl\|CDD\|173880	cd08515, PBP2_NikA_DppA_OppA_like_10, The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	4.01242e-156
NC_009445.1\|WP_011924067.1\|947297_947942_+\|winged-helix-DNA-binding-protein	gnl\|CDD\|227918	COG5631, COG5631, Predicted transcription regulator, contains HTH domain (MarR family) [Transcription].	2.51931e-32
NC_009445.1\|WP_011924077.1\|967078_968128_+\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|236898	PRK11308, dppF, dipeptide transporter ATP-binding subunit; Provisional.	9.65606e-135
NC_009445.1\|WP_011924075.1\|965008_965962_+\|ABC-transporter-permease	gnl\|CDD\|223674	COG0601, DppB, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	6.04772e-110
NC_009445.1\|WP_011924066.1\|945897_947142_-\|dienelactone-hydrolase-family-protein	gnl\|CDD\|223489	COG0412, COG0412, Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism].	4.02743e-59
NC_009445.1\|WP_011924062.1\|941476_942352_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|223521	COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	1.48022e-125
NC_009445.1\|WP_041756081.1\|961414_963010_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|173860	cd08495, PBP2_NikA_DppA_OppA_like_8, The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	0
NC_009445.1\|WP_011924080.1\|970070_971051_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|223521	COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	1.39871e-158
NC_009445.1\|WP_011924081.1\|971175_971445_+\|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein	gnl\|CDD\|225170	COG2261, COG2261, Predicted membrane protein [Function unknown].	4.94762e-10
NC_009445.1\|WP_041756079.1\|942348_943239_-\|ABC-transporter-permease	gnl\|CDD\|224094	COG1173, DppC, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	1.11781e-76
NC_009445.1\|WP_011924069.1\|949546_951022_+\|amidase	gnl\|CDD\|223232	COG0154, GatA, Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit and related amidases [Translation, ribosomal structure and biogenesis].	9.03812e-98
NC_009445.1\|WP_083794822.1\|951042_951780_-\|transglutaminase-like-cysteine-peptidase	gnl\|CDD\|368714	pfam06035, Peptidase_C93, Bacterial transglutaminase-like cysteine proteinase BTLCP. Members of this family are predicted to be bacterial transglutaminase-like cysteine proteinases. They contain a conserved Cys-His-Asp catalytic triad. Their structure is predicted to be similar to that of Salmonella typhimurium N-hydroxyarylamine O-acetyltransferase, in pfam00797, however they lack the sub-domain which is important for arylamine recognition.	4.22543e-20
NC_009445.1\|WP_011924061.1\|940619_941480_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224048	COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only].	3.38386e-103
NC_009445.1\|WP_041756082.1\|965964_966867_+\|ABC-transporter-permease	gnl\|CDD\|224094	COG1173, DppC, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	1.38752e-82
NC_009445.1\|WP_011924079.1\|968350_969763_+\|Asp-tRNA(Asn)/Glu-tRNA(Gln)-amidotransferase-GatCAB-subunit-A	gnl\|CDD\|223232	COG0154, GatA, Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit and related amidases [Translation, ribosomal structure and biogenesis].	1.14695e-148
NC_009445.1\|WP_011924064.1\|943244_944252_-\|ABC-transporter-permease	gnl\|CDD\|223674	COG0601, DppB, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	8.10507e-94
NC_009445.1\|WP_011924060.1\|939906_940623_-\|SDR-family-oxidoreductase	gnl\|CDD\|181335	PRK08264, PRK08264, SDR family oxidoreductase.	1.33725e-94

>NC_009445.1|WP_083794822.1|951042_951780_-|transglutaminase-like-cysteine-peptidase
MTLLALMRASFAAAAASAILWASSPVSAGPIGQPRGLGSAIGDPEPFGLLRTEIEAGPLRDKWLTLARKLDDERVQLALCDGDRERCASPAALRLLAIVDQGRAREGRARLGEINRAINLAIRPASDLAQYGEMDVWASPLATFASLAGDCEDYAIAKFVALRLAGLPQRDLRIIILRDTISGEDHAVASARLDGHWLLLDNQRMAMIQDSDARRIRPRFVLDDIGIAALQDSPWMAEVSSRSRD
>NC_009445.1|WP_011924069.1|949546_951022_+|amidase
MTLAMSWDEWARHDGMALAARVRNGELTAAELAQQAAEGIAKVDPQLSGVVEVFADAVDDPIKAGANADGSFAGLPFLMKDLGPTMAGRLQEQGSLYMRGNRPAADTHLTKKMRRAGLNLMGRTTTPEFGVCSSAENPAVYVTRNPWDTDYTTCGSSAGSAAMVAAGVVPIAHATDGGGSIRIPAGVNGNIGLKVSRGVFSIAPHLSDLSGLVSIQGCQSRSVRDTAAFVDHCRGGAPGEFMPYWTAPEPYVELIKRDPGRLRIALSHQWGDYRATPHIASELQRVGKFLEGLGHHVGYALPDVDYRAAFAAQTTCYISNFAMVINNLLAQRKLERPPAELIEPINIRIWEAGRGTSFAERAAMQAVFNTTSRAFGAFFEEWDIILTPITALPTPKIGTTEYLTISDNPDVLDWFGNLWRNFAFTPLANLCGIPAVSLPLATNEHGLPLGIQAIGKQADDGLLLQLAAQIERAIDGRWNGGATPAVHVTKG
>NC_009445.1|WP_011924067.1|947297_947942_+|winged-helix-DNA-binding-protein
MKRATNAAAKRKTVTVKANSTGSKARSRADKAAERSDNQDSKGDSRGSWHLARSDAERRLSEFEFALERLAQSYYRWKASCLAAVCEVPLTGDDVAVLNVVRMGDEPKRLAEVGQLLNRVDVPNLQYATRKLVRAGLIETEGRSSRKETRYRATARGRAVTEDYAALRAATLPPMFDAVPGWIDSCAATTAQLDQMAGLYGQATRVAITKRHQS
>NC_009445.1|WP_011924066.1|945897_947142_-|dienelactone-hydrolase-family-protein
MAGKSAGQWIDIAAADGGTFKGYLAVPASGSGPGIVLLQEIFGVNASMRDVADYYAEEGYVVLAPDLFWRFEPGIELGYGEADFGKAFGYYQRFDVNLAIKDTADALKVLRARPECKGKVGALGFCLGGKLAYLTAARTDVDCAVSYYGVGIEADIAEAKNIKGPIVFHFAELDKFAPAEAREAIKAGFAGRDDAEFYLYPGCDHAFAAPERASFDKPATLMAHSRSIALFRKVLGPHYDLSSLWDKHTELEFATRSAEATMGTMVAEPYVNHIPTMTGGVGYKDLLRFYANHFIPKTPADTKLVPISRTIGADRVVDEMLFCFTHDIEIDWMLPGIPPTGKYVEIPLVAIVRFRGDKLYNEHIYWDQASVLVQIGLLDPSKLPVAGVETAKKLVDESLPSNTLMKRWAESAPH
>NC_009445.1|WP_011924065.1|944266_945808_-|peptide-ABC-transporter-substrate-binding-protein
MRDHQISRRTMLQLAGAAALPLATGLPLRPASAASGTLTIAYNVNLPSFDPTVGVSAVNPTIQSIYQAIFDPYIGQAADLSFTPGLLTKWGWNEDRTKVTMELRSDATWHDGSKVTPEDVVWSLTRAADPKGGNPIQFVWSKINNFKIDGQTITADVVEFEPVLFKWMAFLTGYVLPKAYYEKVGPEGFEKAPIGSGPYKVDAFERNAFLRLKAHAGYWGPKPAFETVVFKFVTDPTSRVAEIESGGSDITFEIPYEEFDRLKAKPNLAGLTQPISDIGMIFLTDIDPMLDRNVRLAANHAIDKKAIVEKLLRGYGVPIDTLEAPGYAAFDPSIKVAYDPELAKSLLAKSGYSTSKPVKFTIQTTRGFKPKDYEMVQAIAGMWRKVGIEANIEVYEIAQHFELRARHALAPAAFYNWGNAIGDPTTSTGFAMFGPSPHSAWKGKDLIERIGPLWGEKDEAKRIAGWKAVDKYIAEEGEVIPLLQYVQPIVHKKGLKVVPQANGMILPQLVTQG
>NC_009445.1|WP_011924064.1|943244_944252_-|ABC-transporter-permease
MRWSALLKRLALIPPTLLGVGAIVFVLLRVVPGDPIAMMIPPGASPADIARLRALYGLDQPLLSQFVTWLGQVASGDFGRSISLRQQVFELVGARLPATLELAALSVIMALLMGTAVALVGSLLRGSRAEWLLDTTNGVFLAIPDFLWALILLLGFGVLLPLLPISGRLDPQLAIAFRTHFYLIESLLTLRLDVATDLLRHMLLPSLALALPFAALVARLLKAQLAEAEDQDYAQIAHTRGFSRTTILQREVFPNALIPTVALSGVQVTLLLGGTVLVERIFSYEGIGNMAIDAVINRDFPLIQGLILTFAVLFIALNLAVDLLVALLDPRLRHG
>NC_009445.1|WP_041756079.1|942348_943239_-|ABC-transporter-permease
MADLVLSGPIIASPSRWRSALARGGARLWIGGLIVALLLLIALSAPVIAPHDPTEQDLMSAQLPPAFIRGGESAFPLGTDSLGRCVLSRLIYSARTAVSVALIASLLAALIGVVLGLIAGAFGGLPDQLVSRMIDVWMAFPPVLLSIVLAAVIGAGLTSVIAAIVVVDWTRFARIVRAETQAQLARDYAAAARVLGLTRAQALRLEILPNLIPLIVTLLAVEMGIAILVEVILSFVGISVTGDTASWGGMITEGRQIVYQAPWIMALPIAAVIVSVIGFNLFGDGLRAALDPVQRR
>NC_009445.1|WP_011924062.1|941476_942352_-|ABC-transporter-ATP-binding-protein
MSAILEIDNLHVAIGAANVLRGVSLRVEAGEVRGLVGESGAGKSMVGRTIFGLLPSRAKITAGRVSFEGRDLLAMPGKQRRELLGRRIALIPQDPMTSLNPVRRISTQMVAVLQLHLKLSKRAARGRAVELLTEVAIRDPERVLDCYPHELSGGMRQRVLIAMAFACDPSLVIADEPTTALDVTVQRQVLQLVERMRRRHGAAILFVTHDLGVVAKICRSMTVLHAGRVLEDGLTADVLVKPHHAYTRALLAATPRADRPADALKPVPPALIESLWAEAHRLDQLAAARPT
>NC_009445.1|WP_011924061.1|940619_941480_-|ABC-transporter-ATP-binding-protein
MSEILLRTGQLGFAYPARSRALFGKPEMRDVIKSVDLAVPRGAVLGLVGESGSGKTTLGRLLVRLLEPTAGGIQFDGVEISHISEAALRPLRARIQMIFQDPQSSLNPRLPLAVTLTRQLEIYGRINGRRDRRDKAAALLDLVGLPTSFVDRYPHELSGGQRQRAGIARALALQPDFIVADEIVSGLDVSTQAHILMLLKELRAKLGLTVVFISHDLSVIRVLCDDVAILKGGEVVEHGPVGRIFSHPQAAYTRQLLAAIPLPDVEPGWLDDTPSRQQPQQQGSAA
>NC_009445.1|WP_011924060.1|939906_940623_-|SDR-family-oxidoreductase
MSTSIKDSVVVITGATGAIASALVAELLARGAAKIYAAARDVSGLARTDKIVPLKLDVTSDADAAAAAAQASDATLLINNAGVNHNTAFLLAPDLAIATEEIAINYLAPLRLTRAFAPVLIKNHGAVLNILTILARVNLPLMGSYCASKAAALSLTQGLRGELTPKGVRVAGALPGAVDTRMTAGLPIPKMTPADAAKEILDGYEAGEEDIYVGDMAKGLAAGLAQDHKAVEKQLASG
>NC_009445.1|WP_011924072.1|958899_961134_+|adenylate/guanylate-cyclase-domain-containing-protein
MKRLRAVPRWFARRFGYARAICLLLLVGFAALRGSDPAPLQELRLRTFDNFQAFSPRVKSVRPVTIVDIDEKSVADPKLGQWPWPRTRIAEIIDRLTRLGAVVIAFDVVFAEPDRLNPAIAAETFPNLDEATREKLRLLPSNDQVLADALRRSRIVLGETGSNEVRAELDKTLPVTGVATIGPPADDFMESYSGLLRNVAVIEHAASGRGLFTIPPERDGIIRRVPMILQAQDTTMLSLSFEMLRVVTGADTVLIRTDMGGITGLRLGGFEIPTDRRGRIWVHYADHDPSIYVSAIDVLEGRVPPEKIARKLVLIGPSAIGLNDIKTTPVNPTMPGVEVHAQVLETVLTNSILSPPFWGLSAEFFAAVILGLLVIVFAPQLGAVTLVLVGGLFASALFGVSWYAYTQHRLLLDFTYPMVSTTAIYLTLIFASFVREQSQRRQIRSAFGQYLSPALVEQLAHSPEKLVLGGEEREMTIMFSDVRGFTTISESYKHDPQGLTKLMNRFLTPLTNAILARKGTIDKYMGDAIMAFWNAPLDDIGHHRNACEAALDMLDRVDELNRAREQEAKDGGHVYIPINIGIGLNTGICVVGNLGSDQRFDYSVLGDSVNLASRLEGQSKEYGFSIIVGSQTALAVKDKLAILELDFIMVKGKTEPEVIYAIAGREDVMYSERFQLLRNLTIEMLAAYRGRDWDEALAAIARGRKKDEAKELAKLFDLYEARIRDYQQNPPPPDWNGAHALTSK
>NC_009445.1|WP_041756081.1|961414_963010_-|ABC-transporter-substrate-binding-protein
MRMKLSLLAAALALGLSAVAARAETVLRYGISMADIPLTTGQPDRGAGAYQFTGYTIYDPLVAWDMSVADKPGKLIPGLATEWKVDDADKKKWRFTLRKGVKFHDGSDFNADAVIWNLDKVLNDKAPQFDKRQSAQVKTRLPSVASYAKIDDSTVEITTKTVDSFFPYQMLWFLISSPAQYEKLGKDWDKFASQPSGTGPFKLTRLVPRELAELSRNSEYWNKDRIPKTDKLVLVPMPEALTRTNALLAGQVDLIETPAPDAVPQLKAAGMKLVDNVTPHVWNYHLSVLPGSPWTDIRLRKALNLAINRDEVVGLMNGLAKPAKGQVDPSSPWFGKPTFELKYDLAAAKKLVEEAGYSPAKPLKTTFIIAQGGTGQMLSLPMNEFLQQSFKEIGIDIDFKVVELETLYTHWRKGAADEMNAGITANNIAYVTSDPLYAIVRFFASDQIAPTGVNWGGYKNPKVDALIAEAKQTFDPAKQDELIAQAHAAVVDDAVLVWVVHDTNPHALSPKVKTFVQAQHWFQDLTTIGAE
>NC_009445.1|WP_011924074.1|963204_964878_+|ABC-transporter-substrate-binding-protein
MLLRLAPSVTKRAAIGAAMMTSAAILMLPATAGAESVLRIGMTAADIPRTLGQPDQGFEGNRFTGLTMYDALTMWDLSSADKPSVVIPGLATEWKVDESDKTKWTFKLRPGVTFHDGAPFNADAVVWNVEKVLKQDAPQFDPSQVGVTASRMPTLASARKIDDLTVELVTKEPDSFLPINLTNLFMASPAKWQKLYESATGADDKAKSQAAWAAFAKDASGTGPWKMSKFTPRERLELVKNEAYWDKARVPKADKMILLPMPEANARTAALLSGQVDWVEAPAPDALPEIKQRGFKLYANEQPHVWPWQFSRVEGSPWNDIRVRKAANLCIDREGLRDGLLAGLMVPATGTFEKGHPWRGNVTFEIKYDKAAAQKLMQEAGYGPNKKLEVKTQTSASGSGQMQPLPMNEYLQQALAECYFDVKLDVIEWNTLFTNWRRGAKDASANGANATNVTYAAMDPFFALVRFLQSSMAPPVSNNWGFINNPKFDELVKKARQTFDPAERDKALAELHAASVDDAAFLYVAHDVGPRAMSPKVKGVVQPKSWFIDFSPISVEP
>NC_009445.1|WP_011924075.1|965008_965962_+|ABC-transporter-permease
MLSYAARRMVYAIPIIIGVALVCFMLVHITPGDPLVAVLPADASQELAQQLRVAYGFDKPLPVQFGLWLWRAVNGDLGSSIATGRPVLAEVLRAVANTVTLAIAAAIIGFSLGLFFGLVAGYFRDTWVDKVATSIAIAGVSLPHYWLGMVLVIIFSVELNWLPAVGAGPSGSGAWAWDWAHLRFLILPAITTSVIPMGIVTRTVRALTGDILSQDFVEALRAKGLRERQVFRHVLKNAAPTALAVMGLQLGYMLGGSILIETVFSWPGSGLLLNSAIFQRDLPLLQGTILVLAMFFVILNLVVDIAQAAIDPRIKRG
>NC_009445.1|WP_041756082.1|965964_966867_+|ABC-transporter-permease
MSVSSPSAINEASLQSAPAAKARGYWATVGRRIVRDKVSMVCVAILLLIFLSALLAPYLHLADPYQGSMIRRLRHIGTPNYPLGTDELGRDMLARLIHGGRLSLLIGISPVILAFGIGTMLGLVAGYVGGWVNTMIMRTIDVFYAFPSVLLAIAISGALGAGITNSIVSLTIVFVPQITRVAESVTTGVRNRDFVEAARASGANAFTIMRAHMLGNVLGPIFVYATGLISVSMILAAGLSFLGLGTKPPEPEWGLMLNTLRTAIYVNPWVAALPGVMIFAVSICFNLLSDGLRSAMDIRS
>NC_009445.1|WP_011924077.1|967078_968128_+|ATP-binding-cassette-domain-containing-protein
MNEPAVVTGLAPIEDLGGKAQPLLRVDGLTKHFPVRGGLFGARKTVRAVDDVSFNIGKGETVGIVGESGCGKSTTARLLMHLMERDAGEIIFDGRQVGHEISLRELRRGMQMVFQDSYASLNPRLTIEESIAFGPKVHGMADGAARALARELLGKVGLRHEIFANRYPHEISGGQRQRVNIARALALSPRLVILDEAVSALDKSVEAQVLNLLTDLKREFGLTYLFISHDLNVINYISDRVLVMYLGEVVELGPVEQVWAKPAHPYTRALLAAMPSSDPDRRTEQPPLSGDPPNPIDPPSGCRFHTRCPFAEAPCANVAPRLTELDTMGHQAACHMAISGSGHSRAPAA
>NC_009445.1|WP_011924078.1|968156_968354_+|hypothetical-protein
MTRPTPQQVQAIAEASGLPVDKEVATRISDSIGPAFDNFAAIAGTLPFDLEPASYVLAQTLKVGR
>NC_009445.1|WP_011924079.1|968350_969763_+|Asp-tRNA(Asn)/Glu-tRNA(Gln)-amidotransferase-GatCAB-subunit-A
MSTEPALMTLTEVAKAIAEKKLSSVDVTRSCLHRIAQWQPKLNAFMAIESEPALKAAAEADAALAKDGPKGPLHGVPLAHKDMYYEAGHVSTCGSLIRRDFVATTTSTALQRLKDAGAIRLGTLQMAEFAYGPTGHNAHYGPVHNPWKLGYVTGGSSSGSGSAVGARLTFAALGSDTGGSIRMPANFCGVTGLKVTWGRVSRAGAMPLSQSLDTVGPLAQTAEDCALLLGLMAGPDPEDPTASAAQVQDYVAATQSSIKGLKIGVPKSFYVDDLDPEVARCLDAAITVLKTEGADVVQVELPDQRQLTAACQLVLAVEAAAFHKRWMIERPQDYGPQVLMRLQNALAVSGVAYLEALRWRGAALAAHVAATAGVDAIIAPVSPLVTPSIAESDVGGAPGAEAVIQRITRFTRPVNYLGLPSLAIPTGFTATGLPVGMQLIGRSFDEATILTIGAAFQRATDFHARVPTLS
>NC_009445.1|WP_011924080.1|970070_971051_+|ABC-transporter-ATP-binding-protein
MTNLVEISNLSIRFTGERTVHAVNDVSLSLGDGEVLGLLGESGSGKSVTMRALMRLLPKKRTQISGGVKVMGRDILAMSDEELSQFRGRTVSMIFQEPGLALDPVYTIGRQIAETVMRHEGKSYAEGTARALEMLDVVRIPSAKRRLDSYPHEMSGGMRQRAMIALALACRPKVLLADEPTTALDATVQIQILLLLRELQREFGMSVIFVTHDIGVAIEICDRVAVMYAGQIVEQGSLRDIVRQPVHPYARGLLASTIHGPKRGERLQTIPGTPPSLDQAPRSCSFAPRCSLAQPRCSETLPPAVQLGPQRLARCVLAGAESVAAT
>NC_009445.1|WP_011924081.1|971175_971445_+|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein
MHVSNEGILVILFVGLIAGWLAGKIVRGTGFGLIGDIVIGVLGALVASFLFPRLGIHLGTGLVSEIVYSALGAIILLLVVRLVRTGGRL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_009445_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_009445_3

956197-956315

Orphan

Consensus_repeat	Method
TCAACGACGGCACGATCGAGATC	CRISPRCasFinder

2 spacers

The CRISPR arrays of NC_009445_3

>merge|NC_009445|3|956197-956315|CRISPRCasFinder
GCATCGACGGCCCGATCATCAACGACGGCACGATCGAGATCGTCGGTGGGACGTTCCAGATCAACGGCTCGCTCGTCAACGACGGCACCATCGAGATCACCGCCGGCATCTTCGAGATC

>NC_009445|3|3|956197-956315|CRISPRCasFinder
GCATCGACGGCCCGATCATCAAC	GACGGCACGATCGAGA
TCGTCGGTGGGACGTTCCAGATC	AACGGCTCGCTCGTCAACGACGGCACCATCGAGA
TCACCGCCGGCATCTTCGAGATC

Protein	Signature genes	Signature genes Name	Protein_function
NC_009445.1\|WP_011924074.1\|963204_964878_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173860
NC_009445.1\|WP_011924072.1\|958899_961134_+\|adenylate/guanylate-cyclase-domain-containing-protein	unknown	unknown	gnl\|CDD\|215016
NC_009445.1\|WP_011924065.1\|944266_945808_-\|peptide-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173880
NC_009445.1\|WP_011924067.1\|947297_947942_+\|winged-helix-DNA-binding-protein	unknown	unknown	gnl\|CDD\|227918
NC_009445.1\|WP_011924077.1\|967078_968128_+\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|236898
NC_009445.1\|WP_011924075.1\|965008_965962_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223674
NC_009445.1\|WP_011924066.1\|945897_947142_-\|dienelactone-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|223489
NC_009445.1\|WP_011924062.1\|941476_942352_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|223521
NC_009445.1\|WP_041756081.1\|961414_963010_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173860
NC_009445.1\|WP_011924080.1\|970070_971051_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|223521
NC_009445.1\|WP_011924081.1\|971175_971445_+\|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein	unknown	unknown	gnl\|CDD\|225170
NC_009445.1\|WP_041756079.1\|942348_943239_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224094
NC_009445.1\|WP_011924069.1\|949546_951022_+\|amidase	unknown	unknown	gnl\|CDD\|223232
NC_009445.1\|WP_083794822.1\|951042_951780_-\|transglutaminase-like-cysteine-peptidase	unknown	unknown	gnl\|CDD\|368714
NC_009445.1\|WP_011924061.1\|940619_941480_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224048
NC_009445.1\|WP_041756082.1\|965964_966867_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224094
NC_009445.1\|WP_011924078.1\|968156_968354_+\|hypothetical-protein	unknown	unknown	unknown
NC_009445.1\|WP_011924079.1\|968350_969763_+\|Asp-tRNA(Asn)/Glu-tRNA(Gln)-amidotransferase-GatCAB-subunit-A	unknown	unknown	gnl\|CDD\|223232
NC_009445.1\|WP_011924064.1\|943244_944252_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223674
NC_009445.1\|WP_011924060.1\|939906_940623_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|181335

Protein	Function_ID	Function_description	E-value
NC_009445.1\|WP_011924074.1\|963204_964878_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|173860	cd08495, PBP2_NikA_DppA_OppA_like_8, The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	0
NC_009445.1\|WP_011924072.1\|958899_961134_+\|adenylate/guanylate-cyclase-domain-containing-protein	gnl\|CDD\|215016	smart01080, CHASE2, CHASE2 is an extracellular sensory domain, which is present in various classes of transmembrane receptors that are parts of signal transduction pathways in bacteria. Specifically, CHASE2 domains are found in histidine kinases, adenylate cyclases, serine/threonine kinases and predicted diguanylate cyclases/phosphodiesterases. Environmental factors that are recognised by CHASE2 domains are not known at this time.	5.07214e-75
NC_009445.1\|WP_011924065.1\|944266_945808_-\|peptide-ABC-transporter-substrate-binding-protein	gnl\|CDD\|173880	cd08515, PBP2_NikA_DppA_OppA_like_10, The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	4.01242e-156
NC_009445.1\|WP_011924067.1\|947297_947942_+\|winged-helix-DNA-binding-protein	gnl\|CDD\|227918	COG5631, COG5631, Predicted transcription regulator, contains HTH domain (MarR family) [Transcription].	2.51931e-32
NC_009445.1\|WP_011924077.1\|967078_968128_+\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|236898	PRK11308, dppF, dipeptide transporter ATP-binding subunit; Provisional.	9.65606e-135
NC_009445.1\|WP_011924075.1\|965008_965962_+\|ABC-transporter-permease	gnl\|CDD\|223674	COG0601, DppB, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	6.04772e-110
NC_009445.1\|WP_011924066.1\|945897_947142_-\|dienelactone-hydrolase-family-protein	gnl\|CDD\|223489	COG0412, COG0412, Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism].	4.02743e-59
NC_009445.1\|WP_011924062.1\|941476_942352_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|223521	COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	1.48022e-125
NC_009445.1\|WP_041756081.1\|961414_963010_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|173860	cd08495, PBP2_NikA_DppA_OppA_like_8, The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	0
NC_009445.1\|WP_011924080.1\|970070_971051_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|223521	COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	1.39871e-158
NC_009445.1\|WP_011924081.1\|971175_971445_+\|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein	gnl\|CDD\|225170	COG2261, COG2261, Predicted membrane protein [Function unknown].	4.94762e-10
NC_009445.1\|WP_041756079.1\|942348_943239_-\|ABC-transporter-permease	gnl\|CDD\|224094	COG1173, DppC, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	1.11781e-76
NC_009445.1\|WP_011924069.1\|949546_951022_+\|amidase	gnl\|CDD\|223232	COG0154, GatA, Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit and related amidases [Translation, ribosomal structure and biogenesis].	9.03812e-98
NC_009445.1\|WP_083794822.1\|951042_951780_-\|transglutaminase-like-cysteine-peptidase	gnl\|CDD\|368714	pfam06035, Peptidase_C93, Bacterial transglutaminase-like cysteine proteinase BTLCP. Members of this family are predicted to be bacterial transglutaminase-like cysteine proteinases. They contain a conserved Cys-His-Asp catalytic triad. Their structure is predicted to be similar to that of Salmonella typhimurium N-hydroxyarylamine O-acetyltransferase, in pfam00797, however they lack the sub-domain which is important for arylamine recognition.	4.22543e-20
NC_009445.1\|WP_011924061.1\|940619_941480_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224048	COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only].	3.38386e-103
NC_009445.1\|WP_041756082.1\|965964_966867_+\|ABC-transporter-permease	gnl\|CDD\|224094	COG1173, DppC, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	1.38752e-82
NC_009445.1\|WP_011924079.1\|968350_969763_+\|Asp-tRNA(Asn)/Glu-tRNA(Gln)-amidotransferase-GatCAB-subunit-A	gnl\|CDD\|223232	COG0154, GatA, Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit and related amidases [Translation, ribosomal structure and biogenesis].	1.14695e-148
NC_009445.1\|WP_011924064.1\|943244_944252_-\|ABC-transporter-permease	gnl\|CDD\|223674	COG0601, DppB, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	8.10507e-94
NC_009445.1\|WP_011924060.1\|939906_940623_-\|SDR-family-oxidoreductase	gnl\|CDD\|181335	PRK08264, PRK08264, SDR family oxidoreductase.	1.33725e-94

>NC_009445.1|WP_083794822.1|951042_951780_-|transglutaminase-like-cysteine-peptidase
MTLLALMRASFAAAAASAILWASSPVSAGPIGQPRGLGSAIGDPEPFGLLRTEIEAGPLRDKWLTLARKLDDERVQLALCDGDRERCASPAALRLLAIVDQGRAREGRARLGEINRAINLAIRPASDLAQYGEMDVWASPLATFASLAGDCEDYAIAKFVALRLAGLPQRDLRIIILRDTISGEDHAVASARLDGHWLLLDNQRMAMIQDSDARRIRPRFVLDDIGIAALQDSPWMAEVSSRSRD
>NC_009445.1|WP_011924069.1|949546_951022_+|amidase
MTLAMSWDEWARHDGMALAARVRNGELTAAELAQQAAEGIAKVDPQLSGVVEVFADAVDDPIKAGANADGSFAGLPFLMKDLGPTMAGRLQEQGSLYMRGNRPAADTHLTKKMRRAGLNLMGRTTTPEFGVCSSAENPAVYVTRNPWDTDYTTCGSSAGSAAMVAAGVVPIAHATDGGGSIRIPAGVNGNIGLKVSRGVFSIAPHLSDLSGLVSIQGCQSRSVRDTAAFVDHCRGGAPGEFMPYWTAPEPYVELIKRDPGRLRIALSHQWGDYRATPHIASELQRVGKFLEGLGHHVGYALPDVDYRAAFAAQTTCYISNFAMVINNLLAQRKLERPPAELIEPINIRIWEAGRGTSFAERAAMQAVFNTTSRAFGAFFEEWDIILTPITALPTPKIGTTEYLTISDNPDVLDWFGNLWRNFAFTPLANLCGIPAVSLPLATNEHGLPLGIQAIGKQADDGLLLQLAAQIERAIDGRWNGGATPAVHVTKG
>NC_009445.1|WP_011924067.1|947297_947942_+|winged-helix-DNA-binding-protein
MKRATNAAAKRKTVTVKANSTGSKARSRADKAAERSDNQDSKGDSRGSWHLARSDAERRLSEFEFALERLAQSYYRWKASCLAAVCEVPLTGDDVAVLNVVRMGDEPKRLAEVGQLLNRVDVPNLQYATRKLVRAGLIETEGRSSRKETRYRATARGRAVTEDYAALRAATLPPMFDAVPGWIDSCAATTAQLDQMAGLYGQATRVAITKRHQS
>NC_009445.1|WP_011924066.1|945897_947142_-|dienelactone-hydrolase-family-protein
MAGKSAGQWIDIAAADGGTFKGYLAVPASGSGPGIVLLQEIFGVNASMRDVADYYAEEGYVVLAPDLFWRFEPGIELGYGEADFGKAFGYYQRFDVNLAIKDTADALKVLRARPECKGKVGALGFCLGGKLAYLTAARTDVDCAVSYYGVGIEADIAEAKNIKGPIVFHFAELDKFAPAEAREAIKAGFAGRDDAEFYLYPGCDHAFAAPERASFDKPATLMAHSRSIALFRKVLGPHYDLSSLWDKHTELEFATRSAEATMGTMVAEPYVNHIPTMTGGVGYKDLLRFYANHFIPKTPADTKLVPISRTIGADRVVDEMLFCFTHDIEIDWMLPGIPPTGKYVEIPLVAIVRFRGDKLYNEHIYWDQASVLVQIGLLDPSKLPVAGVETAKKLVDESLPSNTLMKRWAESAPH
>NC_009445.1|WP_011924065.1|944266_945808_-|peptide-ABC-transporter-substrate-binding-protein
MRDHQISRRTMLQLAGAAALPLATGLPLRPASAASGTLTIAYNVNLPSFDPTVGVSAVNPTIQSIYQAIFDPYIGQAADLSFTPGLLTKWGWNEDRTKVTMELRSDATWHDGSKVTPEDVVWSLTRAADPKGGNPIQFVWSKINNFKIDGQTITADVVEFEPVLFKWMAFLTGYVLPKAYYEKVGPEGFEKAPIGSGPYKVDAFERNAFLRLKAHAGYWGPKPAFETVVFKFVTDPTSRVAEIESGGSDITFEIPYEEFDRLKAKPNLAGLTQPISDIGMIFLTDIDPMLDRNVRLAANHAIDKKAIVEKLLRGYGVPIDTLEAPGYAAFDPSIKVAYDPELAKSLLAKSGYSTSKPVKFTIQTTRGFKPKDYEMVQAIAGMWRKVGIEANIEVYEIAQHFELRARHALAPAAFYNWGNAIGDPTTSTGFAMFGPSPHSAWKGKDLIERIGPLWGEKDEAKRIAGWKAVDKYIAEEGEVIPLLQYVQPIVHKKGLKVVPQANGMILPQLVTQG
>NC_009445.1|WP_011924064.1|943244_944252_-|ABC-transporter-permease
MRWSALLKRLALIPPTLLGVGAIVFVLLRVVPGDPIAMMIPPGASPADIARLRALYGLDQPLLSQFVTWLGQVASGDFGRSISLRQQVFELVGARLPATLELAALSVIMALLMGTAVALVGSLLRGSRAEWLLDTTNGVFLAIPDFLWALILLLGFGVLLPLLPISGRLDPQLAIAFRTHFYLIESLLTLRLDVATDLLRHMLLPSLALALPFAALVARLLKAQLAEAEDQDYAQIAHTRGFSRTTILQREVFPNALIPTVALSGVQVTLLLGGTVLVERIFSYEGIGNMAIDAVINRDFPLIQGLILTFAVLFIALNLAVDLLVALLDPRLRHG
>NC_009445.1|WP_041756079.1|942348_943239_-|ABC-transporter-permease
MADLVLSGPIIASPSRWRSALARGGARLWIGGLIVALLLLIALSAPVIAPHDPTEQDLMSAQLPPAFIRGGESAFPLGTDSLGRCVLSRLIYSARTAVSVALIASLLAALIGVVLGLIAGAFGGLPDQLVSRMIDVWMAFPPVLLSIVLAAVIGAGLTSVIAAIVVVDWTRFARIVRAETQAQLARDYAAAARVLGLTRAQALRLEILPNLIPLIVTLLAVEMGIAILVEVILSFVGISVTGDTASWGGMITEGRQIVYQAPWIMALPIAAVIVSVIGFNLFGDGLRAALDPVQRR
>NC_009445.1|WP_011924062.1|941476_942352_-|ABC-transporter-ATP-binding-protein
MSAILEIDNLHVAIGAANVLRGVSLRVEAGEVRGLVGESGAGKSMVGRTIFGLLPSRAKITAGRVSFEGRDLLAMPGKQRRELLGRRIALIPQDPMTSLNPVRRISTQMVAVLQLHLKLSKRAARGRAVELLTEVAIRDPERVLDCYPHELSGGMRQRVLIAMAFACDPSLVIADEPTTALDVTVQRQVLQLVERMRRRHGAAILFVTHDLGVVAKICRSMTVLHAGRVLEDGLTADVLVKPHHAYTRALLAATPRADRPADALKPVPPALIESLWAEAHRLDQLAAARPT
>NC_009445.1|WP_011924061.1|940619_941480_-|ABC-transporter-ATP-binding-protein
MSEILLRTGQLGFAYPARSRALFGKPEMRDVIKSVDLAVPRGAVLGLVGESGSGKTTLGRLLVRLLEPTAGGIQFDGVEISHISEAALRPLRARIQMIFQDPQSSLNPRLPLAVTLTRQLEIYGRINGRRDRRDKAAALLDLVGLPTSFVDRYPHELSGGQRQRAGIARALALQPDFIVADEIVSGLDVSTQAHILMLLKELRAKLGLTVVFISHDLSVIRVLCDDVAILKGGEVVEHGPVGRIFSHPQAAYTRQLLAAIPLPDVEPGWLDDTPSRQQPQQQGSAA
>NC_009445.1|WP_011924060.1|939906_940623_-|SDR-family-oxidoreductase
MSTSIKDSVVVITGATGAIASALVAELLARGAAKIYAAARDVSGLARTDKIVPLKLDVTSDADAAAAAAQASDATLLINNAGVNHNTAFLLAPDLAIATEEIAINYLAPLRLTRAFAPVLIKNHGAVLNILTILARVNLPLMGSYCASKAAALSLTQGLRGELTPKGVRVAGALPGAVDTRMTAGLPIPKMTPADAAKEILDGYEAGEEDIYVGDMAKGLAAGLAQDHKAVEKQLASG
>NC_009445.1|WP_011924072.1|958899_961134_+|adenylate/guanylate-cyclase-domain-containing-protein
MKRLRAVPRWFARRFGYARAICLLLLVGFAALRGSDPAPLQELRLRTFDNFQAFSPRVKSVRPVTIVDIDEKSVADPKLGQWPWPRTRIAEIIDRLTRLGAVVIAFDVVFAEPDRLNPAIAAETFPNLDEATREKLRLLPSNDQVLADALRRSRIVLGETGSNEVRAELDKTLPVTGVATIGPPADDFMESYSGLLRNVAVIEHAASGRGLFTIPPERDGIIRRVPMILQAQDTTMLSLSFEMLRVVTGADTVLIRTDMGGITGLRLGGFEIPTDRRGRIWVHYADHDPSIYVSAIDVLEGRVPPEKIARKLVLIGPSAIGLNDIKTTPVNPTMPGVEVHAQVLETVLTNSILSPPFWGLSAEFFAAVILGLLVIVFAPQLGAVTLVLVGGLFASALFGVSWYAYTQHRLLLDFTYPMVSTTAIYLTLIFASFVREQSQRRQIRSAFGQYLSPALVEQLAHSPEKLVLGGEEREMTIMFSDVRGFTTISESYKHDPQGLTKLMNRFLTPLTNAILARKGTIDKYMGDAIMAFWNAPLDDIGHHRNACEAALDMLDRVDELNRAREQEAKDGGHVYIPINIGIGLNTGICVVGNLGSDQRFDYSVLGDSVNLASRLEGQSKEYGFSIIVGSQTALAVKDKLAILELDFIMVKGKTEPEVIYAIAGREDVMYSERFQLLRNLTIEMLAAYRGRDWDEALAAIARGRKKDEAKELAKLFDLYEARIRDYQQNPPPPDWNGAHALTSK
>NC_009445.1|WP_041756081.1|961414_963010_-|ABC-transporter-substrate-binding-protein
MRMKLSLLAAALALGLSAVAARAETVLRYGISMADIPLTTGQPDRGAGAYQFTGYTIYDPLVAWDMSVADKPGKLIPGLATEWKVDDADKKKWRFTLRKGVKFHDGSDFNADAVIWNLDKVLNDKAPQFDKRQSAQVKTRLPSVASYAKIDDSTVEITTKTVDSFFPYQMLWFLISSPAQYEKLGKDWDKFASQPSGTGPFKLTRLVPRELAELSRNSEYWNKDRIPKTDKLVLVPMPEALTRTNALLAGQVDLIETPAPDAVPQLKAAGMKLVDNVTPHVWNYHLSVLPGSPWTDIRLRKALNLAINRDEVVGLMNGLAKPAKGQVDPSSPWFGKPTFELKYDLAAAKKLVEEAGYSPAKPLKTTFIIAQGGTGQMLSLPMNEFLQQSFKEIGIDIDFKVVELETLYTHWRKGAADEMNAGITANNIAYVTSDPLYAIVRFFASDQIAPTGVNWGGYKNPKVDALIAEAKQTFDPAKQDELIAQAHAAVVDDAVLVWVVHDTNPHALSPKVKTFVQAQHWFQDLTTIGAE
>NC_009445.1|WP_011924074.1|963204_964878_+|ABC-transporter-substrate-binding-protein
MLLRLAPSVTKRAAIGAAMMTSAAILMLPATAGAESVLRIGMTAADIPRTLGQPDQGFEGNRFTGLTMYDALTMWDLSSADKPSVVIPGLATEWKVDESDKTKWTFKLRPGVTFHDGAPFNADAVVWNVEKVLKQDAPQFDPSQVGVTASRMPTLASARKIDDLTVELVTKEPDSFLPINLTNLFMASPAKWQKLYESATGADDKAKSQAAWAAFAKDASGTGPWKMSKFTPRERLELVKNEAYWDKARVPKADKMILLPMPEANARTAALLSGQVDWVEAPAPDALPEIKQRGFKLYANEQPHVWPWQFSRVEGSPWNDIRVRKAANLCIDREGLRDGLLAGLMVPATGTFEKGHPWRGNVTFEIKYDKAAAQKLMQEAGYGPNKKLEVKTQTSASGSGQMQPLPMNEYLQQALAECYFDVKLDVIEWNTLFTNWRRGAKDASANGANATNVTYAAMDPFFALVRFLQSSMAPPVSNNWGFINNPKFDELVKKARQTFDPAERDKALAELHAASVDDAAFLYVAHDVGPRAMSPKVKGVVQPKSWFIDFSPISVEP
>NC_009445.1|WP_011924075.1|965008_965962_+|ABC-transporter-permease
MLSYAARRMVYAIPIIIGVALVCFMLVHITPGDPLVAVLPADASQELAQQLRVAYGFDKPLPVQFGLWLWRAVNGDLGSSIATGRPVLAEVLRAVANTVTLAIAAAIIGFSLGLFFGLVAGYFRDTWVDKVATSIAIAGVSLPHYWLGMVLVIIFSVELNWLPAVGAGPSGSGAWAWDWAHLRFLILPAITTSVIPMGIVTRTVRALTGDILSQDFVEALRAKGLRERQVFRHVLKNAAPTALAVMGLQLGYMLGGSILIETVFSWPGSGLLLNSAIFQRDLPLLQGTILVLAMFFVILNLVVDIAQAAIDPRIKRG
>NC_009445.1|WP_041756082.1|965964_966867_+|ABC-transporter-permease
MSVSSPSAINEASLQSAPAAKARGYWATVGRRIVRDKVSMVCVAILLLIFLSALLAPYLHLADPYQGSMIRRLRHIGTPNYPLGTDELGRDMLARLIHGGRLSLLIGISPVILAFGIGTMLGLVAGYVGGWVNTMIMRTIDVFYAFPSVLLAIAISGALGAGITNSIVSLTIVFVPQITRVAESVTTGVRNRDFVEAARASGANAFTIMRAHMLGNVLGPIFVYATGLISVSMILAAGLSFLGLGTKPPEPEWGLMLNTLRTAIYVNPWVAALPGVMIFAVSICFNLLSDGLRSAMDIRS
>NC_009445.1|WP_011924077.1|967078_968128_+|ATP-binding-cassette-domain-containing-protein
MNEPAVVTGLAPIEDLGGKAQPLLRVDGLTKHFPVRGGLFGARKTVRAVDDVSFNIGKGETVGIVGESGCGKSTTARLLMHLMERDAGEIIFDGRQVGHEISLRELRRGMQMVFQDSYASLNPRLTIEESIAFGPKVHGMADGAARALARELLGKVGLRHEIFANRYPHEISGGQRQRVNIARALALSPRLVILDEAVSALDKSVEAQVLNLLTDLKREFGLTYLFISHDLNVINYISDRVLVMYLGEVVELGPVEQVWAKPAHPYTRALLAAMPSSDPDRRTEQPPLSGDPPNPIDPPSGCRFHTRCPFAEAPCANVAPRLTELDTMGHQAACHMAISGSGHSRAPAA
>NC_009445.1|WP_011924078.1|968156_968354_+|hypothetical-protein
MTRPTPQQVQAIAEASGLPVDKEVATRISDSIGPAFDNFAAIAGTLPFDLEPASYVLAQTLKVGR
>NC_009445.1|WP_011924079.1|968350_969763_+|Asp-tRNA(Asn)/Glu-tRNA(Gln)-amidotransferase-GatCAB-subunit-A
MSTEPALMTLTEVAKAIAEKKLSSVDVTRSCLHRIAQWQPKLNAFMAIESEPALKAAAEADAALAKDGPKGPLHGVPLAHKDMYYEAGHVSTCGSLIRRDFVATTTSTALQRLKDAGAIRLGTLQMAEFAYGPTGHNAHYGPVHNPWKLGYVTGGSSSGSGSAVGARLTFAALGSDTGGSIRMPANFCGVTGLKVTWGRVSRAGAMPLSQSLDTVGPLAQTAEDCALLLGLMAGPDPEDPTASAAQVQDYVAATQSSIKGLKIGVPKSFYVDDLDPEVARCLDAAITVLKTEGADVVQVELPDQRQLTAACQLVLAVEAAAFHKRWMIERPQDYGPQVLMRLQNALAVSGVAYLEALRWRGAALAAHVAATAGVDAIIAPVSPLVTPSIAESDVGGAPGAEAVIQRITRFTRPVNYLGLPSLAIPTGFTATGLPVGMQLIGRSFDEATILTIGAAFQRATDFHARVPTLS
>NC_009445.1|WP_011924080.1|970070_971051_+|ABC-transporter-ATP-binding-protein
MTNLVEISNLSIRFTGERTVHAVNDVSLSLGDGEVLGLLGESGSGKSVTMRALMRLLPKKRTQISGGVKVMGRDILAMSDEELSQFRGRTVSMIFQEPGLALDPVYTIGRQIAETVMRHEGKSYAEGTARALEMLDVVRIPSAKRRLDSYPHEMSGGMRQRAMIALALACRPKVLLADEPTTALDATVQIQILLLLRELQREFGMSVIFVTHDIGVAIEICDRVAVMYAGQIVEQGSLRDIVRQPVHPYARGLLASTIHGPKRGERLQTIPGTPPSLDQAPRSCSFAPRCSLAQPRCSETLPPAVQLGPQRLARCVLAGAESVAAT
>NC_009445.1|WP_011924081.1|971175_971445_+|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein
MHVSNEGILVILFVGLIAGWLAGKIVRGTGFGLIGDIVIGVLGALVASFLFPRLGIHLGTGLVSEIVYSALGAIILLLVVRLVRTGGRL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_009445_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_009445_4

6666082-6666273

Orphan

Consensus_repeat	Method
TTTTGACAAAACCGTATATCACCTATC	CRISPRCasFinder
TTTTGACAAAACCGTATATCACCTATC	CRT

3 spacers

The CRISPR arrays of NC_009445_4

>merge|NC_009445|4|6666082-6666273|CRISPRCasFinder,CRT
TTTTGACAAAACCGTATATCACCTATCCGACTTCCGGTTTTTGACAGAGAATTTTTGACAAAACCGTATATCACCTATCGTCCAGTCGGGGTGGCGGTCGAATTTTGACAAAGCCGTATATCACCTACCAAAGGCCGTATATCACCTATGACAAACCGTATATCGCCTATGACAAACCGTATATCACCTATT

>NC_009445|4|4|6666082-6666273|CRISPRCasFinder
TTTTGACAAAACCGTATATCACCTATC	CGACTTCCGGTTTTTGACAGAGAAT
TTTTGACAAAACCGTATATCACCTATC	GTCCAGTCGGGGTGGCGGTCGAA
TTTTGACAAAGCCGTATATCACCTACC	AAAGGCCGTATATCACCTATGACAAACCGTATATCG
CCTATGACAAACCGTATATCACCTATT

>NC_009445|4|1|6666082-6666273|CRT
TTTTGACAAAACCGTATATCACCTATC	CGACTTCCGGTTTTTGACAGAGAAT
TTTTGACAAAACCGTATATCACCTATC	GTCCAGTCGGGGTGGCGGTCGAA
TTTTGACAAAGCCGTATATCACCTACC	AAAGGCCGTATATCACCTATGACAAACCGTATATCG
CCTATGACAAACCGTATATCACCTATT

Protein	Signature genes	Signature genes Name	Protein_function
NC_009445.1\|WP_157872633.1\|6667590_6668325_-\|hypothetical-protein	unknown	unknown	unknown
NC_009445.1\|WP_012029913.1\|6658809_6660702_-\|hypothetical-protein	unknown	unknown	unknown
NC_009445.1\|WP_012029914.1\|6661193_6661394_-\|hypothetical-protein	unknown	unknown	unknown
NC_009445.1\|WP_012029926.1\|6672397_6673831_+\|coniferyl-aldehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143451
NC_009445.1\|WP_041757134.1\|6663116_6663425_+\|hypothetical-protein	unknown	unknown	unknown
NC_009445.1\|WP_157872632.1\|6655577_6656747_+\|hypothetical-protein	unknown	unknown	unknown
NC_009445.1\|WP_012029923.1\|6668550_6669114_+\|recombinase-family-protein	unknown	unknown	gnl\|CDD\|239737
NC_009445.1\|WP_012029929.1\|6676073_6676835_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|180773
NC_009445.1\|WP_012029912.1\|6657484_6658384_-\|DUF4238-domain-containing-protein	unknown	unknown	gnl\|CDD\|379425
NC_009445.1\|WP_041757835.1\|6664829_6666068_+\|replication-initiator-protein-A	unknown	unknown	gnl\|CDD\|370826
NC_009445.1\|WP_041757133.1\|6656740_6657004_-\|hypothetical-protein	unknown	unknown	unknown
NC_009445.1\|WP_012029921.1\|6667389_6667545_-\|hypothetical-protein	unknown	unknown	unknown
NC_009445.1\|WP_012029917.1\|6663477_6663831_-\|hypothetical-protein	unknown	unknown	unknown
NC_009445.1\|WP_012029927.1\|6673990_6675595_+\|GMC-family-oxidoreductase-N-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|235000
NC_009445.1\|WP_012029925.1\|6670257_6671868_+\|recombinase-family-protein	unknown	unknown	gnl\|CDD\|214861
NC_009445.1\|WP_012029915.1\|6662227_6663148_+\|integrase-domain-containing-protein	unknown	unknown	gnl\|CDD\|372339
NC_009445.1\|WP_012029924.1\|6669173_6669410_+\|hypothetical-protein	unknown	unknown	unknown
NC_009445.1\|WP_012029918.1\|6663802_6664465_-\|ParA-family-protein	unknown	unknown	gnl\|CDD\|349760
NC_009445.1\|WP_012029930.1\|6676946_6677462_+\|CvpA-family-protein	unknown	unknown	gnl\|CDD\|367140
NC_009445.1\|WP_012029928.1\|6675641_6675884_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NC_009445.1\|WP_012029929.1\|6676073_6676835_-\|SDR-family-oxidoreductase	gnl\|CDD\|180773	PRK06949, PRK06949, SDR family oxidoreductase.	3.04152e-87
NC_009445.1\|WP_012029930.1\|6676946_6677462_+\|CvpA-family-protein	gnl\|CDD\|367140	pfam02674, Colicin_V, Colicin V production protein. Colicin V production protein is required in E. Coli for colicin V production from plasmid pColV-K30. This protein is coded for in the purF operon.	3.67692e-11
NC_009445.1\|WP_012029925.1\|6670257_6671868_+\|recombinase-family-protein	gnl\|CDD\|214861	smart00857, Resolvase, Resolvase, N terminal domain. The N-terminal domain of the resolvase family contains the active site and the dimer interface. The extended arm at the C-terminus of this domain connects to the C-terminal helix-turn-helix domain of resolvase.	2.143e-35
NC_009445.1\|WP_012029926.1\|6672397_6673831_+\|coniferyl-aldehyde-dehydrogenase	gnl\|CDD\|143451	cd07133, ALDH_CALDH_CalB, Coniferyl aldehyde dehydrogenase-like. Coniferyl aldehyde dehydrogenase (CALDH, EC=1.2.1.68) of Pseudomonas sp. strain HR199 (CalB) which catalyzes the NAD+-dependent oxidation of coniferyl aldehyde to ferulic acid, and similar sequences, are present in this CD.	0
NC_009445.1\|WP_012029915.1\|6662227_6663148_+\|integrase-domain-containing-protein	gnl\|CDD\|372339	pfam12834, Phage_int_SAM_2, Phage integrase, N-terminal. This is a family of DNA-binding prophage integrases. It is found largely in Proteobacteria.	1.30968e-34
NC_009445.1\|WP_012029927.1\|6673990_6675595_+\|GMC-family-oxidoreductase-N-terminal-domain-containing-protein	gnl\|CDD\|235000	PRK02106, PRK02106, choline dehydrogenase; Validated.	0
NC_009445.1\|WP_012029923.1\|6668550_6669114_+\|recombinase-family-protein	gnl\|CDD\|239737	cd03768, SR_ResInv, Serine Recombinase (SR) family, Resolvase and Invertase subfamily, catalytic domain; members contain a C-terminal DNA binding domain. Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and the enzyme. They are functionally versatile and include resolvases, invertases, integrases, and transposases. Resolvases and invertases affect resolution or inversion and comprise a major phylogenic group. Resolvases (e.g. Tn3, gamma-delta, and Tn5044) normally recombine two sites in direct repeat causing deletion of the DNA between the sites. Invertases (e.g. Gin and Hin) recombine sites in inverted repeat to invert the DNA between the sites. Cointegrate resolution with gamma-delta resolvase requires the formation of a synaptosome of three resolvase dimers bound to each of two res sites on the DNA. Also included in this subfamily are some putative integrases including a sequence from bacteriophage phi-FC1.	2.91257e-32
NC_009445.1\|WP_012029918.1\|6663802_6664465_-\|ParA-family-protein	gnl\|CDD\|349760	cd02042, ParAB_family, partition proteins ParAB family. ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation. ParB binds to DNA sequences adjacent to the origin of replication and localizes to opposite cell poles shortly following the initiation of DNA replication. ParB regulates the ParA ATPase activity by promoting nucleotide exchange in a fashion reminiscent of the exchange factors of eukaryotic G proteins. ADP-bound ParA binds single-stranded DNA, whereas the ATP-bound form dissociates ParB from its DNA binding sites. Increasing the fraction of ParA-ADP in the cell inhibits cell division, suggesting that this simple nucleotide switch may regulate cytokinesis. ParA shares sequence similarity to a conserved and widespread family of ATPases which includes the repA protein of the repABC operon in Rhizobium etli symbiotic plasmid. This operon is involved in the plasmid replication and partition.	1.79284e-31
NC_009445.1\|WP_012029912.1\|6657484_6658384_-\|DUF4238-domain-containing-protein	gnl\|CDD\|379425	pfam14022, DUF4238, Protein of unknown function (DUF4238). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria, archaea and eukaryotes. Proteins in this family are typically between 274 and 374 amino acids in length.	1.04435e-39
NC_009445.1\|WP_041757835.1\|6664829_6666068_+\|replication-initiator-protein-A	gnl\|CDD\|370826	pfam10134, RPA, Replication initiator protein A. Members of this family of bacterial proteins are single-stranded DNA binding proteins that are involved in DNA replication, repair and recombination.	7.8086e-66

>NC_009445.1|WP_041757835.1|6664829_6666068_+|replication-initiator-protein-A
MQPLKLDLMSRDAFAALNLQERNEYLQKLTAEFAEKTGRAPVALDKDGLARLRRFYLRRSFADLERGKTDLNIADPDLAAALRSLGETIKDSERKDDLVGMLKSELPGPILRKAPTDDQQLSLFVPVIYDAPLKDDVNLMDVAPFTISKSRRNTAIRYELNDCIVTVDGSAEHGLATVFDYDIFLHMVTYLAEEARRYHIEAAKGLRPSLPAQVYRPKASHILKFCRRGSGGLQYKSLEAALDRLSGTRLKVANLRGGRRREVVNVPLIDKYRVVSATSTGHVDDIEIYIPSWVYESVVREKGTPQILTLNPDYFLISQGLGRMVYRLARRAAGRTEARYSILEVHKRSGSPQALPQFAQILRKLVAHCKMFPLPDYDIDLIEGQSGELLWMRYRGEGTKAPKAKASIPLLG
>NC_009445.1|WP_012029918.1|6663802_6664465_-|ParA-family-protein
MKVISFVNQKGGTGKSMLAINIAVAAEGTGERACLVDLDPQGTVSNWFDTRTAETPPVVSYESATDLTRTLTALEKAGFTLVIIDTKGEDGHATRAAMREADLCLIPVRPAGPDLHATRTTMDALRTMRRDFALVVNQATPNKAAKLTSAVMAGLAQSGTVVPIPLASRMDFQYSYALGQGVAEHAPSSKAAEEIAELWAWCRKRINKEKNGEQQERRRA
>NC_009445.1|WP_012029917.1|6663477_6663831_-|hypothetical-protein
MSSKSDAARNAVAAAAANGFLRPKPAQPVEGRSGNVVEIKPEAAPVDIETTPKERGKPAKASEGKVRTTYKRSMLYLPPKAKKKFKEIAFISDRKEHDIYLEALREYLEKLGHPGLL
>NC_009445.1|WP_041757134.1|6663116_6663425_+|hypothetical-protein
MKAPLSKLVPELERSCAHALEDLAAKHLRSDKIKMELHSAAKKGHRALRILLPDGIDLRKTDGAEIFKAWAKENGLHLDWISRTATVEGGRQADGFDVEISW
>NC_009445.1|WP_012029915.1|6662227_6663148_+|integrase-domain-containing-protein
MDALAYDLKRIALGDGEGSYLTRNQRHRGLQLMARELRGLGFKLPAASSLKPRHVEALISHWQTAELSTGTLKNRMGWLRWWAGRVRKANVVPRGNESAGIENRTAFNGNRAHTTQAEKMAALPHRIQLALRLQMAFGMRLEESLKFRVSQADKGHRLAMQSSWCKGGRAREIPVTHPRQRALLDELRQVCGDGSLIPQGQKYVDFRKEVERVTWGAGIRNMHGHRHWYAQWRYETLTGRPCPASGGATYERLSRTEKAADFRARRQISSELGHARLAITDTYLGSRFAKAQSRPRHESPSLEARA
>NC_009445.1|WP_012029914.1|6661193_6661394_-|hypothetical-protein
MSESRKPSHDAFAVAGTGRNATWTRIGAAWPNEDGKGFNIVIAPGVAVSGKIVLREPRAPTDPEGE
>NC_009445.1|WP_012029913.1|6658809_6660702_-|hypothetical-protein
MRALLLGVMLAGVASAAVAQDWGNMAIISSTLGNNTNRLCIGDHSRAGDIGCPTYAPSLTTAGDLTVSGMVSAAAFVGDGSGLTNIGAAGRSDRIVSGTGSATSMVAISDTGIISVTQNGTNTAYFHPSMGLVTVGVSSTGPISGTSGYLSGGLTIVNNPIYMNSLQGMYWGNNSNNSITGHATQKYITFYTSGTEAMRIVSSGYVGIGTSTPGNLLELLTASNVNGLQIRRTGSLTNNAAILGFRNSASASSTNSADIRAIRINSPQAGDTALTFNVTSNLALAEFMRIDSTGNVGIGTATPTTALEVSGTISATNFVGNGSGLTGVVAGSSDRIVSGTGNATSMVAISTTGIISVTQNGTNTAYFHPQLGLVAVGISTTGPVSATELYSSDEVNAVRWFRTAYGLGTGALGSGTPQTRIDLATPNTMGLFSGGQQNVSLTSGTIILTTSGTEAMRIVSSGNVGIGTATPASKLEVNGSAKINGSGTFGGGSNYVYISYNGPVGGAANVMGGGAYPLVLGTGSTERMRITSTGLVGIGTLTPTTALEVSGTISATNFVGNGSGLTGVVANNNDRIVSGSINMIAEQTSGTVRVSGTLALNNTGNEVCDAAHYYTLRINPTTQRLEMCRP
>NC_009445.1|WP_012029912.1|6657484_6658384_-|DUF4238-domain-containing-protein
MSVPRDHHYIPVFYLNHWCGPNEKLVEYARPIGRKVVVKDVGPKATGFKRDLYAFLDLPEETAQFLESHFLAKADELASIVHKKLLLGTATPWTPEIRSAWSRFVMNFLVRHPDPFAEIKAVAHAAWLQPDGITQQRYEELRRPDDPATFEEWVLAQGEHLADRIRIRLIQSVMDNIRVGGRLNGMNWNVLDLSASRFRLLTSDWPLFRELKGERMLFALPISPTKLFTAVTHPDILQKMRQEKPDEVVKTMNAATVAAARRFVYASDRSQDRFIRNRISTAMVKEPFFPSLAAVAAGG
>NC_009445.1|WP_041757133.1|6656740_6657004_-|hypothetical-protein
MIFYTRSLGLREDDAIYRFNLARFFIGLFLVGGLIGASFLAKRMDWSGGADTLLDFSKIALGGLVGLLFGEKQALTEVRSKTRNRSH
>NC_009445.1|WP_157872632.1|6655577_6656747_+|hypothetical-protein
MRNNLLLGGSPMDRELSDAIAEAQAEFLRAQIFQQIQAELSFRLSNLTYQLKPPRRASLSLLRTYDSTAYVDKGLLKTAKVTLSVGLAIQAFYYANAVARTIETLFPLAINLGHYDPSVRATVNEGHERTLEMLRFGIFGPILPQERWRQVLIYTLMYKALEWILVHETTHIVWGHYEMPDALRSSDWVAQLIESQSDDFATLRFLTSLRIFEKEHDYQAKPWQQDPGHFAFCKKSDRLNITLISMILSIALVGKGNDDKFFSDPRSPDVPKRSHPPSAYRLWRSLNLLTTPVRTNPGMPPLHPLTPATDGILSGRDLYSFVGGLLARISTGGNGPITRLDSSHHATLLEYNQTLMDNLAPVAAYEASWRARNIDPDRHPQNERAYGNQ
>NC_009445.1|WP_012029921.1|6667389_6667545_-|hypothetical-protein
MIFLLVLVIIAVVGGALVHADNWLDGLAMLIIVPLGIWGFLALLNYIFRLP
>NC_009445.1|WP_157872633.1|6667590_6668325_-|hypothetical-protein
MSAVAVLLPWPALFLRRRAVQVIAALLCMLATSAHAAKLYAPVYVKQTTAACRNLASVQYRDSLIREQRTETLSGINTMATFTGECGNAPEGQWMFFDQSNGNYACLRPRLGADCAWLRKSALGEIVELTTPANKPNCSALSAAVEKSKKFEAELTERWRAERPKSRAEDFARGMLGDMLGMVTGVDGGRVDHAKNCLYYAISAQEKARRTLIFEACPVLGNAAQERQYFSALNRTISDTCAPH
>NC_009445.1|WP_012029923.1|6668550_6669114_+|recombinase-family-protein
MTIFGYARVSTSGQELDIQIAQLEAAGCERILCEKQSGVNDQRRELARLLRRLRKGDTVIVPALDRLTRGGPFKMLSVLADITSRGASYRSLAEPWADTTHELGEVLAALVGYIARKTREDILRRTSAGRERALKNGVRFGRKPKLTAEQRSSALARRRSGEPQKLIARDYDVSCSTISRLKDPERG
>NC_009445.1|WP_012029924.1|6669173_6669410_+|hypothetical-protein
MCRPMDLKNLQTAYDDFNKRDAELVARQELATTDRERYLLERLRRGLLVHLEATVQEESDRDFIGQIERQIAGQQRAA
>NC_009445.1|WP_012029925.1|6670257_6671868_+|recombinase-family-protein
MKAAIYARFSSDKQTDRSIEDQVALCRAICEREALIVVAVYDDRAISGASTVNRLGWQRLMRDAKAGKFDVVVAEALDRISRDQEDLAGIHKRLRFAGVDIRTAQDGIAGDIHIGVKGLLGSLYLKDLAQKTRRGQAGVVRDGRHNGGRSFGYRAIPGKPGELEIDQAEAAVVRQIFADYLNAYSPRDIAAALNKKRVPGPRGGVWNASTIAGSRKRLNGILQNELYAGRIIWNRQSFVKDPETGKRISRENPRDQWMTADAEHLRIVDADTWSKVRARREERGGPKGTYATRPKNLLSGLIKCGCCGSGYVVGGNDKRGSILVCTRMKETGLCENRRTVPREAIEALVLKGIEENLAAPELIAEYVREYHRMSRELHSSTAHRRRDLEKRLGNVNGAISKAVDALLGEAPSRALRERLAALEAERDQIEVDIAEVVPPIVEFHANAADAYRGKVRNLKKALAESDEDSRTAAHEAIREIVEKVVVHPRGRYKPVQIEIYGQLAALLRISERAAEPLESRGALVAGIGFEPMTFRL
>NC_009445.1|WP_012029926.1|6672397_6673831_+|coniferyl-aldehyde-dehydrogenase
MDQSLKSPPVSALDDAFHAMVEASRSAPPPPLADRLDRLKRLRAMISDNEKQLEQAISADFGHRCAVETTIAETLFLQTETKHTMTMLPRWMAPRRIATSLQFFPARNRLIPQPLGVVGIIAPWNYPLQLTLAPAIGAIAAGNRVLIKPSELTPGFSALLKELVAAHFDPNDLTVTGIEDGIAQAFAALPFDHLVFTGSTRVGRIVAEAAGRNLTPVTLELGGKSPTIVDVSANIDEAAERIAYAKLMNAGQTCIAPDYVFVTEAQRDAFAGKVHGHMVRMFGTHPANGDYTSIISERHYQRLEGLLRDAIARGAKPLTVTSPEDPAWKKLRKFPPTVVVGATSDMAIMQEEIFGPLLPILSYRDADEAIRFINAHDRPLALYWFGTDEAARDKVLARTVSGGVTINDCLLHFAQMNQPMGGVGASGIGHYHGEWGFNSFSKLKPVFYRSPFNRMKDLYPPYGASVARIEKLLRFLS
>NC_009445.1|WP_012029927.1|6673990_6675595_+|GMC-family-oxidoreductase-N-terminal-domain-containing-protein
MADEVDFIVVGGGSGGATVAGRLSEDPGTSVMLLDAGGRNDNWIVTTPYMLFLMVAGPVNNWSFTTVPQPGLNGRIGYQPRGRGLGGSSAINAMVYIRGHRADYDQWAALGNAGWSYEDVLPYFKRAENNAEFNGVYHGQSGPLPVNRLRTDNPVHEIFLQAAREAQFPIREDFNAETQEGLGLYQVTQQNGERWSAARAYIQPHLGQRRNLRVETRAQASLILFDGKRAVGVKYRQGKEIKEIRCRREVILASGAFQTPQLLMLSGVGDAGALARHGIASVHHLPGVGQNLQDHPDFIFAYTSDNPNFNSLSPKGIRRLLAGIGQYRRERRGVLTSNFAECGGFLKSAPNLDIPDIQLHFGMAVTDDHGRKRHGNGFSCHFCLLRPKSRGRVALGSADPLAPPLIDPNFLGEQDDVETMVAGYKTTRRLMETPAMRSLATRDLFTADVRTDDDIRSVLRARVDTVYHPVGTCKMGSADPLAVVDPSLKVHGLSGLRIVDASVMPTLIGGNTNAPTIMIGEKAADMIKAELRES
>NC_009445.1|WP_012029928.1|6675641_6675884_-|hypothetical-protein
MKYLVCAAVLFAATAASAETYTTTVNRSADTVTTTASNGTVATTQMSRNGNTTTYTTTVTRGGAASYQPMGSGGYKPMGR
>NC_009445.1|WP_012029929.1|6676073_6676835_-|SDR-family-oxidoreductase
MSDLFDVSREVILITGASQGLGRQFARVLAAHGAAVVLAARQIGKLKALEDEIKAKGGRAVAVEMDVTNTASIARGLDAAEAALGPVTVLVNNAGIAVEKLALEQSEADWDAVIGANLKGAYFAATEVARRMIARKAPGNIINIASVLGLSVVKFIAPYAISKAGVVQATKALALELASNNIRVNALAPGYIDTDINHDVWETPAGEKLIKRIPQRRVGHESDLDGAILLLASNASRYMTGSVITVDGGFLLT
>NC_009445.1|WP_012029930.1|6676946_6677462_+|CvpA-family-protein
MNSFDLAACAALMIAVYSGFSTGLLRSAITILAYLLAMPLAMGAVAAMSPQLQDVHGAPLAQNWLQFFAAFLVIGVALGKVGRMMLDEAIGPDAGFGDRLAGALLGAVRVGMVAITLVLVFDRIVPPDRQPRFLDGSRLRPILSLAGAKGFRSLPPEVASLIDRLKQERRI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NC_009445_3	3.1\|956220\|16\|NC_009445\|CRISPRCasFinder	956220-956235	16	NC_009445.1	5323096-5323111	0	1.0

1. spacer 3.1|956220|16|NC_009445|CRISPRCasFinder matches to position: 5323096-5323111, mismatch: 0, identity: 1.0

gacggcacgatcgaga	CRISPR spacer
gacggcacgatcgaga	Protospacer
****************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_009445_4	4.2\|6666161\|23\|NC_009445\|CRISPRCasFinder,CRT	6666161-6666183	23	MN062703	Microbacterium phage McGalleon, complete genome	20939-20961	2	0.913
NC_009445_3	3.2\|956259\|34\|NC_009445\|CRISPRCasFinder	956259-956292	34	NZ_CP020333	Martelella mediterranea DSM 17316 strain MACL11 plasmid pMM170, complete sequence	109795-109828	8	0.765
NC_009445_3	3.2\|956259\|34\|NC_009445\|CRISPRCasFinder	956259-956292	34	NZ_CP013108	Sinorhizobium americanum strain CFNEI 73 plasmid A, complete sequence	51198-51231	9	0.735
NC_009445_3	3.2\|956259\|34\|NC_009445\|CRISPRCasFinder	956259-956292	34	NC_008697	Nocardioides sp. JS614 plasmid pNOCA01, complete sequence	132811-132844	9	0.735
NC_009445_3	3.2\|956259\|34\|NC_009445\|CRISPRCasFinder	956259-956292	34	NZ_LR134465	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 23, complete sequence	297225-297258	10	0.706
NC_009445_3	3.2\|956259\|34\|NC_009445\|CRISPRCasFinder	956259-956292	34	NZ_LR134468	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 26, complete sequence	38868-38901	10	0.706
NC_009445_3	3.2\|956259\|34\|NC_009445\|CRISPRCasFinder	956259-956292	34	NZ_CP031226	Pseudomonas amygdali pv. lachrymans str. M301315 plasmid pMPPla107, complete sequence	697353-697386	10	0.706
NC_009445_3	3.2\|956259\|34\|NC_009445\|CRISPRCasFinder	956259-956292	34	NZ_CP023072	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666a, complete sequence	375211-375244	10	0.706

1. spacer 4.2|6666161|23|NC_009445|CRISPRCasFinder,CRT matches to MN062703 (Microbacterium phage McGalleon, complete genome) position: , mismatch: 2, identity: 0.913

gtccagtcggggtggcggtcgaa	CRISPR spacer
ggccagtcgtggtggcggtcgaa	Protospacer
* ******* *************

2. spacer 3.2|956259|34|NC_009445|CRISPRCasFinder matches to NZ_CP020333 (Martelella mediterranea DSM 17316 strain MACL11 plasmid pMM170, complete sequence) position: , mismatch: 8, identity: 0.765

aacggctcgctcgtcaacgacggcaccatcgaga	CRISPR spacer
acgatctcgctcgtcaatgacggcacgatctcga	Protospacer
*  . ************.******** ***  **

3. spacer 3.2|956259|34|NC_009445|CRISPRCasFinder matches to NZ_CP013108 (Sinorhizobium americanum strain CFNEI 73 plasmid A, complete sequence) position: , mismatch: 9, identity: 0.735

aacggctcgctcgtcaacgacggcaccatcgaga	CRISPR spacer
ctctgccgcttcctcgacgacggcaccatcgaga	Protospacer
  * **.  .** **.******************

4. spacer 3.2|956259|34|NC_009445|CRISPRCasFinder matches to NC_008697 (Nocardioides sp. JS614 plasmid pNOCA01, complete sequence) position: , mismatch: 9, identity: 0.735

aacggctcgctcgtcaacgacggcaccatcgaga	CRISPR spacer
ggccgcatcgtcgtcaacgacggcgtcatcgaga	Protospacer
..* ** .  **************..********

5. spacer 3.2|956259|34|NC_009445|CRISPRCasFinder matches to NZ_LR134465 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 23, complete sequence) position: , mismatch: 10, identity: 0.706

aacggctcgctcgtcaacgacggcaccatcgaga	CRISPR spacer
ctcgcgccgctcgtcgacgacggcaccgtcgccg	Protospacer
  **  .********.***********.***  .

6. spacer 3.2|956259|34|NC_009445|CRISPRCasFinder matches to NZ_LR134468 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 26, complete sequence) position: , mismatch: 10, identity: 0.706

aacggctcgctcgtcaacgacggcaccatcgaga	CRISPR spacer
acgagctcgctcgtcaccgaccgcaccacgtcgc	Protospacer
*  .************ **** ******.   *

7. spacer 3.2|956259|34|NC_009445|CRISPRCasFinder matches to NZ_CP031226 (Pseudomonas amygdali pv. lachrymans str. M301315 plasmid pMPPla107, complete sequence) position: , mismatch: 10, identity: 0.706

aacggctcgctcgtcaacgacggcaccatcgaga	CRISPR spacer
accaaaccgcacgtcaacgtcggcaccatcggtc	Protospacer
* *.. .*** ******** ***********.

8. spacer 3.2|956259|34|NC_009445|CRISPRCasFinder matches to NZ_CP023072 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666a, complete sequence) position: , mismatch: 10, identity: 0.706

aacggctcgctcgtcaacgacggcaccatcgaga	CRISPR spacer
ctttgccgcttcctcgacgacggcaccatcgaga	Protospacer
  . **.  .** **.******************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

3783880 : 3825399

Rhodobacter_phage(33.33%)

capsid,protease,tail,portal,terminase,integrase

attL 3779026:3779042|attR 3813280:3813296

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3779026:3779042	attL	NA	NA	NA	NA
WP_011926516.1\|3783880_3784909_-\|protease	PrsW family intramembrane metalloprotease	NA	NA	NA	NA
WP_011926517.1\|3785770_3787003_+	5-aminolevulinate synthase	NA	NA	NA	NA
WP_011926518.1\|3787141_3787720_+	hemerythrin domain-containing protein	NA	NA	NA	NA
WP_011926519.1\|3787822_3788035_+	hypothetical protein	NA	NA	NA	NA
WP_011926520.1\|3788335_3789088_-	hypothetical protein	NA	NA	NA	NA
WP_011926521.1\|3789294_3789627_+	Rieske 2Fe-2S domain-containing protein	NA	NA	NA	NA
WP_011926522.1\|3790130_3791108_+	hypothetical protein	NA	NA	NA	NA
WP_011926523.1\|3791178_3792255_-\|integrase	tyrosine-type recombinase/integrase	A0A291AUF0	Sinorhizobium_phage	4.0e-29	31.5
WP_011926524.1\|3792251_3792524_-	hypothetical protein	NA	NA	NA	NA
WP_011926525.1\|3792520_3792766_-	hypothetical protein	NA	NA	NA	NA
WP_011926526.1\|3792858_3793068_-	hypothetical protein	NA	NA	NA	NA
WP_157872576.1\|3793070_3793289_-	hypothetical protein	NA	NA	NA	NA
WP_041756610.1\|3793368_3793659_-	hypothetical protein	NA	NA	NA	NA
WP_011926529.1\|3793799_3794459_-	S24 family peptidase	NA	NA	NA	NA
WP_011926530.1\|3794555_3794810_+	hypothetical protein	NA	NA	NA	NA
WP_157872577.1\|3794806_3795190_+	hypothetical protein	NA	NA	NA	NA
WP_011926532.1\|3795186_3795474_+	hypothetical protein	NA	NA	NA	NA
WP_011926533.1\|3795470_3795725_+	hypothetical protein	NA	NA	NA	NA
WP_011926534.1\|3795721_3796192_+	DUF2312 domain-containing protein	NA	NA	NA	NA
WP_011926535.1\|3796204_3796693_+	HNH endonuclease	NA	NA	NA	NA
WP_011926536.1\|3796692_3798525_+	hypothetical protein	M4SPS7	Rhodobacter_phage	5.4e-10	33.0
WP_011926537.1\|3798521_3798713_+	hypothetical protein	NA	NA	NA	NA
WP_050781101.1\|3798747_3799110_+	hypothetical protein	A0A068CDI5	Rhizobium_phage	4.2e-31	66.0
WP_011926539.1\|3799106_3799406_+	hypothetical protein	C4NTA4	Sulfitobacter_phage	2.4e-08	42.4
WP_050781011.1\|3799402_3799660_+	hypothetical protein	NA	NA	NA	NA
WP_011926540.1\|3799626_3799911_+	hypothetical protein	NA	NA	NA	NA
WP_011926541.1\|3799907_3800168_+	hypothetical protein	NA	NA	NA	NA
WP_011926542.1\|3800228_3801491_+	hypothetical protein	NA	NA	NA	NA
WP_011926543.1\|3801487_3802093_+	transcription antitermination protein NusG	NA	NA	NA	NA
WP_157872578.1\|3802248_3802875_-	hypothetical protein	NA	NA	NA	NA
WP_041756616.1\|3803188_3803464_+	HNH endonuclease	A0A286N2R3	Klebsiella_phage	9.3e-07	41.0
WP_011926546.1\|3803554_3804043_+	hypothetical protein	I3ULZ5	Rhodobacter_phage	1.9e-23	44.4
WP_011926547.1\|3804072_3805173_-	FRG domain-containing protein	NA	NA	NA	NA
WP_011926548.1\|3805282_3807022_+\|terminase	terminase large subunit	I3ULZ6	Rhodobacter_phage	2.7e-107	39.5
WP_011926549.1\|3807021_3808347_+\|portal	phage portal protein	A4JWZ9	Burkholderia_virus	5.4e-44	32.3
WP_157872579.1\|3808352_3809213_+	S49 family peptidase	E5AFY0	Erwinia_phage	1.5e-26	36.4
WP_157872580.1\|3809312_3810047_+	hypothetical protein	NA	NA	NA	NA
WP_011926551.1\|3810240_3811551_+\|capsid	phage major capsid protein	NA	NA	NA	NA
WP_011926552.1\|3811620_3812073_+	hypothetical protein	NA	NA	NA	NA
WP_157872581.1\|3812145_3813414_+	hypothetical protein	NA	NA	NA	NA
3813280:3813296	attR	NA	NA	NA	NA
WP_011926554.1\|3813426_3813642_+	hypothetical protein	NA	NA	NA	NA
WP_011926555.1\|3813644_3814259_+	hypothetical protein	NA	NA	NA	NA
WP_011926556.1\|3814264_3814645_+	hypothetical protein	NA	NA	NA	NA
WP_011926557.1\|3814648_3814951_+	hypothetical protein	NA	NA	NA	NA
WP_011926558.1\|3814952_3815423_+	hypothetical protein	NA	NA	NA	NA
WP_011926559.1\|3815434_3815881_+	hypothetical protein	NA	NA	NA	NA
WP_011926560.1\|3815909_3817142_+	hypothetical protein	NA	NA	NA	NA
WP_011926561.1\|3817151_3817598_+	hypothetical protein	NA	NA	NA	NA
WP_011926562.1\|3817660_3817933_+	hypothetical protein	NA	NA	NA	NA
WP_011926563.1\|3817934_3820058_+	hypothetical protein	NA	NA	NA	NA
WP_011926564.1\|3820072_3820321_+	hypothetical protein	NA	NA	NA	NA
WP_011926565.1\|3820322_3820682_+	hypothetical protein	NA	NA	NA	NA
WP_011926566.1\|3820678_3821182_+	DUF1833 family protein	A0A1B0T6D7	Thiobacimonas_phage	1.2e-20	36.0
WP_011926567.1\|3821197_3821602_+	C40 family peptidase	A0A1B0T6J5	Pelagibaca_phage	5.3e-19	38.4
WP_041756622.1\|3821601_3825399_+\|tail	tail fiber protein	M4T544	Rhodobacter_phage	1.9e-94	29.9

DBSCAN-SWA_2

4227696 : 4237338

uncultured_Mediterranean_phage(88.89%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011926925.1\|4227696_4229148_-	LysM peptidoglycan-binding domain-containing M23 family metallopeptidase	Q8SBN9	Clostridium_phage	1.2e-17	40.9
WP_011926926.1\|4229255_4229903_-	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	8.5e-27	49.1
WP_011926927.1\|4230189_4230573_+	response regulator	NA	NA	NA	NA
WP_011926928.1\|4230585_4231353_-	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	7.5e-38	37.9
WP_011926929.1\|4231439_4231808_-	hypothetical protein	NA	NA	NA	NA
WP_011926930.1\|4231909_4233238_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	2.9e-98	47.8
WP_011926931.1\|4233368_4234184_-	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	5.1e-53	46.8
WP_011926932.1\|4234180_4234717_-	twin-arginine translocase subunit TatB	A0A1B1IVT0	uncultured_Mediterranean_phage	5.8e-05	48.9
WP_006614346.1\|4234821_4235055_-	twin-arginine translocase TatA/TatE family subunit	A0A1B1IVR9	uncultured_Mediterranean_phage	4.2e-08	55.4
WP_041756711.1\|4235336_4236479_-	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	2.3e-43	48.1
WP_011926934.1\|4236498_4237338_-	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	3.7e-30	35.9

DBSCAN-SWA_3

4644336 : 4653143

Lake_Baikal_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011927300.1\|4644336_4645611_-	adenylate/guanylate cyclase domain-containing protein	A0A2H4N7Z5	Lake_Baikal_phage	8.4e-10	28.7
WP_011927301.1\|4645645_4646056_-	arsenate reductase (glutaredoxin)	A0A2H4J8T1	uncultured_Caudovirales_phage	3.5e-42	65.9
WP_011927302.1\|4646255_4647074_+	chromate resistance protein	NA	NA	NA	NA
WP_011927303.1\|4647070_4648462_+	chromate efflux transporter	A0A219VHC2	Ochrobactrum_phage	1.5e-36	72.7
WP_011927304.1\|4648471_4649446_-	cation transporter	A0A1V0SED0	Indivirus	7.8e-08	38.0
WP_011927305.1\|4649695_4651948_-	DNA topoisomerase IV subunit A	G3M9Z5	Bacillus_virus	3.1e-92	41.8
WP_011927306.1\|4652312_4653143_+	alpha/beta hydrolase	A0A0B5A484	Mycobacterium_phage	1.5e-07	26.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_009445

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection