CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NC_012923	Streptococcus suis BM407 plasmid pBM407, complete sequence	1 crisprs	NA	0	1	0	0
NC_012926	Streptococcus suis BM407, complete genome	2 crisprs	PrimPol,DinG,csa3,cas3,DEDDh	0	0	9	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_012923_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_012923_1

12837-12931

Orphan

Consensus_repeat	Method
TAAGCTATGGTATATATACCATAGCTTA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_012923_1

>merge|NC_012923|1|12837-12931|CRISPRCasFinder
TAAGCTATGGTATATATACCATAGCTTATAGAATGACTTTTTTTATTTTTTTTGTTAAAGTATAATCTAAGCTATGGTATATATACCATAGCTTA

>NC_012923|1|1|12837-12931|CRISPRCasFinder
TAAGCTATGGTATATATACCATAGCTTA	TAGAATGACTTTTTTTATTTTTTTTGTTAAAGTATAATC
TAAGCTATGGTATATATACCATAGCTTA

Protein	Signature genes	Signature genes Name	Protein_function
NC_012923.1\|WP_012774875.1\|12965_13949_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227645
NC_012923.1\|WP_012774874.1\|11868_12765_-\|nucleotidyl-transferase-AbiEii/AbiGii-toxin-family-protein	unknown	unknown	gnl\|CDD\|378065
NC_012923.1\|WP_001015311.1\|14021_14702_-\|IS6-like-element-IS1216-family-transposase	unknown	unknown	gnl\|CDD\|225853
NC_012923.1\|WP_012774876.1\|18539_21806_-\|ATP-dependent-nuclease-subunit-B	unknown	unknown	gnl\|CDD\|274291
NC_012923.1\|WP_044475473.1\|8194_8380_-\|class-IIb-bacteriocin,-lactobin-A/cerein-7B-family	unknown	unknown	gnl\|CDD\|274873
NC_012923.1\|WP_153585979.1\|10889_11027_-\|hypothetical-protein	unknown	unknown	unknown
NC_012923.1\|WP_044475477.1\|11144_11330_-\|hypothetical-protein	unknown	unknown	unknown
NC_012923.1\|WP_153308592.1\|10375_10531_-\|class-IIb-bacteriocin,-lactobin-A/cerein-7B-family	unknown	unknown	unknown
NC_012923.1\|WP_044475475.1\|9411_9621_-\|class-IIb-bacteriocin,-lactobin-A/cerein-7B-family	unknown	unknown	gnl\|CDD\|274873
NC_012923.1\|WP_079395234.1\|9052_9214_-\|class-IIb-bacteriocin,-lactobin-A/cerein-7B-family	unknown	unknown	gnl\|CDD\|274873
NC_012923.1\|WP_153585981.1\|11507_11669_-\|bacteriocin	unknown	unknown	unknown
NC_012923.1\|WP_079395235.1\|11341_11497_-\|class-IIb-bacteriocin,-lactobin-A/cerein-7B-family	unknown	unknown	gnl\|CDD\|274873
NC_012923.1\|WP_001015311.1\|23592_24273_-\|IS6-like-element-IS1216-family-transposase	unknown	unknown	gnl\|CDD\|225853
NC_012923.1\|WP_012775061.1\|14889_18540_-\|helicase-exonuclease-AddAB-subunit-AddA	unknown	unknown	gnl\|CDD\|274299
NC_012923.1\|WP_153585982.1\|10542_10686_-\|class-IIb-bacteriocin,-lactobin-A/cerein-7B-family	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NC_012923.1\|WP_012775061.1\|14889_18540_-\|helicase-exonuclease-AddAB-subunit-AddA	gnl\|CDD\|274299	TIGR02785, ATP-dependent_helicase/nuclease_subunit_A, helicase-exonuclease AddAB, AddA subunit, Firmicutes type. AddAB, also called RexAB, substitutes for RecBCD in several bacterial lineages. These DNA recombination proteins act before synapse and are particularly important for DNA repair of double-stranded breaks by homologous recombination. The term AddAB is used broadly, with AddA homologous between the Firmicutes (as modeled here) and the alphaproteobacteria, while the partner AddB proteins show no strong homology across the two groups of species. [DNA metabolism, DNA replication, recombination, and repair].	0
NC_012923.1\|WP_001015311.1\|14021_14702_-\|IS6-like-element-IS1216-family-transposase	gnl\|CDD\|225853	COG3316, COG3316, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	4.15926e-92
NC_012923.1\|WP_044475475.1\|9411_9621_-\|class-IIb-bacteriocin,-lactobin-A/cerein-7B-family	gnl\|CDD\|274873	TIGR03949, bact_IIb_cerein, class IIb bacteriocin, lactobin A/cerein 7B family. Members of this protein family are described variably as bacteriocins per se, one chain of a two-chain bacteriocin, or bacteriocin enhancer proteins. All members of the seed alignment occur in paired gene contexts with another member of the same protein family. This family includes bacteriocins that appear not to undergo post-translational modification, other than cleavage at a Gly-Gly motif coupled to sec-independent export. For many members, the N-terminal bacteriocin cleavage motif region is recognized by TIGR01847. C-terminal to the cleavage motif, these proteins are hydrophobic and low in complexity, consistent with pore-forming activity as a mechanism of bacteriocin action.	0.000913004
NC_012923.1\|WP_012774874.1\|11868_12765_-\|nucleotidyl-transferase-AbiEii/AbiGii-toxin-family-protein	gnl\|CDD\|378065	pfam08843, AbiEii, Nucleotidyl transferase AbiEii toxin, Type IV TA system. This family was recently identified as belonging to the nucleotidyltransferase superfamily. AbiEii is the cognate toxin of the type IV toxin-antitoxin 'innate immunity' bacterial abortive infection (Abi) system that protects bacteria from the spread of a phage infection. The Abi system is activated upon infection with phage to abort the cell thus preventing the spread of phage through viral replication. There are some 20 or more Abis, and they are predominantly plasmid-encoded lactococcal systems. TA, toxin-antitoxin, systems on plasmids function by killing cells that lose the plasmid upon division. AbiE phage resistance systems function as novel Type IV TAs and are widespread in bacteria and archaea. The cognate antitoxin is pfam13338.	7.19573e-10
NC_012923.1\|WP_012774875.1\|12965_13949_+\|hypothetical-protein	gnl\|CDD\|227645	COG5340, COG5340, Predicted transcriptional regulator [Transcription].	0.00264294
NC_012923.1\|WP_079395235.1\|11341_11497_-\|class-IIb-bacteriocin,-lactobin-A/cerein-7B-family	gnl\|CDD\|274873	TIGR03949, bact_IIb_cerein, class IIb bacteriocin, lactobin A/cerein 7B family. Members of this protein family are described variably as bacteriocins per se, one chain of a two-chain bacteriocin, or bacteriocin enhancer proteins. All members of the seed alignment occur in paired gene contexts with another member of the same protein family. This family includes bacteriocins that appear not to undergo post-translational modification, other than cleavage at a Gly-Gly motif coupled to sec-independent export. For many members, the N-terminal bacteriocin cleavage motif region is recognized by TIGR01847. C-terminal to the cleavage motif, these proteins are hydrophobic and low in complexity, consistent with pore-forming activity as a mechanism of bacteriocin action.	0.00273464
NC_012923.1\|WP_012774876.1\|18539_21806_-\|ATP-dependent-nuclease-subunit-B	gnl\|CDD\|274291	TIGR02774, putative_ATP-dependent_exonuclease_subunit_B, ATP-dependent nuclease subunit B. DNA repair is accomplished by several different systems in prokaryotes. Recombinational repair of double-stranded DNA breaks involves the RecBCD pathway in some lineages, and AddAB (also called RecAB) in other. The AddA protein is conserved between the firmicutes and the alphaproteobacteria, while the partner protein is not. The partner may be designated AddB, as in Bacillus and in alphaproteobacteria, or RexB as in Streptococcus and Lactococcus. Note, however, that RexB proteins lack an N-terminal GxxGxGK[ST] ATP-binding motif found in Bacillus subtilis and related species, and this difference may be important; this model represents specifically RexB proteins as found in Streptococcus and Lactococcus. [DNA metabolism, DNA replication, recombination, and repair].	0
NC_012923.1\|WP_001015311.1\|23592_24273_-\|IS6-like-element-IS1216-family-transposase	gnl\|CDD\|225853	COG3316, COG3316, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	4.15926e-92
NC_012923.1\|WP_079395234.1\|9052_9214_-\|class-IIb-bacteriocin,-lactobin-A/cerein-7B-family	gnl\|CDD\|274873	TIGR03949, bact_IIb_cerein, class IIb bacteriocin, lactobin A/cerein 7B family. Members of this protein family are described variably as bacteriocins per se, one chain of a two-chain bacteriocin, or bacteriocin enhancer proteins. All members of the seed alignment occur in paired gene contexts with another member of the same protein family. This family includes bacteriocins that appear not to undergo post-translational modification, other than cleavage at a Gly-Gly motif coupled to sec-independent export. For many members, the N-terminal bacteriocin cleavage motif region is recognized by TIGR01847. C-terminal to the cleavage motif, these proteins are hydrophobic and low in complexity, consistent with pore-forming activity as a mechanism of bacteriocin action.	0.000204644
NC_012923.1\|WP_044475473.1\|8194_8380_-\|class-IIb-bacteriocin,-lactobin-A/cerein-7B-family	gnl\|CDD\|274873	TIGR03949, bact_IIb_cerein, class IIb bacteriocin, lactobin A/cerein 7B family. Members of this protein family are described variably as bacteriocins per se, one chain of a two-chain bacteriocin, or bacteriocin enhancer proteins. All members of the seed alignment occur in paired gene contexts with another member of the same protein family. This family includes bacteriocins that appear not to undergo post-translational modification, other than cleavage at a Gly-Gly motif coupled to sec-independent export. For many members, the N-terminal bacteriocin cleavage motif region is recognized by TIGR01847. C-terminal to the cleavage motif, these proteins are hydrophobic and low in complexity, consistent with pore-forming activity as a mechanism of bacteriocin action.	0.000277184

>NC_012923.1|WP_012774874.1|11868_12765_-|nucleotidyl-transferase-AbiEii/AbiGii-toxin-family-protein
MTPDEIRNTILKAIYSDTELVENLVLKGGNALKLHRIVDRESQDLDFSIKETIRFTKENEGVKLQQLITDAFRQKGFFVNSFEFVPKPKNRHRDLPPFWGGYKISFALLDQEKYQDKINSQDSRQMKELNKYALSIEGGVKKIEIDLSYDEYTEHKEAYDLDGTTIYLYSPLMIVYEKIRASCQQLEEYPLTTNKTRARDLYDIFKTLTNINQVELRSEVLSEDNFYILENIFRVKEVPLELMTKLDTKKDDLAADYERKVLPQISNKDREEFEYIFDYNQRLFNELFEKYQKYNESR
>NC_012923.1|WP_153585981.1|11507_11669_-|bacteriocin
MTKFDTLDNMNFVALSESEMMETDGGLVITGPAIVGGLIVVGFGGLGLYLGSK
>NC_012923.1|WP_079395235.1|11341_11497_-|class-IIb-bacteriocin,-lactobin-A/cerein-7B-family
MNNFVDMKQEELENINGGFVVTGTMIYTGVKLASASFALGYAIGQAIKNSK
>NC_012923.1|WP_044475477.1|11144_11330_-|hypothetical-protein
MTKLIDIDMTKLMDILMFSSLSCSFMYFLGAYLSGKSFDNPLTFVMLSGAVAGVLHLLDRV
>NC_012923.1|WP_153585979.1|10889_11027_-|hypothetical-protein
MKTLTQKELVKTTGGSIIGLIGKGQTLRSPRIYLPGPVKPKLEVM
>NC_012923.1|WP_153585982.1|10542_10686_-|class-IIb-bacteriocin,-lactobin-A/cerein-7B-family
MALSEAEMMETEGGFVVTGTMIYTGVKLASASFALGYAIGQAIKNSK
>NC_012923.1|WP_153308592.1|10375_10531_-|class-IIb-bacteriocin,-lactobin-A/cerein-7B-family
MTNFEVIDKTNFVALSEVEMMETEGGFATGLGIAIGTVAVYCIGYMIGKNK
>NC_012923.1|WP_044475475.1|9411_9621_-|class-IIb-bacteriocin,-lactobin-A/cerein-7B-family
MTKFETMDKMNVDFVALTEEELMNVDGGLLPVVVGGVVVGWKVAAGVTAGVIAGGVAIGAAAGYFANRP
>NC_012923.1|WP_079395234.1|9052_9214_-|class-IIb-bacteriocin,-lactobin-A/cerein-7B-family
MNKFNTLCDDELVMIEGGLDPFTVTIGLGTLFLAAASGGYAFGKDLANRQRRK
>NC_012923.1|WP_044475473.1|8194_8380_-|class-IIb-bacteriocin,-lactobin-A/cerein-7B-family
MTKFETMDKMNVDFVALSDRELMDMEGGIIPVAVAAGIVASAAFAGLSAGVTIGISRNGRK
>NC_012923.1|WP_012774875.1|12965_13949_+|hypothetical-protein
MVLSDEKIQNILLEKKITKDASNLVKYSDEIVIQARKEFGNILNRTSIIKILNDFKQSNKLKKSASVSKFIDIIIDKLGLFEPIKILNEYKGETVTRYIATDVQISPYEIALSLLSKSFLSHYSALFVNDLTINNPKDIYINKEQSKKDFYSNNEQNISQGRIDYAFSKKMRRTNMIYSFTYDETSYKVHVLNSKNTNNTGVVLKNVVGFSKPVRTTNIERTLIDATVRPGYSGGALEILEAFLRAKNELNSKQLWSYLKKFNYSYPYHKAIAFYLKYSDYSYKNELVDFCNNDNQNSLTFYLDYQMVSPQKDDELGIYFPKMIPLK
>NC_012923.1|WP_001015311.1|14021_14702_-|IS6-like-element-IS1216-family-transposase
MNHFKGKQFQQDVIIVAVGYYLRYNLSYREVQEILYDRGINVSHTTIYRWVQEYGKLLYQIWKKKNKKSFYSWKMDETYIKIKGKWHYLYRAIDADGLTLDIWLRKKRDTQAAYAFLKRLVKQFDEPKVVVTDKAPSITSAFKKLKEYGFYQGTEHRTIKYLNNLIEQDHRPVKRRNKFYRSLRTASTTIKGMEAIRGLYKKTRKEGTLFGFSVCTEIKVLLGIPA
>NC_012923.1|WP_012775061.1|14889_18540_-|helicase-exonuclease-AddAB-subunit-AddA
MAFEQFLSAEEIKAVQLAEAHSDKQQKRTAEQIEAIYTHGQNVLVSASAGSGKTFVMVQRILDKLKRGIGIDQLFISTFTVKAAGELKERIEKKLNETIAETTDMELRRHLSAQLADLTKADIGTMDSFTQKLVTTYGYSLGISPQFRILQDETEKASLKKEVFDQLFADYLEEDENGAFRKLVRNFSGNRKDNSGFRQVVYQVHDFSQSTSSPTKWLKEQAVQADLYSQERIEQMLEQGFKEKVLDKLYQAADFFRYHVEWGRNDFGSAKYFANVEEVLDLLTGLDSLDQKDLMERVERILLINNQSRGKGLTNANRPKDEHLIAFKEEYNAGKSQIISELRDLGQEVYELTLLKDYQVQALPLLILLRDFVLDFSQAYLDVKIKEAAFEFGDIGHFAIRILEENADIRQFFQEKYHEVMVDEYQDNNHSQERMLDLLSNGHNRFMVGDIKQSIYRFRQADPMIFQEKFELYQANPQSGKLILLKENFRSQIEVLEATNAIFTRLMDRQVGEIKYDDTHSLVAGSPGQKIAQPKNEMEYLIYDQQDSANSSTDAEEETPLTAGEIEVVAKEIIRLHNEEGADFKDITLLVQKRTHNDLIMSIFEKHGIPIVADGGAASYLQSLEVMIMLDTLRVINNPLNDYALVALLKSPMFRFDEDELTRISLQAGTGFFYQKMEIAQQASGQHPELMSEKLKKKITDFLSILENWRAYAKLHSIYDMIWKMFNEKFYYDYVGALPNGSKRQANLYALGLRANQFEKTGYKGLSRFIAMIDRALANDKDLADVQEFLPQNAVQLMTIHKSKGLEFKYVFLMNIDKRFNLEDHYQSVIISRKNGLGIQYLADMKDKVNSPLPQVRVLMNTLPYQNNLQELKIANLSEQMRLLYVALTRAEKKLYLVGKGNADKLAEKYDGKKENGVLAQSTRESMATFQDWILAIDEAFSGEDLHFKKVFVTDEDLTEEKIGKLTLKSKLEDASLKDIRQSEDIAQALDQLSSVQELNERYKAAIELPSLRTPSQIKKLYEPILEQEGMEVMEKYQPKRTFNLPDFSKKPKITGAQVGSAVHELMQRLDLSWLVTEDTVRAALEAVHAEQAIKDKINVQMILDFFDTDLGREILANTDKLHREAPFASLQTDSVSQENFVLRGIIDGYLLYDDHIVLFDYKTDKYDQPIQLSQRYQAQMQLYAEALKKAYKIDRVDCHLILLGGERIEVVEVNI
>NC_012923.1|WP_012774876.1|18539_21806_-|ATP-dependent-nuclease-subunit-B
MKLVYTDIRNPLTQYLTEQTATFAEQGKRVFYIAPNSLSFEMERKVLEYLPEQATFDIIVTRFGQLARYLMIDRKEAGQPLDDVGLAMIFFRVLSQFEDGDLKVYGRLQTDFGFINQLVALYKELQRANMSILDLEAMDSPDKQADLVKIFLAVTDILSKEGFEHQSKLAQLTGLVETGQLDEQLKNIVLVVDGFSRFSAEEEALVSALNERVSEILIGVYASKKAVQATYAEGNVYQANVDFLRQLSAQFQTKATYIGQEPVLDSIGKFSKNMEAYYDYSGTMIDLTPADQEKIQLWEVVNQKEEVEQVATAIRQHVHQGARYKDILLLLGDVDSYKLQIGKIFDKYDIPYYFGKAEEMSHHPLVHFVESLERLRRYRFRAEDLLNLLKSGLYASISQKELDLFESYILFADMKGQAAFSRAFSVNGRADYDAEVIKEKRLVYDLTVLEPLRAKIMEPLNQLFKAGPQSGTALLEKFMAFLEAIDLPKNMEKMSRNLSEVEQEKEEQVWKSFTHLLENFHQIFGKEKLKMDDFLAILQAGMQASHYRTVPATVDVVNVKSYDLIEPHTAKYVYAIGMGQSNFPKVAKNTSLLTEEEMEKVNLVSASSSRFDLVSRENIKKNHAAMMSLLNSATEQLVISTPQIYNEGEDSLSPYIKILQKMGLKSEERGRIKTLSPQDIGHYKSLLSRLIESERPSLETEEWEGQRAFWTVLVRHLKKKLESQSIEIPTITGDIASKQLSDETLAALYPEDKPLNLSASSLTNFYNNQYLYFVRNVLRLREQESIHPTAFQHGLFLHRIFERVVMDQSELDFDQKVDKAILCTRDEAEFAMFYNQDADARYTEEVLDKIARSSATILRDNDLVEIDGQEKSFRQDKALVFDLQNGKSVHVNGTIDRLDTLQINQAVGVVDYKSSDQSFSVGDFYNGLKPQLVTYLAALQELDETKDKPVFGAMYLHLQDPIIKLKDTKNLEQLEGAANTSLVYKGLFLKEESLGLNHFYQTRNQLYTEDEFAVLLNHNQELYKQAAMDILAGRFAINPYTKDGRSVAGEQLKAITGFEADRHMGMARRLVKEAKRQDWMERMKGGQD
>NC_012923.1|WP_001015311.1|23592_24273_-|IS6-like-element-IS1216-family-transposase
MNHFKGKQFQQDVIIVAVGYYLRYNLSYREVQEILYDRGINVSHTTIYRWVQEYGKLLYQIWKKKNKKSFYSWKMDETYIKIKGKWHYLYRAIDADGLTLDIWLRKKRDTQAAYAFLKRLVKQFDEPKVVVTDKAPSITSAFKKLKEYGFYQGTEHRTIKYLNNLIEQDHRPVKRRNKFYRSLRTASTTIKGMEAIRGLYKKTRKEGTLFGFSVCTEIKVLLGIPA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_012923_1	1.1\|12865\|39\|NC_012923\|CRISPRCasFinder	12865-12903	39	NC_012923	Streptococcus suis BM407 plasmid pBM407, complete sequence	12865-12903	0	1.0
NC_012923_1	1.1\|12865\|39\|NC_012923\|CRISPRCasFinder	12865-12903	39	NZ_KX785328	Streptococcus suis strain 3366 plasmid unnamed3, complete sequence	17923-17961	1	0.974
NC_012923_1	1.1\|12865\|39\|NC_012923\|CRISPRCasFinder	12865-12903	39	NZ_CP029399	Streptococcus suis strain HN105 plasmid unnamed1, complete sequence	3511-3549	8	0.795

1. spacer 1.1|12865|39|NC_012923|CRISPRCasFinder matches to NC_012923 (Streptococcus suis BM407 plasmid pBM407, complete sequence) position: , mismatch: 0, identity: 1.0

tagaatgactttttttattttttttgttaaagtataatc	CRISPR spacer
tagaatgactttttttattttttttgttaaagtataatc	Protospacer
***************************************

2. spacer 1.1|12865|39|NC_012923|CRISPRCasFinder matches to NZ_KX785328 (Streptococcus suis strain 3366 plasmid unnamed3, complete sequence) position: , mismatch: 1, identity: 0.974

tagaatgactttttttattttttttgttaaagtataatc	CRISPR spacer
tcgaatgactttttttattttttttgttaaagtataatc	Protospacer
* *************************************

3. spacer 1.1|12865|39|NC_012923|CRISPRCasFinder matches to NZ_CP029399 (Streptococcus suis strain HN105 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.795

tagaatgactttttttattttttttgtt-aaagtataatc	CRISPR spacer
cgcaatgaccttttttattttttttgttcaagatataac-	Protospacer
.. ******.****************** **..*****.

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_012926_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_012926_1

388734-388947

Orphan

Consensus_repeat	Method
TAAAAGGTTGGAGATTGGAA	PILER-CR

3 spacers

The CRISPR arrays of NC_012926_1

>merge|NC_012926|1|388734-388947|PILER-CR
TAAAAGGTTGGAGATTGGAATCGTCGGTAGACGATTCTCATTGTACGTGGGACGTCCTAGAAGGTTGGAGATTGGAACTGCCGTGCCGGCAGGCAGTTTTCTTTATACTCAAAAGTCCGGGGGACAGTCATTTTTATTAAAAGGTTGGAGATTGGAATCGTCGGTAGACGATTCTCATTGTACGTGGGATGTCCTAGAAGGTTGGAGATTGGAA

>NC_012926|1|1|388734-388947|PILER-CR
TAAAAGGTTGGAGATTGGAA	TCGTCGGTAGACGATTCTCATTGTACGTGGGACGTCC
TAGAAGGTTGGAGATTGGAA	CTGCCGTGCCGGCAGGCAGTTTTCTTTATACTCAAAAGTCCGGGGGACAGTCATTTTTAT
TAAAAGGTTGGAGATTGGAA	TCGTCGGTAGACGATTCTCATTGTACGTGGGATGTCC
TAGAAGGTTGGAGATTGGAA

Protein	Signature genes	Signature genes Name	Protein_function
NC_012926.1\|WP_011922661.1\|378910_380419_+\|4-alpha-glucanotransferase	unknown	unknown	gnl\|CDD\|237738
NC_012926.1\|WP_004194196.1\|387510_387822_-\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|163261
NC_012926.1\|WP_011921980.1\|396432_397146_-\|16S-rRNA-(guanine(527)-N(7))-methyltransferase-RsmG	unknown	unknown	gnl\|CDD\|234637
NC_012926.1\|WP_011922665.1\|384634_386803_+\|PTS-transporter-subunit-EIIC	unknown	unknown	gnl\|CDD\|131058
NC_012926.1\|WP_012774979.1\|380411_382676_+\|glycogen/starch/alpha-glucan-family-phosphorylase	unknown	unknown	gnl\|CDD\|340853
NC_012926.1\|WP_009909407.1\|391854_392838_+\|rhodanese-related-sulfurtransferase	unknown	unknown	gnl\|CDD\|234663
NC_012926.1\|WP_011921974.1\|390068_390614_+\|ECF-type-riboflavin-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|184218
NC_012926.1\|WP_011921978.1\|393524_395198_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213192
NC_012926.1\|WP_012774977.1\|375913_376324_+\|peptide-deformylase	unknown	unknown	gnl\|CDD\|181704
NC_012926.1\|WP_011921979.1\|395194_396028_+\|energy-coupling-factor-transporter-transmembrane-protein-EcfT	unknown	unknown	gnl\|CDD\|223692
NC_012926.1\|WP_012775500.1\|376628_378728_+\|ATP-dependent-Clp-protease-ATP-binding-subunit	unknown	unknown	gnl\|CDD\|223616
NC_012926.1\|WP_004194205.1\|382903_383611_-\|UTRA-domain-containing-protein	unknown	unknown	gnl\|CDD\|274116
NC_012926.1\|WP_004194192.1\|389199_390048_+\|S-adenosyl-l-methionine-hydroxide-adenosyltransferase-family-protein	unknown	unknown	gnl\|CDD\|224824
NC_012926.1\|WP_011922666.1\|386873_387500_-\|DUF2812-domain-containing-protein	unknown	unknown	gnl\|CDD\|378589
NC_012926.1\|WP_004194195.1\|387982_388699_+\|YebC/PmpR-family-DNA-binding-transcriptional-regulator	unknown	unknown	gnl\|CDD\|237084
NC_012926.1\|WP_004195223.1\|396187_396391_+\|cold-shock-protein	unknown	unknown	gnl\|CDD\|224197
NC_012926.1\|WP_171840875.1\|393095_393407_+\|lactoylglutathione-lyase	unknown	unknown	gnl\|CDD\|226134
NC_012926.1\|WP_011921981.1\|397204_399391_-\|PBP1A-family-penicillin-binding-protein	unknown	unknown	gnl\|CDD\|273955
NC_012926.1\|WP_012774980.1\|390721_391642_+\|hypothetical-protein	unknown	unknown	unknown
NC_012926.1\|WP_011921968.1\|383809_384601_+\|endonuclease/exonuclease/phosphatase-family-protein	unknown	unknown	gnl\|CDD\|197313

Protein	Function_ID	Function_description	E-value
NC_012926.1\|WP_011922661.1\|378910_380419_+\|4-alpha-glucanotransferase	gnl\|CDD\|237738	PRK14508, PRK14508, 4-alpha-glucanotransferase; Provisional.	0
NC_012926.1\|WP_004194196.1\|387510_387822_-\|transcriptional-regulator	gnl\|CDD\|163261	TIGR03433, padR_acidobact, transcriptional regulator, Acidobacterial, PadR-family. Members of this protein family are putative transcriptional regulators of the PadR family, as found in species of the Acidobacteria. This family of proteins has expanded greatly in this lineage, and where it regularly is found in the vicinity of a putative transporter protein [Regulatory functions, DNA interactions].	2.51666e-11
NC_012926.1\|WP_011921980.1\|396432_397146_-\|16S-rRNA-(guanine(527)-N(7))-methyltransferase-RsmG	gnl\|CDD\|234637	PRK00107, gidB, 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG.	9.06801e-85
NC_012926.1\|WP_011922665.1\|384634_386803_+\|PTS-transporter-subunit-EIIC	gnl\|CDD\|131058	TIGR02003, PTS_system_glucose-specific_IIBC_component, PTS system, IIBC component. This model represents a family of fused B and C components of PTS enzyme II. This clade is a member of a larger family which contains enzyme II's specific for a variety of sugars including glucose (TIGR02002) and N-acetylglucosamine (TIGR01998). None of the members of this clade have been experimentally characterized. This clade includes sequences from Streptococcus and Enterococcus which also include a C-terminal A domain as well as Bacillus and Clostridium which do not. In nearly all cases, these species also contain an authentic glucose-specific PTS transporter. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids].	0
NC_012926.1\|WP_012774979.1\|380411_382676_+\|glycogen/starch/alpha-glucan-family-phosphorylase	gnl\|CDD\|340853	cd04300, GT35_Glycogen_Phosphorylase, glycogen phosphorylase and similar proteins. This is a family of oligosaccharide phosphorylases. It includes yeast and mammalian glycogen phosphorylases, plant starch/glucan phosphorylase, as well as the maltodextrin phosphorylases of bacteria. The members of this family catalyze the breakdown of oligosaccharides into glucose-1-phosphate units. They are important allosteric enzymes in carbohydrate metabolism. The allosteric control mechanisms of yeast and mammalian members of this family are different from that of bacterial members. The members of this family belong to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.	0
NC_012926.1\|WP_009909407.1\|391854_392838_+\|rhodanese-related-sulfurtransferase	gnl\|CDD\|234663	PRK00142, PRK00142, rhodanese-related sulfurtransferase.	0
NC_012926.1\|WP_011921974.1\|390068_390614_+\|ECF-type-riboflavin-transporter-substrate-binding-protein	gnl\|CDD\|184218	PRK13661, PRK13661, ECF-type riboflavin transporter substrate-binding protein.	8.67718e-92
NC_012926.1\|WP_011921978.1\|393524_395198_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|213192	cd03225, ABC_cobalt_CbiO_domain1, First domain of the ATP-binding cassette component of cobalt transport system. Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota. The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed. This ABC transport system of the CbiMNQO family is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways. Most of cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO. Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.	5.22213e-92
NC_012926.1\|WP_012774977.1\|375913_376324_+\|peptide-deformylase	gnl\|CDD\|181704	PRK09218, PRK09218, peptide deformylase; Validated.	1.94042e-84
NC_012926.1\|WP_011921979.1\|395194_396028_+\|energy-coupling-factor-transporter-transmembrane-protein-EcfT	gnl\|CDD\|223692	COG0619, CbiQ, ABC-type cobalt transport system, permease component CbiQ and related transporters [Inorganic ion transport and metabolism].	2.31637e-38
NC_012926.1\|WP_012775500.1\|376628_378728_+\|ATP-dependent-Clp-protease-ATP-binding-subunit	gnl\|CDD\|223616	COG0542, clpA, ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones].	0
NC_012926.1\|WP_004194205.1\|382903_383611_-\|UTRA-domain-containing-protein	gnl\|CDD\|274116	TIGR02404, Trehalose_operon_transcriptional_repressor, trehalose operon repressor, B. subtilis-type. This family consists of repressors of the GntR family typically associated with trehalose utilization operons. Trehalose is imported as trehalose-6-phosphate and then hydrolyzed by alpha,alpha-phosphotrehalase to glucose and glucose-6-P. This family includes repressors mostly from Gram-positive lineages and does not include the TreR from E. coli. [Regulatory functions, DNA interactions].	3.21951e-64
NC_012926.1\|WP_004194192.1\|389199_390048_+\|S-adenosyl-l-methionine-hydroxide-adenosyltransferase-family-protein	gnl\|CDD\|224824	COG1912, COG1912, Uncharacterized conserved protein [Function unknown].	2.06971e-121
NC_012926.1\|WP_011922666.1\|386873_387500_-\|DUF2812-domain-containing-protein	gnl\|CDD\|378589	pfam11193, DUF2812, Protein of unknown function (DUF2812). This is a bacterial family of uncharacterized proteins, however some members of this family are annotated as membrane proteins.	6.08987e-21
NC_012926.1\|WP_004194195.1\|387982_388699_+\|YebC/PmpR-family-DNA-binding-transcriptional-regulator	gnl\|CDD\|237084	PRK12378, PRK12378, YebC/PmpR family DNA-binding transcriptional regulator.	7.09301e-135
NC_012926.1\|WP_004195223.1\|396187_396391_+\|cold-shock-protein	gnl\|CDD\|224197	COG1278, CspC, Cold shock proteins [Transcription].	5.32735e-32
NC_012926.1\|WP_171840875.1\|393095_393407_+\|lactoylglutathione-lyase	gnl\|CDD\|226134	COG3607, COG3607, Predicted lactoylglutathione lyase [General function prediction only].	2.17243e-18
NC_012926.1\|WP_011921981.1\|397204_399391_-\|PBP1A-family-penicillin-binding-protein	gnl\|CDD\|273955	TIGR02074, Includes:_Penicillin-insensitive_transglycosylase, penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan].	0
NC_012926.1\|WP_011921968.1\|383809_384601_+\|endonuclease/exonuclease/phosphatase-family-protein	gnl\|CDD\|197313	cd09079, RgfB-like, Streptococcus agalactiae RgfB, part of a putative two component signal transduction system, and related proteins. This family includes Streptococcus agalactiae RgfB (for regulator of fibrinogen binding) and related proteins. The function of RgfB is unknown. It is part of a putative two component signal transduction system designated rgfBDAC (the rgf locus was identified in a screen for mutants of Streptococcus agalactiae with altered binding to fibrinogen). RgfA,-C,and -D do not belong to this superfamily: rgfA encodes a putative response regulator, and rgfC, a putative histidine kinase. All four genes are co-transcribed, and may be involved in regulating expression of bacterial cell surface components. This family belongs to the large EEP (exonuclease/endonuclease/phosphatase) superfamily that contains functionally diverse enzymes that share a common catalytic mechanism of cleaving phosphodiester bonds.	6.73631e-125

>NC_012926.1|WP_004194195.1|387982_388699_+|YebC/PmpR-family-DNA-binding-transcriptional-regulator
MGRKWANIVAKKTAKDGANSKVYAKFGVEIYVAAKKGDPDPETNSALKFVIDRAKQAQVPKHIIDKAIDKAKGNTDETFVEGRYEGFGPNGSMIIVDTLTSNVNRTAANVRSAFGKNGGNMGASGSVSFMFDKKGVVVFAGDDADAIFELLLEADVEVDDVEAEDGTITVYTAPTDLHKAIVALKESGIQEFNVTELEMIPQSEVSLEGDDLATFEKLYDALEDDEDVQKIYTNVDGF
>NC_012926.1|WP_004194196.1|387510_387822_-|transcriptional-regulator
MKRNKHLPLTETTYYILLALLEPAHGYHIMQKVEDMSDGDVKIAAGTMYGAIENLLKLKWICSVPSSDKRRKVYQVTATGQEIIKLETQRIQKLHHIAKELGF
>NC_012926.1|WP_011922666.1|386873_387500_-|DUF2812-domain-containing-protein
MIRHKLFTSLQEEEHWINSIQSEGYQLVKVTPWTATYHFEKCSRTPHPVRLDFHEHIAKGEYSNYLSLFEDCGWQPIQGSRRCGIHYFQQTIETSSTEIFSDTESKKAFYSRYQNYAYSYFGLFLTLFFIHYQVGLQNGYTLWNPKSWYLTPGLWERTGTSFWFGFLFETPFALFRSGIIPLFFLAWSIYFLHIAEKGKKEAKKLEKY
>NC_012926.1|WP_011922665.1|384634_386803_+|PTS-transporter-subunit-EIIC
MKKFLSFEFWQKFGKCLMVVIAVMPAAGLMVSIGNSIPLISPESELLIRIGNIIAQIGWGIIGNLHLLFALAIGGSWAKEKAGGAFSAGLAFILINLITGHFFGVTTDMLADAAATVTTVFGTEIPVSGYFVNILGQPALNMGVFVGIIAGFVGATTYNKYYNYRKLPDVLTFFNGKRFVPFVVIYRSVLVALGLAIFWPVVQTGINSFGKWIASSQDTAPILAPFVYGTLERLLLPFGLHHMLTIPMNYTSLGGTYDILTGAQAGTQVFGQDPLWLAWITDLINLKDAGDMAQYNDLLANITPARFKVGQMIGSSGILMGLTYAMYRNVDEDKKHKYKGMFISSALAVFLTGVTEPIEFMFMFAAMPLYVVYAFVQGAAFAMADIVNLRMHSFGNIEFLTRTPMAIKAGIGMDVINFIWVTALFAVGMYFIANFMIKKFNLATAGRNGNYDTETTDVVSNSNVDTADANSQVVQIINLLGGRDNIADVDACMTRLRVSVKDVAQVGDENAWKQAGAMGLIIKDSGVQAVYGPKADVLKSDIQDLLESGVAIPRTEIVATEEVAPETQFKGVTETVYSVAEGQAIAITEVKDPVFSQKMMGDGYAVEPSSGNVYAPVSGIVTSVFPTKHAVGILSDKGVEVLVHVGLDTVALNGAPFSTKVTDGQRVEAGDLLLVADLEAIRSAGRETTIVVAFTNTAEIKSVSLENLGQVSQDSQVATVEL
>NC_012926.1|WP_011921968.1|383809_384601_+|endonuclease/exonuclease/phosphatase-family-protein
MKLLTINVHAWLEERQDEKLDVLAQTIAEKAYDVIALQEVNQLITADLVTKDLKADNYGLILLEKLRTLGQFDYSYYWSNSHIGYDKYEEGIAFLTKLPVYEVDQFYCSQNKSIDSILSRKIMGLTVFYQDQLIDLYSCHINLPGSEEEDQLDNIRTIVERTGNRRFKILMGDFNTDAFSDREAYEAITELGLYDSYNLAMEKDQGITVEKAIDGWAGHSQEKRLDYIFLNQKKEVLSSLVIFNGENRPIISDHFGVEVEINV
>NC_012926.1|WP_004194205.1|382903_383611_-|UTRA-domain-containing-protein
MSKYKKVYQDIKKKIEEQVWSTGQALPTENELMEVYSYSKDTIRKALSLLEMDGYIQKKQGKSSIVIEHGLMKDQYLSEIKTAGELNKRSQHQIQTQLTSLYIIQGQEDLMSTFEVDDKVDFYRVSRVRTIDGERLEYDISYFDRRVVPYLSKEIAESSIYRYLEEELHLTISHSRREISFRFANEEEKQLMDLGDYDMVVVVTSITYLSNGQAFQYGTISYRPDKVSFVSMAKR
>NC_012926.1|WP_012774979.1|380411_382676_+|glycogen/starch/alpha-glucan-family-phosphorylase
MTKFTTFAETNTSKKLADLTNEEIYLQLLNYVKDAAASKPKNTGKRKVYYISAEFLIGKLLSNNLINLGVYKDVQAELAAAGKSLAQVEDVEPEPSLGNGGLGRLASCFVDSMSTLAINGEGVGLNYHCGLFRQVFKKNEQEAEPNFWIENDSWLIPTTISYDVPFKNFTLKSKLDRLDILGYKKETKNYLNLFDIESVNYDLITDGISFDKTDIKENLTLFLYPDDSDKNGELLRIYQQYFMVSNAAQLLIDEAIERGSNLHDLADYAYVQINDTHPSMVIPELIRLLTEKHGIEFAEAVAIVKNMTGYTNHTILAEALEKWPLEFLEEVVPHLVDIIKELDALIRAEIKDPAVQIIDESGRVHMAHMDIHFSNSVNGVAALHTEILKNSELKAFYELYPEKFNNKTNGITFRRWLEFANQDLADYIKELIGDEYLTDATKLEKLLAFADDKEVHAKLAEIKFNNKLALKRYLKDNKGIELDENSIIDTQIKRFHEYKRQQMNALYVIHKYLEIKNGNLPKRKITVIFGGKAAPAYIIAQDIIHLILCLSELINNDPEVNKYLNVHLVENYNVTVAEKLIPATDISEQISLASKEASGTGNMKFMLNGALTLGTMDGANVEIAELAGMDNIYTFGKDSDTIIDLYDKAGYVSADYYNGDANIKRAVDFIVSDEVKALGNEERLGRLHHELISKDWFMTLIDLAEYIEVKEQVFADYEDQDSWNKKVVHNIAKAGFFSSDRTIEQYNEDIWHSN
>NC_012926.1|WP_011922661.1|378910_380419_+|4-alpha-glucanotransferase
MTNRTSGILMHITSLPGKFGIGTFGQSAYDFVDFLVETKQTYWQILPLTTTSYGDSPYQSFSAIAGNTHLIDFDLLVEDGLLATEDFQDVNFGDNPEKVDYALIYQVRRPILEKAVQAFLQDDKKKAAFLEFEKANSSWLTDYAEFMAIKEYFGNKALQEWEDKKVVARNEEALDKYRLELANQIDYYKVTQYFFFSQWKQLKEYANKHHIKIIGDMPIYVSADSVEVWTKPQLFKLDSERKPLYVAGVPADNFSADGQLWGNPIYDWPEHEKTGYNWWIYRIHESFKLYDVLRIDHFKGFSDFWQVDGKAEVAKVGTWEPGPGYNLFKAVKETLGDLPIIAEDLGNIDAKARKLLADCGYPGMKILEFGFFDVTGKSIDAPHRCIPNSVAYTGTHDNEVVNGWYNNLDPEQQEYVDAYSNRKPIEKVSQAMLRMLFATVSDTAIATMQDVLDLGEESRMNMPSTIGGNWEWRMKAEDLTQERKDFLTKMTLLYQRGNENHD
>NC_012926.1|WP_012775500.1|376628_378728_+|ATP-dependent-Clp-protease-ATP-binding-subunit
MNNNFNNFNNMDDIFNQLMGNMGGYSTERRRYSINGREVTPEEFAMYRQTGRLPQTEEVAQTQAKGQIKSDGILAKLGRNLTQDAREGKLDPVIGRNKEIQETSEILARRTKNNPVLVGDAGVGKTAVVEGLAQAIVNGDVPAAIKNKEIISIDISGLEAGTQYRGAFEENVQNLVDEVKKAGNIILFFDEIHQILGAGSTGGDSGSKGLADILKPALSRGELTVIGATTQDEYRNTIHKNAALARRFNEVKVNAPSAEDTYQILKGIKPLYEAHHNIELPDEVLRAAVDYSVQYIPQRSLPDKAIDLVDVTAAHLAAQHPVTDIQTLEAEMAEAKQLQLEAAEKEDYEKALNEKVRIDKLQKQIDNHTEQQKVVATVNDVAQAVERMTGIPVSQMGASDIERLKELKNRLAANVIGQDDAVEAVSRAIRRNRAGFDDGNHPIGSFLFVGPTGVGKTELAKQLALDLFGNKDAIIRLDMSEYSDRTAVSKLIGTTAGYIGYDDNSHTLTERVRRNPYSIVLMDEIEKADPQVITLLLQVLDDGHLTDGQGNQVNFKNTIIIATSNAGFGYGMAEGEENQDIMDRIAPFFRPEFLNRFNAVIEFKHLDKDDLKAIVELLLAQVNNTLAKKGIQLTVTEAAKEFLMEEGYDKAMGARPLRRVIENQIRDKVTDFYLDHVDVKYLEADVVDGSIQIKEQSFA
>NC_012926.1|WP_012774977.1|375913_376324_+|peptide-deformylase
MIQPIMKDIFFLQQKSEPATQLDVQVGQDLQDTLAANAHACVGMAANMIGVKKRIIIVNMGFTNLVMYNPVLISKAKPYQTEEGCLSLEGTRPTTRYQEIEVEFFDASWKKISLKLTDFQAQIVQHELDHLEGIII
>NC_012926.1|WP_004194192.1|389199_390048_+|S-adenosyl-l-methionine-hydroxide-adenosyltransferase-family-protein
MSNNLLVLQSDFGLVDGAVSAMIGVALQESRDLVVHHLTHDITPYNIFEGSYRLFQTVEYWPEGTTFVSVVDPGVGSKRKSVVALTEQNHYIVTPDNGTLSFIKKYVGIKAVREISEVANRRANTEHSYTFHGRDVYAYTGAKLASGHISFEEVGPELSVDKIVEIPTVPTEVGSDYVKGAIDILDVRFGSLWTSITREEFYTLQPQFEDRFEVTIYNNDMLVYQNQVTYGKSFADVRIGQPLIYINSLYRVGVAINQGSFAKAYNVGVGQNWHIEIKRISN
>NC_012926.1|WP_011921974.1|390068_390614_+|ECF-type-riboflavin-transporter-substrate-binding-protein
MKNNSIKTVVATGIGAALFVVIGHLINIPTFVPNTSIQLQYAVQSLLAVVFGPVVGFLVGFIGHTLKDSLTYGPWWSWILASGVFGLVVGLTKKRLRIQEGIFEGKDILFFNLVQIAANVLAWGVIAPVLDILIYSEAANKVFAQGLVAGIANSITIAIAGTLLLVVYAKSQTKTGSLSKD
>NC_012926.1|WP_012774980.1|390721_391642_+|hypothetical-protein
MVWTEEKLGPIIHSILNPDEEVLSLYQSKTTKSIYGCILWNNYYYKVFRVSNHPSQSTYKQPTFYDFHGEFYMKGAIRTYLYHTNSWYELSKQGYYLLLFFQKLWDEKQEVEASWQNGRMQIRLVVEEEGWQVHYRFPDNQAREVERLLGSGMLVAIRSSRNFIKIRTSRFVAPYIALIKQRQLYRKKPSKAMLQWEKYQSQLIEIQRTYRLVEESAPQTFFGHWLNKVQLYLCSAIASYWEEVIKGVEWQEAREIKEQRKAEKPHNPIEDKWKENIARRHKRKMDQLIGHDTLEKLRQLKTELDD
>NC_012926.1|WP_009909407.1|391854_392838_+|rhodanese-related-sulfurtransferase
MSKDIRVLLYYKYVPIENAKEYAAEHLAFCKSIGLKGRILIADEGINGTVSGDYETTQKYMDYVHANPLFSDLWFKIDEENEQAFKKMFVRYKKEIVHLGLEDNDFDNDIDPLVTTGAYLSPKEFKEALLDEDTVVLDTRNDYEYDLGHFRGAIRPDIRNFRELPQWVRDNKEKFMDKRVVVYCTGGVRCEKFSGWMVREGYKDVGQLHGGIATYGKDPEVRGELWDGKMYVFDERIAVDVNHVNPVVVGKDWFDGTPCERYVNCGNPFCNRRILTSEENEHKYVRGCSAECRAHERNRYISENGLTRQEWAERLEAIGETLTPANA
>NC_012926.1|WP_171840875.1|393095_393407_+|lactoylglutathione-lyase
MAGRFYEAIGFAVATFGDIKSATLPKGGNLILMQADSFAQRVPFQVVASGNEVLISLNVASREEVDRIIERVEANGGQITGCPTDARGFYGASFTDLDGIILM
>NC_012926.1|WP_011921978.1|393524_395198_+|ABC-transporter-ATP-binding-protein
MKKIIEFKDFTFKYQAQQEPTLKDIQLTIYQGEKVLIIGPSGSGKSTIGQCLNGIIPNIYKGEHSGSLLLDGQEAFNLSVYDKSLLVSTVLQDTDGQFIGLSVAEDLAFALENDMESQVVMKQKVGDWAERLSLTDLLAHRPQDLSGGQKQRVSLGGVLIDESPILLFDEPLANLDPKSGQDTIDLIDRLHKQEGTTTIIIEHRLEDVLYRQVDRVVLINDGRILFNGGPDDLLRTSLLQENGIREPLYLSTLRALGYPIAQAERLSSVWEIDIEALNIASLPTLHFENGEKEALLEVKHLYFSYPNKQVLTDIQLTIHKGERLAIVGKNGAGKSTLAKVLCGFIQGEGEILWKGQSIKEDSVKERAERIGYVLQNPNQMISQTMIFDEVALGLRMRGVTEEEIEHRVHHILKVCGLYPFRNWPISALSYGQKKRVTIASILVLNPEIILLDEPTAGQDQRHYREMMEFLDQLNAQGHTIVMITHDMQLMLDYSDRAVVVVDGQIIEDASPAEILSDDTVIERANLKETSIFHLAERVGVNPLELTTFYMQEERRGR
>NC_012926.1|WP_011921979.1|395194_396028_+|energy-coupling-factor-transporter-transmembrane-protein-EcfT
MSQQKLIGYHPGTGLIHSLSAVSKLLFFLIVSILAMITYDTRLILFIAVFSLALFKMSGIRYKEISLVLILTIIFAAMNALMVHLFAPRYGVELYGADTPLLSGLGVYSLTSQQAFYLVNLLLKYFCTVPLAIIFLMTTHPSQFASSLNQIGVSYKVAYAVSLTMRYIPDIQEEFYTIRMSQEARGLELSKKGKLMDRIKGNLSLVIPLIFSSLERIDTISTAMELRRFGKNKKRTWYTQQPLQRIDYAVLLFILALVVVTIYLFFVNQGRFYNPWR
>NC_012926.1|WP_004195223.1|396187_396391_+|cold-shock-protein
MVQGTVKWFNAEKGFGFIAQENGPDVFAHFSEIQSNGFKSLEDGQKVTFEVEQGQRGLQATNITKIG
>NC_012926.1|WP_011921980.1|396432_397146_-|16S-rRNA-(guanine(527)-N(7))-methyltransferase-RsmG
MKPEVFYKTLADQGIQLTDQQKHQFHRYFQLLVEWNEKINLTAITEESEVYLKHFYDSIAPLLQGHIQNEPLRLLDIGAGAGFPSLPMKIIFPQLDVTIIDSLNKRINFLHLLAEELELEGVHFYHGRAEDFAQDKNFRAQFDLVTARAVARMQILSELTIPYLKLHGKLIALKASSAEDELTQAKNALNLLFAKVIENHDYTLPNGDPRTLTIVEKKKETPNKFPRKAGMPNKRPL
>NC_012926.1|WP_011921981.1|397204_399391_-|PBP1A-family-penicillin-binding-protein
MVNLLKTTTIKKALLITANILLAGAIIACLAGAALVVYYIQSAPELTEESLTATVSSKIYDKNGNLIADLGAEKRSSAKTEEIPTDLVNAIVAIEDQRFFNHRGVDVIRIAGSLINNLSGGRLQGGSTLDQQFIKLTYFSTSVEDQNLKRKIQEAWLATQLERRNTKQEILTYYINKVYMSNGNYGMKTAALAFYGKELKDLTLPQLALLAGMPQAPNQYDPYTNPEDAKARRDLVLAEMLEEKYIDNTQYEQAVLTPVTDGLQPLSNAAAYPAYMDNYLKQVVEEVEAKTGYNLLTTGMDVYTNVDPAAQQQLWNIYNTDMYVSYPDDLLQVASTVVDVSNGKVVAQLGGRKQETNVSFGTNQAVETNRDFGSTMKPITDYAPAFENGIYTSTADLILDGPYNYPGTPTPVNNWDKQYYGNISVKTAIQYSRNVTAVKALEATGLENALKFLNSVGINYPDIHYSNAISSNTSDTSSKYGASSEKMAAAYAAFANGGTYYAPQYVNKIVFSDGTVTEYAPKGTKVMSAETAYMMTDMMKAVMSYGYGLNASVSGVPMAGKTGTSNYTDSETDTILASIPEANYSYMVVPDENFVGYSSQYAMAVWTGYTNRMTPILDNSMRIATDVYHNMMLFMHSDYTATDWEMPSGLVRYGSNYYLRGSRSLSNAYNTYTSSSTSSSSSTETSETTEATTTSSETSSGTATETATSSTETATTGNNPATGQTDGQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_012926_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_012926_2

1825030-1825153

Orphan

Consensus_repeat	Method
CCAATCAACCACTACTGCGCTAAGATGTTGAC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_012926_2

>merge|NC_012926|2|1825030-1825153|CRISPRCasFinder
CCAATCAACCACTACTGCGCTAAGATGTTGACACTAACGTTGAGAAGCGGTACAGGGCTTGAGCCCAGCTTCACTCCACTGGACTGTTAAACCCAATCAACCACTACTGCGCTGAGATGTTGAC

>NC_012926|2|1|1825030-1825153|CRISPRCasFinder
CCAATCAACCACTACTGCGCTAAGATGTTGAC	ACTAACGTTGAGAAGCGGTACAGGGCTTGAGCCCAGCTTCACTCCACTGGACTGTTAAAC
CCAATCAACCACTACTGCGCTGAGATGTTGAC

Protein	Signature genes	Signature genes Name	Protein_function
NC_012926.1\|WP_012027759.1\|1813477_1814419_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224048
NC_012926.1\|WP_009910803.1\|1833475_1834498_-\|ketol-acid-reductoisomerase	unknown	unknown	gnl\|CDD\|235491
NC_012926.1\|WP_012775335.1\|1829866_1830610_+\|amino-acid-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224051
NC_012926.1\|WP_009910800.1\|1830735_1830945_-\|hypothetical-protein	unknown	unknown	unknown
NC_012926.1\|WP_002938143.1\|1812519_1813476_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223674
NC_012926.1\|WP_009910805.1\|1834638_1835115_-\|acetolactate-synthase-small-subunit	unknown	unknown	gnl\|CDD\|183365
NC_012926.1\|WP_002938165.1\|1824000_1824774_-\|Fe-S-cluster-assembly-ATPase-SufC	unknown	unknown	gnl\|CDD\|223473
NC_012926.1\|WP_012775689.1\|1815805_1817596_-\|oligopeptide-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173875
NC_012926.1\|WP_012775692.1\|1831942_1833193_-\|threonine-ammonia-lyase-IlvA	unknown	unknown	gnl\|CDD\|236318
NC_012926.1\|WP_012027769.1\|1825326_1826499_-\|undecaprenyl/decaprenyl-phosphate-alpha-N-acetylglucosaminyl-1-phosphate-transferase	unknown	unknown	gnl\|CDD\|133463
NC_012926.1\|WP_012027766.1\|1821494_1822718_-\|cysteine-desulfurase	unknown	unknown	gnl\|CDD\|131034
NC_012926.1\|WP_012027770.1\|1827345_1828182_-\|undecaprenyl-diphosphate-phosphatase	unknown	unknown	gnl\|CDD\|234712
NC_012926.1\|WP_012775333.1\|1822721_1823984_-\|Fe-S-cluster-assembly-protein-SufD	unknown	unknown	gnl\|CDD\|223791
NC_012926.1\|WP_012775691.1\|1821067_1821508_-\|SUF-system-NifU-family-Fe-S-cluster-assembly-protein	unknown	unknown	gnl\|CDD\|273918
NC_012926.1\|WP_012775690.1\|1817808_1819050_+\|D-alanyl-D-alanine-carboxypeptidase	unknown	unknown	gnl\|CDD\|224600
NC_012926.1\|WP_012028491.1\|1828308_1829874_+\|ABC-transporter-substrate-binding-protein/permease	unknown	unknown	gnl\|CDD\|270345
NC_012926.1\|WP_002938151.1\|1819302_1820718_-\|Fe-S-cluster-assembly-protein-SufB	unknown	unknown	gnl\|CDD\|131035
NC_012926.1\|WP_012775334.1\|1826495_1827218_-\|adaptor-protein-MecA	unknown	unknown	gnl\|CDD\|235030
NC_012926.1\|WP_012775688.1\|1814421_1815420_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|223521
NC_012926.1\|WP_012027774.1\|1831030_1831933_-\|SPFH-domain-containing-protein	unknown	unknown	gnl\|CDD\|259805

Protein	Function_ID	Function_description	E-value
NC_012926.1\|WP_012027759.1\|1813477_1814419_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224048	COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only].	2.10004e-119
NC_012926.1\|WP_009910803.1\|1833475_1834498_-\|ketol-acid-reductoisomerase	gnl\|CDD\|235491	PRK05479, PRK05479, ketol-acid reductoisomerase; Provisional.	0
NC_012926.1\|WP_012775335.1\|1829866_1830610_+\|amino-acid-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224051	COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism].	7.30548e-147
NC_012926.1\|WP_002938143.1\|1812519_1813476_-\|ABC-transporter-permease	gnl\|CDD\|223674	COG0601, DppB, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	1.06681e-112
NC_012926.1\|WP_009910805.1\|1834638_1835115_-\|acetolactate-synthase-small-subunit	gnl\|CDD\|183365	PRK11895, ilvH, acetolactate synthase 3 regulatory subunit; Reviewed.	1.6123e-73
NC_012926.1\|WP_002938165.1\|1824000_1824774_-\|Fe-S-cluster-assembly-ATPase-SufC	gnl\|CDD\|223473	COG0396, sufC, Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones].	2.74827e-148
NC_012926.1\|WP_012775689.1\|1815805_1817596_-\|oligopeptide-ABC-transporter-substrate-binding-protein	gnl\|CDD\|173875	cd08510, PBP2_Lactococcal_OppA_like, The substrate binding component of an ABC-type lactococcal OppA-like transport system contains. This family represents the substrate binding domain of an ATP-binding cassette (ABC)-type oligopeptide import system from Lactococcus lactis and other gram-positive bacteria, as well as its closet homologs from gram-negative bacteria. Oligopeptide-binding protein (OppA) from Lactococcus lactis can bind peptides of length from 4 to at least 35 residues without sequence preference. The oligopeptide import system OppABCDEF is consisting of five subunits: two homologous integral membrane proteins OppB and OppF that form the translocation pore; two homologous nucleotide-binding domains OppD and OppF that drive the transport process through binding and hydrolysis of ATP; and the substrate-binding protein or receptor OppA that determines the substrate specificity of the transport system. The dipeptide (DppA) and oligopeptide (OppA) binding proteins differ in several ways. The DppA binds dipeptides and some tripeptides and also is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	0
NC_012926.1\|WP_012775692.1\|1831942_1833193_-\|threonine-ammonia-lyase-IlvA	gnl\|CDD\|236318	PRK08639, PRK08639, threonine dehydratase; Validated.	0
NC_012926.1\|WP_012027769.1\|1825326_1826499_-\|undecaprenyl/decaprenyl-phosphate-alpha-N-acetylglucosaminyl-1-phosphate-transferase	gnl\|CDD\|133463	cd06853, GT_WecA_like, This subfamily contains Escherichia coli WecA, Bacillus subtilis TagO and related proteins. WecA is an UDP-N-acetylglucosamine (GlcNAc):undecaprenyl-phosphate (Und-P) GlcNAc-1-phosphate transferase that catalyzes the formation of a phosphodiester bond between a membrane-associated undecaprenyl-phosphate molecule and N-acetylglucosamine 1-phosphate, which is usually donated by a soluble UDP-N-acetylglucosamine precursor. WecA participates in the biosynthesis of O antigen LPS in many enteric bacteria and is also involved in the biosynthesis of enterobacterial common antigen. A conserved short sequence motif and a conserved arginine at a cytosolic loop of this integral membrane protein were shown to be critical in recognition of substrate UDP-N-acetylglucosamine.	9.66017e-81
NC_012926.1\|WP_012027766.1\|1821494_1822718_-\|cysteine-desulfurase	gnl\|CDD\|131034	TIGR01979, Probable_cysteine_desulfurase, cysteine desulfurases, SufSfamily. This model represents a subfamily of NifS-related cysteine desulfurases involved in FeS cluster formation needed for nitrogen fixation among other vital functions. Many cysteine desulfurases are also active as selenocysteine lyase and/or cysteine sulfinate desulfinase. This subfamily is associated with the six-gene SUF system described in E. coli and Erwinia as an FeS cluster formation system during oxidative stress. The active site Cys is this subfamily resembles GHHC with one or both His conserved. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other].	0
NC_012926.1\|WP_012027770.1\|1827345_1828182_-\|undecaprenyl-diphosphate-phosphatase	gnl\|CDD\|234712	PRK00281, PRK00281, undecaprenyl-diphosphate phosphatase.	1.49616e-101
NC_012926.1\|WP_012775333.1\|1822721_1823984_-\|Fe-S-cluster-assembly-protein-SufD	gnl\|CDD\|223791	COG0719, SufB, Cysteine desulfurase activator SufB [Posttranslational modification, protein turnover, chaperones].	4.97321e-124
NC_012926.1\|WP_012775691.1\|1821067_1821508_-\|SUF-system-NifU-family-Fe-S-cluster-assembly-protein	gnl\|CDD\|273918	TIGR01994, Iron-sulfur_cluster_assembly_scaffold_protein_IscU, SUF system FeS assembly protein, NifU family. Three iron-sulfur cluster assembly systems are known so far. ISC is broadly distributed while NIF tends to be associated with nitrogenase in nitrogen-fixing bacteria. The most recently described is SUF, believed to be important to maintain the function during aerobic stress of enzymes with labile Fe-S clusters. It is fairly widely distributed. This family represents one of two different proteins proposed to act as a scaffold on which the Fe-S cluster is built and from which it is transferred. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other].	1.35279e-67
NC_012926.1\|WP_012775690.1\|1817808_1819050_+\|D-alanyl-D-alanine-carboxypeptidase	gnl\|CDD\|224600	COG1686, DacC, D-alanyl-D-alanine carboxypeptidase [Cell envelope biogenesis, outer membrane].	6.03184e-91
NC_012926.1\|WP_012028491.1\|1828308_1829874_+\|ABC-transporter-substrate-binding-protein/permease	gnl\|CDD\|270345	cd13627, PBP2_AA_binding_like_2, Substrate-binding domain of putative amino acid-binding protein; the type 2 periplasmic-binding protein fold. This putative amino acid-binding protein belongs to the type 2 periplasmic-binding fold protein (PBP2) superfamily, whose members are involved in chemotaxis and uptake of nutrients and other small molecules from the extracellular space as a primary receptor. PBP2 typically comprises of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two receptor cytoplasmically-located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.18368e-91
NC_012926.1\|WP_002938151.1\|1819302_1820718_-\|Fe-S-cluster-assembly-protein-SufB	gnl\|CDD\|131035	TIGR01980, UPF0051_protein_slr0074, FeS assembly protein SufB. This protein, SufB, forms a cytosolic complex SufBCD. This complex enhances the cysteine desulfurase of SufSE. The system, together with SufA, is believed to act in iron-sulfur cluster formation during oxidative stress. Note that SufC belongs to the family of ABC transporter ATP binding proteins, so this protein, encoded by an adjacent gene, has often been annotated as a transporter component. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other].	0
NC_012926.1\|WP_012775334.1\|1826495_1827218_-\|adaptor-protein-MecA	gnl\|CDD\|235030	PRK02315, PRK02315, adaptor protein MecA.	2.58092e-83
NC_012926.1\|WP_012775688.1\|1814421_1815420_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|223521	COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	3.12901e-160
NC_012926.1\|WP_012027774.1\|1831030_1831933_-\|SPFH-domain-containing-protein	gnl\|CDD\|259805	cd03407, SPFH_like_u4, Uncharacterized family; SPFH (stomatin, prohibitin, flotillin, and HflK/C) superfamily. This model summarizes an uncharacterized family of proteins similar to stomatin, prohibitin, flotillin, HflK/C (SPFH) and podocin. The conserved domain common to the SPFH superfamily has also been referred to as the Band 7 domain. Many superfamily members are associated with lipid rafts. Individual proteins of the SPFH superfamily may cluster to form membrane microdomains which may in turn recruit multiprotein complexes. Microdomains formed from flotillin proteins may in addition be dynamic units with their own regulatory functions. Flotillins have been implicated in signal transduction, vesicle trafficking, cytoskeleton rearrangement and are known to interact with a variety of proteins. Stomatin interacts with and regulates members of the degenerin/epithelia Na+ channel family in mechanosensory cells of Caenorhabditis elegans and vertebrate neurons and participates in trafficking of Glut1 glucose transporters. Prohibitin may act as a chaperone for the stabilization of mitochondrial proteins. Prokaryotic HflK/C plays a role in the decision between lysogenic and lytic cycle growth during lambda phage infection. Flotillins have been implicated in the progression of prion disease, in the pathogenesis of neurodegenerative diseases such as Parkinson's and Alzheimer's disease and, in cancer invasion and metastasis. Mutations in the podocin gene give rise to autosomal recessive steroid resistant nephritic syndrome.	3.71678e-128

>NC_012926.1|WP_002938165.1|1824000_1824774_-|Fe-S-cluster-assembly-ATPase-SufC
MSVLEIKDLHVEIEGKEILKGVNLTLKTGEIAAIMGPNGTGKSTLSAAIMGNPSYEVTQGEILFDGVNILELEVDERARMGLFLAMQYPSEIPGITNAEFLRAAMNAGKEDEDKISVRDFITKLDEKMELLNMKEEMAERYLNEGFSGGEKKRNEILQLLMLEPTFALLDEIDSGLDIDALKVVSKGINAMRGEGFGAMIITHYQRLLNYITPDVVHVMMEGRVVLSGGPELAQRLEKEGYVQVAAELGIDYKEDDI
>NC_012926.1|WP_012775333.1|1822721_1823984_-|Fe-S-cluster-assembly-protein-SufD
MTKEKIQEFSALQAEPTWLTDLRLKAFDKIAELDLPVIERVKFHRWNLGDGSLATNDEIGAVPDFTAIGDNPMLVQVGSQTILEQLPVALVEKGVVFTDFASAMDVIPDVLEKYLGAAVAYDEHKLAAYNTAYFNATAVLYVPDNVEIDQPVEALFYQDSTSPVAFNKRVLIIAGKNAKLNYLERFESLGDGAATTSANIVVEVIALAGSQIKFAAIDRLGKHLDTYLNRRGYLGNDATIDWAIGLLNEGNVVADLDSELKGNGSHANLKVVGLSSGRQVQGVDTRVTNYGHNSVGHILQHGVILESGTLTFNGIGHIVRGAKGADAQQESRVLMLSDKARSDANPILLIDENEVTAGHAASIGQVDPEDMYYLMSRGLDRATAERLVVRGFLGSVITEIPVKEVRDQLIAVIEEKLTKR
>NC_012926.1|WP_012027766.1|1821494_1822718_-|cysteine-desulfurase
MDLERIRKEFSILDQVVNDEPLVYLDNAATTQKPQQVLDVLADYYQKDNANVHRGVHTLSERATTRYEAARQKVADFIQAKSSKEILFTRGTTTSLNWVAQFAKEILQPDQEVIISVQEHHSNIIPWQQACQQTGAKLRYVTLKDGELDMDHLRSLLSSKTKFVSLAHVSNVLGGVVPIGEIAELVHQVGAYLVVDGAQSVPHMGVNVQELDVDFYAFSGHKMLGPTGIGILYGKEELLNLMSPVEFGGEMIDFVYEQSATWKELPWKFEAGTPNIAGAIGLGAAIDYLTEIGMDAIQAHEAELVDYVFPKLQAIPGLTIYGSQDLSKRTGVIAFNLDDLHPHDVATALDYEGVAVRAGHHCAQPLLRYLQVPATVRASFYIYNTKADCDKLVEAIIKTKEFFNGPI
>NC_012926.1|WP_012775691.1|1821067_1821508_-|SUF-system-NifU-family-Fe-S-cluster-assembly-protein
MALSRLDSLYMAVVSEHSKSPRHRGSLDGVEKLELHNPTCGDVIELSVKIEKDVITDIAFDGVGCTISTASASMMTEAVLGKEISQIQELAEIFSQMVRGQEDPRQKELGDASLLAGVAKFPQRIKCATLPWNALKKALERSDSAE
>NC_012926.1|WP_002938151.1|1819302_1820718_-|Fe-S-cluster-assembly-protein-SufB
MSEERIEPTPIDLGEYKFGFHDENVELVASTGKGLNEEVIREMSRIKGEPEWMLEFRLKSYETFKKMPMQTWGADLSELDFDDIVYYQKPSDKPARSWDDVPDKIKETFERIGIPEAERAYLAGASAQYESEVVYHNMKEEYDKHGIIFTDTDTALKEHPELFKKYFGKLVPPSDNKLAALNSAVWSGGTFIYVPKGVKLDIPLQTYFRINNEGTGQFERTLIIVDEGASVHYVEGCTAPTYSTASLHAAIVEIIAHEGAYMRYTTIQNWSDNVYNLVTKRARAEKNATVEWIDGNLGAKTTMKYPAVYLEGEGARGTMLSIAFANKGQVQDTGAKMIHNAPRTSSSIVSKSIARGGGEVNYRGQVTFAKNSAKSISHIECDTIIMDDISKSDTIPFNEIHNSQVALEHEAKVSKISEEQLYYLMSRGLSESEATEMIVMGFVEPFTKELPMEYAVELNRLIAYEMEGSVG
>NC_012926.1|WP_012775690.1|1817808_1819050_+|D-alanyl-D-alanine-carboxypeptidase
MRKLLLTLTTILAVFLTSTPILAEDFSVAAKHAIAVEVSSGKILYEQDAETKASIASISKTLSIYLVYEALAKGEITLDTMVDISDYPYSLTSNTELSNVNLDERSYSVRDLLNASLITSSNSAIIALAEKIAGSEAAFVDRMKAKVQEWGITDTKIVNVSGLDNTDLGENIYPSSSPEDVNMFSALDVAIIARRLILDYPQVLDITSLNAYDFGGYTYYSTNQMLSDGTHARGGVDGLKTGTSNSAGSSFLATTQQAGMRIITVVLNANDGLTSPENRFVATNDLMNYVYSNFSLVTLVKKSEAFGDSKIKVFNGEKETSPVVAAADLTVVQRNQTDNVPTATFTTDIKEIDAPLKAGTLVSKLQLKDQDLIGKGYISEQTGVDMIIPSDMKEASWPFSWWNQFVRYVNEKL
>NC_012926.1|WP_012775689.1|1815805_1817596_-|oligopeptide-ABC-transporter-substrate-binding-protein
MKKTTKLFALAGVTLLSASVLAACGSKQSGAAKQELSFPAEVKQDGTAVADAQLKYAWVSPTTSSGLLIDELTENTTDSTFGGMVDILMFGYDGERKLDDSGLAKAEFDVKGKKITVSLTGKDYKWSDGEPFTINDYIFTIKSMASKDYTGIRFDDKFLNIEGMQEFVDGKASDISGIKKVDDYTVELTVKEMSPSMMYAGGDVPAYIQPEHIYKDIPVADWEKSEYSRTAKLVGMGPWKIKEIVNGESITYVPNEYFFKGTKPKTSSLKIDIVSPDTIVSEMKAGNYDIAEMPVDQLDSYKDASNLNIVGQLESSYEYISFNFGKYDEAAGKNVMDENAKMNDVKLRQAIAYAIDTKTAGKSLYNGLYHPAKSLIISFFGDIHDSELEGYSYNPEKAKKLLDEAGYKDVDGDGIREGKDGKAFKITFAARKRTEANEALVQQYIAWWKEVGLNVELYTGRTVEGKSFYNSVQANDAAIDMYAGGWSTGYDPNPSGLWGPIAAFNMSRFVSDENTKLLEAISSAESFDDKKNVENYKAWQKYAHEQAFAIPTFESEKITAVNKRVKSYDTKYGSASGTGLAYEGIELTADKGVVAE
>NC_012926.1|WP_012775688.1|1814421_1815420_-|ABC-transporter-ATP-binding-protein
MATEKPLLDIKDLHVGFRIGDDYFDAVDGVDISLQKNEILAIVGESGCGKSTLATTIMGLHNPLNTKITGSIQYNDMELMGMDEAKYNTVRGNDIGMIFQDPLASLNPLMTIGAQIDEALFYHTDLDANARTERVLELLAQVGIPNPKRTFKQYPHELSGGMRQRIIIAMALSCKPPIIIADEPTTALDVTIQAQILDLLNDIQAETGSGIILITHDLGVVAETADRVAVMYGGQFVEVAPVEELFTNPKHPYTRSLLKSNPQSGSEGGDLHVIEGIVPPITKMVRKGCRFAPRIPWIGAEAHEENPSMHEVGPNHFVRCTCHETFYFEGEA
>NC_012926.1|WP_012027759.1|1813477_1814419_-|ABC-transporter-ATP-binding-protein
MGFIEVKDLKVHYPIRSGFFNRVTDHVYAVDGVNIEFEEGKTYGLVGESGSGKSTIGKAIIGLERATSGQIIYEGQDVTNKSRGKKGNFNRDVQMIFQDSLSSFNPKKRILDIIAEPIRNFDRLSPDEEKKKVLQLLDTIGLNEEALIKYPHEFSGGQRQRIGVARALASNPRLIIADEPVSALDLSVQAQVLNYMKRIQDEFKLSYLFISHDLGVVQHMCDELFIMYRGRFVETGNKNDIYNNPQHIYTKRLLSAIPTIDPLNRLKNKEKRLAAEKEYQEMQGQYYDENGRVYDLRSFSETHQVALPEGGQN
>NC_012926.1|WP_002938143.1|1812519_1813476_-|ABC-transporter-permease
MWKTVLRRLLMMIPQIIILSVIAFFVAKMMPGDPFTGLIDPNIDPAIIEQKRIAAGYYDPIPVQYFRWVGNLLQGDFGQSVIFKQPVVDVIMQRLNNTIGLSLLTMVLTYLIALPLGMIAGRYQNSLADKIIGVYNFLTFSTPTFVFAILMLWMFGFSLGWFPTRGSISGGVEGFAATLSRLHHMILPAITMAILSTTVTIQYLRTGIIDAKSQDYVRTARAKGVPERVVYNRHIFRNSILPIASFLGYELTGLIGGSIFIENIFTYPGIGQLFFNSISSRDYSVILALLLVFGMGTLLGTLISDIIMSIVDPRIRVK
>NC_012926.1|WP_012027769.1|1825326_1826499_-|undecaprenyl/decaprenyl-phosphate-alpha-N-acetylglucosaminyl-1-phosphate-transferase
MIPFALKYIMVIITTMVISAIATPLVRFMSLRVGAVDNPNARRINKVPMPSAGGLAIFVAFTISVLWFLPGIVTRVNYHGTYLHYIWPLVLASSIIVLTGFIDDVKELKPAPKMFGILAAATIIWIFTEFRFDSFKIPFGGPFLQFPVWLSFLLTVLWIVSITNAVNLIDGLDGLVSGVSIISLTTMGIVSYFFLHDSNIFLTLTIFVLVAAIVGFLPYNYNPAIIYLGDTGALFIGFMIGVLSLQGLKNSTAVAVVTPMIILGVPITDTVVAIIRRKLSGQKIYEADKMHLHHRLLSLGLTHRGTVLVIYAISFLFSLTSLLLNVSSRIGGILLLVTMGLGIEILCELIGIFGINRTPLLNLLRFIGNSSYRQEKIAKYKKCCEEKKRK
>NC_012926.1|WP_012775334.1|1826495_1827218_-|adaptor-protein-MecA
MKVKQISDSTLKITIKLDDLEERGMELSDFLIPQEKTEEFFYTVLDELDLPMTFRESGMLSFRVTPKPDRVDIFVTKSDLDQNLNFDEFTDLSELGDVASMTPDEFFKSLEQTVREKSAPDATAVRHLEEVEQEEEADEEEQERYIYYILEFPTIEDLFTFVGTVDYPVEESELYKMDGHYYLTVLINVENRSKQYPGYILSRMLEFTNDTKLTRPALQEHGTLMLPLAAIEELRKVPTV
>NC_012926.1|WP_012027770.1|1827345_1828182_-|undecaprenyl-diphosphate-phosphatase
MLLELLKAIFLGIIEGVTEWLPVSSTGHLILVQEFVKLNQSKNFLEMFNIVIQLGAILAVMTIYFKKLNPFQPGKTKRDIQLTWQLWAKVVIACIPSILIAVPLDNWFEAHFNFMVPIAIALIVYGIAFIWIENRNRGIEPQVTDLAKMSYKTALLIGCFQVLSIVPGTSRSGATILGAIILGTSRSVAADFTFFLGIPTMFGYSGLKAVKYFLDGNSLNMEQVWILLVASVTAYLVSLVVIRFLTDFVKKHDFTVFGYYRIILGAILLVYAFITFLF
>NC_012926.1|WP_012028491.1|1828308_1829874_+|ABC-transporter-substrate-binding-protein/permease
MKRKLSIFLLTLIAVFSVTTGVRADEYLRVGMEAAYAPFNWTQEDDSNSAVPIEGTNQFANGYDVQVAKKIAASMDKELLVVKTKWEGLVPALTSGKIDMIIAGMSPTEERKKEIAFSDSYYTSIPTLVVRSDSQYANATSLEDFAGAKITAQQGVYLYDLIDQIEGANKQTAMGDFSQIRQALESGIIDAYVSERPEGRTAEAANKAFKMVELADSFETNAEDVTIAVGMRKDDERIAQVNEVLATISEEEQIALMDDMIENQPVEEASEGETPSFFAQVWNIVVNNWQQLLRGTGMTLLISILGTIIGTAIGLLIGVFRTAPKAANKALAIGQKVLGWIINIYIEIFRGTPMIVQSMVIYYGTAQAFGLNLDRTLAAIFIVSINTGAYMSEIVRGGIFAVDKGQFEAATALGFTHNQTMRKIVLPQVIRNILPATGNEFVINIKDTSVLNVISVVELYFSGNTVATQTYQYFQTFTVIAIIYFILTFTVTRILRAVEKYFDTDTYTTGANQMQVEVPHD
>NC_012926.1|WP_012775335.1|1829866_1830610_+|amino-acid-ABC-transporter-ATP-binding-protein
MTKNVILEIKNLKKSYGQNQVLKDISISVEKGEVISIIGSSGSGKSTFLRSINLLETPTEGQILYHGQDVLAKGYDLTTYREKLGMVFQSFNLFNNLNVLENAIVAQTTVLKRDRAEAEKIAKENLNKVGMTEQYWQAKPSQLSGGQKQRVAIARALSVDPEVILFDEPTSALDPEMVGEVLKTMQDLAKSGLTMLIVTHEMEFARDVSDRVIFMDKGVIAEEGSPQQIFENPQEERTREFLQRFLG
>NC_012926.1|WP_009910800.1|1830735_1830945_-|hypothetical-protein
MTSYEKVAAVVGWVREKKITGYRISKETNAREMSVIALAQGRAKIDNISFATALGLIDFYDKNHKKFEN
>NC_012926.1|WP_012027774.1|1831030_1831933_-|SPFH-domain-containing-protein
MVFGPIVFIGSFLFFVLIALILIASGLYVVKQQTVAIIERFGKYQKTSTSGINFKIPFGVDVIAARIQLRMLQSEIVVETKTQDNVFVTMNVATQYRVNENNVTDAYYKLMHPEAQIKSYIEDALRSSVPKLTLDELFEKKDEIALEVQKQVAEEMSTYGYVIVKTLITKVEPDAEVKQSMNEINAAQRKRVAAQELAEADKIKIVTAAEAEAEKDRLHGVGIAQQRKAIVDGLADSIRELKESNVSLSEEQIMSILLTNQYLDTLNNFAQGGNQTIFLPGNPEGVEDIRTQILSSLRAK
>NC_012926.1|WP_012775692.1|1831942_1833193_-|threonine-ammonia-lyase-IlvA
MITAKNVEQAYSVLKRVVVRTPLDYSRYLSEKYGATIYLKRENEQRVRSFKIRGAYYAISQLTDDEKSRGVVCASAGNHAQGVAYTCQEMQIPATIFIPITTPQQKIGQVKFFGGDYVEIRLVGDTFDESAKAAQDYTQESGKTFIDPFDDENVQAGQGTVAYEILEEAEEQTISFDQILVPIGGGGLVAGVSAYLKEHAPEIKIVGVEASGARSMKAAFDKGRPVKLDQIDKFADGIAVQKVGKSTYEVARKYVDRLIGVDEGWISGTILDLYSKLGIVAEPAGAATIAALEVVKDQIKGQTICCIISGGNNDINRMPEMEERALIYEGIKHYFVVNFPQRPGALREFVNDILGPNDDITRFEYIKRANKGTGPVLIGIALGDKTDYTQFISRLEEFDPQYINLHENDSLYKMLV
>NC_012926.1|WP_009910803.1|1833475_1834498_-|ketol-acid-reductoisomerase
MTVTMQYEKDVTVAALDGKRIAVIGYGSQGHAHAQNLRDTGHDVIIGVRAGKSFDKAKEDGFETFEVAEAAKQADVIMILAPDEIQADLYNEEIAPNLEAGNALGFAHGFNVHFEFIKVPADVDVFMCAPKGPGHLVRRTFEEGFGVPALYAVYQDATGNAKHIAMDWAKGVGSARVGLLETTFKEETEEDLFGEQAVLCGGLTALMQAGFEVLTEAGYAPELAYFEVLHEMKLIVDLVYEGGFKKMRQSISNTAEFGDYVSGPRVITDQVKENMKAVLADIQSGKFANDFVNDYKAGRPRMEAYRKEAENLEIEKVGAELRKAMPFVGRNDDDAFKIYN
>NC_012926.1|WP_009910805.1|1834638_1835115_-|acetolactate-synthase-small-subunit
MRRMLTAKLRNSSGVLNRFTGVLSRRQINIESISVGPTEVDGISRVTVIVDVVSHDEVEQIIKQLNRLIDVVRVRDLTDIPHLEREVILVKISAPPTKRAEILAIIQPFRANVVDVAPHSITIQMTGDGDKIDALLRVIQPYGIKNIARTGATGFSRD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

31436 : 41698

Microbacterium_phage(16.67%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012775466.1\|31436_35156_+	phosphoribosylformylglycinamidine synthase	A6N228	Microbacterium_phage	8.6e-39	26.9
WP_011921648.1\|35158_36613_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	3.2e-58	35.4
WP_012774882.1\|36668_37691_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A127KMF9	Cyanophage	1.3e-58	42.7
WP_011922533.1\|37687_38239_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	3.6e-26	38.5
WP_011921652.1\|38248_39796_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	2.6e-74	47.6
WP_011921653.1\|39921_41184_+	phosphoribosylamine--glycine ligase	NA	NA	NA	NA
WP_011921654.1\|41209_41698_+	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	2.7e-17	45.0

DBSCAN-SWA_2

535570 : 553093

Streptococcus_phage(100.0%)

integrase

attL 533140:533171|attR 554459:554490

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
533140:533171	attL	NA	NA	NA	NA
WP_001291561.1\|535570_536788_-\|integrase	tyrosine-type recombinase/integrase	A0A1S5SEW7	Streptococcus_phage	3.7e-233	100.0
WP_000814511.1\|536869_537073_-	excisionase	A0A1S5SF07	Streptococcus_phage	4.0e-31	100.0
WP_000857133.1\|537533_537764_-	helix-turn-helix domain-containing protein	A0A1S5SEX1	Streptococcus_phage	2.7e-36	100.0
WP_000804885.1\|537760_538183_-	sigma-70 family RNA polymerase sigma factor	A0A1S5SEW0	Streptococcus_phage	2.5e-72	100.0
WP_001227347.1\|538687_539041_+	helix-turn-helix domain-containing protein	A0A1S5SFA6	Streptococcus_phage	1.3e-58	100.0
WP_000336323.1\|539100_539268_-	cysteine-rich KTR domain-containing protein	D0R0F6	Streptococcus_phage	1.6e-14	68.0
WP_002371500.1\|539386_541306_-	tetracycline resistance ribosomal protection protein Tet(M)	A0A1S5SF82	Streptococcus_phage	0.0e+00	99.2
WP_001791010.1\|541321_541438_-	tetracycline resistance determinant leader peptide	NA	NA	NA	NA
WP_001224318.1\|541682_542615_-	conjugal transfer protein	A0A1S5SF22	Streptococcus_phage	3.1e-171	99.4
WP_000769868.1\|542611_543613_-	lysozyme family protein	A0A1S5SEZ8	Streptococcus_phage	5.0e-191	100.0
WP_000804748.1\|543609_545787_-	membrane protein	A0A1S5SF30	Streptococcus_phage	0.0e+00	100.0
WP_000331160.1\|545789_548237_-	ATP-binding protein	A0A1S5SF64	Streptococcus_phage	0.0e+00	100.0
WP_000506270.1\|548220_548727_-	conjugal transfer protein	A0A1S5SEX7	Streptococcus_phage	8.6e-91	100.0
WP_000342539.1\|548701_549199_-	antirestriction protein ArdA	A0A1S5SF25	Streptococcus_phage	1.7e-91	100.0
WP_001009056.1\|549315_549537_-	hypothetical protein	A0A1S5SEY0	Streptococcus_phage	4.3e-31	100.0
WP_000398284.1\|549579_550785_-	replication initiation factor domain-containing protein	A0A1S5SEX3	Streptococcus_phage	2.8e-233	100.0
WP_000879507.1\|550807_550960_-	hypothetical protein	NA	NA	NA	NA
WP_000813488.1\|550962_552348_-	DNA translocase FtsK	A0A1S5SFB5	Streptococcus_phage	1.1e-265	100.0
WP_000985015.1\|552376_552763_-	YdcP family protein	A0A1S5SF96	Streptococcus_phage	3.0e-64	100.0
WP_000420682.1\|552778_553093_-	YdcP family protein	A0A1S5SF38	Streptococcus_phage	5.2e-54	100.0
554459:554490	attR	NA	NA	NA	NA

DBSCAN-SWA_3

664268 : 670049

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012027304.1\|664268_665030_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.0e-34	38.4
WP_004298854.1\|665223_665928_+	response regulator transcription factor	W8CYM9	Bacillus_phage	1.1e-38	39.8
WP_012027301.1\|665920_667270_+	cell wall metabolism sensor histidine kinase VicK	W8CYF6	Bacillus_phage	2.1e-35	34.5
WP_012027300.1\|667276_668080_+	MBL fold metallo-hydrolase	A0A0C5AJ83	Bacteriophage	2.8e-35	35.6
WP_014735627.1\|668335_668608_+	hypothetical protein	NA	NA	NA	NA
WP_012027299.1\|668594_669137_+	ATP-binding cassette domain-containing protein	A0A2I4R674	Erysipelothrix_phage	5.9e-21	35.1
WP_012027298.1\|669299_670049_+	ABC-F family ATP-binding cassette domain-containing protein	A0A1B0RXA0	Streptococcus_phage	3.4e-27	32.9

DBSCAN-SWA_4

1031088 : 1039655

Streptococcus_phage(88.89%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002321849.1\|1031088_1031826_+	23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B)	E4ZFQ0	Streptococcus_phage	3.7e-135	100.0
WP_073459356.1\|1031971_1032256_+	topoisomerase DNA-binding C4 zinc finger domain-containing protein	A0A1X9I6W8	Streptococcus_phage	2.3e-40	93.0
WP_001140406.1\|1032297_1032672_+	TnpV protein	A0A1B0RXG6	Streptococcus_phage	2.0e-68	100.0
WP_012775603.1\|1033038_1034958_+	tetracycline resistance ribosomal protection protein Tet(O)	A0A1B0RXH7	Streptococcus_phage	0.0e+00	99.5
WP_079394308.1\|1035009_1035198_+	cysteine-rich KTR domain-containing protein	D0R0F6	Streptococcus_phage	2.7e-18	90.9
WP_002294505.1\|1035370_1036234_-	aminoglycoside nucleotidyltransferase ANT(6)-Ia	A0A1X9I6F2	Streptococcus_phage	8.7e-168	100.0
WP_012775604.1\|1036266_1036950_-	class I SAM-dependent methyltransferase	A0A1X9I6N4	Streptococcus_phage	3.9e-131	100.0
WP_012775605.1\|1037076_1037550_-	dihydrofolate reductase	A0A0N9S8H6	Staphylococcus_phage	5.1e-21	35.8
WP_012775606.1\|1037652_1038678_-\|transposase	IS1595-like element ISSsu9 family transposase	NA	NA	NA	NA
WP_012775607.1\|1038785_1039655_-	nucleotidyltransferase domain-containing protein	A0A1X9I6C9	Streptococcus_phage	8.8e-152	90.3

DBSCAN-SWA_5

1047761 : 1057636

Streptococcus_phage(88.89%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012775114.1\|1047761_1049579_+	ATP-dependent helicase	G3MA40	Bacillus_virus	7.5e-12	21.0
WP_012775608.1\|1050334_1050649_+	YdcP family protein	A0A1S5SF38	Streptococcus_phage	6.8e-54	99.0
WP_000985015.1\|1050664_1051051_+	YdcP family protein	A0A1S5SF96	Streptococcus_phage	3.0e-64	100.0
WP_012775609.1\|1051079_1052462_+	DNA translocase FtsK	A0A1S5SFB5	Streptococcus_phage	3.0e-263	99.3
WP_000398284.1\|1052640_1053846_+	replication initiation factor domain-containing protein	A0A1S5SEX3	Streptococcus_phage	2.8e-233	100.0
WP_001009056.1\|1053888_1054110_+	hypothetical protein	A0A1S5SEY0	Streptococcus_phage	4.3e-31	100.0
WP_000342539.1\|1054226_1054724_+	antirestriction protein ArdA	A0A1S5SF25	Streptococcus_phage	1.7e-91	100.0
WP_000506270.1\|1054698_1055205_+	conjugal transfer protein	A0A1S5SEX7	Streptococcus_phage	8.6e-91	100.0
WP_000331160.1\|1055188_1057636_+	ATP-binding protein	A0A1S5SF64	Streptococcus_phage	0.0e+00	100.0

DBSCAN-SWA_6

1128693 : 1135723

Bacillus_phage(33.33%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002943192.1\|1128693_1130526_-	elongation factor 4	A0A2K9L2P9	Tupanvirus	2.2e-19	38.8
WP_012775626.1\|1130807_1131479_-	membrane protein	A0A1S5SAM6	Streptococcus_phage	3.0e-06	35.2
WP_012028095.1\|1131582_1131996_-	nucleoside-diphosphate kinase	D2E8E1	Anguillid_herpesvirus	4.3e-24	42.5
WP_012775089.1\|1132018_1132606_-	YihA family ribosome biogenesis GTP-binding protein	NA	NA	NA	NA
WP_002934974.1\|1132661_1133888_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.2e-133	59.2
WP_002934972.1\|1133909_1134083_-	hypothetical protein	NA	NA	NA	NA
WP_011922360.1\|1134085_1134598_-	dihydrofolate reductase	A0A076GDN3	Bacillus_phage	1.6e-20	36.6
WP_011922359.1\|1134883_1135723_-	thymidylate synthase	U5J9N5	Bacillus_phage	1.7e-88	55.7

DBSCAN-SWA_7

1286821 : 1302166

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012775042.1\|1286821_1287649_+	exodeoxyribonuclease III	M1PSC0	Streptococcus_phage	2.9e-152	100.0
WP_011922204.1\|1287835_1288735_+	cation transporter	M1Q1N9	Streptococcus_phage	5.1e-163	99.7
WP_002935368.1\|1288751_1289105_-	arsenate reductase family protein	M1PLC0	Streptococcus_phage	1.9e-60	100.0
WP_011922203.1\|1289088_1289595_-	methylated-DNA--[protein]-cysteine S-methyltransferase	M1PFU9	Streptococcus_phage	7.0e-93	97.0
WP_011922202.1\|1289597_1290779_-	phosphoglycerate dehydrogenase	M1NSB9	Streptococcus_phage	7.8e-220	99.7
WP_011922201.1\|1290832_1291390_-	GNAT family acetyltransferase	M1PSC3	Streptococcus_phage	5.9e-93	94.6
WP_011922200.1\|1291389_1292481_-	3-phosphoserine/phosphohydroxythreonine transaminase	M1Q1P2	Streptococcus_phage	2.4e-207	100.0
WP_002935362.1\|1292950_1293814_-	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	2.1e-158	99.7
WP_012775637.1\|1293815_1294133_-	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	5.2e-54	99.0
WP_012775638.1\|1294152_1295037_-	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	4.3e-154	99.0
WP_012775041.1\|1295033_1295672_-	dTMP kinase	M1PSC7	Streptococcus_phage	1.0e-112	98.1
WP_002935357.1\|1295846_1296713_+	YitT family protein	M1Q1P6	Streptococcus_phage	4.6e-153	99.7
WP_012775639.1\|1296749_1298021_-	toxic anion resistance protein	M1PLC8	Streptococcus_phage	3.3e-208	98.3
WP_011922194.1\|1298026_1298854_-	hypothetical protein	M1PFV6	Streptococcus_phage	1.0e-133	98.5
WP_011922763.1\|1298947_1299604_-	CBS domain-containing protein	M1NSC5	Streptococcus_phage	2.7e-113	98.6
WP_012775640.1\|1299928_1302166_-	DNA internalization-related competence protein ComEC/Rec2	M1PSD2	Streptococcus_phage	1.2e-99	96.7

DBSCAN-SWA_8

1383079 : 1396192

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012775429.1\|1383079_1383757_-	tyrosine-protein kinase	A0A1X9I5D6	Streptococcus_phage	8.1e-121	99.1
WP_011922111.1\|1383766_1384456_-	capsular polysaccharide biosynthesis protein CpsC	A0A1X9I5E1	Streptococcus_phage	1.3e-110	96.1
WP_012775020.1\|1384473_1385919_-	LCP family protein	A0A1X9I5X1	Streptococcus_phage	2.4e-226	99.5
WP_012775019.1\|1386023_1386758_-	peroxide stress protein YaaA	A0A1X9I5I0	Streptococcus_phage	1.5e-120	99.5
WP_011922108.1\|1386880_1388140_+	PLP-dependent aminotransferase family protein	A0A1X9I5H2	Streptococcus_phage	1.2e-239	98.8
WP_002938910.1\|1388238_1389090_-	DegV family protein	A0A1X9I5J4	Streptococcus_phage	1.3e-152	98.6
WP_011922106.1\|1389216_1389621_+	TetR/AcrR family transcriptional regulator	A0A1X9I6A2	Streptococcus_phage	3.2e-64	99.3
WP_011922105.1\|1389643_1390429_-	pyrroline-5-carboxylate reductase	A0A1X9I6T5	Streptococcus_phage	1.0e-130	95.4
WP_011922104.1\|1390438_1391677_-	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	1.0e-217	96.8
WP_011922103.1\|1391741_1392818_-	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	1.5e-193	99.2
WP_011922102.1\|1392977_1395491_-	bifunctional DnaQ family exonuclease/ATP-dependent helicase	A0A1X9I5C8	Streptococcus_phage	0.0e+00	98.5
WP_011922101.1\|1395553_1396192_+	MBL fold metallo-hydrolase	A0A1X9I5D3	Streptococcus_phage	1.0e-125	99.5

DBSCAN-SWA_9

1503702 : 1513765

Streptococcus_phage(90.0%)

integrase

attL 1495064:1495078|attR 1521175:1521189

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1495064:1495078	attL	NA	NA	NA	NA
WP_012775260.1\|1503702_1504245_-\|integrase	site-specific integrase	A0A1S5SCL7	Streptococcus_phage	1.1e-80	78.9
WP_014636468.1\|1504231_1504417_-	hypothetical protein	NA	NA	NA	NA
WP_012027449.1\|1504735_1506268_-	primase	A0A1X9I717	Streptococcus_phage	4.9e-105	42.3
WP_012027450.1\|1506282_1506855_-	hypothetical protein	NA	NA	NA	NA
WP_012027451.1\|1506847_1507048_-	hypothetical protein	NA	NA	NA	NA
WP_012775262.1\|1507059_1507263_-	membrane protein	A0A1X9I5T6	Streptococcus_phage	2.4e-20	73.1
WP_012027452.1\|1507283_1507601_-	hypothetical protein	A0A1X9I5Z6	Streptococcus_phage	1.3e-09	41.0
WP_012027454.1\|1507954_1508218_-	hypothetical protein	A0A1S5S7M1	Streptococcus_phage	1.0e-07	43.8
WP_012775263.1\|1508348_1508756_-	hypothetical protein	A0A1X9I5V7	Streptococcus_phage	1.8e-35	52.2
WP_012027456.1\|1508767_1509085_-	hypothetical protein	NA	NA	NA	NA
WP_012027457.1\|1509071_1509293_-	hypothetical protein	NA	NA	NA	NA
WP_012027458.1\|1509289_1509532_-	hypothetical protein	NA	NA	NA	NA
WP_012027459.1\|1509528_1509729_-	hypothetical protein	NA	NA	NA	NA
WP_014636470.1\|1509718_1510009_-	hypothetical protein	A0A1X9I5U4	Streptococcus_phage	1.8e-08	40.7
WP_012027461.1\|1510326_1510515_-	helix-turn-helix transcriptional regulator	R9QNG3	Lactococcus_phage	2.0e-05	42.4
WP_012027462.1\|1510666_1511188_+	helix-turn-helix transcriptional regulator	A0A1X9I723	Streptococcus_phage	8.7e-14	65.1
WP_012028388.1\|1511243_1511936_+	DUF3800 domain-containing protein	NA	NA	NA	NA
WP_012775654.1\|1512622_1513765_+\|integrase	site-specific integrase	A0A1S5S7K9	Streptococcus_phage	5.5e-69	39.5
1521175:1521189	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_012923

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NC_012926

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection