CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NC_012989	Methylorubrum extorquens AM1 plasmid p2METDI, complete sequence	0 crisprs	NA	0	0
NC_012988	Methylorubrum extorquens AM1, complete genome	1 crisprs	csa3,c2c9_V-U4,DEDDh,WYL,cas3	1	6
NC_012987	Methylorubrum extorquens AM1 plasmid p1METDI, complete sequence	0 crisprs	NA	0	2

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_012988_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_012988_1

4505445-4505541

Orphan

Consensus_repeat	Method
AGCATCGTCCCGAAAGGTGGGCACCGGCTTTCGGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NC_012988_1

>merge|NC_012988|1|4505445-4505541|CRISPRCasFinder
AGCATCGTCCCGAAAGGTGGGCACCGGCTTTCGGAGAAGACGATGCAAAAACAAAAGGCGAGAGCATCGTCCCGAAAGGTGGGCACCGGCTTTCGGA

>NC_012988|1|1|4505445-4505541|CRISPRCasFinder
AGCATCGTCCCGAAAGGTGGGCACCGGCTTTCGGA	GAAGACGATGCAAAAACAAAAGGCGAG
AGCATCGTCCCGAAAGGTGGGCACCGGCTTTCGGA

Protein	Signature genes	Signature genes Name	Protein_function
NC_012988.1\|WP_015823881.1\|4517111_4517498_-\|CidA/LrgA-family-protein	unknown	unknown	gnl\|CDD\|377131
NC_012988.1\|WP_015823872.1\|4504700_4505357_-\|glutathione-S-transferase	unknown	unknown	gnl\|CDD\|198298
NC_012988.1\|WP_041358103.1\|4513433_4514549_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223669
NC_012988.1\|WP_003605770.1\|4502726_4502960_+\|hypothetical-protein	unknown	unknown	unknown
NC_012988.1\|WP_012254846.1\|4499117_4499690_+\|fasciclin-domain-containing-protein	unknown	unknown	gnl\|CDD\|225214
NC_012988.1\|WP_158020975.1\|4510321_4510570_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|375977
NC_012988.1\|WP_015823866.1\|4499936_4500773_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223669
NC_012988.1\|WP_012254862.1\|4516398_4517115_-\|LrgB-family-protein	unknown	unknown	gnl\|CDD\|377236
NC_012988.1\|WP_012254849.1\|4502266_4502485_+\|hypothetical-protein	unknown	unknown	unknown
NC_012988.1\|WP_003605771.1\|4502965_4503214_+\|BrnA-antitoxin-family-protein	unknown	unknown	gnl\|CDD\|226045
NC_012988.1\|WP_041358101.1\|4507273_4507978_+\|amino-acid-transporter	unknown	unknown	unknown
NC_012988.1\|WP_015823871.1\|4504247_4504628_+\|TonB-family-protein	unknown	unknown	gnl\|CDD\|372476
NC_012988.1\|WP_015823875.1\|4508001_4509051_+\|4-hydroxythreonine-4-phosphate-dehydrogenase-PdxA	unknown	unknown	gnl\|CDD\|235402
NC_012988.1\|WP_015823877.1\|4510602_4511649_-\|HlyD-family-efflux-transporter-periplasmic-adaptor-subunit	unknown	unknown	gnl\|CDD\|273776
NC_012988.1\|WP_015823869.1\|4501687_4502206_+\|GAF-domain-containing-protein	unknown	unknown	gnl\|CDD\|379056
NC_012988.1\|WP_015823873.1\|4505619_4506714_+\|molybdenum-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|226628
NC_012988.1\|WP_173390168.1\|4500793_4501321_-\|GFA-family-protein	unknown	unknown	gnl\|CDD\|226314
NC_012988.1\|WP_015823876.1\|4509059_4509950_+\|16S-rRNA-(adenine(1518)-N(6)/adenine(1519)-N(6))--dimethyltransferase-RsmA	unknown	unknown	gnl\|CDD\|234708
NC_012988.1\|WP_015823880.1\|4514714_4516220_-\|SulP-family-inorganic-anion-transporter	unknown	unknown	gnl\|CDD\|223732
NC_012988.1\|WP_015823870.1\|4503299_4504025_+\|molybdate-ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|181841

Protein	Function_ID	Function_description	E-value
NC_012988.1\|WP_015823881.1\|4517111_4517498_-\|CidA/LrgA-family-protein	gnl\|CDD\|377131	pfam03788, LrgA, LrgA family. This family is uncharacterized. It contains the protein LrgA that has been hypothesized to export murein hydrolases.	4.4725e-18
NC_012988.1\|WP_015823872.1\|4504700_4505357_-\|glutathione-S-transferase	gnl\|CDD\|198298	cd03189, GST_C_GTT1_like, C-terminal, alpha helical domain of GTT1-like Glutathione S-transferases. Glutathione S-transferase (GST) C-terminal domain family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S. cerevisiae GST protein, GTT1, and the Schizosaccharomyces pombe GST-III. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain. GTT1, a homodimer, exhibits GST activity with standard substrates and associates with the endoplasmic reticulum. Its expression is induced after diauxic shift and remains high throughout the stationary phase. S. pombe GST-III is implicated in the detoxification of various metals.	3.87173e-48
NC_012988.1\|WP_015823876.1\|4509059_4509950_+\|16S-rRNA-(adenine(1518)-N(6)/adenine(1519)-N(6))--dimethyltransferase-RsmA	gnl\|CDD\|234708	PRK00274, ksgA, 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase RsmA.	5.7051e-117
NC_012988.1\|WP_158020975.1\|4510321_4510570_-\|hypothetical-protein	gnl\|CDD\|375977	pfam18551, TackOD1, Thaumarchaeal output domain 1. TackOD1 (Thaumarchaeal output domain 1) is a predicted metal-binding domain found in archaea and in some bacteria. It contains 11 highly conserved Cys residues, which form 5 CxxC motifs and an HxxC motif. In several instances, it is found in combination with the Response_reg pfam00072 domain (Galperin et al., 2018, Phyletic distribution and lineage-specific domain architectures of archaeal two-component signal transduction systems).	2.55872e-07
NC_012988.1\|WP_015823866.1\|4499936_4500773_+\|alpha/beta-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	2.36884e-38
NC_012988.1\|WP_012254862.1\|4516398_4517115_-\|LrgB-family-protein	gnl\|CDD\|377236	pfam04172, LrgB, LrgB-like family. The two products of the lrgAB operon are potential membrane proteins, and LrgA and LrgB are both thought to control of murein hydrolase activity and penicillin tolerance.	1.10129e-79
NC_012988.1\|WP_012254846.1\|4499117_4499690_+\|fasciclin-domain-containing-protein	gnl\|CDD\|225214	COG2335, COG2335, Secreted and surface protein containing fasciclin-like repeats [Cell envelope biogenesis, outer membrane].	1.25977e-54
NC_012988.1\|WP_003605771.1\|4502965_4503214_+\|BrnA-antitoxin-family-protein	gnl\|CDD\|226045	COG3514, COG3514, Uncharacterized protein conserved in bacteria [Function unknown].	1.57636e-11
NC_012988.1\|WP_041358103.1\|4513433_4514549_-\|alpha/beta-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	1.06572e-25
NC_012988.1\|WP_015823871.1\|4504247_4504628_+\|TonB-family-protein	gnl\|CDD\|372476	pfam13103, TonB_2, TonB C terminal. This family contains TonB members that are not captured by pfam03544.	1.63413e-06
NC_012988.1\|WP_015823875.1\|4508001_4509051_+\|4-hydroxythreonine-4-phosphate-dehydrogenase-PdxA	gnl\|CDD\|235402	PRK05312, pdxA, 4-hydroxythreonine-4-phosphate dehydrogenase PdxA.	0
NC_012988.1\|WP_015823877.1\|4510602_4511649_-\|HlyD-family-efflux-transporter-periplasmic-adaptor-subunit	gnl\|CDD\|273776	TIGR01730, COG0845:_Membrane-fusion_protein, RND family efflux transporter, MFP subunit. This model represents the MFP (membrane fusion protein) component of the RND family of transporters. RND refers to Resistance, Nodulation, and cell Division. It is, in part, a subfamily of pfam00529 (Pfam release 7.5) but hits substantial numbers of proteins missed by that model. The related HlyD secretion protein, for which pfam00529 is named, is outside the scope of this model. Attributed functions imply outward transport. These functions include nodulation, acriflavin resistance, heavy metal efflux, and multidrug resistance proteins. Most members of this family are found in Gram-negative bacteria. The proposed function of MFP proteins is to bring the inner and outer membranes together and enable transport to the outside of the outer membrane. Note, however, that a few members of this family are found in Gram-positive bacteria, where there is no outer membrane. [Transport and binding proteins, Unknown substrate].	2.88033e-11
NC_012988.1\|WP_015823869.1\|4501687_4502206_+\|GAF-domain-containing-protein	gnl\|CDD\|379056	pfam13185, GAF_2, GAF domain.	6.46328e-08
NC_012988.1\|WP_015823873.1\|4505619_4506714_+\|molybdenum-ABC-transporter-ATP-binding-protein	gnl\|CDD\|226628	COG4148, ModC, ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism].	9.98659e-145
NC_012988.1\|WP_173390168.1\|4500793_4501321_-\|GFA-family-protein	gnl\|CDD\|226314	COG3791, COG3791, Uncharacterized conserved protein [Function unknown].	6.65863e-29
NC_012988.1\|WP_015823880.1\|4514714_4516220_-\|SulP-family-inorganic-anion-transporter	gnl\|CDD\|223732	COG0659, SUL1, Sulfate permease and related transporters (MFS superfamily) [Inorganic ion transport and metabolism].	3.45559e-141
NC_012988.1\|WP_015823870.1\|4503299_4504025_+\|molybdate-ABC-transporter-permease-subunit	gnl\|CDD\|181841	PRK09421, modB, molybdate ABC transporter permease subunit.	5.63768e-127

>NC_012988.1|WP_015823872.1|4504700_4505357_-|glutathione-S-transferase
MITVHHLENSRSQRVLWLLEELGLDYTVKRYERDPATMQAPRELRAVHPLGKSPVIAADGQVVAETGAIVEFLTARADGALVPPAGTPERARYTYFLHYAEGSAMPPLLLKLIFSRLAPGSPALLRPLVRAIAGKVTGGFVDPELRRHAAYWESELAERAYFCGADFTAADIMMSFPLEAFAARGTGAGPLLTDWLARIHTRPAYKRALERGGPYAYA
>NC_012988.1|WP_015823871.1|4504247_4504628_+|TonB-family-protein
MKLKLAAACLLATIAFQAKAHPSCGEGGRNAFREYKDKLQPMISARVRSVRSDASIERINIVSLSIRKDGVVMSSEIAKSSGSPQFDAKLLSMLPAGLQLPPLPACYKPNLITLMFPIRFRPAPPL
>NC_012988.1|WP_015823870.1|4503299_4504025_+|molybdate-ABC-transporter-permease-subunit
MSGPADWPSAWLGLSPDETTALLLSLRVAFVATLASLPLGLLLAWLLARRRFPGHALLDGLVHLPLILPPVVTGYLLLLAFGRRGVFGAWLAEIGIVFSFRWTGAALACAVMGLPLMVRAMRLSIEAVDRKLEQAAATLGAAPSLVFLSVTLPLSLPGILAGAVLAFAKAMGEFGATITFVSNIPGETQTLPSAIYTLTQVPGGEAGALRLTLISVAVSMLALVASEGLARRMSRRIGAGR
>NC_012988.1|WP_003605771.1|4502965_4503214_+|BrnA-antitoxin-family-protein
MAIDRTRRPSDPRQAAEAAFRAVTTRKAPEEAAPAPPRAPLIPGTRETVSLRIDRAVLEHYQKDGPGWQDRINAALKAAAGL
>NC_012988.1|WP_003605770.1|4502726_4502960_+|hypothetical-protein
MSDDIDAKTRAAERAERAERMAREGQQAMAEHLAAVKAVDERTVRLRALRLAKEAEEAAERAANPPAPKRGRKKATA
>NC_012988.1|WP_012254849.1|4502266_4502485_+|hypothetical-protein
MPVFVLRGACRAPDGQIGPPLFEETITAASPSEAVRLANAHDLSTKDERANALWLVDAQGVLHWSLRRADRD
>NC_012988.1|WP_015823869.1|4501687_4502206_+|GAF-domain-containing-protein
MPMLDERSQANPHLMRTAELMAAAQSLEDVVDVLAQTARRIAGSDGIAVVLREEDFCAYVAEDAIEPLWKGCRFPLDICVSGWAMQNRETAVILDVGSDPRIPAAAYAYKAIRSLVMVPIGAPEPVAALGAYWCAMVWLDTTTVSRLEALAHQATVALARLRAPQSAEPAIP
>NC_012988.1|WP_173390168.1|4500793_4501321_-|GFA-family-protein
MPNLLGGCLCGALRYEVRSPPLRVTLCHCRFCQRTTGSSHLVEPLFDRADLHVTAGVPTVYRHRSEGSGRHLDLHFCPVCGTTLFMRFERFPGLCGVYAGTLDDPAAIEVRPDNAKQVFVASARPEAVLLPGLATFAGPAMDAAGVPHAPRVHDAPQIVGRRGCEPLPGGDAQPR
>NC_012988.1|WP_015823866.1|4499936_4500773_+|alpha/beta-hydrolase
MATITTGDGTEIFYKDWGPKDAQPIMFHHGWPLSSDDWDAQMLFFAHQGFRVVAHDRRGHGRSAQVSEGHDMDHYAADAAAVAEHLDLRNAVHIGHSTGGGEAARYVARHGEPQGRVAKAVLVSAVPPLMLKTEANPEGLPIEVFDGFRKALADNRAQFFLDVAAGPFYGFNRDGAAVREGVIRNWWRQGMMGSAKAHYEGIKAFSETDQTEDLRAISVPTLVLHGEDDQIVPIVAAARKSITLLRNGTLKTYPGLPHGMLTVNADQLNADILAFIRG
>NC_012988.1|WP_012254846.1|4499117_4499690_+|fasciclin-domain-containing-protein
MFRIRSSVTKSLTLGAALALSLAAAPTAALAKNPMVGGAPMYASKTIVENAVNSKDHTTLVAAVKAAGLVDTLSGPGPFTVFAPTDAAFAKLPPGTVDSLVQPQNKATLTGILTYHVVPGTYTAKDLMALAKRGGGEASLKTVQGEPLTVQARGKKVFVTDAKGNTATVTIANVMQSNGVIHVINGVLQP
>NC_012988.1|WP_015823873.1|4505619_4506714_+|molybdenum-ABC-transporter-ATP-binding-protein
MTIAIDVSLRRDGFTLDVAFSAGAGLTALFGRSGSGKTTVIDLIAGLAQPQRGRIAIDGTVLLDTARGIRVPVHRRRIGCVFQEARLMPHLSVRQNLRFGRLFSRGAGGPSLDAVADLLGIGPLLDRRPAGLSGGERQRVAIGRALLARPRLLLMDEPLSALDEARKREILPYIERLRDEAGLPIVYVSHSVAEVARLASTVVVLEAGRVAASGPVDAVLRRPDLIPDGAEAGSVLAMRVERHDPEAGLTRLTGPAGPLDLPLIDAPQGRRLNLRVPARDVLLALARPEALSARNVLPGRVAALREEGTACLVEVACGGATLAARLTRASARDLGLTVGSPVFAIVKSVALDAGEAPGGGRIEI
>NC_012988.1|WP_041358101.1|4507273_4507978_+|amino-acid-transporter
MTAPPDAPGSAHVGSGPSRDGSDGAVAASGTADRHNPSVPPEDDWSPWHPGELARRLETVARPWCVVGGWALDLWHGHQTRDHEDLEFTVLRDDVGVFRQALSDMTLYTVADGRFEILTEGAEPPPHILQIWCFDARAARWRVDLMIEPGEPDVWVCRRCPAIRHPRAEMVASTPDGIPYLRPAAVLLFKAKYRRDKDAADFERALPHLTHAERRWLREGLDRLHPGHAWAQAL
>NC_012988.1|WP_015823875.1|4508001_4509051_+|4-hydroxythreonine-4-phosphate-dehydrogenase-PdxA
MASDDRPLALTLGDPSGIGPEIALAAWQLRSERGVPPFQLIGDPEFLEATAYRLGLSVPVAEVEPDDACEVFPRALPVLPLPSGAKVIATPGAPDSANAGAIVESITAAVDLVRSGAASAVVTNPIAKFVLTRVGFAHPGHTEFLAALAAREGREPPLPVMMIWSDTLAVVPVTIHVALRRVPDLLTQDLVERTARIVHADLRARFGLEHPRLVLSGLNPHAGESGTMGTEDRDVLAPAVAVLRSEGIDIRGPLPADTLFHERARATYDVALTPTHDQALIPVKTLAFDEGVNVTLGLPFVRTSPDHGTAFDIAGKGIAKPDSLIAALRLAHRLAHRPADTVLPFPVRA
>NC_012988.1|WP_015823876.1|4509059_4509950_+|16S-rRNA-(adenine(1518)-N(6)/adenine(1519)-N(6))--dimethyltransferase-RsmA
MSTEALNTDGLPPLREVVRRHGLEPKKALGQNFLFDLNLTGRIARSAGALEGVTVVEVGPGPGGLTRALLAAGAKRVVAIERDPRALPALAEIAAHYPGRLDVIDADAVGFDPRPLVGEGPVRIVANLPYNVATVLLTGWLGADTRDEAWPPWWDSATLMFQREVAERIVADESDRANYGRLGVLCGWRTQATILFDVAPSAFVPPPKVTSSVVHLRPRPEPLPCRIADLERVTRAAFGQRRKMLRQSLKAATPDPIRLLTAAGLPETARAEEIPVAGFVAMARALEAGESRESAL
>NC_012988.1|WP_158020975.1|4510321_4510570_-|hypothetical-protein
MNIEAGQSSCPLCGAEHLEITPVLHHMICAYIGPQYDFAESPTGYTCPKCRRSIVSDDMACEIVGFSARCTACGKEMIVSPL
>NC_012988.1|WP_015823877.1|4510602_4511649_-|HlyD-family-efflux-transporter-periplasmic-adaptor-subunit
MNVRINRLDPNVPDPVESRRRAAGRLVRIAYAVGIFGVLGFFVVYFGAPFVFLSGPGIVSSPRHVLSLPFTVQVSRMNVRPGSTVKAGDEIGQVYSPEQETIVATYMRALSDIAGRSAELRVKARVAAESLEAARAYQRETETALERIAAMASTTTTFRVQILRERALANKDVISQQAEAEEATKQLVSLDAFSKQIREQLDEVKQNFRSGRVFAPVGGIISTGLAQTGQSLVAGAPIADILNPNDVYVDWYIPNERLIDSRIGNDVFVLFGHRRIPGKITEILPVSAVFGSSQQLTLRDRPATQIARIRFTSEAVTPALNSTVCVHMHYSKISTDISRSLIKICGLD
>NC_012988.1|WP_041358103.1|4513433_4514549_-|alpha/beta-hydrolase
MFPFDPSRQSRRRASRSLTRTTRQMTGQLTRSLESAAKSAAKAVSKAVTRSTEQAIRETRKATVRSVKRTVRDTEKAVAAAFSAQETEVVRKPPGQFVTVDGLPVHVIVRGRGRPVVLVHGNGTMAEDFAICGLIDRLAARYRVIAIDRPGFGYTGRPRHRIWTAQAQAVLLHRVLEQLGVERPLLVGHSWGTIVALALAADGRRPLRGLVLLSGSYFPGHRTDAALIAPLAVPGLGDAMRAMVPAKVSASLTGQSFRQVFWPQPVPARFTARFPIEIAAAATQLRAVSEDAASMNAAVTGLQRRYAGLTLPVSILAGDADAIVKASEHSVRLHTTIPGSTLRLLPGLGHMIHYGARLKVERAIDDLMKLR
>NC_012988.1|WP_015823880.1|4514714_4516220_-|SulP-family-inorganic-anion-transporter
MSSTVSTARGRFGSTWFANWFANPWADILSGIVVALALIPEAIGFSVIAGVDPKVGLYASVVIACVIAFAGGRPAMISAATAATAVVMVDLVRDHGVQYLFAATILMGVFQILAGLARLGRLMRFVSRSVMTGFVNALAILIFLAQLPELTGVTPATYGLIALGLAIIYGFPKLTRAVPSPLVAIAVLTALTAYLGLDVRTVAHLGALPTALPSFALPQVPLTFETLRIILPYSATLAAVGLLESLLTAQIVDDMTDTGSSKNRECMGQGLANMSSAVFGGMGGCAMIGQSVINVSSGARGRLSTLVAGSFLLALLVLLQDLLAIVPVAALTAVMIMVSLNTFSWRSLLALRSNPLPSSLVMLATVAVVVATRDLAIGVLVGVLLSGVFFAGKVARMSRITAELSPDGRTRTYRVAGQVFFASAGSFAEAIDVREPVERLVIDVHAAHFWDISAVGALDRVVMKARAAGRTVEVVGLNEASATLVERFGQHDKAEASLPAH
>NC_012988.1|WP_012254862.1|4516398_4517115_-|LrgB-family-protein
MTGEFALWVYLSHTPLLWLTVTLLAYAVADRLFQAAGRHPMANPVIHAIWMIGLVLTLTGTPYRAYFEGAQFVHFLLGPATVALAVPLYERRATVMRALLPMLAALLVGCVTAMTSALVFAKLVGIPYDVRLAMAPKSVTTGVAMGIVEALGGDPTLAAVLVMLTGMAGAVIVTPLMRTLRIEDMRARGFAAGLAAHGLGTARAFQVSEVAGTFAGIAMGLNAFLTAVLVPVAVSFLR
>NC_012988.1|WP_015823881.1|4517111_4517498_-|CidA/LrgA-family-protein
MIVSLTLILLAQLVGEVAARAAGLPVPGPVIGMALLLIFLVLRDRTQPASNRWLPPPLVDGGLEGTAKGMLAHLSILFVPAGVGIVGKLDVLASHGVALAVVLTLSVTLTLAATVLTFVAVSKLLDRR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_012988_1	1.1\|4505480\|27\|NC_012988\|CRISPRCasFinder	4505480-4505506	27	MF417881	Uncultured Caudovirales phage clone 7AX_3, partial genome	34229-34255	5	0.815
NC_012988_1	1.1\|4505480\|27\|NC_012988\|CRISPRCasFinder	4505480-4505506	27	MF417842	Uncultured Caudovirales phage clone 8AX_3, partial genome	1123-1149	5	0.815
NC_012988_1	1.1\|4505480\|27\|NC_012988\|CRISPRCasFinder	4505480-4505506	27	MF417862	Uncultured Caudovirales phage clone 7F_9, partial genome	7490-7516	5	0.815
NC_012988_1	1.1\|4505480\|27\|NC_012988\|CRISPRCasFinder	4505480-4505506	27	MN693295	Marine virus AFVG_25M553, complete genome	3827-3853	6	0.778
NC_012988_1	1.1\|4505480\|27\|NC_012988\|CRISPRCasFinder	4505480-4505506	27	KX349325	Cyanophage S-RIM12 isolate W1_24_0910, complete genome	170406-170432	7	0.741
NC_012988_1	1.1\|4505480\|27\|NC_012988\|CRISPRCasFinder	4505480-4505506	27	KX349322	Cyanophage S-RIM12 isolate Sn_31_0910, complete genome	170411-170437	7	0.741
NC_012988_1	1.1\|4505480\|27\|NC_012988\|CRISPRCasFinder	4505480-4505506	27	KX349320	Cyanophage S-RIM12 isolate RW_29_1109, complete genome	170621-170647	7	0.741
NC_012988_1	1.1\|4505480\|27\|NC_012988\|CRISPRCasFinder	4505480-4505506	27	KX349310	Cyanophage S-RIM12 isolate RW_01_0310, complete genome	170939-170965	7	0.741
NC_012988_1	1.1\|4505480\|27\|NC_012988\|CRISPRCasFinder	4505480-4505506	27	KX349321	Cyanophage S-RIM12 isolate Sn_07_0910, complete genome	170622-170648	7	0.741
NC_012988_1	1.1\|4505480\|27\|NC_012988\|CRISPRCasFinder	4505480-4505506	27	KX349314	Cyanophage S-RIM12 isolate RW_07_1112, complete genome	170620-170646	7	0.741
NC_012988_1	1.1\|4505480\|27\|NC_012988\|CRISPRCasFinder	4505480-4505506	27	KX349316	Cyanophage S-RIM12 isolate RW_22_0110, complete genome	170622-170648	7	0.741
NC_012988_1	1.1\|4505480\|27\|NC_012988\|CRISPRCasFinder	4505480-4505506	27	KX349312	Cyanophage S-RIM12 isolate RW_04_0709, complete genome	171059-171085	7	0.741
NC_012988_1	1.1\|4505480\|27\|NC_012988\|CRISPRCasFinder	4505480-4505506	27	KX349315	Cyanophage S-RIM12 isolate RW_14_0101, complete genome	170315-170341	7	0.741
NC_012988_1	1.1\|4505480\|27\|NC_012988\|CRISPRCasFinder	4505480-4505506	27	KX349317	Cyanophage S-RIM12 isolate RW_25_0210, complete genome	170462-170488	7	0.741
NC_012988_1	1.1\|4505480\|27\|NC_012988\|CRISPRCasFinder	4505480-4505506	27	NC_015285	Prochlorococcus phage Syn33, complete genome	170554-170580	7	0.741
NC_012988_1	1.1\|4505480\|27\|NC_012988\|CRISPRCasFinder	4505480-4505506	27	KX349309	Cyanophage S-RIM12 isolate Np_22_1112, complete genome	170473-170499	7	0.741
NC_012988_1	1.1\|4505480\|27\|NC_012988\|CRISPRCasFinder	4505480-4505506	27	KX349319	Cyanophage S-RIM12 isolate RW_28_1109, complete genome	170086-170112	7	0.741
NC_012988_1	1.1\|4505480\|27\|NC_012988\|CRISPRCasFinder	4505480-4505506	27	KX349307	Cyanophage S-RIM12 isolate Np_14_0310, complete genome	170090-170116	7	0.741
NC_012988_1	1.1\|4505480\|27\|NC_012988\|CRISPRCasFinder	4505480-4505506	27	KX349318	Cyanophage S-RIM12 isolate RW_27_0310, complete genome	171054-171080	7	0.741

1. spacer 1.1|4505480|27|NC_012988|CRISPRCasFinder matches to MF417881 (Uncultured Caudovirales phage clone 7AX_3, partial genome) position: , mismatch: 5, identity: 0.815

gaagacgatgcaaaaacaaaaggcgag	CRISPR spacer
cagcacgatgcaaataaaaaaggcgag	Protospacer
 *. ********** * **********

2. spacer 1.1|4505480|27|NC_012988|CRISPRCasFinder matches to MF417842 (Uncultured Caudovirales phage clone 8AX_3, partial genome) position: , mismatch: 5, identity: 0.815

gaagacgatgcaaaaacaaaaggcgag	CRISPR spacer
cagcacgatgcaaataaaaaaggcgag	Protospacer
 *. ********** * **********

3. spacer 1.1|4505480|27|NC_012988|CRISPRCasFinder matches to MF417862 (Uncultured Caudovirales phage clone 7F_9, partial genome) position: , mismatch: 5, identity: 0.815

gaagacgatgcaaaaacaaaaggcgag	CRISPR spacer
cagcacgatgcaaataaaaaaggcgag	Protospacer
 *. ********** * **********

4. spacer 1.1|4505480|27|NC_012988|CRISPRCasFinder matches to MN693295 (Marine virus AFVG_25M553, complete genome) position: , mismatch: 6, identity: 0.778

gaagacgatgcaaaaacaaaaggcgag	CRISPR spacer
gaagacgatccaaaaacaaaactagca	Protospacer
********* ***********   * .

5. spacer 1.1|4505480|27|NC_012988|CRISPRCasFinder matches to KX349325 (Cyanophage S-RIM12 isolate W1_24_0910, complete genome) position: , mismatch: 7, identity: 0.741

gaagacgatgcaaaaacaaaaggcgag	CRISPR spacer
gtctctaatgcaaaaacaaaaggcgaa	Protospacer
*    ..*******************.

6. spacer 1.1|4505480|27|NC_012988|CRISPRCasFinder matches to KX349322 (Cyanophage S-RIM12 isolate Sn_31_0910, complete genome) position: , mismatch: 7, identity: 0.741

gaagacgatgcaaaaacaaaaggcgag	CRISPR spacer
gtctctaatgcaaaaacaaaaggcgaa	Protospacer
*    ..*******************.

7. spacer 1.1|4505480|27|NC_012988|CRISPRCasFinder matches to KX349320 (Cyanophage S-RIM12 isolate RW_29_1109, complete genome) position: , mismatch: 7, identity: 0.741

gaagacgatgcaaaaacaaaaggcgag	CRISPR spacer
gtctctaatgcaaaaacaaaaggcgaa	Protospacer
*    ..*******************.

8. spacer 1.1|4505480|27|NC_012988|CRISPRCasFinder matches to KX349310 (Cyanophage S-RIM12 isolate RW_01_0310, complete genome) position: , mismatch: 7, identity: 0.741

gaagacgatgcaaaaacaaaaggcgag	CRISPR spacer
gtctctaatgcaaaaacaaaaggcgaa	Protospacer
*    ..*******************.

9. spacer 1.1|4505480|27|NC_012988|CRISPRCasFinder matches to KX349321 (Cyanophage S-RIM12 isolate Sn_07_0910, complete genome) position: , mismatch: 7, identity: 0.741

gaagacgatgcaaaaacaaaaggcgag	CRISPR spacer
gtctctaatgcaaaaacaaaaggcgaa	Protospacer
*    ..*******************.

10. spacer 1.1|4505480|27|NC_012988|CRISPRCasFinder matches to KX349314 (Cyanophage S-RIM12 isolate RW_07_1112, complete genome) position: , mismatch: 7, identity: 0.741

gaagacgatgcaaaaacaaaaggcgag	CRISPR spacer
gtctctaatgcaaaaacaaaaggcgaa	Protospacer
*    ..*******************.

11. spacer 1.1|4505480|27|NC_012988|CRISPRCasFinder matches to KX349316 (Cyanophage S-RIM12 isolate RW_22_0110, complete genome) position: , mismatch: 7, identity: 0.741

gaagacgatgcaaaaacaaaaggcgag	CRISPR spacer
gtctctaatgcaaaaacaaaaggcgaa	Protospacer
*    ..*******************.

12. spacer 1.1|4505480|27|NC_012988|CRISPRCasFinder matches to KX349312 (Cyanophage S-RIM12 isolate RW_04_0709, complete genome) position: , mismatch: 7, identity: 0.741

gaagacgatgcaaaaacaaaaggcgag	CRISPR spacer
gtctctaatgcaaaaacaaaaggcgaa	Protospacer
*    ..*******************.

13. spacer 1.1|4505480|27|NC_012988|CRISPRCasFinder matches to KX349315 (Cyanophage S-RIM12 isolate RW_14_0101, complete genome) position: , mismatch: 7, identity: 0.741

gaagacgatgcaaaaacaaaaggcgag	CRISPR spacer
gtctctaatgcaaaaacaaaaggcgaa	Protospacer
*    ..*******************.

14. spacer 1.1|4505480|27|NC_012988|CRISPRCasFinder matches to KX349317 (Cyanophage S-RIM12 isolate RW_25_0210, complete genome) position: , mismatch: 7, identity: 0.741

gaagacgatgcaaaaacaaaaggcgag	CRISPR spacer
gtctctaatgcaaaaacaaaaggcgaa	Protospacer
*    ..*******************.

15. spacer 1.1|4505480|27|NC_012988|CRISPRCasFinder matches to NC_015285 (Prochlorococcus phage Syn33, complete genome) position: , mismatch: 7, identity: 0.741

gaagacgatgcaaaaacaaaaggcgag	CRISPR spacer
gtctctaatgcaaaaacaaaaggcgaa	Protospacer
*    ..*******************.

16. spacer 1.1|4505480|27|NC_012988|CRISPRCasFinder matches to KX349309 (Cyanophage S-RIM12 isolate Np_22_1112, complete genome) position: , mismatch: 7, identity: 0.741

gaagacgatgcaaaaacaaaaggcgag	CRISPR spacer
gtctctaatgcaaaaacaaaaggcgaa	Protospacer
*    ..*******************.

17. spacer 1.1|4505480|27|NC_012988|CRISPRCasFinder matches to KX349319 (Cyanophage S-RIM12 isolate RW_28_1109, complete genome) position: , mismatch: 7, identity: 0.741

gaagacgatgcaaaaacaaaaggcgag	CRISPR spacer
gtctctaatgcaaaaacaaaaggcgaa	Protospacer
*    ..*******************.

18. spacer 1.1|4505480|27|NC_012988|CRISPRCasFinder matches to KX349307 (Cyanophage S-RIM12 isolate Np_14_0310, complete genome) position: , mismatch: 7, identity: 0.741

gaagacgatgcaaaaacaaaaggcgag	CRISPR spacer
gtctctaatgcaaaaacaaaaggcgaa	Protospacer
*    ..*******************.

19. spacer 1.1|4505480|27|NC_012988|CRISPRCasFinder matches to KX349318 (Cyanophage S-RIM12 isolate RW_27_0310, complete genome) position: , mismatch: 7, identity: 0.741

gaagacgatgcaaaaacaaaaggcgag	CRISPR spacer
gtctctaatgcaaaaacaaaaggcgaa	Protospacer
*    ..*******************.

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

767890 : 840442

Aeromonas_phage(20.0%)

transposase,tRNA,integrase

attL 778649:778708|attR 840452:841288

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012252470.1\|767890_768934_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	6.8e-66	45.0
WP_015821224.1\|769111_769825_+	uroporphyrinogen-III synthase	NA	NA	NA	NA
WP_015821225.1\|769980_772272_+	hypothetical protein	NA	NA	NA	NA
WP_015821226.1\|772389_773925_+	hypothetical protein	NA	NA	NA	NA
WP_158020927.1\|774700_775594_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_015821228.1\|775755_776652_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_041357411.1\|776768_777404_+	NADPH-dependent F420 reductase	NA	NA	NA	NA
WP_041357412.1\|777505_778495_+	zinc-dependent alcohol dehydrogenase family protein	NA	NA	NA	NA
778649:778708	attL	NA	NA	NA	NA
WP_076611329.1\|778717_779471_+\|transposase	IS5-like element ISMex15 family transposase	NA	NA	NA	NA
WP_015821231.1\|780310_781843_+	hypothetical protein	NA	NA	NA	NA
WP_015821232.1\|782109_782730_-	recombinase family protein	A0A219YB42	Aeromonas_phage	1.4e-15	36.2
WP_015821233.1\|783113_786200_+	EAL domain-containing protein	A0A127AWB9	Bacillus_phage	1.6e-14	33.3
WP_041357413.1\|786332_788024_+	HAMP domain-containing protein	NA	NA	NA	NA
WP_015821234.1\|788350_789493_+	hypothetical protein	NA	NA	NA	NA
WP_015821235.1\|789492_789840_+	hypothetical protein	NA	NA	NA	NA
WP_015821236.1\|789885_790179_+	hypothetical protein	NA	NA	NA	NA
WP_158020928.1\|790297_791074_-	hypothetical protein	NA	NA	NA	NA
WP_041357414.1\|791389_792193_-	hypothetical protein	NA	NA	NA	NA
WP_158020929.1\|792355_792862_+	hypothetical protein	NA	NA	NA	NA
WP_015821232.1\|793381_794002_+	recombinase family protein	A0A219YB42	Aeromonas_phage	1.4e-15	36.2
WP_015821231.1\|794268_795801_-	hypothetical protein	NA	NA	NA	NA
WP_015821240.1\|796517_798377_-	recombinase family protein	K4ICM1	Acidithiobacillus_phage	5.4e-90	45.4
WP_041358421.1\|798369_798819_-	DUF2924 domain-containing protein	K4I3X1	Acidithiobacillus_phage	7.7e-19	42.4
WP_085985081.1\|798917_799301_-	DUF3489 domain-containing protein	NA	NA	NA	NA
WP_015821243.1\|800025_801039_-\|transposase	IS110-like element ISMdi14B family transposase	NA	NA	NA	NA
WP_041357415.1\|801507_802743_-	HlyD family secretion protein	NA	NA	NA	NA
WP_015821245.1\|802745_803207_-	hypothetical protein	NA	NA	NA	NA
WP_080579848.1\|805307_806012_+	glycerate-2-kinase family protein	NA	NA	NA	NA
WP_041357416.1\|806390_807155_+	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_041357417.1\|807268_807718_-	response regulator	NA	NA	NA	NA
WP_015821250.1\|808396_808687_+	hypothetical protein	NA	NA	NA	NA
WP_012252511.1\|808942_809320_-	VOC family protein	NA	NA	NA	NA
WP_080579849.1\|809874_810390_+	hypothetical protein	NA	NA	NA	NA
WP_015821253.1\|810457_811858_+	cytochrome P450	A0A2I2L481	Orpheovirus	4.1e-34	25.8
WP_015821254.1\|812547_813168_-	5-formyltetrahydrofolate cyclo-ligase	NA	NA	NA	NA
WP_076611771.1\|813521_814477_-\|transposase	IS630-like element ISMdi1 family transposase	A0A1V0SCG6	Indivirus	1.1e-09	19.7
WP_012252516.1\|815197_815455_-	hypothetical protein	NA	NA	NA	NA
WP_003599782.1\|817219_817456_-	hypothetical protein	NA	NA	NA	NA
WP_015821258.1\|817452_818583_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_015821259.1\|818852_819566_+	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_015821260.1\|819565_819826_+	hypothetical protein	NA	NA	NA	NA
WP_015821261.1\|819873_820179_+	hypothetical protein	NA	NA	NA	NA
WP_003599774.1\|820221_820455_-	hypothetical protein	NA	NA	NA	NA
WP_015821262.1\|820767_821478_+	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_015821264.1\|822133_822856_+	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_015821265.1\|822943_823180_+	hypothetical protein	NA	NA	NA	NA
WP_015821267.1\|823390_824020_+\|integrase	tyrosine-type recombinase/integrase	A0A0A8WF93	Clostridium_phage	8.1e-06	24.2
WP_015821268.1\|824566_825550_+	formylglycine-generating enzyme family protein	NA	NA	NA	NA
WP_015821274.1\|829295_829508_+	hypothetical protein	NA	NA	NA	NA
WP_041357420.1\|829826_831701_+	PAS domain S-box protein	NA	NA	NA	NA
WP_150105696.1\|832090_832321_-	hypothetical protein	NA	NA	NA	NA
WP_041357421.1\|832769_833759_-	zinc-dependent alcohol dehydrogenase family protein	NA	NA	NA	NA
WP_015821278.1\|833863_834748_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_015821280.1\|836221_839419_-	PAS domain S-box protein	W8CYM9	Bacillus_phage	9.2e-05	24.1
WP_076611329.1\|839687_840442_-\|transposase	IS5-like element ISMex15 family transposase	NA	NA	NA	NA
840452:841288	attR	NA	NA	NA	NA

DBSCAN-SWA_2

1141759 : 1198246

uncultured_virus(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003598648.1\|1141759_1142683_-\|transposase	IS110-like element ISMex31 family transposase	NA	NA	NA	NA
WP_085985055.1\|1143824_1144785_+\|transposase	IS630-like element ISMex30 family transposase	A0A1V0SCG6	Indivirus	7.5e-11	25.5
WP_003598652.1\|1144953_1145121_-	hypothetical protein	NA	NA	NA	NA
WP_041357443.1\|1145195_1145408_-	hypothetical protein	NA	NA	NA	NA
WP_080515519.1\|1145716_1145944_-	cytochrome C biogenesis protein	NA	NA	NA	NA
WP_003598654.1\|1146045_1147119_-	murein L,D-transpeptidase	NA	NA	NA	NA
WP_012753610.1\|1147207_1147729_-	signal peptidase II	NA	NA	NA	NA
WP_003598656.1\|1147725_1149921_-	cadmium-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	3.2e-118	38.7
WP_003598658.1\|1150021_1150423_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_003598660.1\|1151099_1153520_-	heavy metal translocating P-type ATPase	A0A218MNH6	uncultured_virus	2.9e-67	33.1
WP_003598662.1\|1153587_1154070_-	DUF305 domain-containing protein	A0A218MND9	uncultured_virus	3.9e-08	44.0
WP_015821476.1\|1154124_1154457_-	four-helix bundle copper-binding protein	NA	NA	NA	NA
WP_003598665.1\|1154636_1155035_-	DUF305 domain-containing protein	A0A218MND9	uncultured_virus	6.9e-11	50.7
WP_003598666.1\|1155061_1155427_-	hypothetical protein	NA	NA	NA	NA
WP_003598668.1\|1155446_1158596_-	CusA/CzcA family heavy metal efflux RND transporter	NA	NA	NA	NA
WP_003598670.1\|1158609_1160349_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_003598673.1\|1160994_1161207_-	heavy-metal-associated domain-containing protein	NA	NA	NA	NA
WP_003598674.1\|1161587_1162328_+	NYN domain-containing protein	NA	NA	NA	NA
WP_003598675.1\|1162341_1162818_-	metal-binding protein	NA	NA	NA	NA
WP_003598676.1\|1162837_1166011_-	efflux RND transporter permease subunit	NA	NA	NA	NA
WP_003598677.1\|1166007_1167525_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_003598678.1\|1167521_1167926_-	FixH family protein	NA	NA	NA	NA
WP_003598679.1\|1168007_1168406_-	hypothetical protein	NA	NA	NA	NA
WP_003598680.1\|1169201_1169396_+	hypothetical protein	NA	NA	NA	NA
WP_003598681.1\|1169452_1169674_-	hypothetical protein	NA	NA	NA	NA
WP_173390153.1\|1169939_1170299_-	hypothetical protein	NA	NA	NA	NA
WP_003598686.1\|1171060_1171492_-	hypothetical protein	NA	NA	NA	NA
WP_050900019.1\|1173290_1173860_-	DUF1109 family protein	NA	NA	NA	NA
WP_003599784.1\|1176096_1179213_+	alkaline phosphatase	NA	NA	NA	NA
WP_085985056.1\|1179441_1180582_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	6.5e-38	36.0
WP_012253152.1\|1180768_1181698_+\|transposase	IS110-like element ISMex17 family transposase	Q75QL1	Wolbachia_phage	2.2e-28	33.7
WP_015821487.1\|1182097_1182352_+	hypothetical protein	NA	NA	NA	NA
WP_003599790.1\|1183588_1185808_+	TonB-dependent siderophore receptor	NA	NA	NA	NA
WP_003599791.1\|1185811_1187251_+	PepSY domain-containing protein	NA	NA	NA	NA
WP_003599792.1\|1187832_1188216_-	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_003599794.1\|1188849_1189830_-	arsenic resistance protein	NA	NA	NA	NA
WP_003599795.1\|1189826_1190213_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_041357445.1\|1190662_1192351_+	MCP four helix bundle domain-containing protein	NA	NA	NA	NA
WP_015821493.1\|1193132_1193879_-	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	6.3e-82	65.7
WP_003599807.1\|1193929_1194289_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_003599806.1\|1194281_1194809_+	arsenate reductase ArsC	A0A2H4J8A6	uncultured_Caudovirales_phage	6.9e-27	43.9
WP_015821494.1\|1194808_1195234_+	arsenate reductase (glutaredoxin)	A0A2H4J8T1	uncultured_Caudovirales_phage	6.6e-44	63.0
WP_085985057.1\|1195989_1197130_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	8.5e-38	36.0
WP_012253152.1\|1197316_1198246_+\|transposase	IS110-like element ISMex17 family transposase	Q75QL1	Wolbachia_phage	2.2e-28	33.7

DBSCAN-SWA_3

1273694 : 1296317

Leptospira_phage(33.33%)

integrase,transposase

attL 1267482:1267498|attR 1295933:1295949

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1267482:1267498	attL	NA	NA	NA	NA
WP_015821540.1\|1273694_1274303_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_015821541.1\|1274426_1275095_+	Abi family protein	NA	NA	NA	NA
WP_085985060.1\|1276250_1277392_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	9.4e-37	36.7
WP_015821545.1\|1278381_1279395_-\|transposase	IS110-like element ISMdi14 family transposase	NA	NA	NA	NA
WP_015821546.1\|1279791_1280112_-	DUF736 domain-containing protein	NA	NA	NA	NA
WP_015821548.1\|1280609_1282769_-	ParB N-terminal domain-containing protein	NA	NA	NA	NA
WP_015821549.1\|1283120_1284128_-	DUF1738 domain-containing protein	A0A1V0EEV1	Caulobacter_phage	6.8e-47	38.1
WP_041357458.1\|1284307_1284523_+	hypothetical protein	NA	NA	NA	NA
WP_015821550.1\|1284770_1285856_-\|transposase	IS110-like element ISMdi10 family transposase	NA	NA	NA	NA
WP_015821551.1\|1286119_1286362_-	hypothetical protein	NA	NA	NA	NA
WP_158020932.1\|1286663_1286960_-	hypothetical protein	NA	NA	NA	NA
WP_015821555.1\|1288803_1289829_-\|transposase	IS110-like element ISMdi12 family transposase	A0A1S7J231	Thermus_phage	9.4e-12	37.0
WP_015821557.1\|1290481_1290760_+	hypothetical protein	NA	NA	NA	NA
WP_015821558.1\|1291280_1293413_+	amylo-alpha-1,6-glucosidase	NA	NA	NA	NA
WP_080579857.1\|1293489_1293774_-	hypothetical protein	NA	NA	NA	NA
WP_158020932.1\|1294531_1294828_-	hypothetical protein	NA	NA	NA	NA
WP_015821561.1\|1295177_1296317_+\|transposase	IS110-like element ISMdi9 family transposase	NA	NA	NA	NA
1295933:1295949	attR	NA	NA	NA	NA

DBSCAN-SWA_4

1958370 : 1969881

Paracoccus_phage(33.33%)

protease,tail,head

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015822048.1\|1958370_1958934_-	lysozyme	W6E9Q2	Rhizobium_phage	9.1e-25	41.4
WP_015822051.1\|1960159_1964062_-\|tail	glycoside hydrolase/phage tail family protein	A0A0B5A7K5	Paracoccus_phage	5.6e-190	35.6
WP_015822052.1\|1964085_1964550_-	peptidase P60	A0A1V0DYB6	Dinoroseobacter_phage	8.5e-29	46.1
WP_015822053.1\|1964557_1965451_-	DUF2163 domain-containing protein	A0A0K0PVK1	Roseobacter_phage	1.9e-56	41.2
WP_015822054.1\|1965461_1966103_-	DUF2460 domain-containing protein	A0A0B5A2K3	Paracoccus_phage	1.1e-45	49.5
WP_041357584.1\|1966114_1966741_-\|tail	phage tail tape measure protein	G9JXH3	Shigella_phage	1.1e-07	67.4
WP_015822056.1\|1966740_1966971_-\|tail	phage tail assembly chaperone	NA	NA	NA	NA
WP_041357586.1\|1966967_1967294_-	gene transfer agent family protein	NA	NA	NA	NA
WP_041357588.1\|1967296_1967707_-\|tail	phage major tail protein, TP901-1 family	NA	NA	NA	NA
WP_015822059.1\|1967736_1968156_-	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_015822060.1\|1968152_1968494_-\|head,tail	head-tail adaptor protein	NA	NA	NA	NA
WP_015822061.1\|1968516_1969092_-	hypothetical protein	NA	NA	NA	NA
WP_015822062.1\|1969125_1969881_+\|protease	trypsin-like serine protease	NA	NA	NA	NA

DBSCAN-SWA_5

2500950 : 2561211

uncultured_Caudovirales_phage(22.22%)

integrase,transposase

attL 2505735:2505751|attR 2510813:2510829

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015822435.1\|2500950_2502123_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_015822436.1\|2502136_2503225_-	hypothetical protein	NA	NA	NA	NA
WP_015822437.1\|2503221_2503659_-	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_015822438.1\|2503655_2503934_-	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_015822439.1\|2504055_2504355_+	hypothetical protein	NA	NA	NA	NA
2505735:2505751	attL	NA	NA	NA	NA
WP_015822441.1\|2505900_2507145_-	TniQ family protein	NA	NA	NA	NA
WP_015822442.1\|2507141_2508020_-	TniB family NTP-binding protein	NA	NA	NA	NA
WP_015822443.1\|2508021_2509680_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_050983370.1\|2509820_2510882_+	DUF1612 and helix-turn-helix domain-containing protein	NA	NA	NA	NA
2510813:2510829	attR	NA	NA	NA	NA
WP_015822445.1\|2510881_2512393_+	hypothetical protein	NA	NA	NA	NA
WP_015822446.1\|2512605_2513814_+	ATP-binding protein	A0A1V0SG63	Hokovirus	4.2e-11	30.9
WP_015822447.1\|2513803_2516332_+	S8 family peptidase	NA	NA	NA	NA
WP_015822448.1\|2516449_2517640_+	abortive infection family protein	NA	NA	NA	NA
WP_015822449.1\|2517707_2518358_+	DUF2971 domain-containing protein	NA	NA	NA	NA
WP_015822450.1\|2518363_2519320_+	hypothetical protein	NA	NA	NA	NA
WP_041357690.1\|2519347_2520814_+	caspase family protein	NA	NA	NA	NA
WP_041357692.1\|2520874_2521153_-	DUF2285 domain-containing protein	NA	NA	NA	NA
WP_015822453.1\|2521290_2522187_-	hypothetical protein	NA	NA	NA	NA
WP_015822454.1\|2522286_2522628_+	type II toxin-antitoxin system PrlF family antitoxin	NA	NA	NA	NA
WP_015822455.1\|2522624_2523128_+	type II toxin-antitoxin system YhaV family toxin	NA	NA	NA	NA
WP_158020948.1\|2523182_2523386_+	hypothetical protein	NA	NA	NA	NA
WP_015822457.1\|2523455_2524157_+	hypothetical protein	NA	NA	NA	NA
WP_080579881.1\|2524279_2524519_+	hypothetical protein	NA	NA	NA	NA
WP_015822458.1\|2524545_2524857_-	DUF736 domain-containing protein	NA	NA	NA	NA
WP_015822460.1\|2525899_2527309_+	type I glutamate--ammonia ligase	NA	NA	NA	NA
WP_041358596.1\|2527332_2528178_-	hypothetical protein	C8CHK2	Thermus_virus	2.9e-59	45.6
WP_015822462.1\|2528210_2529137_-	DUF1738 domain-containing protein	A0A1V0EEV1	Caulobacter_phage	2.9e-76	49.8
WP_015822463.1\|2529486_2530074_-	hypothetical protein	NA	NA	NA	NA
WP_015822464.1\|2530467_2530794_-	hypothetical protein	NA	NA	NA	NA
WP_041357695.1\|2530790_2531042_-	hypothetical protein	NA	NA	NA	NA
WP_015822466.1\|2531038_2531242_-	hypothetical protein	NA	NA	NA	NA
WP_015822467.1\|2531245_2532118_-	hypothetical protein	NA	NA	NA	NA
WP_015822468.1\|2532114_2532588_-	hypothetical protein	NA	NA	NA	NA
WP_015822469.1\|2532674_2534357_-	ParB N-terminal domain-containing protein	NA	NA	NA	NA
WP_015822470.1\|2534607_2539704_-	DEAD/DEAH box helicase family protein	I6NW45	Burkholderia_virus	0.0e+00	41.8
WP_015822471.1\|2539808_2540003_-	hypothetical protein	NA	NA	NA	NA
WP_015822472.1\|2540019_2540622_-	DUF1419 domain-containing protein	NA	NA	NA	NA
WP_015822473.1\|2540913_2541207_-	hypothetical protein	NA	NA	NA	NA
WP_015822474.1\|2541238_2541901_-	hypothetical protein	A0A0F6YR75	Sinorhizobium_phage	5.7e-18	44.1
WP_015822475.1\|2541940_2543734_-	PcfJ domain-containing protein	NA	NA	NA	NA
WP_015822476.1\|2543730_2544162_-	hypothetical protein	NA	NA	NA	NA
WP_015822478.1\|2544848_2545142_-	hypothetical protein	NA	NA	NA	NA
WP_015822479.1\|2545138_2545552_-	hypothetical protein	NA	NA	NA	NA
WP_015822480.1\|2545684_2546611_-	toprim domain-containing protein	NA	NA	NA	NA
WP_015822481.1\|2546815_2546992_-	hypothetical protein	NA	NA	NA	NA
WP_015822482.1\|2547540_2548344_-	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
WP_085985082.1\|2548346_2549150_-	xanthine dehydrogenase	NA	NA	NA	NA
WP_041358600.1\|2549172_2549913_-	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	1.5e-22	34.1
WP_015822485.1\|2549905_2550574_-	molybdate ABC transporter permease subunit	NA	NA	NA	NA
WP_111772103.1\|2550589_2551327_-	molybdate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_015822487.1\|2551650_2552604_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_015822488.1\|2552811_2553660_-	universal stress protein	A0A2H4J154	uncultured_Caudovirales_phage	1.6e-49	41.8
WP_041357698.1\|2553671_2555156_-	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	1.4e-162	62.5
WP_085985065.1\|2556693_2557531_+\|transposase	IS5-like element ISMdi21 family transposase	NA	NA	NA	NA
WP_013214472.1\|2557644_2558910_-\|transposase	IS256-like element IS1354 family transposase	A0A0K2CZ57	Paenibacillus_phage	1.2e-27	26.7
WP_085985066.1\|2559071_2559909_+\|transposase	IS5-like element IS1355 family transposase	NA	NA	NA	NA
WP_013214745.1\|2559975_2561211_+\|transposase	IS701-like element IS1357 family transposase	NA	NA	NA	NA

DBSCAN-SWA_6

4270855 : 4305780

Indivirus(28.57%)

integrase,transposase

attL 4266424:4266441|attR 4289181:4289198

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
4266424:4266441	attL	NA	NA	NA	NA
WP_085985069.1\|4270855_4271816_+\|transposase	IS630 family transposase	A0A1V0SCG6	Indivirus	2.3e-12	24.1
WP_015823672.1\|4273949_4274873_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_076611329.1\|4274967_4275721_+\|transposase	IS5-like element ISMex15 family transposase	NA	NA	NA	NA
WP_076611771.1\|4275823_4276778_+\|transposase	IS630-like element ISMdi1 family transposase	A0A1V0SCG6	Indivirus	1.1e-09	19.7
WP_041357996.1\|4277581_4278157_-	PAS domain-containing protein	NA	NA	NA	NA
WP_041357997.1\|4278429_4278660_-	hypothetical protein	NA	NA	NA	NA
WP_015823677.1\|4278819_4279302_-	hypothetical protein	NA	NA	NA	NA
WP_017484448.1\|4279298_4279487_-	hypothetical protein	NA	NA	NA	NA
WP_015823679.1\|4279701_4280265_-	hypothetical protein	NA	NA	NA	NA
WP_015823680.1\|4280451_4281150_-	TIGR02594 family protein	H6WBN0	Rhodobacter_phage	4.7e-39	43.7
WP_041358001.1\|4281681_4282563_-	hypothetical protein	NA	NA	NA	NA
WP_015823684.1\|4282758_4283718_+	hypothetical protein	A0A068CCA6	Rhizobium_phage	5.3e-41	38.9
WP_111772148.1\|4283692_4284832_-\|integrase	tyrosine-type recombinase/integrase	B4UTU2	Rhizobium_phage	3.9e-51	37.4
WP_158020962.1\|4285371_4285965_-	hypothetical protein	NA	NA	NA	NA
WP_015823688.1\|4286249_4287056_-	hypothetical protein	NA	NA	NA	NA
WP_158020963.1\|4287066_4287234_-	hypothetical protein	NA	NA	NA	NA
WP_015823690.1\|4287230_4288061_-	hypothetical protein	NA	NA	NA	NA
WP_015823691.1\|4288060_4288273_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_015823692.1\|4288269_4288749_-	hypothetical protein	NA	NA	NA	NA
WP_015823693.1\|4289034_4289754_+	hypothetical protein	NA	NA	NA	NA
4289181:4289198	attR	NA	NA	NA	NA
WP_015823694.1\|4289750_4290680_+	DNA adenine methylase	A0A0K1LM14	Caulobacter_phage	1.6e-58	45.5
WP_041358003.1\|4291117_4292494_-	ATP-binding protein	NA	NA	NA	NA
WP_015823696.1\|4292814_4295544_+	N-6 DNA methylase	NA	NA	NA	NA
WP_015823697.1\|4295540_4296212_+	hypothetical protein	NA	NA	NA	NA
WP_041358004.1\|4296850_4297102_-	hypothetical protein	NA	NA	NA	NA
WP_041358005.1\|4297177_4298182_+\|transposase	IS481-like element ISMdi4 family transposase	NA	NA	NA	NA
WP_012252226.1\|4298186_4298393_-	DUF2934 domain-containing protein	NA	NA	NA	NA
WP_158020964.1\|4298479_4298668_+	hypothetical protein	NA	NA	NA	NA
WP_041358758.1\|4298849_4299440_-	DUF1003 domain-containing protein	NA	NA	NA	NA
WP_041358007.1\|4299451_4299676_-	hypothetical protein	NA	NA	NA	NA
WP_012778891.1\|4300684_4300897_+	hypothetical protein	NA	NA	NA	NA
WP_012778892.1\|4301093_4301471_-	hypothetical protein	NA	NA	NA	NA
WP_041358008.1\|4302096_4302489_-	hypothetical protein	NA	NA	NA	NA
WP_015823707.1\|4302800_4303109_-	hypothetical protein	NA	NA	NA	NA
WP_158020965.1\|4303179_4303542_-	hypothetical protein	NA	NA	NA	NA
WP_158020966.1\|4304137_4304380_+	hypothetical protein	NA	NA	NA	NA
WP_085985070.1\|4304680_4305780_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.0e-51	42.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NC_012987

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

12843 : 66825

Escherichia_phage(26.67%)

transposase,integrase

attL 2950:2966|attR 68189:68205

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2950:2966	attL	NA	NA	NA	NA
WP_012778770.1\|12843_14343_+\|transposase	IS21-like element ISMdi7 family transposase	A0A2L1IVA1	Escherichia_phage	1.3e-17	28.1
WP_003596510.1\|14339_15182_+	ATP-binding protein	A0A059NT77	Lactococcus_phage	3.3e-39	38.3
WP_050983430.1\|15317_15797_+	TniB family NTP-binding protein	NA	NA	NA	NA
WP_158020992.1\|15891_16632_-	hypothetical protein	NA	NA	NA	NA
WP_012778771.1\|16628_18164_-\|transposase	ISL3-like element ISMdi2 family transposase	NA	NA	NA	NA
WP_009867550.1\|18597_19866_-\|transposase	IS256-like element ISMex3 family transposase	A0A2P1JQX9	Mycobacterium_phage	2.5e-91	45.7
WP_085985084.1\|19973_21114_+\|transposase	IS3-like element ISMex5 family transposase	S5WIU1	Leptospira_phage	7.0e-32	32.4
WP_012778773.1\|22670_23045_+	DUF485 domain-containing protein	NA	NA	NA	NA
WP_012778774.1\|23041_24733_+	cation acetate symporter	NA	NA	NA	NA
WP_012778776.1\|27579_28797_+	FIST C-terminal domain-containing protein	NA	NA	NA	NA
WP_012778777.1\|29292_30546_+	phosphoglycerate dehydrogenase	A0A1V0SBV6	Catovirus	1.9e-86	41.2
WP_012778778.1\|30565_31993_+	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_085985085.1\|32295_33100_+\|transposase	IS5-like element ISMdi24 family transposase	NA	NA	NA	NA
WP_012778779.1\|33124_34303_+	CHAT domain-containing protein	NA	NA	NA	NA
WP_173390191.1\|34431_35832_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	1.3e-27	33.3
WP_012778781.1\|37077_38136_+	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	2.4e-87	49.4
WP_012778782.1\|38153_39044_+	dTDP-4-dehydrorhamnose reductase	A0A1D7XFA3	Escherichia_phage	1.4e-24	34.4
WP_012778783.1\|39059_39950_+	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	2.1e-92	55.6
WP_080579950.1\|40064_41210_+	glycosyltransferase	NA	NA	NA	NA
WP_080579951.1\|41209_42529_+	glycosyltransferase	A0A2P1ELT8	Moumouvirus	9.0e-07	23.9
WP_158020993.1\|42586_43543_+	ATP-grasp domain-containing protein	NA	NA	NA	NA
WP_158020994.1\|43535_44177_+	HAD hydrolase-like protein	NA	NA	NA	NA
WP_050983432.1\|44157_44577_+	WxcM-like domain-containing protein	NA	NA	NA	NA
WP_041359143.1\|44576_45692_+	DegT/DnrJ/EryC1/StrS family aminotransferase	E5ES42	Bathycoccus_sp._RCC1105_virus	7.3e-50	35.1
WP_041359080.1\|47354_48806_+	hypothetical protein	NA	NA	NA	NA
WP_012778786.1\|48954_50313_+\|transposase	IS701-like element ISMdi28 family transposase	NA	NA	NA	NA
WP_041359084.1\|50991_51723_-	ATP-binding protein	A0A059NT77	Lactococcus_phage	1.9e-30	37.3
WP_012778788.1\|51722_53222_-\|transposase	IS21-like element ISMdi27 family transposase	A0A2L1IVA1	Escherichia_phage	1.1e-11	24.2
WP_158020995.1\|54263_55397_+	SGNH/GDSL hydrolase family protein	NA	NA	NA	NA
WP_158020996.1\|57032_57839_-	sulfotransferase	NA	NA	NA	NA
WP_158020997.1\|58099_58909_-	hypothetical protein	NA	NA	NA	NA
WP_012778789.1\|60182_60542_-	toll/interleukin-1 receptor domain-containing protein	NA	NA	NA	NA
WP_012778790.1\|60923_61985_-\|integrase	tyrosine-type recombinase/integrase	Q5QBN6	Enterobacteria_phage	1.8e-21	28.3
WP_080579955.1\|62173_62473_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
WP_111772158.1\|62462_62855_+	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_162129466.1\|63284_64172_+	metallo-hydrolase/oxidoreductase	NA	NA	NA	NA
WP_012778793.1\|64185_64653_-	hypothetical protein	NA	NA	NA	NA
WP_158020999.1\|64730_65003_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	Q9ZXG3	Shigella_phage	9.7e-25	61.5
WP_158021000.1\|65021_65360_-	hypothetical protein	NA	NA	NA	NA
WP_158021001.1\|65756_65915_-	pyridoxamine 5'-phosphate oxidase family protein	NA	NA	NA	NA
WP_012778795.1\|65865_66825_-\|transposase	ISAs1 family transposase	NA	NA	NA	NA
68189:68205	attR	NA	NA	NA	NA

DBSCAN-SWA_2

75726 : 94082

Acinetobacter_phage(16.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085985087.1\|75726_76910_-\|transposase	IS3-like element ISMdi5 family transposase	A0A0P0I4A4	Acinetobacter_phage	1.5e-53	43.6
WP_012778804.1\|77046_78372_-	polyhydroxyalkanoate depolymerase	NA	NA	NA	NA
WP_012778805.1\|78695_79139_+	phasin	NA	NA	NA	NA
WP_085985089.1\|79629_80800_+\|transposase	IS3-like element ISMdi16 family transposase	S5WIU1	Leptospira_phage	1.8e-38	36.8
WP_158021002.1\|80917_81496_+	hypothetical protein	A0A2H4J162	uncultured_Caudovirales_phage	2.7e-08	50.6
WP_041359162.1\|81577_82387_-\|transposase	IS5-like element ISMdi26 family transposase	NA	NA	NA	NA
WP_158021003.1\|82411_82636_-	hypothetical protein	NA	NA	NA	NA
WP_158021004.1\|82719_82956_+	hypothetical protein	NA	NA	NA	NA
WP_012778808.1\|83072_83951_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_012778809.1\|84122_85061_+	EamA family transporter	NA	NA	NA	NA
WP_012778810.1\|85090_86107_+	zinc-binding alcohol dehydrogenase family protein	NA	NA	NA	NA
WP_076611539.1\|86855_88207_-\|transposase	IS3-like element ISMex16 family transposase	Q6J1X2	Lactobacillus_phage	2.6e-09	25.5
WP_041359169.1\|89813_91289_+	diguanylate cyclase	G3MA91	Bacillus_virus	2.0e-10	28.6
WP_158021005.1\|91480_92236_+	hypothetical protein	NA	NA	NA	NA
WP_012778812.1\|92417_93428_+\|transposase	IS110-like element ISMex29 family transposase	A0A1S7J231	Thermus_phage	9.9e-14	29.0
WP_080579959.1\|93590_94082_-\|transposase	IS630 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_012988

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NC_012987

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection