CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number
NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	10 crisprs	c2c9_V-U4,csa3,csx1,cas1,cas2,cas10,csm2gr11,csm3gr7,csm4gr5,csm5gr7,cmr3gr5,cmr1gr7,cmr4gr7,cmr5gr11,cmr6gr7,WYL,cas3,cas8e,cse2gr11,cas7,cas5,cas6e,cas4,cas8b5,cas6	136
NC_006463	Thermus thermophilus HB8 plasmid pTT8, complete sequence	0 crisprs	NA	0
NC_006461	Thermus thermophilus HB8 chromosome 1, complete sequence	2 crisprs	cas2,DEDDh,csa3,cas3,Cas9_archaeal	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_006461_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_006461_1

872101-873200

Orphan

III-A

Consensus_repeat	Method
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	PILER-CR
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	CRISPRCasFinder
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	CRT

14 spacers

The CRISPR arrays of NC_006461_1

>merge|NC_006461|1|872101-873200|PILER-CR,CRISPRCasFinder,CRT
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGACTCGTAAGCGATAACGGGGAGGGCGACGCCAATCGCGTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGACGCCACGGCGTACGCCGCCGCCCAGAGGGCCTTCTGGTTCAGGTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGACTTTGCGAGGATTACCCCCTCGGTGGGCCCGAGGAGGTTCGTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGACCACGTCCCTCACGACCGAGGCCAGGGACGTCTTCACGTGGTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGACCTCCCTCCTTTCCCGCCTATCTTACTCCCCCATGAGGTGTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGACACTTCAAAGTGAAGGAGCCTAGGGGCTTGGTCATAGACTGGCGTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGACGGCGAGGAGCCGCCGCACCCCGATGATCTTGCCGTCGGAGTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGACCATTGGCGTGGGTGCCACCCCGCCTACGCCGATGCTACGGGTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGACTTTGCCCTTCTAGGGCCTTCTGGAGTTCGTGAAGGTTCGCCACGTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGACCTTCAGGAATGGGCACGCCCACCTGCCGGAGAAGTTCAATGTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGACCTAAGCAGGAGGAGGCCCACGGCCTGGTAGAGGCCAAAATAGTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGACATCTCTAACCAGGCTACGGAGAGGATAGTGGAACTCTACCGGGTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGACTATCAAGGGTCTTCCGCAAGCGGAAGGCGCGCGGGGAGTGTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGACCAGCCCGCTCCATCTCGGCCAGCTCTAGGGCGTGGGGACCAGTTGCAAGGGATTGAGCCCCGTAAGGGGATTGATACT

>NC_006461|1|1|872101-873122|PILER-CR
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	TCGTAAGCGATAACGGGGAGGGCGACGCCAATCGC
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	GCCACGGCGTACGCCGCCGCCCAGAGGGCCTTCTGGTTCAG
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	TTTGCGAGGATTACCCCCTCGGTGGGCCCGAGGAGGTTC
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	CACGTCCCTCACGACCGAGGCCAGGGACGTCTTCACGTG
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	CTCCCTCCTTTCCCGCCTATCTTACTCCCCCATGAGGT
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	ACTTCAAAGTGAAGGAGCCTAGGGGCTTGGTCATAGACTGGC
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	GGCGAGGAGCCGCCGCACCCCGATGATCTTGCCGTCGGA
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	CATTGGCGTGGGTGCCACCCCGCCTACGCCGATGCTACGG
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	TTTGCCCTTCTAGGGCCTTCTGGAGTTCGTGAAGGTTCGCCAC
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	CTTCAGGAATGGGCACGCCCACCTGCCGGAGAAGTTCAAT
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	CTAAGCAGGAGGAGGCCCACGGCCTGGTAGAGGCCAAAATA
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	ATCTCTAACCAGGCTACGGAGAGGATAGTGGAACTCTACCGG
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	TATCAAGGGTCTTCCGCAAGCGGAAGGCGCGCGGGGAGT
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC

>NC_006461|1|1|872101-873200|CRISPRCasFinder
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	TCGTAAGCGATAACGGGGAGGGCGACGCCAATCGC
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	GCCACGGCGTACGCCGCCGCCCAGAGGGCCTTCTGGTTCAG
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	TTTGCGAGGATTACCCCCTCGGTGGGCCCGAGGAGGTTC
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	CACGTCCCTCACGACCGAGGCCAGGGACGTCTTCACGTG
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	CTCCCTCCTTTCCCGCCTATCTTACTCCCCCATGAGGT
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	ACTTCAAAGTGAAGGAGCCTAGGGGCTTGGTCATAGACTGGC
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	GGCGAGGAGCCGCCGCACCCCGATGATCTTGCCGTCGGA
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	CATTGGCGTGGGTGCCACCCCGCCTACGCCGATGCTACGG
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	TTTGCCCTTCTAGGGCCTTCTGGAGTTCGTGAAGGTTCGCCAC
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	CTTCAGGAATGGGCACGCCCACCTGCCGGAGAAGTTCAAT
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	CTAAGCAGGAGGAGGCCCACGGCCTGGTAGAGGCCAAAATA
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	ATCTCTAACCAGGCTACGGAGAGGATAGTGGAACTCTACCGG
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	TATCAAGGGTCTTCCGCAAGCGGAAGGCGCGCGGGGAGT
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	CAGCCCGCTCCATCTCGGCCAGCTCTAGGGCGTGGGGACCA
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGATACT

>NC_006461|1|1|872101-873199|CRT
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	TCGTAAGCGATAACGGGGAGGGCGACGCCAATCGC
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	GCCACGGCGTACGCCGCCGCCCAGAGGGCCTTCTGGTTCAG
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	TTTGCGAGGATTACCCCCTCGGTGGGCCCGAGGAGGTTC
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	CACGTCCCTCACGACCGAGGCCAGGGACGTCTTCACGTG
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	CTCCCTCCTTTCCCGCCTATCTTACTCCCCCATGAGGT
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	ACTTCAAAGTGAAGGAGCCTAGGGGCTTGGTCATAGACTGGC
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	GGCGAGGAGCCGCCGCACCCCGATGATCTTGCCGTCGGA
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	CATTGGCGTGGGTGCCACCCCGCCTACGCCGATGCTACGG
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	TTTGCCCTTCTAGGGCCTTCTGGAGTTCGTGAAGGTTCGCCAC
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	CTTCAGGAATGGGCACGCCCACCTGCCGGAGAAGTTCAAT
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	CTAAGCAGGAGGAGGCCCACGGCCTGGTAGAGGCCAAAATA
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	ATCTCTAACCAGGCTACGGAGAGGATAGTGGAACTCTACCGG
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	TATCAAGGGTCTTCCGCAAGCGGAAGGCGCGCGGGGAGT
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	CAGCCCGCTCCATCTCGGCCAGCTCTAGGGCGTGGGGACCA
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGATAC

Protein	Signature genes	Signature genes Name	Protein_function
NC_006461.1\|WP_011172996.1\|867478_867766_+\|ribosome-binding-factor-A	unknown	unknown	gnl\|CDD\|376719
NC_006461.1\|WP_041443401.1\|864547_865153_-\|biotin-transporter-BioY	unknown	unknown	gnl\|CDD\|224187
NC_006461.1\|WP_011228303.1\|882423_882636_-\|addiction-module-toxin,-HicA-family	unknown	unknown	gnl\|CDD\|224638
NC_006461.1\|WP_011228302.1\|881128_882427_-\|tRNA-uridine-5-carboxymethylaminomethyl(34)-synthesis-GTPase-MnmE	unknown	unknown	gnl\|CDD\|235392
NC_006461.1\|WP_011228288.1\|869398_871633_+\|ribonuclease-R	unknown	unknown	gnl\|CDD\|273947
NC_006461.1\|WP_011228284.1\|865264_866260_+\|type-I-glyceraldehyde-3-phosphate-dehydrogenase	unknown	unknown	gnl\|CDD\|223135
NC_006461.1\|WP_011172991.1\|863405_863840_-\|SsrA-binding-protein-SmpB	unknown	unknown	gnl\|CDD\|235455
NC_006461.1\|WP_011173000.1\|874921_876034_-\|AmmeMemoRadiSam-system-protein-B	unknown	unknown	gnl\|CDD\|280116
NC_006461.1\|WP_011228296.1\|873210_874164_-\|IS110-like-element-IS1000B-family-transposase	unknown	unknown	gnl\|CDD\|376564
NC_006461.1\|WP_041443404.1\|879579_881070_+\|bifunctional-phosphoribosylaminoimidazolecarboxamide-formyltransferase/IMP-cyclohydrolase	unknown	unknown	gnl\|CDD\|234854
NC_006461.1\|WP_024119826.1\|878570_879086_+\|methyltransferase	unknown	unknown	gnl\|CDD\|367574
NC_006461.1\|WP_011228286.1\|867744_868143_+\|acyl-CoA-thioesterase	unknown	unknown	gnl\|CDD\|223894
NC_006461.1\|WP_011228300.1\|875987_877283_-\|HDIG-domain-containing-protein	unknown	unknown	gnl\|CDD\|131739
NC_006461.1\|WP_011228282.1\|862254_863409_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|119407
NC_006461.1\|WP_011172989.1\|861760_862258_-\|GerMN-domain-containing-protein	unknown	unknown	gnl\|CDD\|214905
NC_006461.1\|WP_011228301.1\|877863_878367_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|376884
NC_006461.1\|WP_011228287.1\|868152_869397_+\|aspartate-aminotransferase-family-protein	unknown	unknown	gnl\|CDD\|227325
NC_006461.1\|WP_011173002.1\|877283_877895_+\|dephospho-CoA-kinase	unknown	unknown	gnl\|CDD\|366476
NC_006461.1\|WP_011228285.1\|866260_867433_+\|phosphoglycerate-kinase	unknown	unknown	gnl\|CDD\|234613
NC_006461.1\|WP_011173005.1\|879086_879569_+\|pantetheine-phosphate-adenylyltransferase	unknown	unknown	gnl\|CDD\|234674

Protein	Function_ID	Function_description	E-value
NC_006461.1\|WP_011172996.1\|867478_867766_+\|ribosome-binding-factor-A	gnl\|CDD\|376719	pfam02033, RBFA, Ribosome-binding factor A.	1.86681e-12
NC_006461.1\|WP_041443401.1\|864547_865153_-\|biotin-transporter-BioY	gnl\|CDD\|224187	COG1268, BioY, Uncharacterized conserved protein [General function prediction only].	2.76434e-38
NC_006461.1\|WP_011228303.1\|882423_882636_-\|addiction-module-toxin,-HicA-family	gnl\|CDD\|224638	COG1724, COG1724, Predicted RNA binding protein (dsRBD-like fold), HicA family [General function prediction only].	3.3835e-12
NC_006461.1\|WP_011228302.1\|881128_882427_-\|tRNA-uridine-5-carboxymethylaminomethyl(34)-synthesis-GTPase-MnmE	gnl\|CDD\|235392	PRK05291, trmE, tRNA uridine-5-carboxymethylaminomethyl(34) synthesis GTPase MnmE.	0
NC_006461.1\|WP_011228288.1\|869398_871633_+\|ribonuclease-R	gnl\|CDD\|273947	TIGR02063, Ribonuclease_R, ribonuclease R. This family consists of an exoribonuclease, ribonuclease R, also called VacB. It is one of the eight exoribonucleases reported in E. coli and is broadly distributed throughout the bacteria. In E. coli, double mutants of this protein and polynucleotide phosphorylase are not viable. Scoring between trusted and noise cutoffs to the model are shorter, divergent forms from the Chlamydiae, and divergent forms from the Campylobacterales (including Helicobacter pylori) and Leptospira interrogans. [Transcription, Degradation of RNA].	0
NC_006461.1\|WP_011228284.1\|865264_866260_+\|type-I-glyceraldehyde-3-phosphate-dehydrogenase	gnl\|CDD\|223135	COG0057, GapA, Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism].	3.24933e-179
NC_006461.1\|WP_011172991.1\|863405_863840_-\|SsrA-binding-protein-SmpB	gnl\|CDD\|235455	PRK05422, smpB, SsrA-binding protein SmpB.	2.14685e-74
NC_006461.1\|WP_011173000.1\|874921_876034_-\|AmmeMemoRadiSam-system-protein-B	gnl\|CDD\|280116	pfam01875, Memo, Memo-like protein. This family contains members from all branches of life. The molecular function of this protein is unknown, but Memo (mediator of ErbB2-driven cell motility) a human protein is included in this family. It has been suggested that Memo controls cell migration by relaying extracellular chemotactic signals to the microtubule cytoskeleton.	2.49075e-89
NC_006461.1\|WP_011228296.1\|873210_874164_-\|IS110-like-element-IS1000B-family-transposase	gnl\|CDD\|376564	pfam01548, DEDD_Tnp_IS110, Transposase. Transposase proteins are necessary for efficient DNA transposition. This family includes an amino-terminal region of the pilin gene inverting protein (PIVML) and of members of the IS111A/IS1328/IS1533 family of transposases. The C-terminus is represented by family pfam02371.	2.28212e-29
NC_006461.1\|WP_041443404.1\|879579_881070_+\|bifunctional-phosphoribosylaminoimidazolecarboxamide-formyltransferase/IMP-cyclohydrolase	gnl\|CDD\|234854	PRK00881, purH, bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase; Provisional.	0
NC_006461.1\|WP_024119826.1\|878570_879086_+\|methyltransferase	gnl\|CDD\|367574	pfam03602, Cons_hypoth95, Conserved hypothetical protein 95.	7.13888e-38
NC_006461.1\|WP_011228286.1\|867744_868143_+\|acyl-CoA-thioesterase	gnl\|CDD\|223894	COG0824, FcbC, Predicted thioesterase [General function prediction only].	8.16799e-33
NC_006461.1\|WP_011228300.1\|875987_877283_-\|HDIG-domain-containing-protein	gnl\|CDD\|131739	TIGR02692, putative_tRNA_nucleotidyltransferase, tRNA adenylyltransferase. The enzyme tRNA adenylyltransferase, also called tRNA-nucleotidyltransferase and CCA-adding enzyme, can add or repair the required CCA triplet at the 3'-end of tRNA molecules. Genes encoding tRNA include the CCA tail in some but not all bacteria, and this enzyme may be required for viability. Members of this family represent a distinct clade within the larger family pfam01743 (tRNA nucleotidyltransferase/poly(A) polymerase family protein). The example from Streptomyces coelicolor was shown to act as a CCA-adding enzyme and not as a poly(A) polymerase. [Protein synthesis, tRNA and rRNA base modification].	9.96447e-45
NC_006461.1\|WP_011228282.1\|862254_863409_-\|hypothetical-protein	gnl\|CDD\|119407	cd02696, MurNAc-LAA, N-acetylmuramoyl-L-alanine amidase or MurNAc-LAA (also known as peptidoglycan aminohydrolase, NAMLA amidase, NAMLAA, Amidase 3, and peptidoglycan amidase; EC 3.5.1.28) is an autolysin that hydrolyzes the amide bond between N-acetylmuramoyl and L-amino acids in certain cell wall glycopeptides. These proteins are Zn-dependent peptidases with highly conserved residues involved in cation co-ordination. MurNAc-LAA in this family is one of several peptidoglycan hydrolases (PGHs) found in bacterial and bacteriophage or prophage genomes that are involved in the degradation of the peptidoglycan. In Escherichia coli, there are five MurNAc-LAAs present: AmiA, AmiB, AmiC and AmiD that are periplasmic, and AmpD that is cytoplasmic. Three of these (AmiA, AmiB and AmiC) belong to this family, the other two (AmiD and AmpD) do not. E. coli AmiA, AmiB and AmiC play an important role in cleaving the septum to release daughter cells after cell division. In general, bacterial MurNAc-LAAs are members of the bacterial autolytic system and carry a signal peptide in their N-termini that allows their transport across the cytoplasmic membrane. However, the bacteriophage MurNAc-LAAs are endolysins since these phage-encoded enzymes break down bacterial peptidoglycan at the terminal stage of the phage reproduction cycle. As opposed to autolysins, almost all endolysins have no signal peptides and their translocation through the cytoplasmic membrane is thought to proceed with the help of phage-encoded holin proteins. The amidase catalytic module is fused to another functional module (cell wall binding module or CWBM) either at the N- or C-terminus, which is responsible for high affinity binding of the protein to the cell wall.	1.54487e-27
NC_006461.1\|WP_011172989.1\|861760_862258_-\|GerMN-domain-containing-protein	gnl\|CDD\|214905	smart00909, Germane, Sporulation and spore germination. The GerMN domain is a region of approximately 100 residues that is found, duplicated, in the Bacillus GerM protein and is implicated in both sporulation and spore germination. The domain is found in a number of different bacterial species both alone and in association with other domains such as Amidase_3 pfam01520 Gmad1 and Gmad2. It is predicted to have a novel alpha-beta fold.	6.93497e-06
NC_006461.1\|WP_011228301.1\|877863_878367_-\|hypothetical-protein	gnl\|CDD\|376884	pfam02660, G3P_acyltransf, Glycerol-3-phosphate acyltransferase. This family of enzymes catalyzes the transfer of an acyl group from acyl-ACP to glycerol-3-phosphate to form lysophosphatidic acid.	4.88457e-11
NC_006461.1\|WP_011228287.1\|868152_869397_+\|aspartate-aminotransferase-family-protein	gnl\|CDD\|227325	COG4992, ArgD, Ornithine/acetylornithine aminotransferase [Amino acid transport and metabolism].	0
NC_006461.1\|WP_011173002.1\|877283_877895_+\|dephospho-CoA-kinase	gnl\|CDD\|366476	pfam01121, CoaE, Dephospho-CoA kinase. This family catalyzes the phosphorylation of the 3'-hydroxyl group of dephosphocoenzyme A to form Coenzyme A EC:2.7.1.24. This enzyme uses ATP in its reaction.	2.68828e-81
NC_006461.1\|WP_011228285.1\|866260_867433_+\|phosphoglycerate-kinase	gnl\|CDD\|234613	PRK00073, pgk, phosphoglycerate kinase; Provisional.	0
NC_006461.1\|WP_011173005.1\|879086_879569_+\|pantetheine-phosphate-adenylyltransferase	gnl\|CDD\|234674	PRK00168, coaD, phosphopantetheine adenylyltransferase; Provisional.	6.3222e-102

>NC_006461.1|WP_011228288.1|869398_871633_+|ribonuclease-R
MQETLLEFFKKTGRPHRLEEILHRFGLEKREAKAHLKALVARGLLEKKGSRYFLANRVQGPLSLHRDGYGFVRLPEGDLFVPPGYTGDAWPGDLVEARVMPPGRDGRPWGVVERVLKRARERLVGTLDFRKGRALLLPDEPNLPELPLAPEGLEGLKRGSRIVVQVHYGKRPYGTFLAYLGEGEAPETETEAVIAKYGLRAEFPEEVLKEAEAIPLEIPEAELRRREDFRGLRVFTIDGVDAKDFDDAIHVERLPGGYRIGVHIADVSHYVKEGSLLDQEAFLRGTSVYLPGRVLPMLPERLSNGVCSLRPGEDRLVLSVLVDLTEDLKVKRVRFREGVIRSVARLTYTEVEAFAEGFGLPEEHAFLAEDLRLLLDLTQRMREKRLKEGALDFAFPEVKVEVGEEGELHLIPQAEPKARSLIEELMLLANRLVAEYLVQKGLPGLFRVHEEPVQDAYEKLRQALARLGYTLPPKLSGHALQKALLASRGRPEEPVVAYLVLRSLRLARYAPENLGHFGLAMEHYLHFTSPIRRYPDLVVHRVLKAALRRTLTPARKARWQEAFPAIAEHASEMERKAEAAERELTKYYMAKWAELHVGERFLGKVTGVANFGAFVTLPNGVEGLVRLEALGPYTYSEEAMALLGPKGRRIRLGDEMEVRIAGANPRLRQVDLLPVEEAPKKTKNRKEKAKEVEMRKVVGPPKDRARDTRPERATVNTIYFGEWTPKEPEEPRPERTRARKKRRR
>NC_006461.1|WP_011228287.1|868152_869397_+|aspartate-aminotransferase-family-protein
MDLDAFTLFERHINPGLAGLLRFTGLDRVESHAEGPYVWDTQGKRYLDFLGLYGTLNLGHRHPKVVEAVKRQLDRMPMSVRVLVSEPTARLAAKLAEITPEGLEMVFFGNSGAEAVEAAIKLARAYTGKPGIVTTQGGFHGKTMGALSLTPKPEYQDPARPLLPGVKVVPYGDLKALEEAIDETTAAVIVEPIQGEGGIRVPPEGYLRGVRELTREKGVLMIADEVQTGLGRTGKLFGVDWEGVSPDLMTLAKALGGGVMPIGACVGRREVFEVFKNNPLFHSSTFGGNPLAAAAALAAIEVTLEEDLPGRALELGRHLMEGLKVLKEEHPHLIEDVRGRGLMVGVEFADADIGALVVAEMAERGVLTAFGLNNPKVVRLEPPLIIGKEHVDEALAVFAEALKATEKALEGLLG
>NC_006461.1|WP_011228286.1|867744_868143_+|acyl-CoA-thioesterase
MESVTRIKVRYAETDQMGVVHHSVYAVYLEAARVDFLERAGLPYHRVEARGVFFPVVELGLTFRAPARFGEVVEVRTRLAELSSRALLFRYRVEREGVLLAEGFTRHLCQVGERAARIPEDIYRALSVLHLK
>NC_006461.1|WP_011172996.1|867478_867766_+|ribosome-binding-factor-A
MAYGKAHLEAQLKRALAEEIQALEDPRLFLLTVEAVRLSKDGSVLSVYVEAFREEEGALRALSRAERRLVAALARRVRMRRLPRLEFLPWRASPA
>NC_006461.1|WP_011228285.1|866260_867433_+|phosphoglycerate-kinase
MRTLLDLDPKGKRVLVRVDYNVPVQDGKVQDETRILESLPTLRHLLAGGASLVLLSHLGRPKGPDPKYSLAPVGEALRAHLPEARFAPFPPGSEEARREAEALRPGEVLLLENVRFEPGEEKNDPELSARYARLGEAFVLDAFGSAHRAHASVVGVARLLPAYAGFLMEKEVRALSRLLKDPERPYAVVLGGAKVSDKIGVIESLLPRIDRLLIGGAMAFTFLKALGGEVGRSLVEEDRLDLAKDLLGRAEALGVRVYLPEDVVAAERIEAGVETRVFPARAIPVPYMGLDIGPKTREAFARALEGARTVFWNGPMGVFEVPPFDEGTLAVGQAIAALEGAFTVVGGGDSVAAVNRLGLKERFGHVSTGGGASLEFLEKGTLPGLEVLEG
>NC_006461.1|WP_011228284.1|865264_866260_+|type-I-glyceraldehyde-3-phosphate-dehydrogenase
MKVGINGFGRIGRQVFRILHERGVEVALINDLTDNKTLAHLLKYDSTYGRFPGAVGYDEENLYVDGKAIRATAIKDPREIPWKQAGVGVVVESTGVFTDGEKARAHLEAGAKKVIITAPAKNEDITVVLGVNHEQYDPAKHHILSNASCTTNSLAPVMKVLEEAFGVEKALMTTVHSYTNDQRLLDLPHKDLRRARAAALNIIPTTTGAAKATALVLPSLKGRFDGMALRVPTPTGSISDITALLKREVTAEEVNAALKAAAEGPLKGILAYTEDEIVLRDIVMDPHSSIVDGKLTKAIGNLVKVFAWYDNEWGYANRVADLVELVLKKGV
>NC_006461.1|WP_041443401.1|864547_865153_-|biotin-transporter-BioY
MKTEVLPYTPLMKTIWPQRTLSRDLLLILVGSLFVALTAQIALPLPFTPVPITGQTLGVLLVGAALGSRLGFLALLAYLLEGAMGLPVFAGGTGGIAKILGPTGGFLLAFPLAAGLVGLLVERFGLDRGFFGTLLAMLLGNALLYLVGLPWLAAWLMGAGKFGGVSALLAMGLFPFIPGDLVKAVLAALLFPTAWRFLGPR
>NC_006461.1|WP_011172991.1|863405_863840_-|SsrA-binding-protein-SmpB
MAPVLENRRARHDYEILETYEAGIALKGTEVKSLRAGKVDFTGSFARFEDGELYLENLYIAPYEKGSYANVDPRRKRKLLLHKHELRRLLGKVEQKGLTLVPLKIYFNERGYAKVLLGLARGKKAYEKRREDKKEAVRRALEEL
>NC_006461.1|WP_011228282.1|862254_863409_-|hypothetical-protein
MRALFLLFLAAFALAQAPKPLKVGELTGEALYPGNRGVSYGEVGLVARGLGLALWQGEGQVALGLGARYRTFPVEADEAKAASSLAAWRKDGRVYVPLRPLADALGLSYQAQVGIQLDLPWARLLQVEARPEGYLLRFSREVNAVVRPGGVLFLMAQGSHPSLVQEAMGLFLPLSRPPERVYYPGGGQVAVGLTPLPLPSPTVLLDPGHGGEDPGLEVQGLAEKEVALDLARRVAALLPGARLTRQGDETLPLEARLALARTASVVVSLHMARGREVRLYLPKDRTSPLAQSLPRLGDLPEERARLLRAYAGDPARLALALERALAAQGFAVVKAEGPYALTRVDGAAVLLEVGAERLGTEEARALVAQAIAQGIRAYLEGGAP
>NC_006461.1|WP_011172989.1|861760_862258_-|GerMN-domain-containing-protein
MRKYLSVYNLLGLLVFALGLFVYWQSPVPNPPKALPLPADEAAREEKLTLNLYRPDPPRGFLREPVVLEVGLGENPYEKALLAWAQATGSPTPLGLFAAEGRLVVDLPEDFVRGLDAEGEVYRLYSLAYTLLATFPEGSEVRFLVEGQPSPGLAHLDLEVPVRLP
>NC_006461.1|WP_011228296.1|873210_874164_-|IS110-like-element-IS1000B-family-transposase
MTFAGIDVSKTHLDLALVSNSPKPTRLRFPNSPEGRQALLAALAHHNPAWVALEPTSAYHLPLLKLLAENRLQVALVNPYHLAAFRKAKGERQKTDRQDALLLARYAQVYHEDLRAYTLPPETLRELKALVGYREDLAGRERTILNQMEAAEWAGSKEVLALLQKELACVKGLLGEVEARIQALLATLPEAEVLMALPGVGPQVAAAVLALLPPELWGRAKRAASYAGLIPEREESGKSVERSRLSKKGPPLLRRKLYMGALVAVRHDPEMRAFYHRLLSRGKRKKQALVAVAHKLLRRMMGRLREYYATQLDQGVA
>NC_006461.1|WP_011173000.1|874921_876034_-|AmmeMemoRadiSam-system-protein-B
MEGRLRLREPQITPIEGGFLVSDPYGVYEKPLALTEGGLFLLSLMEGRTLEEVQEEVFKRHGVLVPKKELEDLAKALEEAGLLLTEKVEARLKEEEEKLKRERPMRLAGLSYPEGEREARAFLEAFRASYPGEGEEARVLLMPHLEPSRVPEVYGAALAALEKTPPPERIYLVGVAHRPLKEKAAALPVPFQTPFGPALPDLPALQALDALLPFELFNTPLAFREEHSLELPLFFLKGRFPEARVLPLLVARRSPELGEALKVVLRDFPGLLVLAVDLSHVGPRFGDTPLTRTLAEEARRRDLGFLERLAEGEPEAALAFLGANPTRIDGVEVVASLLPLLRERKGKVLAHRLDLEAPTLSAVGAGTLVL
>NC_006461.1|WP_011228300.1|875987_877283_-|HDIG-domain-containing-protein
MDFPFYTPKDAFPVGGAVRDLLLGRRPTDLDYAALDPEGAAEEAKRRLGGSLFPLDPKRGHYRLVVGERTLDFTPLEGRLEEDLLRRDYRVNALLWKGGAVFGLKGVEEDLRRRLLVPVREENLYQDHLRSLRGVRLAATLGFGLPQRTREALGRHARFLQAHPEALPARERVKEELARLLLSPRAAFGLRLLERVGLLGVYLPELALLVGLHQGGVHHLPAWDHTLSAVFHLLWLWPEAPLEARLAALFHDVGKPLTRRFDPEVGRFRFLGHAEVGAEIARASLFWLRFPKEVVERAAGLVRRHMDRLPEERKALRRFFLRRQDLLPDLVYLMAADRLATRGVEREAWEVLGRYEEVLKDPLPQRPLLSGEEVMALLGLQEGPEVGRALKALLEAQAEGRVGTKEEARAFLLYWRGGREAQASGTPDHPH
>NC_006461.1|WP_011173002.1|877283_877895_+|dephospho-CoA-kinase
MGHEAKHPIIIGITGNIGSGKSTVAALLRSWGYPVLDLDALAARARENKEEELKRLFPEAVVGGRLDRRALARLVFSDPERLKALEAVVHPEVRRLLMEELSRLEAPLVFLEIPLLFEKGWEGRLHGTLLVAAPLEERVRRVMARSGLSREEVLARERAQMPEEEKRKRATWVLENTGSLEDLERALKAVLAELTGGAKGGRG
>NC_006461.1|WP_011228301.1|877863_878367_-|hypothetical-protein
MAAALLAGYLMGSLPFAFWFAALQGKAWSGREPLWRLGPVPAGLVLLLDFAKGVFAVALGEFLARDYTGGLAAGAAAAFAHALSPWLGLRRAGSLLAPLGVLFAVDPRLLLLAGLPAGVLLLGSRKAHPALLAFALALPLAALLLGGGQAHLLFALALSLALLWPPR
>NC_006461.1|WP_024119826.1|878570_879086_+|methyltransferase
MVRILGGKARGVALKVPASARPSPVRLRKALFDYLRLRYPRRGRFLDLFAGSGAVGLEAASEGWEAVLVEKDPEAVRLLKENVRRTGLGARVVALPVEVFLPEAKAQGERFTVAFMAPPYAMDLAALFGELLASGLVEAGGLYVLQHPKDLYLPLGERRVYGENALTLVEV
>NC_006461.1|WP_011173005.1|879086_879569_+|pantetheine-phosphate-adenylyltransferase
MHVVYPGSFDPLTNGHLDVIQRASRLFEKVTVAVLENPSKRGQYLFSAEERLAIIREATAHLANVEAATFSGLLVDFVRRVGAQAIVKGLRAVSDYEYELQMAHLNRQLYPGLETLFILAATRYSFVSSTMVKEIARYGGDVSKLVPPATLRALKAKLGQ
>NC_006461.1|WP_041443404.1|879579_881070_+|bifunctional-phosphoribosylaminoimidazolecarboxamide-formyltransferase/IMP-cyclohydrolase
MWALLSVADKRGIVDFARGLAELGFRLLATGGTYRALREAGLPVTYISDFTGFPEILEGRVKTLHPKVHAALLARPDQEEELKALGLERIGVLAVNLYPFRETVARGASFAEALEQIDIGGPAMLRAAAKNHQAVLPVCDPEDYPRVLEALKAGPSPDFRQKLARKAFAHTALYDAAIAEWLSGEKFPEEKLLALRREASLRYGENPHQEAALYRVVGERGPLLEAQVLQGKAMSFNNYLDAEAAWNLVSEFAEPACVAVKHQNPCGVALGETPLEAYRKAYEADPVSIFGGIVAFNRPLDGPTAEALAEVFLEVVLAPSFSPEARAVLARKKNLRLLQVPFPAQGPYLDLRRLRGGVLLQDADTEDPAEPKVVTERAPTPEEWPDLRFAWKVVKHVRSNAIVVAKGGMTLGIGVGQTNRLAAARHALEAAGERAKGAVLASDAFFPFDDVVRLAASYGIAAIIQPGGSVRDQDSIRAAEEAGIAMVFTGVRHFRH
>NC_006461.1|WP_011228302.1|881128_882427_-|tRNA-uridine-5-carboxymethylaminomethyl(34)-synthesis-GTPase-MnmE
MNLKDPICAIATPPGKGAIGVVRLSGEGALEIAARVWRGKDPRRLKGGRFALGEVVDPKTGEAIDQAILLVFRAPRSYTGEDLVEFQTHGSPAVLRRVMEVLVAEGARPAGRGEFTFRAYLNGKMDLAQAEAVLALIEAEGELARRQALRALEGALSRRIEALENRLLNLLAHIQALLDYPEEGVEPLEAERTIREVLAEVEALLAQAKASRLAQKGARLALIGAPNAGKSSLLNALLGYERALVSPIPGTTRDYLEAPLELFGIPLVAVDTAGVRETEDPVERMGVERALGIAEEADLVLYVVDRSQPKPAPPPLPWARTLKVATKSDLPPAWEDPEFLPVSSLTGEGLDRLKEAVREALLGREGGEVLLTERQVEALLRARERLEEALSLPEDLMGLALEEAARALALLTGKEVAEEVVARVFQNFCVGK
>NC_006461.1|WP_011228303.1|882423_882636_-|addiction-module-toxin,-HicA-family
MPPKTSEVARKLERLGFKPLPRRGKGGHRVYVHPDGRKVVLPLHSGEIPWGLFKTVLKQAGITEEEFRRA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_006461_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_006461_2

874397-874734

Orphan

III-A

Consensus_repeat	Method
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	PILER-CR
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	CRISPRCasFinder
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	CRT

4 spacers

The CRISPR arrays of NC_006461_2

>merge|NC_006461|2|874397-874734|PILER-CR,CRISPRCasFinder,CRT
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGACCACCTCACCTCCACTCGCTTATCACGCGCCTCCACCAATGGTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGACGGGGTCATAGATCCAGTCCCTAGGCGGGCCGAGGCGAATCCGTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGACTTGCTGATTGTGAATGATGCCCATTCCTCCTTAGAAGGAAGTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGACGCTCGTCACGGGAAGCGCAAAAAGGTAGCTCCTAAGGGTTGCAAGGGATTGAGCCCCGTAAGGGGATTACTGT

>NC_006461|2|2|874397-874661|PILER-CR
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	CACCTCACCTCCACTCGCTTATCACGCGCCTCCACCAATG
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	GGGGTCATAGATCCAGTCCCTAGGCGGGCCGAGGCGAATCC
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	TTGCTGATTGTGAATGATGCCCATTCCTCCTTAGAAGGAA
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC

>NC_006461|2|2|874397-874734|CRISPRCasFinder
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	CACCTCACCTCCACTCGCTTATCACGCGCCTCCACCAATG
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	GGGGTCATAGATCCAGTCCCTAGGCGGGCCGAGGCGAATCC
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	TTGCTGATTGTGAATGATGCCCATTCCTCCTTAGAAGGAA
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	GCTCGTCACGGGAAGCGCAAAAAGGTAGCTCCTAAGG
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTACTGT

>NC_006461|2|2|874397-874734|CRT
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	CACCTCACCTCCACTCGCTTATCACGCGCCTCCACCAATG
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	GGGGTCATAGATCCAGTCCCTAGGCGGGCCGAGGCGAATCC
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	TTGCTGATTGTGAATGATGCCCATTCCTCCTTAGAAGGAA
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	GCTCGTCACGGGAAGCGCAAAAAGGTAGCTCCTAAGG
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTACTGT

Protein	Signature genes	Signature genes Name	Protein_function
NC_006461.1\|WP_011172996.1\|867478_867766_+\|ribosome-binding-factor-A	unknown	unknown	gnl\|CDD\|376719
NC_006461.1\|WP_041443401.1\|864547_865153_-\|biotin-transporter-BioY	unknown	unknown	gnl\|CDD\|224187
NC_006461.1\|WP_011228303.1\|882423_882636_-\|addiction-module-toxin,-HicA-family	unknown	unknown	gnl\|CDD\|224638
NC_006461.1\|WP_011228302.1\|881128_882427_-\|tRNA-uridine-5-carboxymethylaminomethyl(34)-synthesis-GTPase-MnmE	unknown	unknown	gnl\|CDD\|235392
NC_006461.1\|WP_011228288.1\|869398_871633_+\|ribonuclease-R	unknown	unknown	gnl\|CDD\|273947
NC_006461.1\|WP_011228284.1\|865264_866260_+\|type-I-glyceraldehyde-3-phosphate-dehydrogenase	unknown	unknown	gnl\|CDD\|223135
NC_006461.1\|WP_011172991.1\|863405_863840_-\|SsrA-binding-protein-SmpB	unknown	unknown	gnl\|CDD\|235455
NC_006461.1\|WP_011173000.1\|874921_876034_-\|AmmeMemoRadiSam-system-protein-B	unknown	unknown	gnl\|CDD\|280116
NC_006461.1\|WP_011228296.1\|873210_874164_-\|IS110-like-element-IS1000B-family-transposase	unknown	unknown	gnl\|CDD\|376564
NC_006461.1\|WP_038039534.1\|882625_882847_-\|type-II-toxin-antitoxin-system-HicB-family-antitoxin	unknown	unknown	gnl\|CDD\|224514
NC_006461.1\|WP_041443404.1\|879579_881070_+\|bifunctional-phosphoribosylaminoimidazolecarboxamide-formyltransferase/IMP-cyclohydrolase	unknown	unknown	gnl\|CDD\|234854
NC_006461.1\|WP_024119826.1\|878570_879086_+\|methyltransferase	unknown	unknown	gnl\|CDD\|367574
NC_006461.1\|WP_011228286.1\|867744_868143_+\|acyl-CoA-thioesterase	unknown	unknown	gnl\|CDD\|223894
NC_006461.1\|WP_011228300.1\|875987_877283_-\|HDIG-domain-containing-protein	unknown	unknown	gnl\|CDD\|131739
NC_006461.1\|WP_011228282.1\|862254_863409_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|119407
NC_006461.1\|WP_011228301.1\|877863_878367_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|376884
NC_006461.1\|WP_011228287.1\|868152_869397_+\|aspartate-aminotransferase-family-protein	unknown	unknown	gnl\|CDD\|227325
NC_006461.1\|WP_011173002.1\|877283_877895_+\|dephospho-CoA-kinase	unknown	unknown	gnl\|CDD\|366476
NC_006461.1\|WP_011228285.1\|866260_867433_+\|phosphoglycerate-kinase	unknown	unknown	gnl\|CDD\|234613
NC_006461.1\|WP_011173005.1\|879086_879569_+\|pantetheine-phosphate-adenylyltransferase	unknown	unknown	gnl\|CDD\|234674

Protein	Function_ID	Function_description	E-value
NC_006461.1\|WP_011172996.1\|867478_867766_+\|ribosome-binding-factor-A	gnl\|CDD\|376719	pfam02033, RBFA, Ribosome-binding factor A.	1.86681e-12
NC_006461.1\|WP_041443401.1\|864547_865153_-\|biotin-transporter-BioY	gnl\|CDD\|224187	COG1268, BioY, Uncharacterized conserved protein [General function prediction only].	2.76434e-38
NC_006461.1\|WP_011228303.1\|882423_882636_-\|addiction-module-toxin,-HicA-family	gnl\|CDD\|224638	COG1724, COG1724, Predicted RNA binding protein (dsRBD-like fold), HicA family [General function prediction only].	3.3835e-12
NC_006461.1\|WP_011228302.1\|881128_882427_-\|tRNA-uridine-5-carboxymethylaminomethyl(34)-synthesis-GTPase-MnmE	gnl\|CDD\|235392	PRK05291, trmE, tRNA uridine-5-carboxymethylaminomethyl(34) synthesis GTPase MnmE.	0
NC_006461.1\|WP_011228288.1\|869398_871633_+\|ribonuclease-R	gnl\|CDD\|273947	TIGR02063, Ribonuclease_R, ribonuclease R. This family consists of an exoribonuclease, ribonuclease R, also called VacB. It is one of the eight exoribonucleases reported in E. coli and is broadly distributed throughout the bacteria. In E. coli, double mutants of this protein and polynucleotide phosphorylase are not viable. Scoring between trusted and noise cutoffs to the model are shorter, divergent forms from the Chlamydiae, and divergent forms from the Campylobacterales (including Helicobacter pylori) and Leptospira interrogans. [Transcription, Degradation of RNA].	0
NC_006461.1\|WP_011228284.1\|865264_866260_+\|type-I-glyceraldehyde-3-phosphate-dehydrogenase	gnl\|CDD\|223135	COG0057, GapA, Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism].	3.24933e-179
NC_006461.1\|WP_011172991.1\|863405_863840_-\|SsrA-binding-protein-SmpB	gnl\|CDD\|235455	PRK05422, smpB, SsrA-binding protein SmpB.	2.14685e-74
NC_006461.1\|WP_011173000.1\|874921_876034_-\|AmmeMemoRadiSam-system-protein-B	gnl\|CDD\|280116	pfam01875, Memo, Memo-like protein. This family contains members from all branches of life. The molecular function of this protein is unknown, but Memo (mediator of ErbB2-driven cell motility) a human protein is included in this family. It has been suggested that Memo controls cell migration by relaying extracellular chemotactic signals to the microtubule cytoskeleton.	2.49075e-89
NC_006461.1\|WP_011228296.1\|873210_874164_-\|IS110-like-element-IS1000B-family-transposase	gnl\|CDD\|376564	pfam01548, DEDD_Tnp_IS110, Transposase. Transposase proteins are necessary for efficient DNA transposition. This family includes an amino-terminal region of the pilin gene inverting protein (PIVML) and of members of the IS111A/IS1328/IS1533 family of transposases. The C-terminus is represented by family pfam02371.	2.28212e-29
NC_006461.1\|WP_038039534.1\|882625_882847_-\|type-II-toxin-antitoxin-system-HicB-family-antitoxin	gnl\|CDD\|224514	COG1598, COG1598, Predicted nuclease of the RNAse H fold, HicB family [General function prediction only].	2.55986e-11
NC_006461.1\|WP_041443404.1\|879579_881070_+\|bifunctional-phosphoribosylaminoimidazolecarboxamide-formyltransferase/IMP-cyclohydrolase	gnl\|CDD\|234854	PRK00881, purH, bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase; Provisional.	0
NC_006461.1\|WP_024119826.1\|878570_879086_+\|methyltransferase	gnl\|CDD\|367574	pfam03602, Cons_hypoth95, Conserved hypothetical protein 95.	7.13888e-38
NC_006461.1\|WP_011228286.1\|867744_868143_+\|acyl-CoA-thioesterase	gnl\|CDD\|223894	COG0824, FcbC, Predicted thioesterase [General function prediction only].	8.16799e-33
NC_006461.1\|WP_011228300.1\|875987_877283_-\|HDIG-domain-containing-protein	gnl\|CDD\|131739	TIGR02692, putative_tRNA_nucleotidyltransferase, tRNA adenylyltransferase. The enzyme tRNA adenylyltransferase, also called tRNA-nucleotidyltransferase and CCA-adding enzyme, can add or repair the required CCA triplet at the 3'-end of tRNA molecules. Genes encoding tRNA include the CCA tail in some but not all bacteria, and this enzyme may be required for viability. Members of this family represent a distinct clade within the larger family pfam01743 (tRNA nucleotidyltransferase/poly(A) polymerase family protein). The example from Streptomyces coelicolor was shown to act as a CCA-adding enzyme and not as a poly(A) polymerase. [Protein synthesis, tRNA and rRNA base modification].	9.96447e-45
NC_006461.1\|WP_011228282.1\|862254_863409_-\|hypothetical-protein	gnl\|CDD\|119407	cd02696, MurNAc-LAA, N-acetylmuramoyl-L-alanine amidase or MurNAc-LAA (also known as peptidoglycan aminohydrolase, NAMLA amidase, NAMLAA, Amidase 3, and peptidoglycan amidase; EC 3.5.1.28) is an autolysin that hydrolyzes the amide bond between N-acetylmuramoyl and L-amino acids in certain cell wall glycopeptides. These proteins are Zn-dependent peptidases with highly conserved residues involved in cation co-ordination. MurNAc-LAA in this family is one of several peptidoglycan hydrolases (PGHs) found in bacterial and bacteriophage or prophage genomes that are involved in the degradation of the peptidoglycan. In Escherichia coli, there are five MurNAc-LAAs present: AmiA, AmiB, AmiC and AmiD that are periplasmic, and AmpD that is cytoplasmic. Three of these (AmiA, AmiB and AmiC) belong to this family, the other two (AmiD and AmpD) do not. E. coli AmiA, AmiB and AmiC play an important role in cleaving the septum to release daughter cells after cell division. In general, bacterial MurNAc-LAAs are members of the bacterial autolytic system and carry a signal peptide in their N-termini that allows their transport across the cytoplasmic membrane. However, the bacteriophage MurNAc-LAAs are endolysins since these phage-encoded enzymes break down bacterial peptidoglycan at the terminal stage of the phage reproduction cycle. As opposed to autolysins, almost all endolysins have no signal peptides and their translocation through the cytoplasmic membrane is thought to proceed with the help of phage-encoded holin proteins. The amidase catalytic module is fused to another functional module (cell wall binding module or CWBM) either at the N- or C-terminus, which is responsible for high affinity binding of the protein to the cell wall.	1.54487e-27
NC_006461.1\|WP_011228301.1\|877863_878367_-\|hypothetical-protein	gnl\|CDD\|376884	pfam02660, G3P_acyltransf, Glycerol-3-phosphate acyltransferase. This family of enzymes catalyzes the transfer of an acyl group from acyl-ACP to glycerol-3-phosphate to form lysophosphatidic acid.	4.88457e-11
NC_006461.1\|WP_011228287.1\|868152_869397_+\|aspartate-aminotransferase-family-protein	gnl\|CDD\|227325	COG4992, ArgD, Ornithine/acetylornithine aminotransferase [Amino acid transport and metabolism].	0
NC_006461.1\|WP_011173002.1\|877283_877895_+\|dephospho-CoA-kinase	gnl\|CDD\|366476	pfam01121, CoaE, Dephospho-CoA kinase. This family catalyzes the phosphorylation of the 3'-hydroxyl group of dephosphocoenzyme A to form Coenzyme A EC:2.7.1.24. This enzyme uses ATP in its reaction.	2.68828e-81
NC_006461.1\|WP_011228285.1\|866260_867433_+\|phosphoglycerate-kinase	gnl\|CDD\|234613	PRK00073, pgk, phosphoglycerate kinase; Provisional.	0
NC_006461.1\|WP_011173005.1\|879086_879569_+\|pantetheine-phosphate-adenylyltransferase	gnl\|CDD\|234674	PRK00168, coaD, phosphopantetheine adenylyltransferase; Provisional.	6.3222e-102

>NC_006461.1|WP_011228296.1|873210_874164_-|IS110-like-element-IS1000B-family-transposase
MTFAGIDVSKTHLDLALVSNSPKPTRLRFPNSPEGRQALLAALAHHNPAWVALEPTSAYHLPLLKLLAENRLQVALVNPYHLAAFRKAKGERQKTDRQDALLLARYAQVYHEDLRAYTLPPETLRELKALVGYREDLAGRERTILNQMEAAEWAGSKEVLALLQKELACVKGLLGEVEARIQALLATLPEAEVLMALPGVGPQVAAAVLALLPPELWGRAKRAASYAGLIPEREESGKSVERSRLSKKGPPLLRRKLYMGALVAVRHDPEMRAFYHRLLSRGKRKKQALVAVAHKLLRRMMGRLREYYATQLDQGVA
>NC_006461.1|WP_011228288.1|869398_871633_+|ribonuclease-R
MQETLLEFFKKTGRPHRLEEILHRFGLEKREAKAHLKALVARGLLEKKGSRYFLANRVQGPLSLHRDGYGFVRLPEGDLFVPPGYTGDAWPGDLVEARVMPPGRDGRPWGVVERVLKRARERLVGTLDFRKGRALLLPDEPNLPELPLAPEGLEGLKRGSRIVVQVHYGKRPYGTFLAYLGEGEAPETETEAVIAKYGLRAEFPEEVLKEAEAIPLEIPEAELRRREDFRGLRVFTIDGVDAKDFDDAIHVERLPGGYRIGVHIADVSHYVKEGSLLDQEAFLRGTSVYLPGRVLPMLPERLSNGVCSLRPGEDRLVLSVLVDLTEDLKVKRVRFREGVIRSVARLTYTEVEAFAEGFGLPEEHAFLAEDLRLLLDLTQRMREKRLKEGALDFAFPEVKVEVGEEGELHLIPQAEPKARSLIEELMLLANRLVAEYLVQKGLPGLFRVHEEPVQDAYEKLRQALARLGYTLPPKLSGHALQKALLASRGRPEEPVVAYLVLRSLRLARYAPENLGHFGLAMEHYLHFTSPIRRYPDLVVHRVLKAALRRTLTPARKARWQEAFPAIAEHASEMERKAEAAERELTKYYMAKWAELHVGERFLGKVTGVANFGAFVTLPNGVEGLVRLEALGPYTYSEEAMALLGPKGRRIRLGDEMEVRIAGANPRLRQVDLLPVEEAPKKTKNRKEKAKEVEMRKVVGPPKDRARDTRPERATVNTIYFGEWTPKEPEEPRPERTRARKKRRR
>NC_006461.1|WP_011228287.1|868152_869397_+|aspartate-aminotransferase-family-protein
MDLDAFTLFERHINPGLAGLLRFTGLDRVESHAEGPYVWDTQGKRYLDFLGLYGTLNLGHRHPKVVEAVKRQLDRMPMSVRVLVSEPTARLAAKLAEITPEGLEMVFFGNSGAEAVEAAIKLARAYTGKPGIVTTQGGFHGKTMGALSLTPKPEYQDPARPLLPGVKVVPYGDLKALEEAIDETTAAVIVEPIQGEGGIRVPPEGYLRGVRELTREKGVLMIADEVQTGLGRTGKLFGVDWEGVSPDLMTLAKALGGGVMPIGACVGRREVFEVFKNNPLFHSSTFGGNPLAAAAALAAIEVTLEEDLPGRALELGRHLMEGLKVLKEEHPHLIEDVRGRGLMVGVEFADADIGALVVAEMAERGVLTAFGLNNPKVVRLEPPLIIGKEHVDEALAVFAEALKATEKALEGLLG
>NC_006461.1|WP_011228286.1|867744_868143_+|acyl-CoA-thioesterase
MESVTRIKVRYAETDQMGVVHHSVYAVYLEAARVDFLERAGLPYHRVEARGVFFPVVELGLTFRAPARFGEVVEVRTRLAELSSRALLFRYRVEREGVLLAEGFTRHLCQVGERAARIPEDIYRALSVLHLK
>NC_006461.1|WP_011172996.1|867478_867766_+|ribosome-binding-factor-A
MAYGKAHLEAQLKRALAEEIQALEDPRLFLLTVEAVRLSKDGSVLSVYVEAFREEEGALRALSRAERRLVAALARRVRMRRLPRLEFLPWRASPA
>NC_006461.1|WP_011228285.1|866260_867433_+|phosphoglycerate-kinase
MRTLLDLDPKGKRVLVRVDYNVPVQDGKVQDETRILESLPTLRHLLAGGASLVLLSHLGRPKGPDPKYSLAPVGEALRAHLPEARFAPFPPGSEEARREAEALRPGEVLLLENVRFEPGEEKNDPELSARYARLGEAFVLDAFGSAHRAHASVVGVARLLPAYAGFLMEKEVRALSRLLKDPERPYAVVLGGAKVSDKIGVIESLLPRIDRLLIGGAMAFTFLKALGGEVGRSLVEEDRLDLAKDLLGRAEALGVRVYLPEDVVAAERIEAGVETRVFPARAIPVPYMGLDIGPKTREAFARALEGARTVFWNGPMGVFEVPPFDEGTLAVGQAIAALEGAFTVVGGGDSVAAVNRLGLKERFGHVSTGGGASLEFLEKGTLPGLEVLEG
>NC_006461.1|WP_011228284.1|865264_866260_+|type-I-glyceraldehyde-3-phosphate-dehydrogenase
MKVGINGFGRIGRQVFRILHERGVEVALINDLTDNKTLAHLLKYDSTYGRFPGAVGYDEENLYVDGKAIRATAIKDPREIPWKQAGVGVVVESTGVFTDGEKARAHLEAGAKKVIITAPAKNEDITVVLGVNHEQYDPAKHHILSNASCTTNSLAPVMKVLEEAFGVEKALMTTVHSYTNDQRLLDLPHKDLRRARAAALNIIPTTTGAAKATALVLPSLKGRFDGMALRVPTPTGSISDITALLKREVTAEEVNAALKAAAEGPLKGILAYTEDEIVLRDIVMDPHSSIVDGKLTKAIGNLVKVFAWYDNEWGYANRVADLVELVLKKGV
>NC_006461.1|WP_041443401.1|864547_865153_-|biotin-transporter-BioY
MKTEVLPYTPLMKTIWPQRTLSRDLLLILVGSLFVALTAQIALPLPFTPVPITGQTLGVLLVGAALGSRLGFLALLAYLLEGAMGLPVFAGGTGGIAKILGPTGGFLLAFPLAAGLVGLLVERFGLDRGFFGTLLAMLLGNALLYLVGLPWLAAWLMGAGKFGGVSALLAMGLFPFIPGDLVKAVLAALLFPTAWRFLGPR
>NC_006461.1|WP_011172991.1|863405_863840_-|SsrA-binding-protein-SmpB
MAPVLENRRARHDYEILETYEAGIALKGTEVKSLRAGKVDFTGSFARFEDGELYLENLYIAPYEKGSYANVDPRRKRKLLLHKHELRRLLGKVEQKGLTLVPLKIYFNERGYAKVLLGLARGKKAYEKRREDKKEAVRRALEEL
>NC_006461.1|WP_011228282.1|862254_863409_-|hypothetical-protein
MRALFLLFLAAFALAQAPKPLKVGELTGEALYPGNRGVSYGEVGLVARGLGLALWQGEGQVALGLGARYRTFPVEADEAKAASSLAAWRKDGRVYVPLRPLADALGLSYQAQVGIQLDLPWARLLQVEARPEGYLLRFSREVNAVVRPGGVLFLMAQGSHPSLVQEAMGLFLPLSRPPERVYYPGGGQVAVGLTPLPLPSPTVLLDPGHGGEDPGLEVQGLAEKEVALDLARRVAALLPGARLTRQGDETLPLEARLALARTASVVVSLHMARGREVRLYLPKDRTSPLAQSLPRLGDLPEERARLLRAYAGDPARLALALERALAAQGFAVVKAEGPYALTRVDGAAVLLEVGAERLGTEEARALVAQAIAQGIRAYLEGGAP
>NC_006461.1|WP_011173000.1|874921_876034_-|AmmeMemoRadiSam-system-protein-B
MEGRLRLREPQITPIEGGFLVSDPYGVYEKPLALTEGGLFLLSLMEGRTLEEVQEEVFKRHGVLVPKKELEDLAKALEEAGLLLTEKVEARLKEEEEKLKRERPMRLAGLSYPEGEREARAFLEAFRASYPGEGEEARVLLMPHLEPSRVPEVYGAALAALEKTPPPERIYLVGVAHRPLKEKAAALPVPFQTPFGPALPDLPALQALDALLPFELFNTPLAFREEHSLELPLFFLKGRFPEARVLPLLVARRSPELGEALKVVLRDFPGLLVLAVDLSHVGPRFGDTPLTRTLAEEARRRDLGFLERLAEGEPEAALAFLGANPTRIDGVEVVASLLPLLRERKGKVLAHRLDLEAPTLSAVGAGTLVL
>NC_006461.1|WP_011228300.1|875987_877283_-|HDIG-domain-containing-protein
MDFPFYTPKDAFPVGGAVRDLLLGRRPTDLDYAALDPEGAAEEAKRRLGGSLFPLDPKRGHYRLVVGERTLDFTPLEGRLEEDLLRRDYRVNALLWKGGAVFGLKGVEEDLRRRLLVPVREENLYQDHLRSLRGVRLAATLGFGLPQRTREALGRHARFLQAHPEALPARERVKEELARLLLSPRAAFGLRLLERVGLLGVYLPELALLVGLHQGGVHHLPAWDHTLSAVFHLLWLWPEAPLEARLAALFHDVGKPLTRRFDPEVGRFRFLGHAEVGAEIARASLFWLRFPKEVVERAAGLVRRHMDRLPEERKALRRFFLRRQDLLPDLVYLMAADRLATRGVEREAWEVLGRYEEVLKDPLPQRPLLSGEEVMALLGLQEGPEVGRALKALLEAQAEGRVGTKEEARAFLLYWRGGREAQASGTPDHPH
>NC_006461.1|WP_011173002.1|877283_877895_+|dephospho-CoA-kinase
MGHEAKHPIIIGITGNIGSGKSTVAALLRSWGYPVLDLDALAARARENKEEELKRLFPEAVVGGRLDRRALARLVFSDPERLKALEAVVHPEVRRLLMEELSRLEAPLVFLEIPLLFEKGWEGRLHGTLLVAAPLEERVRRVMARSGLSREEVLARERAQMPEEEKRKRATWVLENTGSLEDLERALKAVLAELTGGAKGGRG
>NC_006461.1|WP_011228301.1|877863_878367_-|hypothetical-protein
MAAALLAGYLMGSLPFAFWFAALQGKAWSGREPLWRLGPVPAGLVLLLDFAKGVFAVALGEFLARDYTGGLAAGAAAAFAHALSPWLGLRRAGSLLAPLGVLFAVDPRLLLLAGLPAGVLLLGSRKAHPALLAFALALPLAALLLGGGQAHLLFALALSLALLWPPR
>NC_006461.1|WP_024119826.1|878570_879086_+|methyltransferase
MVRILGGKARGVALKVPASARPSPVRLRKALFDYLRLRYPRRGRFLDLFAGSGAVGLEAASEGWEAVLVEKDPEAVRLLKENVRRTGLGARVVALPVEVFLPEAKAQGERFTVAFMAPPYAMDLAALFGELLASGLVEAGGLYVLQHPKDLYLPLGERRVYGENALTLVEV
>NC_006461.1|WP_011173005.1|879086_879569_+|pantetheine-phosphate-adenylyltransferase
MHVVYPGSFDPLTNGHLDVIQRASRLFEKVTVAVLENPSKRGQYLFSAEERLAIIREATAHLANVEAATFSGLLVDFVRRVGAQAIVKGLRAVSDYEYELQMAHLNRQLYPGLETLFILAATRYSFVSSTMVKEIARYGGDVSKLVPPATLRALKAKLGQ
>NC_006461.1|WP_041443404.1|879579_881070_+|bifunctional-phosphoribosylaminoimidazolecarboxamide-formyltransferase/IMP-cyclohydrolase
MWALLSVADKRGIVDFARGLAELGFRLLATGGTYRALREAGLPVTYISDFTGFPEILEGRVKTLHPKVHAALLARPDQEEELKALGLERIGVLAVNLYPFRETVARGASFAEALEQIDIGGPAMLRAAAKNHQAVLPVCDPEDYPRVLEALKAGPSPDFRQKLARKAFAHTALYDAAIAEWLSGEKFPEEKLLALRREASLRYGENPHQEAALYRVVGERGPLLEAQVLQGKAMSFNNYLDAEAAWNLVSEFAEPACVAVKHQNPCGVALGETPLEAYRKAYEADPVSIFGGIVAFNRPLDGPTAEALAEVFLEVVLAPSFSPEARAVLARKKNLRLLQVPFPAQGPYLDLRRLRGGVLLQDADTEDPAEPKVVTERAPTPEEWPDLRFAWKVVKHVRSNAIVVAKGGMTLGIGVGQTNRLAAARHALEAAGERAKGAVLASDAFFPFDDVVRLAASYGIAAIIQPGGSVRDQDSIRAAEEAGIAMVFTGVRHFRH
>NC_006461.1|WP_011228302.1|881128_882427_-|tRNA-uridine-5-carboxymethylaminomethyl(34)-synthesis-GTPase-MnmE
MNLKDPICAIATPPGKGAIGVVRLSGEGALEIAARVWRGKDPRRLKGGRFALGEVVDPKTGEAIDQAILLVFRAPRSYTGEDLVEFQTHGSPAVLRRVMEVLVAEGARPAGRGEFTFRAYLNGKMDLAQAEAVLALIEAEGELARRQALRALEGALSRRIEALENRLLNLLAHIQALLDYPEEGVEPLEAERTIREVLAEVEALLAQAKASRLAQKGARLALIGAPNAGKSSLLNALLGYERALVSPIPGTTRDYLEAPLELFGIPLVAVDTAGVRETEDPVERMGVERALGIAEEADLVLYVVDRSQPKPAPPPLPWARTLKVATKSDLPPAWEDPEFLPVSSLTGEGLDRLKEAVREALLGREGGEVLLTERQVEALLRARERLEEALSLPEDLMGLALEEAARALALLTGKEVAEEVVARVFQNFCVGK
>NC_006461.1|WP_011228303.1|882423_882636_-|addiction-module-toxin,-HicA-family
MPPKTSEVARKLERLGFKPLPRRGKGGHRVYVHPDGRKVVLPLHSGEIPWGLFKTVLKQAGITEEEFRRA
>NC_006461.1|WP_038039534.1|882625_882847_-|type-II-toxin-antitoxin-system-HicB-family-antitoxin
MRYTVVLRPDPETPGVWLAEVPALPWCATFGHSPEEALENAKDALEAALEALEALGEAPPPDVTVAQISLDAA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NC_006462_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_006462_1

18044-18305

Orphan

III-A

Consensus_repeat	Method
GTCGCAATCCCCTTACGGGGCTCAATCCCTTGCAAC	CRISPRCasFinder
GTCGCAATCCCCTTACGGGGCTCAATCCCTTGCAAC	CRT
GGGTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	PILER-CR

3 spacers

The CRISPR arrays of NC_006462_1

>merge|NC_006462|1|18044-18305|CRISPRCasFinder,CRT,PILER-CR
GCATCAATCCCCTTACGGGGCTCAATCCCTTGCAACCCGGTTGTCAACGACGACCGGGAGATAAAGGGGCTCATGTCGCAATCCCCTTACGGGGCTCAATCCCTTGCAACGCGACCATCGTCGCCCGCCCTGACGGCGGACCTAAGCGGTCGCAATCCCCTTACGGGGCTCAATCCCTTGCAACCCTTGGAGAAGGCCTTGGAGAAGGTTTCCCCCACCCTGGTGTCGCAATCCCCTTACGGGGCTCAATCCCTTGCAACGG

>NC_006462|1|1|18044-18303|CRISPRCasFinder
GCATCAATCCCCTTACGGGGCTCAATCCCTTGCAAC	CCGGTTGTCAACGACGACCGGGAGATAAAGGGGCTCAT
GTCGCAATCCCCTTACGGGGCTCAATCCCTTGCAAC	GCGACCATCGTCGCCCGCCCTGACGGCGGACCTAAGCG
GTCGCAATCCCCTTACGGGGCTCAATCCCTTGCAAC	CCTTGGAGAAGGCCTTGGAGAAGGTTTCCCCCACCCTGGT
GTCGCAATCCCCTTACGGGGCTCAATCCCTTGCAAC

>NC_006462|1|1|18044-18303|CRT
GCATCAATCCCCTTACGGGGCTCAATCCCTTGCAAC	CCGGTTGTCAACGACGACCGGGAGATAAAGGGGCTCAT
GTCGCAATCCCCTTACGGGGCTCAATCCCTTGCAAC	GCGACCATCGTCGCCCGCCCTGACGGCGGACCTAAGCG
GTCGCAATCCCCTTACGGGGCTCAATCCCTTGCAAC	CCTTGGAGAAGGCCTTGGAGAAGGTTTCCCCCACCCTGGT
GTCGCAATCCCCTTACGGGGCTCAATCCCTTGCAAC

>NC_006462|1|1|18048-18305|PILER-CR
CAATCCCCTTACGGGGCTCAATCCCTTGCAACCCGGTT	GTCAACGACGACCGGGAGATAAAGGGGCTCATGTCG
CAATCCCCTTACGGGGCTCAATCCCTTGCAACGCGACC	ATCGTCGCCCGCCCTGACGGCGGACCTAAGCGGTCG
CAATCCCCTTACGGGGCTCAATCCCTTGCAACCCTTGG	AGAAGGCCTTGGAGAAGGTTTCCCCCACCCTGGTGTCG
CAATCCCCTTACGGGGCTCAATCCCTTGCAACGG

Protein	Signature genes	Signature genes Name	Protein_function
NC_006462.1\|WP_011229257.1\|10274_10730_-\|MaoC-family-dehydratase	unknown	unknown	gnl\|CDD\|239530
NC_006462.1\|WP_164926106.1\|28562_31178_-\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|226456
NC_006462.1\|WP_011229247.1\|18730_19525_+\|carbohydrate-deacetylase	unknown	unknown	gnl\|CDD\|212113
NC_006462.1\|WP_011229238.1\|33582_34278_+\|hypothetical-protein	unknown	unknown	unknown
NC_006462.1\|WP_164926104.1\|14193_15357_-\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|224292
NC_006462.1\|WP_011229236.1\|36194_37517_-\|cobyrinate-a,c-diamide-synthase	unknown	unknown	gnl\|CDD\|234896
NC_006462.1\|WP_011174342.1\|31850_33125_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|236090
NC_006462.1\|WP_011229240.1\|26954_28217_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340890
NC_006462.1\|WP_011229249.1\|17143_17341_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227511
NC_006462.1\|WP_011229254.1\|12047_13184_-\|acyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173847
NC_006462.1\|WP_164926107.1\|34274_35861_+\|hypothetical-protein	unknown	unknown	unknown
NC_006462.1\|WP_011229259.1\|8944_9889_-\|AMP-binding-protein	unknown	unknown	gnl\|CDD\|341284
NC_006462.1\|WP_164926105.1\|22529_24911_+\|glycoside-hydrolase-family-31-protein	unknown	unknown	gnl\|CDD\|224418
NC_006462.1\|WP_011229250.1\|16327_17122_+\|hypothetical-protein	unknown	unknown	unknown
NC_006462.1\|WP_011229253.1\|13170_13746_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380061
NC_006462.1\|WP_011229256.1\|10713_11505_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|235546
NC_006462.1\|WP_011229260.1\|8183_8945_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|181295
NC_006462.1\|WP_011229244.1\|20793_22518_+\|beta-galactosidase	unknown	unknown	gnl\|CDD\|236657
NC_006462.1\|WP_011229258.1\|9924_10278_-\|PaaI-family-thioesterase	unknown	unknown	gnl\|CDD\|239527
NC_006462.1\|WP_011174341.1\|33124_33574_+\|YbjN-domain-containing-protein	unknown	unknown	gnl\|CDD\|341122

Protein	Function_ID	Function_description	E-value
NC_006462.1\|WP_011229257.1\|10274_10730_-\|MaoC-family-dehydratase	gnl\|CDD\|239530	cd03446, MaoC_like, MoaC_like Similar to the MaoC (monoamine oxidase C) dehydratase regulatory protein but without the N-terminal PutA domain. This protein family has a hot-dog fold similar to that of (R)-specific enoyl-CoA hydratase, the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit.	7.96632e-77
NC_006462.1\|WP_164926106.1\|28562_31178_-\|transcriptional-regulator	gnl\|CDD\|226456	COG3947, COG3947, Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms].	5.66975e-11
NC_006462.1\|WP_011229247.1\|18730_19525_+\|carbohydrate-deacetylase	gnl\|CDD\|212113	cd10802, YdjC_TTHB029_like, Thermus thermophiles TTHB029 and similar proteins. This subfamily is represented by an YdjC-family protein TTHB029 from Thermus thermophilus HB8; it is similar to Escherichia coli YdjC, a hypothetical protein encoded by the celG gene. TTHB029 functions as a homodimer. Each of monomer consists of (beta/alpha)-barrel fold. The molecular function of TTHB029 is unclear.	7.55678e-75
NC_006462.1\|WP_164926104.1\|14193_15357_-\|ATP-binding-protein	gnl\|CDD\|224292	COG1373, COG1373, Predicted ATPase (AAA+ superfamily) [General function prediction only].	2.93899e-61
NC_006462.1\|WP_011229236.1\|36194_37517_-\|cobyrinate-a,c-diamide-synthase	gnl\|CDD\|234896	PRK01077, PRK01077, cobyrinate a,c-diamide synthase.	0
NC_006462.1\|WP_011174342.1\|31850_33125_+\|hypothetical-protein	gnl\|CDD\|236090	PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated.	5.92224e-06
NC_006462.1\|WP_011229240.1\|26954_28217_+\|MFS-transporter	gnl\|CDD\|340890	cd17332, MFS_MelB_like, Salmonella enterica Na+/melibiose symporter MelB and similar transporters of the Major Facilitator Superfamily. This family is composed of Salmonella enterica Na+/melibiose symporter MelB, Major Facilitator Superfamily domain-containing proteins, MFSD2 and MFSD12, and other sugar transporters. MelB catalyzes the electrogenic symport of galactosides with Na+, Li+ or H+. The MFSD2 subfamily is composed of two vertebrate members, MFSD2A and MFSD2B. MFSD2A is more commonly called sodium-dependent lysophosphatidylcholine symporter 1 (NLS1). It is an LPC symporter that plays an essential role for blood-brain barrier formation and function. Inactivating mutations in MFSD2A cause a lethal microcephaly syndrome. MFSD2B is a potential risk or protect factor in the prognosis of lung adenocarcinoma. MelB-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	2.86661e-88
NC_006462.1\|WP_011229249.1\|17143_17341_-\|hypothetical-protein	gnl\|CDD\|227511	COG5184, ATS1, Alpha-tubulin suppressor and related RCC1 domain-containing proteins [Cell division and chromosome partitioning / Cytoskeleton].	0.000214799
NC_006462.1\|WP_011229254.1\|12047_13184_-\|acyl-CoA-dehydrogenase	gnl\|CDD\|173847	cd01158, SCAD_SBCAD, Short chain acyl-CoA dehydrogenases and eukaryotic short/branched chain acyl-CoA dehydrogenases. Short chain acyl-CoA dehydrogenase (SCAD). SCAD is a mitochondrial beta-oxidation enzyme. It catalyzes the alpha,beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of SCAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. This subgroup also contains the eukaryotic short/branched chain acyl-CoA dehydrogenase(SBCAD), the bacterial butyryl-CoA dehydorgenase(BCAD) and 2-methylbutyryl-CoA dehydrogenase, which is involved in isoleucine catabolism. These enzymes are homotetramers.	2.50206e-157
NC_006462.1\|WP_011229259.1\|8944_9889_-\|AMP-binding-protein	gnl\|CDD\|341284	cd12119, ttLC_FACS_AlkK_like, Fatty acyl-CoA synthetases similar to LC-FACS from Thermus thermophiles. This family includes fatty acyl-CoA synthetases that can activate medium-chain to long-chain fatty acids. They catalyze the ATP-dependent acylation of fatty acids in a two-step reaction. The carboxylate substrate first reacts with ATP to form an acyl-adenylate intermediate, which then reacts with CoA to produce an acyl-CoA ester. The fatty acyl-CoA synthetases are responsible for fatty acid degradation as well as physiological regulation of cellular functions via the production of fatty acyl-CoA esters. The fatty acyl-CoA synthetase from Thermus thermophiles in this family catalyzes the long-chain fatty acid, myristoyl acid, while another member in this family, the AlkK protein identified from Pseudomonas oleovorans, targets medium chain fatty acids. This family also includes uncharacterized FACS proteins.	1.07669e-95
NC_006462.1\|WP_164926105.1\|22529_24911_+\|glycoside-hydrolase-family-31-protein	gnl\|CDD\|224418	COG1501, COG1501, Alpha-glucosidases, family 31 of glycosyl hydrolases [Carbohydrate transport and metabolism].	0
NC_006462.1\|WP_011229253.1\|13170_13746_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|380061	pfam17932, TetR_C_24, Tetracyclin repressor-like, C-terminal domain. TetR family regulators are involved in the transcriptional control of multidrug efflux pumps, pathways for the biosynthesis of antibiotics, response to osmotic stress and toxic chemicals, control of catabolic pathways, differentiation processes, and pathogenicity. The TetR proteins identified in overm ultiple genera of bacteria and archaea share a common helix-turn-helix (HTH) structure in their DNA-binding domain. However, TetR proteins can work in different ways: they can bind a target operator directly to exert their effect (e.g. TetR binds Tet(A) gene to repress it in the absence of tetracycline), or they can be involved in complex regulatory cascades in which the TetR protein can either be modulated by another regulator or TetR can trigger the cellular response. TetR regulates the expression of the membrane-associated tetracycline resistance protein, TetA, which exports the tetracycline antibiotic out of the cell before it can attach to the ribosomes and inhibit protein synthesis. TetR blocks transcription from the genes encoding both TetA and TetR in the absence of antibiotic. The C-terminal domain is multi-helical and is interlocked in the homodimer with the helix-turn-helix (HTH) DNA-binding domain. This entry represents the C-terminal domain present in family members such as HTH-type transcriptional repressor KstR2 as well as fatty acid metabolism regulator proteins. In Mycobacterium smegmatis, KstR2 is involved in involved in cholesterol catabolism, while YsiA in Bacillus subtilis is involved in fatty acid degradation.	5.43104e-39
NC_006462.1\|WP_011229256.1\|10713_11505_-\|SDR-family-oxidoreductase	gnl\|CDD\|235546	PRK05653, fabG, 3-oxoacyl-ACP reductase FabG.	4.63307e-80
NC_006462.1\|WP_011229260.1\|8183_8945_-\|SDR-family-oxidoreductase	gnl\|CDD\|181295	PRK08213, PRK08213, gluconate 5-dehydrogenase; Provisional.	3.73233e-127
NC_006462.1\|WP_011229244.1\|20793_22518_+\|beta-galactosidase	gnl\|CDD\|236657	PRK10150, PRK10150, beta-D-glucuronidase; Provisional.	4.27967e-35
NC_006462.1\|WP_011229258.1\|9924_10278_-\|PaaI-family-thioesterase	gnl\|CDD\|239527	cd03443, PaaI_thioesterase, PaaI_thioesterase is a tetrameric acyl-CoA thioesterase with a hot dog fold and one of several proteins responsible for phenylacetic acid (PA) degradation in bacteria. Although orthologs of PaaI exist in archaea and eukaryotes, their function has not been determined. Sequence similarity between PaaI, E. coli medium chain acyl-CoA thioesterase II, and human thioesterase III suggests they all belong to the same thioesterase superfamily. The conserved fold present in these thioesterases is referred to as an asymmetric hot dog fold, similar to those of 4-hydroxybenzoyl-CoA thioesterase (4HBT) and the beta-hydroxydecanoyl-ACP dehydratases (FabA/FabZ).	1.67748e-26
NC_006462.1\|WP_011174341.1\|33124_33574_+\|YbjN-domain-containing-protein	gnl\|CDD\|341122	cd17511, YbjN_AmyR-like, YbjN protein family is structurally similar to type III secretion system chaperones. This YbjN protein family includes Escherichia coli YbjN, Erwinia amylovora AmyR, and similar proteins. YbjN proteins share a class I type III secretion chaperone (T3SC)-like fold with type III secretion system (T3SS) chaperone proteins but appear to function independently of the T3SS. YbjN is an enterobacteria-specific protein. In E. coli, it acts as a sensory transduction regulator that may play important roles in regulating bacterial multicellular behavior, metabolism, and survival under stress conditions. E. amylovora AmyR, a functionally conserved ortholog of E. coli YbjN, is a stress and virulence associated protein that regulates the ams operon. Ams proteins are required for amylovoran biosynthesis. AmyR may also regulate the Rcs phosphorelay system, an atypical two-component signal transduction (TCST) system present only in Enterobacteriaceae and positively regulates amylovoran biosynthesis by activating the ams operon transcription.	5.22626e-28

>NC_006462.1|WP_011229249.1|17143_17341_-|hypothetical-protein
MGYQSRATLVQVQGIAGVREATGGWDFTVIFKEDGTVWSVGANNCGQLGDGTHVDRNPIVFVAAP
>NC_006462.1|WP_011229250.1|16327_17122_+|hypothetical-protein
MRGWRKLRLAWRNKEGRQTLIAPLLLLVVALLSLGGAGFRWTDVATLGLVFLFLEEVSRLSSTPWPPLPFWARLGLLLRFFFAREERGVLAGKPFRGRLPVLAYDLEREKLAFGLLTEGVSLKLPELLFAALLEANPSRNPSTPCPGGTPLVLPWGEGEVHLCAPRGAPGLGWAELRLLRVRARTLKVEPPVPLARLGELLEDGAAFPHLFGPRVPPGLARSLLEAPITRETAALLDHFLEGRSIPSGPPTGGQGPLSPPSGRA
>NC_006462.1|WP_164926104.1|14193_15357_-|ATP-binding-protein
MIPRRLQPLLEARLEEVPVVVLTGPRQAGKTTLALEVAQRREALYLDLESEADRAKLSAPELYLEAHLGRLVILDEVHRMPGLFPLLRSLVDRARRRGLRNGLYLLLGSLAPEVSRQAGESLAGRASYLELSPFDLLEVGREAEPVLWLRGGFPESFLALEDEESFRWRMDFLRSYVEREIPLLGGRLPAEVLRRFLTMLAHLQGELLNASALARNLGLDGRTVNRYLDFLVDLYLLRRLPPLEANVGKRLVKSPKLYLRDSGLVHALLGIRTLEDLLAHPVVGRSYEGFVVENLLRVLPEGGEAYFYRTRAGAEVDLVLLLPGGRFWAVEVKRSLDPRPSRGFHEALKDLKPQEAFVIYPGGETFPVGEGVFAAPLGAVMERLWRG
>NC_006462.1|WP_011229253.1|13170_13746_-|TetR/AcrR-family-transcriptional-regulator
MVTTTRDRILEEAAKLFTEKGYEATSVQDLAQALGLSKAALYHHFGSKEEILYEISLLALKGLVAAGEKALEVADPKEALRRFMEAHARYFEENYPFFVTMLQGIKSLSPENRLKTIALRDRHEENLRAILRRGVEQGVFREVDVALAGRAVLSMLNWMIRWFRPDGPMRAEEVARAYHDLILRGLERGSA
>NC_006462.1|WP_011229254.1|12047_13184_-|acyl-CoA-dehydrogenase
MEVPEHKEIRELARRFLSERGGALRAYEEEEAFPWPLVEEMAELGFLGVFVPEALGGAGLDFFAYLALLEEMGGWASLRSVLSVQQSLVLTPLLAYGTEAQKARYVPRLARREILGAFALTEPEAGSDAASLKTRAHREGDFYVLEGQKTFISHANVAEVFLVFAKTDPEKGAKGITCFLVERGDGVKTSPLKGKLGLRAADTGMVFLDGVRVPKDRVLGKEGEGFRIALSTLDTGRISLAAGAVGLMQRALDLSLAYTRERKQFGKPIAQFQLVQEHLAAMKLDLEAARLLTYRAAWKKVKGEPYTLEASLAKLFASEAANRVAYRAIQVHGGYGFFEEYEVARLYRDARILTLYEGTSEVQKLIIGAHLTGVRAFA
>NC_006462.1|WP_011229256.1|10713_11505_-|SDR-family-oxidoreductase
MGRLSGKTILVTGAASGIGRAALDLFAREGASLVAVDREERLLAEAVAALEAEAIAVVADVSDPKAVEAVFAEALEEFGRLHGVAHFAGVAHSALSWNLPLEAWEKVLRVNLTGSFLVARKAGEVLEEGGSLVLTGSVAGLGAFGLAHYAAGKLGVVGLARTLALELARKGVRVNVLLPGLIQTPMTAGLPPWAWEQEVGASPLGRAGRPEEVAQAALFLLSEESAYITGQALYVDGGRSIVGPPGLPPGFGPKGGERHAHVL
>NC_006462.1|WP_011229257.1|10274_10730_-|MaoC-family-dehydratase
MPMYFEDFEVGQRFVTAGRTVTEADVVNFAGVSGDYNPIHTDAEFAKSTPFGQRIAHGLLVLSMLTGLRQRTGATDGTLIAWLEIRNYRFLKPVLIGDTVHGETEIVEKRETSKPDRGIVVQRVRVLNQRGEVVQEGEFVTMIRRRPREEA
>NC_006462.1|WP_011229258.1|9924_10278_-|PaaI-family-thioesterase
MSPFARWFQARVLRKEAGEAELLLEVREEFLQGQGLVHGGILAALLDSALGQAVESLGAKVVTAELSVSYLRPVREGVLLARGWVVHPGRHLLHAAGEALLEGKRVAFAKGVFYRVG
>NC_006462.1|WP_011229259.1|8944_9889_-|AMP-binding-protein
MFPSTMMEEELNLWDFLERAAALFGRKEVVSRLHTGEVHRTTYAEVYQRARRLMGGLKALGVGVGDRVATLGFLVEAIRGELKTVQHFVVMDEKAPEGYLAYEEALGEEADPVRVPERAACGMAYTTGTTGLPIPLVRLRVADEEGRPVPKDGKALGEVQLKGPWITGGYYGNEEATRSALTPDGFFRTGDIAVWDEERYVEIKDRLKDLIKSGGEWISSVDLENALMGHPKVKEAAVVAIPHPKWQERPLAVVVPRGEKPTPEELNEHLLKAGFAKWQLPDAYVFAEEIPRTSAGKFLKRALREQYKNYYGGA
>NC_006462.1|WP_011229260.1|8183_8945_-|SDR-family-oxidoreductase
MFLEKFRLDGKAALVTGGSRGLGLEAALALKEAGARVAVVARRASFFEEARKALGEDALYLEGDVRDEARLEAIAEEVEERLGPLTVLVNAAGVSWGAPSLEMPVEKVREVLEVNLVGAFLASRVAARRMKERGYGKIIHIASVAGLKGEYPEVLDAVGYSASKGGLIALTRDLAVKWGRWGIRVNALAPGFFPTRMTEKVLPRAEAFLKATLPLGRPGAPGELGGAVLFLASPASDYVTGAVLPVDGGATAL
>NC_006462.1|WP_011229247.1|18730_19525_+|carbohydrate-deacetylase
MDLLERLGLGGRRVLILHHDDLGLTHAQNGAYQALGLPTGSVMVPGAWASGVKGEDLGVHLVLTSEWPAPRMRPLTEGESLRDEAGYFPESLEALWRKARAEEVERELKAQIQAAAKLFSPTHLDAHQGAVLRPDLAEVYLRLAEAYRLVPLVPESLEGLGVPPPFLPELERLLYETPFPQVRFLDPYGLPPEERLGFYLDLAHLPPGLYYLVHHSALPTPEGRALPDWPTREADYFALSHPEVRRVLAEFHPLTWRAVREALF
>NC_006462.1|WP_011229244.1|20793_22518_+|beta-galactosidase
MRLDPNHPRPTLQRPGWRSLEGHWDFALSEAEAPGGVRFDRKILVPFPPEAPGSGVGEAWVGVAWYRKVLRAKPRPGRRLFLRFGAVDYRAEVFVNGVRVLEHEGGHTPFGLDLTPFLERPVEVLVRAEDDPLDPEAPRGKQALGEPGGIFYPRTTGIWQPVWLEWVPESHIAALRLTPDLKALGFHLEVQAHGEGEAVEVALFPGVRGEAPLGEAPWLEARFPLLGGRASGFLGLPAKGNPEGLLWRPETPVLFPLRLRLLSGRRVLDEVYSYGGLREVAAQKGVFLLNGEPYFPRLVLDQGLWPEGHLAPPSLAALRRDAALAKALGFNGVRKHQKVEDPRYLHLADRLGLLVFAEMPSFFRFSPKAARRYLAELAEALERDRNHPSLVAWILFNEGWGLTPWRAETLAFLQGAFLLARALDPTRLLVDNDGFEHGPFWDLLTVHDYAPPEVLARRYGEGLPEAPMGRPLALAGLPPGVRPFLSEFGGLRLKGPGPGWGYREAEDEEAFLREALRYLETACGSRLSGFCYTQLYDTFQEENGLLDFWRRPKVPPERVRAFLEGCEARRLLAE
>NC_006462.1|WP_164926105.1|22529_24911_+|glycoside-hydrolase-family-31-protein
MAVPGKGLGKKLWSAAEMAALLGPGILLLAVRYARERDRWTPRDPLPPWQGVGRVQGLEAIPGGVRVRFAEAELEAVFLGEDLLRLTWSPGEALPPYALAEEASPLEPERLQGPDGVLLLRTRRLALALGEEGLEVRDREGRLLRQEAYPERAGRAWRHRVRLAPGERVLGLGERAHPLDRRGGAFRLWNRDPGGSYGPGEDPLYLSVPVWLSLLPQGGYLAFYENPAEGFADLRGEEAWVGFLGGAFRYYLIPGPLEAALSRYVRLTGLPPMPPRWALGFHYARWGLRTREEVEERVAGFLERGLPLRAVHLDIDYMRGYRVFTVDEGRYPDLQGLVRGFQEKGVRTVLILDPGVKAEKGFPPYEEGLREGLFCRLPSGEVVRGPVWPGLAAFPDFTDPKARAWWGEKLKGFLEMGVAGFWLDMNEPALFAAWGEPTLPASARHALEGQGGDHRLAHNLYGLLMARASWEGFRKHAPERRPFLLTRSGHAGVQRYAWTWTGDVESTWEGLRTTLRALLGLSLSGVYFVGSDIGGFSGNPSPELYLRWFQMAALTPFFRLHAARWTKRREPWRFGEEVLEGVRRAMALRESLLPYLYTLAHRASREGKPLLRPLFLEGGPYTEEAFLLGEALLVAPVLEEGARAKEVPLPKGGWYPWGEDRALQGPTWARLPAPLDRIPLLVRAGTVLPLLEEGGLALHLYPGAEGAEGRLYWDEGEGEGPYRLDRFRLLPAEGGFRLLWQGKGELPWPWARVRLRLFGKRLLRAHVEGEAHAAEEGGVLLPPFREALLEVEG
>NC_006462.1|WP_011229240.1|26954_28217_+|MFS-transporter
MPPHLAYALGGLGLTLPAQTFGTYLAFYYLDRLGMPAGAFALARLIFSVWDAVNDPLFGYLSDRTRTPWGRRRPWLFLSLPFLLLAFYLAFSVPEAFRKGTRLFWYGLWAMLLFETFSALAWVNHAALFPELFQSREERARANAWRQGFYFLGLTASIALTPLVYAALGFPGMALLYGAVGGGLVLLFLLSVREDPRAREAEPLPFVPAFRYTLGNRAFWIYALAALFLLFAVGLFAAAMPFYAKHALGLGEEATALLFASVLLAALPSVSLWARLAGALGPKRAWLWAIGLLALGALLLLWPRGLLEALPVGVLIGTGFGGVLVLGDVLLAEVIDRDAAATGRRREGVYYSVYGFINRLSGPLQALAFALLTPLFGYVSGENPGPNPEAAFRFLMAVPPFAASLLALALAARFPYGAKG
>NC_006462.1|WP_164926106.1|28562_31178_-|transcriptional-regulator
MALAWQSPVYLERKRLLDLLPEEPGFAVWLEAPAGFGKSVLAGQLAARLGLRTLWASALLGEPRDLLAQALGLPREAPWGAVVAALGEAPSLVVLEDLTGEEALSPLLRTLPCLLVLASRRPLPYPELPKLLAEGRLVHLKAPDLAFTEEEAEALFGGREGWREAHRATGGWALPLFLSAFTGRPPEPMALLQGLRESLSEEEFQEGLLLAALPLLPAERALPVTEGLFQKGLLQRVPAGYRLHPLLREMAQRALRAEVQEAVRKAEGRLSPELLAEALFGAGLEEELLQLLESPIPLPIPAEKLAAWEGLLRRGGPRARLRLGEALLQVGRREGFALLEPLAQGEDPALALQALGHLAYYKAEPLLGKALPEARAHLERGLALLDRVGGELAGRFLNDAARVPYEEGRPEEAEALLEEALRRLPPGSPYRLAPLTNLAFLRFEREGSLLGRIAALEEAVGRLGPLGPANLAGHLRDLGRLYLLLGEREKAREHLRRAQEAEGHPLAALEARMLLAHLEEDAEALARLVAQAELLENPYLVERGRALLAGLRRDPGLLEGLPGFLPALARALLREDPALLPPRPEAREERLYWHAARYRLLREEEDLKALLSLTDARERVLPGLVPLDLLPRKRPELARAYPLEEVLRSGWKEAVALRLAEIPPLRVEVLGSFRVRNPLGGVELKGKAREVLAILLLGLPREEVAFALWPDLSEEAALNNLYVWLNRLRKALEPWGLPTYLGEEGLKHLACDLHALEEALRREDAEAAFALYREPLFPGLDHPLLDRKREEVFHRVRALFLKKGEPRYLERLLELDPLDEEALLPLVERCLARGQRARALAHLERYRRRLWEELGERPSPEVEALLRELGG
>NC_006462.1|WP_011174342.1|31850_33125_+|hypothetical-protein
MKKLLVATWTLLAWAWAQFPPGPGLPGPMAPTMPPGPPSQGQVYQNPALGMSFPVPAGFEPAGEMPVQGGMAAAFLHPSGAELYAVSYPFQGDLQAFHRQNLQRLAQLDAQLQAQGFRVQRQPLSGLSMGGRPALGVQSQILYQGQSYVDLSVYTTEGGRVYAFQLTAPAQAFPQVQGAFQALLQGVQIGGGGPGLSPFPQPGFPTQPGFPTQPGFPAQPGLPSQPGFPPGPGTPPPNPFPTPPGPGGGEGSPPPLVSPTPPMGQGASPPRATSPAPRPAFTPPADRVVELRYGKEVGDGKRFAVAVGGLRYRIAPQGSGRWAVTEVVEDPRGDEEATYLLDGLGLQEGEDALLPPVWHTGRREMGGLELERSDQGGLIVYRYQDEEMRLEIAYRPDGWMAYYVYCDLAKKANPCVRHTLREVR
>NC_006462.1|WP_011174341.1|33124_33574_+|YbjN-domain-containing-protein
MARLFLLALILVPALAQGVRTGITPGEMEALLKAGSYRYERVEEGGRVYFHLRLAGLRAVLFLQDCREGSCESLLLYAGFSTDNPPSLERVNEWNREKRFSRAYLDEEGDPVLEADLDLAGGVADGAIRAFLDLFEENLRAFAAWIGWE
>NC_006462.1|WP_011229238.1|33582_34278_+|hypothetical-protein
MEELAFPAWARWRLWWALLLGASLLAFALWARELWSLLLGVLLLGAFALHFRRTGYAVALEPEGLRYEGRFYPRGALKGVRLDPLLGRLRLDFGGDGLPLPLGLPGWDEVLAHLGVGWREVEGLEDYLLGQRGRVWFLGSLYPPREAEGVHAWALGVYRRHFRRIYGALALAGAGLLLPEGLGTVLFALGLGLALWWLLFFPHDMVHLRGGGGRYNPLDPEFRKLWEEARG
>NC_006462.1|WP_164926107.1|34274_35861_+|hypothetical-protein
MRKLVLLLLLCAWPGPAGAERMVDLLHGFAVDLPEGWRVSLSPGGLLFTDLESVVLVRGMPQKSPKEAVKPLLEEAKRIGGGQATLHFRQASGGLMLWAQGLAYPLVFTQGAMGDLVLFALEPQVQAALSGLRYEAIHLLLPGPKTLLAVSAYLPQDLPDGKRQEVRGLLRSLEFVAPKDRVPYRTEALMDPLLGVPAAYLPVPQGYAFQGSVVAKGGTLRAPAFQLTKGGVVLRRDVIYLEAMAVATPFGGNPSTILLWNGQLGQVPGYLCAGSSGEVPALLAQGLWAWETGAPWQVSKVQPLRGTSRVARYLEGVRWAWEQQMNQSMLMAMGRPGDQFQSWREVLGLWAAQGGLRRQATVEARARGFFLPSPAASSAHCALSLEAVLLHGPSEALARETGALSGVMLGFSMNPRWAALEAERSRQASAELTRMVLGMLKEGEEFNSWMSRSWANLLSDQTYARDPSTGETFRLYKQSFDTGAFWRDPVFGGVLGTVERGGKLEELLGQAGWRRLEESLSGLPGTWR
>NC_006462.1|WP_011229236.1|36194_37517_-|cobyrinate-a,c-diamide-synthase
MRLLLAAPHSGAGKTTVSLALLLALRARGLRVQPFKVGPDYIDPTHLEKAAARRPYNLDGFFLDETGLLALFRHGARGADFALIEGVMGLFDGKDPRGEVGSTAQVARLLKAPVALVVDAKGMAGSIAPLALGFRDFHPGVRVVGVFANRVGSERHAEILKEALKAVGLPLLGWLPQDPALALPERHLGLVLAGEVAPPLEALRRAFRVDLEGVLRLAASAPPLPEARPFLPPRRPPRARVAYAWDKAFSFYYPEALELLEALGAELVPFSPLEDEALPKAHALLLGGGYPELFAERLSANVALREAIRRFPGPIVAECGGYMYLSQGLWVGERFFPMVGLVPGEARMAERPVLGYREVEALRDSPVARKGQAFKGHEFHYARLPASPSPAWRRLGGEEVEGYTDGRVLASFVHLYLPAKPEGVERLLGLASRGKAAGAS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_006462_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_006462_2

113544-113809

TypeI-A

Consensus_repeat	Method
CCCCAAGTCTTCCGATAC	CRT

4 spacers

c2c9_V-U4,csa3

The CRISPR arrays of NC_006462_2

>merge|NC_006462|2|113544-113809|CRT
CCCCAAGTCTTCCGATACTTTCTCCCCAAGTCTTCCGATAGGGGAGGGGGTCAACACCCCAAGTCTTCCGATACCTTTTCCCCAAGTCTTCCGATACCCCGCACCCCCCGACGCCCCAAGTCTTCCGATACTTTCTCCCCAAGTCTTCCGATAGGGGAGGGGGTCAACACCCCAAGTCTTCCGATACCGCCCACCCGCAAAGAAAACCGCTTGGGGAGGGCGAAACCTGGCGCTTTTCCTTCCCGCCTCCCCAAGTCTTCCGATAG

>NC_006462|2|2|113544-113809|CRT
CCCCAAGTCTTCCGATAC	TTTCTCCCCAAGTCTTCCGATAGGGGAGGGGGTCAACA
CCCCAAGTCTTCCGATAC	CTTTTCCCCAAGTCTTCCGATACCCCGCACCCCCCGACG
CCCCAAGTCTTCCGATAC	TTTCTCCCCAAGTCTTCCGATAGGGGAGGGGGTCAACA
CCCCAAGTCTTCCGATAC	CGCCCACCCGCAAAGAAAACCGCTTGGGGAGGGCGAAACCTGGCGCTTTTCCTTCCCGCCT
CCCCAAGTCTTCCGATAG

Protein	Signature genes	Signature genes Name	Protein_function
NC_006462.1\|WP_011229167.1\|121041_121572_+\|peptide-methionine-(S)-S-oxide-reductase-MsrA	unknown	unknown	gnl\|CDD\|237597
NC_006462.1\|WP_164926113.1\|110262_110400_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225296
NC_006462.1\|WP_011229165.1\|121928_122324_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224146
NC_006462.1\|WP_164926114.1\|120082_120250_+\|hypothetical-protein	unknown	unknown	unknown
NC_006462.1\|WP_165446283.1\|104029_105631_-\|acyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173843
NC_006462.1\|WP_011229177.1\|109972_110275_-\|recombinase-family-protein	unknown	unknown	gnl\|CDD\|239738
NC_006462.1\|WP_011229174.1\|111456_112344_-\|ParB/RepB/Spo0J-family-partition-protein	unknown	unknown	gnl\|CDD\|275105
NC_006462.1\|WP_011229164.1\|122440_122887_-\|type-II-toxin-antitoxin-system-VapC-family-toxin	unknown	unknown	gnl\|CDD\|350222
NC_006462.1\|WP_011229173.1\|112340_113309_-\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|224113
NC_006462.1\|WP_011229180.1\|106161_106641_+\|prepilin-type-N-terminal-cleavage/methylation-domain-containing-protein	unknown	unknown	gnl\|CDD\|131575
NC_006462.1\|WP_164926112.1\|109631_109982_-\|transposase	c2c9_V-U4	-	gnl\|CDD\|223747
NC_006462.1\|WP_011228558.1\|118437_119658_-\|IS256-like-element-ISTth4-family-transposase	unknown	unknown	gnl\|CDD\|307151
NC_006462.1\|WP_011229169.1\|119723_120062_+\|helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|197713
NC_006462.1\|WP_011229178.1\|107594_109466_+\|DUF4900-domain-containing-protein	unknown	unknown	gnl\|CDD\|292858
NC_006462.1\|WP_011229170.1\|117877_118360_-\|arsenate-reductase-(azurin)-small-subunit	unknown	unknown	gnl\|CDD\|131741
NC_006462.1\|WP_011229179.1\|106652_107582_+\|prepilin-type-N-terminal-cleavage/methylation-domain-containing-protein	unknown	unknown	gnl\|CDD\|227132
NC_006462.1\|WP_011229172.1\|113819_115211_-\|replication-initiator-protein-A	unknown	unknown	gnl\|CDD\|370826
NC_006462.1\|WP_011229168.1\|120480_121032_+\|hypothetical-protein	unknown	unknown	unknown
NC_006462.1\|WP_011229171.1\|115280_117866_-\|arsenate-reductase-(azurin)-large-subunit	unknown	unknown	gnl\|CDD\|274261
NC_006462.1\|WP_011229181.1\|105745_106165_+\|type-IV-pilin	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NC_006462.1\|WP_164926113.1\|110262_110400_-\|hypothetical-protein	gnl\|CDD\|225296	COG2452, COG2452, Predicted site-specific integrase-resolvase [DNA replication, recombination, and repair].	0.000277928
NC_006462.1\|WP_011229167.1\|121041_121572_+\|peptide-methionine-(S)-S-oxide-reductase-MsrA	gnl\|CDD\|237597	PRK14054, PRK14054, peptide-methionine (S)-S-oxide reductase.	7.80607e-99
NC_006462.1\|WP_165446283.1\|104029_105631_-\|acyl-CoA-dehydrogenase	gnl\|CDD\|173843	cd01154, AidB, Proteins involved in DNA damage response, similar to the AidB gene product. AidB is one of several genes involved in the SOS adaptive response to DNA alkylation damage, whose expression is activated by the Ada protein. Its function has not been entirely elucidated; however, it is similar in sequence and function to acyl-CoA dehydrogenases. It has been proposed that aidB directly destroys DNA alkylating agents such as nitrosoguanidines (nitrosated amides) or their reaction intermediates.	3.1934e-140
NC_006462.1\|WP_011229177.1\|109972_110275_-\|recombinase-family-protein	gnl\|CDD\|239738	cd03769, SR_IS607_transposase_like, Serine Recombinase (SR) family, IS607-like transposase subfamily, catalytic domain; members contain a DNA binding domain with homology to MerR/SoxR located N-terminal to the catalytic domain. Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and the enzyme. They are functionally versatile and include resolvases, invertases, integrases, and transposases. This subfamily is composed of proteins that catalyze the transposition of insertion sequence (IS) elements such as IS607 from Helicobacter and IS1535 from Mycobacterium, and similar proteins from other bacteria and several archaeal species. IS elements are DNA segments that move to new sites in prokaryotic and eukaryotic genomes causing insertion mutations and gene rearrangements.	8.42752e-25
NC_006462.1\|WP_011229174.1\|111456_112344_-\|ParB/RepB/Spo0J-family-partition-protein	gnl\|CDD\|275105	TIGR04285, parB-like_partition_protein, nucleoid occlusion protein. This model describes nucleoid occlusion protein, a close homolog to ParB chromosome partitioning proteins including Spo0J in Bacillus subtilis. Its gene often is located near the gene for the Spo0J ortholog. This protein bind a specific DNA sequence and blocks cytokinesis from happening until chromosome segregation is complete.	1.02978e-38
NC_006462.1\|WP_011229164.1\|122440_122887_-\|type-II-toxin-antitoxin-system-VapC-family-toxin	gnl\|CDD\|350222	cd09874, PIN_MT3492-like, VapC-like PIN domain of the hypothetical protein MT3492 of Mycobacterium tuberculosis CDC1551 and other uncharacterized, annotated PilT protein domain proteins. Virulence associated protein C (VapC)-like PIN (PilT N terminus) domain of Mycobacterium tuberculosis CDC1551, hypothetical protein MT3492, and similar bacterial and archaeal proteins are included in this subfamily. They are PIN domain homologs of the Mycobacterium tuberculosis VapC and Neisseria gonorrhoeae FitB toxins of the prokaryotic toxin/antitoxin operons, VapBC and FitAB, respectively, which are believed to be involved in growth inhibition by regulating translation. These toxins are nearly always co-expressed with an antitoxin, a cognate protein inhibitor, forming an inert protein complex. Disassociation of the protein complex activates the ribonuclease activity of the toxin by an, as yet undefined mechanism. The PIN domain belongs to a large nuclease superfamily. The structural properties of the PIN (PilT N terminus) domain indicate its active center, consisting of three highly conserved catalytic residues which coordinate metal ions, in some members, additional metal coordinating residues can be found. Some members of the superfamily lack several of these key catalytic residues. The PIN active site is geometrically similar in the active center of structure-specific 5' nucleases, PIN-domain ribonucleases of eukaryotic rRNA editing proteins, and bacterial toxins of toxin-antitoxin (TA) operons.	2.20344e-37
NC_006462.1\|WP_011229173.1\|112340_113309_-\|AAA-family-ATPase	gnl\|CDD\|224113	COG1192, Soj, ATPases involved in chromosome partitioning [Cell division and chromosome partitioning].	1.12779e-37
NC_006462.1\|WP_011229180.1\|106161_106641_+\|prepilin-type-N-terminal-cleavage/methylation-domain-containing-protein	gnl\|CDD\|131575	TIGR02523, probable_type-4_fimbrial_biogenesis_protein, type IV pilus modification protein PilV. Pilus systems categorized as type IV pilins differ greatly from one another, with some showing greater similarty to type II or type III secretion systems than to each other. Members of this protein family represent the PilV protein of type IV pilus systems as found in Pseudomonas aeruginosa PAO1, Pseudomonas syringae DC3000, Neisseria meningitidis MC58, Xylella fastidiosa 9a5c, etc. [Cell envelope, Surface structures, Protein fate, Protein modification and repair].	6.64392e-05
NC_006462.1\|WP_011228558.1\|118437_119658_-\|IS256-like-element-ISTth4-family-transposase	gnl\|CDD\|307151	pfam00872, Transposase_mut, Transposase, Mutator family.	1.20089e-89
NC_006462.1\|WP_011229169.1\|119723_120062_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|197713	smart00418, HTH_ARSR, helix_turn_helix, Arsenical Resistance Operon Repressor.	6.79638e-17
NC_006462.1\|WP_011229178.1\|107594_109466_+\|DUF4900-domain-containing-protein	gnl\|CDD\|292858	pfam16241, DUF4900, Domain of unknown function (DUF4900). This family consists of uncharacterized proteins around 600 residues in length and is mainly found in various Thermotoga and Fervidobaterium species. The function of this family is unknown.	7.87132e-41
NC_006462.1\|WP_011229170.1\|117877_118360_-\|arsenate-reductase-(azurin)-small-subunit	gnl\|CDD\|131741	TIGR02694, Arsenite_oxidase_subunit_AioB, arsenite oxidase, small subunit. This model represents the small subunit of an arsenite oxidase complex. It is a Rieske protein and appears to rely on the Tat (twin-arginine translocation) system to cross the membrane. Although this enzyme could run in the direction of arsenate reduction to arsenite in principle, the relevant biological function is arsenite oxidation for energy metabolism, not arsenic resistance. Homologs to both large (TIGR02693) and small subunits that score in the gray zone between the set trusted and noise bit score cutoffs for the respective models are found in Aeropyrum pernix K1 and in Sulfolobus tokodaii str. 7. [Energy metabolism, Electron transport].	1.01746e-81
NC_006462.1\|WP_011229179.1\|106652_107582_+\|prepilin-type-N-terminal-cleavage/methylation-domain-containing-protein	gnl\|CDD\|227132	COG4795, PulJ, Type II secretory pathway, component PulJ [Intracellular trafficking and secretion].	2.0232e-08
NC_006462.1\|WP_011229172.1\|113819_115211_-\|replication-initiator-protein-A	gnl\|CDD\|370826	pfam10134, RPA, Replication initiator protein A. Members of this family of bacterial proteins are single-stranded DNA binding proteins that are involved in DNA replication, repair and recombination.	1.09598e-67
NC_006462.1\|WP_011229165.1\|121928_122324_-\|hypothetical-protein	gnl\|CDD\|224146	COG1225, Bcp, Peroxiredoxin [Posttranslational modification, protein turnover, chaperones].	0.0057395
NC_006462.1\|WP_011229171.1\|115280_117866_-\|arsenate-reductase-(azurin)-large-subunit	gnl\|CDD\|274261	TIGR02693, Arsenite_oxidase_subunit_AioA, arsenite oxidase, large subunit. This model represents the large subunit of an arsenite oxidase complex. The small subunit is a Rieske protein. Homologs to both large and small subunits that score in the gray zone between the set trusted and noise bit score cutoffs for the respective models are found in Aeropyrum pernix K1 and in Sulfolobus tokodaii str. 7. This enzyme acts in energy metabolim by arsenite oxidation, rather than detoxification by reduction of arsenate to arsenite prior to export. [Energy metabolism, Electron transport].	0
NC_006462.1\|WP_164926112.1\|109631_109982_-\|transposase	gnl\|CDD\|223747	COG0675, COG0675, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	2.50605e-07

>NC_006462.1|WP_011229173.1|112340_113309_-|AAA-family-ATPase
MKQGELVPVSEMARRLGVTRERVRQMILEGKLEGVRLGRYWYVREREGGRLRRVYTFFTHAGGAGKTSLARDLGFELARRGFRVLLVDTDPQANLTSWLGVREVAPEETLLHLVDTGQLPTPRRLSEWGLDLIPASLDLARVEVRLMQRPLSTLLLRTALRKTEGYDFVLIDSLPSLGHLAALGALAGDGLLVPVETSVKGVEALVGVMEAAQEYREALEQVDPRVPRSFVRLFIPTKFDARTLGDNRVLEKIAGLEDLAPVASPIAYRPGPHRRATERAVPLQLVGDRQAREEVERLAEEFLQRVVAQDAVREGVLEEVAE
>NC_006462.1|WP_011229174.1|111456_112344_-|ParB/RepB/Spo0J-family-partition-protein
MSRLDEVLGTAILKGKKALGKEAPEVLRLPLDLLRVRGQPRRRFENLEALAESIREKGVLQPLLVRRVGEAYEVVAGERRLRAAAMAGLKEVPARVLELSDKEARLLALVENLQREDLNPYEETLGVLALLSEDLGKSVEGVVGLLRKMKNAKEGRVRDNVVPTAEARRVEELFKALGRMSWESFVQHRLPLLFLPEDLKAALEEGAIPYTAALELKKVKDASLRKVLLEEVKAGLSLRELKARVRGVLRKEKAPRPWPKEVAAKLARLDLEALPPERRARVEELLAELERVLGK
>NC_006462.1|WP_164926113.1|110262_110400_-|hypothetical-protein
MSYLTAWRWFKSGKFPVPARQLPSGTILVEEPLPEGRTVRKICFA
>NC_006462.1|WP_011229177.1|109972_110275_-|recombinase-family-protein
MFRVTYARVSSADQEEDLERQVERLKAFAQAQGWAEYEVVAEVGSATRKRGRLLQVLADPGVSRIVAEKRHHLNQFGFPLVEAALRASGRRIVVLEDECG
>NC_006462.1|WP_164926112.1|109631_109982_-|transposase
MRVTQAFRFELDPNALQRGALSKHIGAALIVAPRSFPSTRLCSRCEACGLEVDRDLNAAVNLQKYGLAHFRGSTGSSPRSDACRDRLCGGTTLKGRSTSHGSRKQEVACGRDFLGR
>NC_006462.1|WP_011229178.1|107594_109466_+|DUF4900-domain-containing-protein
MRNKGIAIVLALATVLVVSGIGTLIFTRTIREIRHGAQDQGIVQTLMLARGAANLGGSLLATRGRERLERIVQQTASSTDRWAYGGNTGTEAPDPVLVAQALANVADRFQSDLDGFLCGKNFAPDGLPAEVRVRVYVTTSACGEPLPPKTHLPPGRFVEGAPRTGTGSGVSQTYALPFVMVAEASLGQARRNIVLQGEYRFTIGRSSFARYALFTNVHALPNGTGVWFTDRTLFDGPVHTNGHFRFYRSPWFGGEVTSAGCLSPGSQSCQGQTVPGAYFYGEGFVRDRNMQPSAARPSYRNPYGTHAPEFTAGVDWNASFIPLPPNSQDQRTAAQESGLYFSDDIRSLKLYRKCLLGETEVACSEPLGPGALKLQYIEVTYCKNQCNQTATEVYRYGLDGLLYQKDNGGLFVPVLRDGAPVRFNGVIYTDGEVRSLSGPERSRATDPATAPPALAEFAQITVAAQGDIRITGDLKYEKPPCTGVPTREPDGTVTPAVCDNLGVQNVLGVYSQEGSVWIAREAPRDIHIHGTLMSSRGVVGVEDYNSIPEKGSVYLLGGIIEYYYGAFGTFDPATGRNRTGYGRAFTYDRRFLQGLAPPFFPTTGQDRVTSVSVFSYGQREQVY
>NC_006462.1|WP_011229179.1|106652_107582_+|prepilin-type-N-terminal-cleavage/methylation-domain-containing-protein
MSERRGFTLVELLLALAILATLLAVAYGGVIQFMQSRSDLEAAINAQAKLRRIVEVFTQDLRSAVFGGLSATPYPSGNASVSFALIEGGAGYPVLPHDSGDNQSFKRATEVKIVVLAEALSDVGIAPGDEVLMVNNLGDGVILPVTDVKPVEGGLEVVHDECGNTIDYTPNTLLFRVRTLGFRFDPTTRRLVYREGREGGGEEVKEVPVAFDMERFEIHYVYEGAFGDTVTDPPGGAFTPGYDFARPTGAPPYQVTEVATGKVYTLRRLSLVLEARFPSRGRPVSRTYTAQVELAANTQYQAKRIVPCE
>NC_006462.1|WP_011229180.1|106161_106641_+|prepilin-type-N-terminal-cleavage/methylation-domain-containing-protein
MKKALGLTLVEVLVAIAVLSLVLVAMNAVLLSSIRQTAISGSRTQAVQILNYLGRRVVGGETALLPPSGTAKVYDYGSLGAAFPDLPREVRFADPALYKAEIANRGSPGWASGLGVAVNVYRIRVCWRQAGEERCTEAYTLSAPPGGAGPAAPPLPGIN
>NC_006462.1|WP_011229181.1|105745_106165_+|type-IV-pilin
MIELLVVLAVLAVIFAIGAFNGRRTLLSQEQAAFLRSLQGLFWEAATEAASRGENLVLHFTGQRLEVRRTDGTVLRALDLPPGVSLSLTPGVVAQFTPPGKVADQDGRNLLQPLSFTATVGSKTYTYTVSLIGETEVVP
>NC_006462.1|WP_165446283.1|104029_105631_-|acyl-CoA-dehydrogenase
MEWISYAYGKNHYEADPELRDLLRHFWPGAGDREAELLAWGAYMGREVYEAAYHIDQDAGPELVMHDLDGNRVDRVRLSPVQREVLKRLRPIVRPPYEGGSWHHHFALGYLLADGGLYCILTITHQVAYPIHKYAPGLASWKERVLYGEAFGATWMTEIQGGSDLGANRTVARREGEVWRLYGGDKYFASGAGLADVALVTARPEGAPPGPKGLALFLLPRLDREGRLNYRVRRLKRKSGTRAVPSGEVELEGSEAYLIGRAEEGIYYTLETLTVSRLANAIAAMGIAAKALLETRQRVRRRQSFGRFLADHPLVRHDLLDLSVRQAGGLALALAAVEAFDRAWHERPPYGEAYHLARFLSHLAKNRTAEHSAEITRLAMELFGGLGFLEEYAVARWHRESLITPIWEGPSNIQALDLLEAMQKKGAHRPFLAWLEARLKGRSEEAEGALAAARKTLDRLAALEPEAAQFSAKTALRRLADAAAVAGLLEASATAGPRYRELAGLYARRFLLGEDYPPEALGARALYLPEGGA
>NC_006462.1|WP_011229172.1|113819_115211_-|replication-initiator-protein-A
MARKRRQDATPPLFELELAKEPRHFDEANVARLGLISIQERIPEGYASWEEEFEVLGKPVKLACYANPNVGGVPHGLDNEVSLALIALYLNAGSPPDGTFTTTAYQILKLMGFDTSGYYYRALKESLLRLTTATYVLSEAWRADGRWQSVSFRYIDKLEFTSGKEGSLDRSSVIRITLAKEIVRSLQNRYTKPIDIEFMASLKRPLSRALYRLLDAQRLSPEREEPLAQLEVGLMEWAAACKIVHKRPDKVRRTLEPAHRELIERRYLRSVEYVGRGKNQTIVYVFGEEAGGIPDAEAVNLLMAEGLSFTSAYSLARRYSLGHIKERLERYRAILEAGYRPKNRLGLLVDVIRDETGKYERPTRTRRPAKRQAAQEEAEARRLEEEAAREWAEMPREAQIRRALQVAQLVLRSRISVGELEDLNRLMESGALEPRRVVEELKEALAQDRLEGWLERFRKMLPG
>NC_006462.1|WP_011229171.1|115280_117866_-|arsenate-reductase-(azurin)-large-subunit
MALIPRRDRLPIPPKNAKVYNQVCQYCTVGCGYKVYVWPVGEEGGVKPEQNAFGLDLSTPQPPLAGQSYTETMHAVTVGRDGRQYNVVIVPAKDSPINRGNYSIRGGTNALTVWSLDRGTQDRLTYPLLRVGDQFQAITWQDALTLMGLLIKGIRDRDGNDDNIAVKCFDHGGSGQGFEDNYAAGKLFFAALSVKHIAIHNRPAYNSEVWGSRERGVHELNYTYEDARLADTIVLWGANSYETATVFYVEHMLPNIQGATVAEKQQAFDPGEPAEPGYLIVIDPRKTSSYTVAAQVAPDRVMLLRPNLGTDYILANAIARAVWEKGYYDMAYLQARTDMTLFEEYKAKSLKLSVPYDEFMAQAERITGVSRAEIEKAADWIAKPKAGRFKRRTLTIYEKGIIWNMKNYDQVAAIVQLAVLTHNIGRPGTGCGRQGGHQEGYVRPPAPTPGSIYRGGPPVNVDKFLIEGKGKFYWVIANDPYLSTPNNQVFRKRIHERTEKLTKALGAGGEPGTIQERAQKILDILYQDPDALFLVVQDIYMTETARDAHLILPAAGWGEANETSINCNSRLLRLYEKFMDPPGEAKPDWEIFKWVGLRIAELYRAEGKFEEAKKFEFGKNWKTDEDVFLAGAEEFRDNTVSEEDEAVLEAENYKGVTYKLLKELGQKGIQTPVRRDPKTGKLVGTVRRYTYRFGTEDGKFKWYGTDDWEGYPAEVAKYLEPGMAEKYPFWVTTGRAQTIWQTAYHDRHLPEKALALPLPYVEVNPEDAKRLGLKSGDLVEVYNEEGNGTFLVYVTDAVKPGTLFLVMYHWRGTSNSLVTGYTDPKTTIPWYKGTRANLRKVAGAIPSVQQTASFLQQNKFD
>NC_006462.1|WP_011229170.1|117877_118360_-|arsenate-reductase-(azurin)-small-subunit
MTQTMTRRRFVQLTAAATALFTAGGKAQLWYAPSLTYPAVKVANLSQVKTGEPIFFNYPDASSPAVLVKLGRPAIGGVGRERDIVAFSALCTHMGCPVQYEEGRFICRCHYSMFDPAKAGQPYQGLASSWLPQIPLRIDGKGDIYAVAVAGLIWGRVKNV
>NC_006462.1|WP_011228558.1|118437_119658_-|IS256-like-element-ISTth4-family-transposase
MFNRGAHLSTRRCPVDQDTLRILLREAVRETVAEVLQTVLELDRTAFLQVHGGRRNGYYPRKLETTFGQVDLKVPRDRESRYYPAFLKPYARRLVDVGEVAVALYAAGVSQRKAAEILSLLLGHRYSHETLSALTDEVLEAAGAFRTRPLPEEMAFVYLDGLSLKVFREGEGIVRESVYVALGIAPNGERRVLGFWLLPTESALGWEGVLGELWQRGLRRVLLFVTDGLPGLPEAIRRVYPQAEWQRCVVHGVRWSLSQVRSRDRALLAEDLRRVYGAESREEALGALEEVKAAWGSRYPGVVGLWVQDSGAFLRFYGYPKVLWPYLRSTNLMERFIRELRRGTKVRDHKFPKEEAVYKLLYLESERQEGRWAERKLKGFSEVKEVLEKMLQERYAPRTQTLTHNS
>NC_006462.1|WP_011229169.1|119723_120062_+|helix-turn-helix-transcriptional-regulator
MTTSLHRLEALAHPARVRIVRLLAELPDEETAKDPRCGTAYGVCFCHLKEKTGLSAPTVSHHLRILREAGLVEGVRVGRWTYYRLRPGALEAVARELLGLAQRARALEERSA
>NC_006462.1|WP_164926114.1|120082_120250_+|hypothetical-protein
MRRGLLGVLFLLFLLLGAMGPAASQGAWLGFLGVPVEDFPLVRSLGARTVEYRAG
>NC_006462.1|WP_011229168.1|120480_121032_+|hypothetical-protein
MGRDLARLHQVFHAFRTALRLVVNFGRLECLERMRRESGGAPVADVALFTVTAKKMRQEPGYVEGQAALARRARTEQAGLEVVPMVAVWAGDGVPLPNPGWVGGAVEALRGAGAFSGLLFYPWTRPCWAEQAIKDVFPEFFRELRPQAGAHQVVGHLLALLSPSLPLEAAFVAAAGLLALSSR
>NC_006462.1|WP_011229167.1|121041_121572_+|peptide-methionine-(S)-S-oxide-reductase-MsrA
MPEEIATLAGGCFWCTEAAFKLLRGVLEVVPGYAGGHVPHPTYEEVCTGTTGHREAVQVRFDPGVLPYADLLRYFFAVHDPTSEDRQGPDVGPQYSPAIFYHSEEQKRVAEAVMRELAPLYPKPIATKLLPFTTFYPAEAYHRDYFARHPEAPYCRFVIAPKLEKARKAFKSLLRP
>NC_006462.1|WP_011229165.1|121928_122324_-|hypothetical-protein
MVRLRKPLPPYALKTPEGGKVYLPDLKGKPLVLLRSEALAQGLAAREAELKALEAQAYLLAQAPRPSPLPLLLDPEGALLGAIPEGGVLVADAFLEVYHLGPVRDEEEVLEWLRFVEAQCPECVLPEADWL
>NC_006462.1|WP_011229164.1|122440_122887_-|type-II-toxin-antitoxin-system-VapC-family-toxin
MILPYLDTSALVKRYDPEEPGAEEVRTLFTEVRAVLTSSLAVVEAVSAFRIKERQGVLTPEEVRLAVEALEAHAALQYRLVPPKPPVLREAKRLLLRHKLRAYDALHLATALVVARVAGVEPRKLPFWTADEEQARAGEAEGLAVKRV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_006462_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_006462_3

133766-133955

TypeIII

III-A

Consensus_repeat	Method
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	CRISPRCasFinder

2 spacers

cas1,csx1,cas2,cas10,csm2gr11,csm3gr7,csm4gr5,csm5gr7

The CRISPR arrays of NC_006462_3

>merge|NC_006462|3|133766-133955|CRISPRCasFinder
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGACATGTGGCAGTCCAACGACGACGGCTTCGGCATGTTCTTTCGGTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGACCATGATGAGGGCGTGAGCGGCCTCGGGCCGGGACTGAAGGGTTGCAAGGGATTGAGCCCCGTAAGGGGATTGATACT

>NC_006462|3|2|133766-133955|CRISPRCasFinder
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	ATGTGGCAGTCCAACGACGACGGCTTCGGCATGTTCTTTCG
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	CATGATGAGGGCGTGAGCGGCCTCGGGCCGGGACTGAAGG
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGATACT

Protein	Signature genes	Signature genes Name	Protein_function
NC_006462.1\|WP_011229147.1\|147019_148930_+\|hypothetical-protein	unknown	unknown	unknown
NC_006462.1\|WP_011229161.1\|124188_124500_+\|metal-sulfur-cluster-assembly-factor	unknown	unknown	gnl\|CDD\|225062
NC_006462.1\|WP_011229156.1\|129693_131226_+\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|215257
NC_006462.1\|WP_011229153.1\|133965_134919_-\|IS110-like-element-IS1000A-family-transposase	unknown	unknown	gnl\|CDD\|376564
NC_006462.1\|WP_011229151.1\|139290_140016_+\|type-III-A-CRISPR-associated-RAMP-protein-Csm3	csm3gr7	cd09684_csm3gr7_CAS-III-A:CAS-III-D	gnl\|CDD\|187815
NC_006462.1\|WP_011229148.1\|142062_143457_+\|type-III-A-CRISPR-associated-protein-Csm6	csx1	cd09747_csx1_CAS-III	gnl\|CDD\|378236
NC_006462.1\|WP_011229152.1\|136456_138874_+\|type-III-A-CRISPR-associated-protein-Cas10/Csm1	cas10	cd09680_cas10_CAS-III	gnl\|CDD\|274209
NC_006462.1\|WP_164926115.1\|133474_133714_-\|hypothetical-protein	unknown	unknown	unknown
NC_006462.1\|WP_011174458.1\|140897_142052_+\|type-III-A-CRISPR-associated-RAMP-protein-Csm5	csm5gr7	cd09662_csm5gr7_CAS-III-A	gnl\|CDD\|273863
NC_006462.1\|WP_011228296.1\|144853_145807_-\|IS110-like-element-IS1000B-family-transposase	unknown	unknown	gnl\|CDD\|376564
NC_006462.1\|WP_011229158.1\|127397_128072_-\|glycerophosphodiester-phosphodiesterase	unknown	unknown	gnl\|CDD\|176499
NC_006462.1\|WP_011229159.1\|125926_127396_-\|Na/Pi-cotransporter-family-protein	unknown	unknown	gnl\|CDD\|224202
NC_006462.1\|WP_011229155.1\|131245_132451_+\|TIGR02710-family-CRISPR-associated-protein	csx1	cd09702_csx1_CAS-III	gnl\|CDD\|274263
NC_006462.1\|WP_011229154.1\|132454_133402_+\|CRISPR-associated-endonuclease-Cas1	cas1	cd09634_cas1_CAS-I:CAS-II:CAS-III:CAS-V	gnl\|CDD\|187766
NC_006462.1\|WP_011229157.1\|128206_129694_+\|glycerol-kinase-GlpK	unknown	unknown	gnl\|CDD\|198361
NC_006462.1\|WP_011229150.1\|140025_140901_+\|hypothetical-protein	csm4gr5	mkCas0089_csm4gr5_CAS-III-A:CAS-III-D	gnl\|CDD\|187794
NC_006462.1\|WP_024119885.1\|124593_124740_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|176198
NC_006462.1\|WP_011229160.1\|124776_126021_+\|multidrug-effflux-MFS-transporter	unknown	unknown	gnl\|CDD\|340878
NC_006462.1\|WP_011174461.1\|138874_139279_+\|type-III-A-CRISPR-associated-protein-Csm2	csm2gr11	cd09647_csm2gr11_CAS-III-A	gnl\|CDD\|187778
NC_006462.1\|WP_011174463.1\|136128_136401_+\|CRISPR-associated-endonuclease-Cas2	cas2	mkCas0081_cas2_CAS-I:CAS-II:CAS-III	gnl\|CDD\|187856

Protein	Function_ID	Function_description	E-value
NC_006462.1\|WP_011229160.1\|124776_126021_+\|multidrug-effflux-MFS-transporter	gnl\|CDD\|340878	cd17320, MFS_MdfA_MDR_like, Multidrug transporter MdfA and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This family is composed of bacterial multidrug resistance (MDR) transporters including several proteins from Escherichia coli such as MdfA (also called chloramphenicol resistance pump Cmr), EmrD, MdtM, MdtL, bicyclomycin resistance protein (also called sulfonamide resistance protein), and the uncharacterized inner membrane transport protein YdhC. EmrD is a proton-dependent secondary transporter, first identified as an efflux pump for uncouplers of oxidative phosphorylation. It expels a range of drug molecules and amphipathic compounds across the inner membrane of E. coli. Similarly, MdfA is a secondary multidrug transporter that exports a broad spectrum of structurally and electrically dissimilar toxic compounds. These MDR transporters are drug/H+ antiporters (DHA) belonging to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	6.46861e-79
NC_006462.1\|WP_011229156.1\|129693_131226_+\|FAD-dependent-oxidoreductase	gnl\|CDD\|215257	PLN02464, PLN02464, glycerol-3-phosphate dehydrogenase.	2.8258e-162
NC_006462.1\|WP_011229153.1\|133965_134919_-\|IS110-like-element-IS1000A-family-transposase	gnl\|CDD\|376564	pfam01548, DEDD_Tnp_IS110, Transposase. Transposase proteins are necessary for efficient DNA transposition. This family includes an amino-terminal region of the pilin gene inverting protein (PIVML) and of members of the IS111A/IS1328/IS1533 family of transposases. The C-terminus is represented by family pfam02371.	3.27877e-28
NC_006462.1\|WP_011229151.1\|139290_140016_+\|type-III-A-CRISPR-associated-RAMP-protein-Csm3	gnl\|CDD\|187815	cd09684, Csm3_III-A, CRISPR/Cas system-associated RAMP superfamily protein Csm3. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; RAMP superfamily protein.	4.10911e-103
NC_006462.1\|WP_011229148.1\|142062_143457_+\|type-III-A-CRISPR-associated-protein-Csm6	gnl\|CDD\|378236	pfam09670, Cas_Cas02710, CRISPR-associated protein (Cas_Cas02710). Members of this family are found, exclusively in the vicinity of CRISPR repeats and other CRISPR-associated (cas) genes, in Methanothermobacter thermautotrophicus (Methanobacterium thermoformicicum), Thermus thermophilus (Deinococcus-Thermus), Chloroflexus aurantiacus (Chloroflexi), and Thermomicrobium roseum (Thermomicrobia).	2.23057e-125
NC_006462.1\|WP_011229152.1\|136456_138874_+\|type-III-A-CRISPR-associated-protein-Cas10/Csm1	gnl\|CDD\|274209	TIGR02578, CRISPR-associated_protein_Cas10/Csm1, CRISPR-associated protein Cas10/Csm1, subtype III-A/MTUBE. The family is designated Csm2, for CRISPR/Cas Subtype Mtube Protein 2. A typical example is TM1811 from Thermotoga maritima. CRISPR are Clustered Regularly Interspaced Short Palindromic Repeats. This protein family belongs to a conserved gene cluster regularly found near CRISPR repeats.	0
NC_006462.1\|WP_011174458.1\|140897_142052_+\|type-III-A-CRISPR-associated-RAMP-protein-Csm5	gnl\|CDD\|273863	TIGR01899, cas_TM1807_csm5, CRISPR type III-A/MTUBE-associated RAMP protein Csm5. CRISPR is a term for Clustered Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR associated) proteins. Members of this cas gene family are found in the mtube subtype of CRISPR/cas locus and designated Csm5, for CRISPR/cas Subtype Mtube, protein 5.	1.01226e-19
NC_006462.1\|WP_011228296.1\|144853_145807_-\|IS110-like-element-IS1000B-family-transposase	gnl\|CDD\|376564	pfam01548, DEDD_Tnp_IS110, Transposase. Transposase proteins are necessary for efficient DNA transposition. This family includes an amino-terminal region of the pilin gene inverting protein (PIVML) and of members of the IS111A/IS1328/IS1533 family of transposases. The C-terminus is represented by family pfam02371.	2.28212e-29
NC_006462.1\|WP_011229158.1\|127397_128072_-\|glycerophosphodiester-phosphodiesterase	gnl\|CDD\|176499	cd08556, GDPD, Glycerophosphodiester phosphodiesterase domain as found in prokaryota and eukaryota, and similar proteins. The typical glycerophosphodiester phosphodiesterase domain (GDPD) consists of a TIM barrel and a small insertion domain named the GDPD-insertion (GDPD-I) domain, which is specific for GDPD proteins. This family corresponds to both typical GDPD domain and GDPD-like domain which lacks the GDPD-I region. Members in this family mainly consist of a large family of prokaryotic and eukaryotic glycerophosphodiester phosphodiesterases (GP-GDEs, EC 3.1.4.46), and a number of uncharacterized homologs. Sphingomyelinases D (SMases D) (sphingomyelin phosphodiesterase D, EC 3.1.4.41) from spider venom, SMases D-like proteins, and phospholipase D (PLD) from several pathogenic bacteria are also included in this family. GDPD plays an essential role in glycerol metabolism and catalyzes the hydrolysis of glycerophosphodiesters to sn-glycerol-3-phosphate (G3P) and the corresponding alcohols are major sources of carbon and phosphate. Its catalytic mechanism is based on the metal ion-dependent acid-base reaction, which is similar to that of phosphoinositide-specific phospholipases C (PI-PLCs, EC 3.1.4.11). Both, GDPD related proteins and PI-PLCs, belong to the superfamily of PI-PLC-like phosphodiesterases.	5.95697e-59
NC_006462.1\|WP_011229159.1\|125926_127396_-\|Na/Pi-cotransporter-family-protein	gnl\|CDD\|224202	COG1283, NptA, Na+/phosphate symporter [Inorganic ion transport and metabolism].	1.68827e-39
NC_006462.1\|WP_011229155.1\|131245_132451_+\|TIGR02710-family-CRISPR-associated-protein	gnl\|CDD\|274263	TIGR02710, conserved_hypothetical_protein, CRISPR-associated protein, TIGR02710 family. Members of this family are found, exclusively in the vicinity of CRISPR repeats and other CRISPR-associated (cas) genes, in Methanothermobacter thermautotrophicus (Archaea), Thermus thermophilus (Deinococcus-Thermus), Chloroflexus aurantiacus (Chloroflexi), and Thermomicrobium roseum (Thermomicrobia).	8.33434e-162
NC_006462.1\|WP_011229154.1\|132454_133402_+\|CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|187766	cd09634, Cas1_I-II-III, CRISPR/Cas system-associated protein Cas1. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas1 is the most universal CRISPR system protein thought to be involved in spacer integration; Cas1 is metal-dependent deoxyribonuclease, also binds RNA; Shown to possess a unique fold consisting of a N-terminal beta-strand domain and a C-terminal alpha-helical domain.	1.16225e-102
NC_006462.1\|WP_011229157.1\|128206_129694_+\|glycerol-kinase-GlpK	gnl\|CDD\|198361	cd07786, FGGY_EcGK_like, Escherichia coli glycerol kinase-like proteins; belongs to the FGGY family of carbohydrate kinases. This subgroup is composed of mostly bacterial and archaeal glycerol kinases (GK), including the well characterized proteins from Escherichia coli (EcGK), Thermococcus kodakaraensis (TkGK), and Enterococcus casseliflavus (EnGK). GKs contain two large domains separated by a deep cleft that forms the active site. This model includes both the N-terminal domain, which adopts a ribonuclease H-like fold, and the structurally related C-terminal domain. The high affinity ATP binding site of EcGK is created only by a substrate-induced conformational change, which is initiated by protein-protein interactions through complex formation with enzyme IIAGlc (also known as IIIGlc), the glucose-specific phosphocarrier protein of the phosphotransferase system (PTS). EcGK exists in a dimer-tetramer equilibrium. IIAGlc binds to both EcGK dimer and tetramer, and inhibits the uptake and subsequent metabolism of glycerol and maltose. Another well-known allosteric regulator of EcGK is fructose 1,6-bisphosphate (FBP), which binds to the EcGK tetramer and plays an essential role in the stabilization of the inactive tetrameric form. EcGK requires Mg2+ for its enzymatic activity. Members in this subgroup belong to the FGGY family of carbohydrate kinases.	0
NC_006462.1\|WP_011229150.1\|140025_140901_+\|hypothetical-protein	gnl\|CDD\|187794	cd09663, Csm4_III-A, CRISPR/Cas system-associated RAMP superfamily protein Csm4. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; RAMP superfamily protein.	3.841e-11
NC_006462.1\|WP_024119885.1\|124593_124740_+\|hypothetical-protein	gnl\|CDD\|176198	cd08236, sugar_DH, NAD(P)-dependent sugar dehydrogenases. This group contains proteins identified as sorbitol dehydrogenases and other sugar dehydrogenases of the medium-chain dehydrogenase/reductase family (MDR), which includes zinc-dependent alcohol dehydrogenase and related proteins. Sorbitol and aldose reductase are NAD(+) binding proteins of the polyol pathway, which interconverts glucose and fructose. Sorbitol dehydrogenase is tetrameric and has a single catalytic zinc per subunit. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Related proteins include threonine dehydrogenase, formaldehyde dehydrogenase, and butanediol dehydrogenase. The medium chain alcohol dehydrogenase family (MDR) has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Horse liver alcohol dehydrogenase is a dimeric enzyme and each subunit has two domains. The NAD binding domain is in a Rossmann fold and the catalytic domain contains a zinc ion to which substrates bind. There is a cleft between the domains that closes upon formation of the ternary complex.	0.00382704
NC_006462.1\|WP_011229161.1\|124188_124500_+\|metal-sulfur-cluster-assembly-factor	gnl\|CDD\|225062	COG2151, PaaD, Predicted metal-sulfur cluster biosynthetic enzyme [General function prediction only].	1.98371e-38
NC_006462.1\|WP_011174461.1\|138874_139279_+\|type-III-A-CRISPR-associated-protein-Csm2	gnl\|CDD\|187778	cd09647, Csm2_III-A, CRISPR/Cas system-associated protein Csm2. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Small alpha-helical protein; signature gene for subtype III-A.	5.43062e-18
NC_006462.1\|WP_011174463.1\|136128_136401_+\|CRISPR-associated-endonuclease-Cas2	gnl\|CDD\|187856	cd09725, Cas2_I_II_III, CRISPR/Cas system-associated protein Cas2. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas2 is present in majority of CRISPR/Cas systems along with Cas1; RNAse specific to U-rich regions; Possesses an RRM/ferredoxin fold.	2.97709e-24

>NC_006462.1|WP_164926115.1|133474_133714_-|hypothetical-protein
MRKMKLGICTRRIMGVFEGLHQWKATGERGDEKKKRIFAFRKGKTGFQDPRPEVRVGKSIAHTATLHQVKISAKKRLPK
>NC_006462.1|WP_011229154.1|132454_133402_+|CRISPR-associated-endonuclease-Cas1
MTLHLTRQGATLRLRQGRLLLEEEGREVAGFPARQVRSVALWGNVRLSTPALVFLLRQGVPVFFYSLEGFLHGVAGAYPDPHPAHLRAQFAAEGLPLARAFVVGKLRSALALLERHRLPEAGGVVEALARAEGASELERLRGAEGEGSRVYFQGLARLLGPYGFGGRTRRPPRDPVNAALSYGYALLLGRVLVAVRLAGLHPEVGFLHAEGRRSPALALDLMEEFRVPVVDQVVLSAFRRGLLTPSHAEVREGGVYLNEEGRRRLIQLFEERLLEGVSHPLGFRKPLGETIEVQAQRLKAALLGRGRYTPFYLWR
>NC_006462.1|WP_011229155.1|131245_132451_+|TIGR02710-family-CRISPR-associated-protein
MKVLILTVGTTREPLEVALAEHAPQGVVFLASQASHPVAAELVRDYGGSFRHHTLLLEDAESLMEAYQKALLALRKALEWEATAIVADLTGGTKPMAAGLVLALTGRGVVFSYVGGEARDPGTGRVLAGKERLRLLEDPTARLGLKEWAGFTRAWNALNLGMALAELESLLRRDLSPSEARFYGAMKGVVEGLMEWDRFRHREAWERLSVHLPLALAVAEAWGHGAKVRVLKGLEALLPHLKGIVEAGPKPTFLLLQDLLANAERRAALGRFDDALARLYRALELAVEADVHERLGFSLKDPRTWPEGFPEGLRERILKPRGLMDLLDAAFDLDLAFGEQGTLAQRLYGEKNRLQALLQRRHESILAHGTRPVGEEDYTALRDFLMRLDERLRPLPPWPRF
>NC_006462.1|WP_011229156.1|129693_131226_+|FAD-dependent-oxidoreductase
MDREALLERLKEPFDLLVLGGGATGAGVLWEATLRGLKAALVEAGDFASGTSSRSTKLLHGGVRYLELAFKRLDRRQLKLVVDALHERKVVMDLAPHLAKPLTLVTPLFRPLEIPYYTLGLKLYDLLAGKRRLAPSRYLPPEEVARLFPDLPKTLGGVAYQDGQFADFRLNLALVLSALERGAVALNHAEATALLLEGGRVRGAVVRDGLSGKEVEVRAKAVVNATGSLADRVRRLLDPHLPPLLTASSGVHLVLDYPLEAGLLVPKTRDGRVLFLLPYRGMALLGTTDLPAEPASCPLPREEEVAYLLEEIRPYLGDVSGRVRAVWSGLRPLVGKGETKLLVRDHYIEERRGLYTLVGGKWTTFRLMALDLVERLAKDLGLALPPSKSHATPLLGAGPRPPLPLPEEAARRLWETYGTLAPEVLALGDRPLLPGLPYLEGEVVWAVRRELARKPLDVLARRMGLAFLDQEKTREALPKVVELMAGLLGWDERERALRLKEAEEGLPGLC
>NC_006462.1|WP_011229157.1|128206_129694_+|glycerol-kinase-GlpK
MAFLLALDQGTTSSRAILFTLEGRPVAVAKREFRQLYPKPGWVEHDPLEIWETTLWAAREVLRRAGAEAGEVLALGITNQRETTLLWDRKTGKPLHNAIVWQDRRTTPLCEALRAKGLEPLFRERTGLLFDPYFSGTKLVWLLENVPGLKARAEGGGVAFGTVDTWLIWNLTGGKVHATDPTNASRTLLFNLHTLAWDPELLEALGIPAALLPEVRPSDGDFGETLPELLGAPVPIRGVLGDQQAALFGQAALGGGEGKCTYGTGAFLLLNTGKRPVLSEKGLLATVAWSLGGRATYALEGSLFVAGAAVGWLKEVGLIRESAEVEALAASVEDTGDVYFVPAFTGLGAPYWDPYARGTLLGLTRGTSRAHLARAALEGVAFQVRDVVLAMEEEAGVRLKVLKADGGMAQNRLFLKIQADLLGVPVAVPEVTETTALGAALMAGVGAGALSPEDVAGRFREAERFLPTMPEGRREALYRRWREAVERAKGWAREG
>NC_006462.1|WP_011229158.1|127397_128072_-|glycerophosphodiester-phosphodiesterase
MTAFRQRPLRLGHRGAPLKAKENTLESFRLALEAGLDGVELDVWPTRDGVFAVRHDPDTPLGPVFQVDYADLKAQEPDLPRLEEVLALKEAFPQAVFNVELKSFPGLGEEAARRLAALLRGREGVWVSSFDPLALLALRKAAPGLPLGFLMAEDHSALLPCLGVEAVHPHHALVTEEAVAGWRKRGLFVVAWTVNEEGEARRLLALGLDGLIGDRPEVLLPLGG
>NC_006462.1|WP_011229159.1|125926_127396_-|Na/Pi-cotransporter-family-protein
MALLGILALLYLGTLLVTEGAGGLVGPSGRRLLSRLRGFPLGLAALLLGAASGSGTGLSLLGRGLLQVGVLPLYEAALLALGGTLGATVLVAVAGLGNRTLAFAALSLALALEVLKRGQGANRLLFGLGLLFLGLDLARGEALGTGAWLGSLPPLALFLAGLLLAFAVGSANLVALLALGLAGEGVGPEGTLALVLGGGVGCTGPVLLRSTPESLRLGLVLLFHRLALALPLLFAPNPGVFPAHAGFHALAFLAFPLAYPLWERLAARLAPSPKPLAPKYLRPEALNDPLLAQGLALRELARIGDAARHMLEGVLKALVQETGHEAELLPLEEKVDRLSREVLVYVAKLPQDTPALPLLKAASELEHLADLAKRALRKAERLWTQGVTFSPEGKAELARIVGRTLARLERALTALATGNRALAERVLAEYPEVLAEVEASREAHLRRLRDRVETRASTLTHLDLLLLLEELNLGVNRLARLVEEIHKEG
>NC_006462.1|WP_011229160.1|124776_126021_+|multidrug-effflux-MFS-transporter
MGPLEELLFLGTLMALGAFSIDVMLPALEATAHRYGTSPTAAQLVVGLYFLGFALGQLLWGPLMDALGRRKVLRGALFGFSLAALATVAAPGFSLLLAARFVQGFFAASFRIGVTASIRDRYRGEAMARRLSYALLVLMVAPVLAPALGVALLALGPWAPYALPAFLGLLALLWSGRFRETLPEEARRPLRLASLGEGALLVLRDRRAGLYALALGGVFGILYAYLAASAELYKAHLGLSNPAFALAFGATGLVLAGANLLGPQVVARLGLGKALRRAVAGLLALLLFLPLHALAPRPFPFWLHLTLVLLLVVFTFPNAQARALEGLGKVAGLAASFTGFLSTLLAALLGTLVGQASGGAPLPFSLGLLGLGVLAFAAVFLAEASPLCGSPPPGGPGGSPPGSAPPGGGGGPGG
>NC_006462.1|WP_024119885.1|124593_124740_+|hypothetical-protein
MDRQGGPAYLREGRVRVEPLVSEAVPLEALPGHFQNRLQGRIQTLVRF
>NC_006462.1|WP_011229161.1|124188_124500_+|metal-sulfur-cluster-assembly-factor
MTARNPLEAQAWALLEAVYDPELGLDVVNLGLIYDLVVEPPRAYVRMTLTTPGCPLHDSLGEAVRQALSRLPGVEEVEVEVTFEPPWTLARLSEKARRLLGWG
>NC_006462.1|WP_011229153.1|133965_134919_-|IS110-like-element-IS1000A-family-transposase
MTFAGIDVSKTHLDLALVSNSPKPTRLRFPNSPEGRQALLAALAHHNPAWVALEPTGAYHLPLLKLLAENRLQVALVNPYHLAAFRKAKGERQKTDRQDALLLARYAQVYHGELWAYTLPPEALRELKALVGYREDLAGRERAILNQMEAAEWAGSKEVLALLQKELACVKGLLGEVEARIQALLATLPEAEVLMALPGVGPQVAAAVLALLPPELWGRAKRAASYAGLIPEREESGKSVERSRLSKKGPPLLRRKLYMGALVAVRHDPEMRAFYHRLLSRGKRKKQALVAVAHKLLRRMMGRLREYYATQLDQGVA
>NC_006462.1|WP_011174463.1|136128_136401_+|CRISPR-associated-endonuclease-Cas2
MGKRLYAVAYDIPDDTRRVKLANLLKSYGERVQLSVFECYLDERLLEDLRRRARRLLDLGQDALRIYPVAGQVEVLGVGPLPELREVQVL
>NC_006462.1|WP_011229152.1|136456_138874_+|type-III-A-CRISPR-associated-protein-Cas10/Csm1
MLGDGLSVALAGLLHDVGKLYSRARWGERDDQVPDRTHTAYTAHFVREHAGLFRGAGLDPDWLARTASRHHEGWRDRPQYRPETPEEWCVALADTYASKEREEGEGGGSPPEVPLSPPFRRLLLGGEEGREGGYSPVGAGGRVGLEAGGLYPEERPNVSKDVYKRLLERLEGRLEEMARFSLGKEALVLNLALALQETLSLVPSDTQSEPDVSLYDHLRLTAAIAHALWLFHGGSPSAQNLRQDGEKFLLVVGDMGGIQGHIYRIAGAEAGVGGIAKRLRARSLEVSLAAEAMALGLLWRLGLTSLNRILGAGGKFYLLLPNTEEARAALEGTREAWGRWALKRGGSLVPHLAWVAFRGQDFRDFAALLKRLHEALAREKLRPFAFLASTGGVLGAPLRPCAACGLEPARRDEPGSLCPDCEREAALGARLPRSDRVGFFLEEAPRPYLDFPGLKVGLGGPLEGAFHLFRARLDFAPWPDPSEAKPLLGHLPRVEHALKAKGWSLEAYRAWAEEEGLLEDEEPHPEKVLTFAELAALSEGAPYLGALMLDADRMGEAFATGFRREGRDLATPSRLAALSRTLEVFFTTEVLTLLEEPRRYRERLGWDDLEAQRKEARYPLLYSVYSGGDDLFLLGPWDALLDFALDLERLYRLFTRHPRLTLSGGFLLVPPSLPVPELARLLGEAEKRAKAEGRERLFLFGQAVPWETLRGLRAWAEGLRQDLRAERVSRAQVYRWLLLWRRFSPLEDPGERMRYKPLLAYALRRVRERDEEAWKRYLKLLDHQDPAWAYLPVWVQWALYRERRV
>NC_006462.1|WP_011174461.1|138874_139279_+|type-III-A-CRISPR-associated-protein-Csm2
MPALEFFKDKERGVLDPKVFERAREVAEGLARGKLKSSQFRNYFAELRALENRFERERRKEGEELAFARLVPQLELLRAKLFYNTRSQGPLRDAKEFVEFMEEALEAGKRSPKDFEAMMKYVEAVLAYFYALAK
>NC_006462.1|WP_011229151.1|139290_140016_+|type-III-A-CRISPR-associated-RAMP-protein-Csm3
MKLKKVIRIRSVLLAKTGLRIGMSRDQMAIGDLDNPVVRNPLTDEPYIPGSSLKGKLRYLLEWSLGGDYILKAKERQVYASPDPKDPVARIFGLAPENDERSLAVARERGPTRLLVRDAYLTEDAKEALERTSARGGLYTEIKQEVFIPRLGGNANPRTTERVPAGARFRVEMTYRVLDDLDEEYFGKYLLRALELLELDGLGGHISRGYGQVYFLHPERLTEDQEGWPLKERLKVEEVVL
>NC_006462.1|WP_011229150.1|140025_140901_+|hypothetical-protein
MRATLFRLYFQGPLKALPRAPTLLGHLFWWYRYTHGREALEELLERFRQEPPFRLSSVYPEGWLPRPKLPPVQVEETTLRKALKSLSLVRLDTFQALAERGEEALLEAPEVQGKARPPEMRRLRRTRVGVDRAAGTARPGVLFTQEYLFPDPRTPYALYVLGEAPFDLGEALAFVGEMGYGGQASLGLGRFRVEGPFAVELPEAKEPNAYATLAPGPLEEALYYEVEPYWGRLGGAYVGARPFKRPYLRAKEGSVYRGPTHRLLEVTPTEPPEAGARVWEALVVFPLGVRV
>NC_006462.1|WP_011174458.1|140897_142052_+|type-III-A-CRISPR-associated-RAMP-protein-Csm5
MRFLRSFRLELEALSPVHVGTGEAYPAYAYVPDFARKAVHLLDPAALLLALPEARRRQYLEKVAQGPKAAQEVLRYLLEEDQLPREAVLHTLPASKAFLEALRSATEEALLEYRPLPRSPLGAYLPGSSVKGALRTAWLFHVLVREGKVAVFDRKEGVWRLRAWREGDGGTHVYPSRNPSLYENQAFEGAVLGYAREGKGRRMSLDLYRDPFRAVRLSDSGPVETFLNRLGVFHPHKDTSRMVLLAETFRIGTRFALTLRYHEGLSRDGDGERGVSMPIPPEDLVRALRDYYGKVAEWEEGFAEEHRLKRALEVYRALRERLQDPEAFPLRVGFGSGRLALRLALLLPEDHPEAQEPKTRKTAGAQNPVDGYPLGWMVGRLEPL
>NC_006462.1|WP_011229148.1|142062_143457_+|type-III-A-CRISPR-associated-protein-Csm6
MEDLDALWERYREAVRAGGNPQALYQEMVWPALLALWREKPRVYPFPQAFAVSVHTLGTSPEATALAILGAGAERVYVLHTPESARFLPRLRQDTGKDLYPVEIGKSDVEAIYREVKRLLEKHPEVPVALDLTSGTKAMSAGLAAAGFFFQRFYPKVRVVYVDNEDYDPELRRPRAGTEKLRILPNPHEALAEVDALFAKELYGKGEFGQAAAYFRGMVGRTGNQAYALYALLAEMYRAWRALDFGEALKAGRKLLGQLSQNVWLNHPLNARREALEAQVALLEAVDRFLKARDFALKEGVYGLARTLLHLAQEAKEEAAVLAALYAYRALELLLQERLALLGRRAEAPGLSPEEAEALRKALAELLGVLPEEVRLPAKLGLLDLLAFLRLKGDEALGRLSLAELRGLAGALKGRNSALLVHGFDVPSPKAVEGIARLAQGLLQDLEARTALGPLSPEPVPLGF
>NC_006462.1|WP_011228296.1|144853_145807_-|IS110-like-element-IS1000B-family-transposase
MTFAGIDVSKTHLDLALVSNSPKPTRLRFPNSPEGRQALLAALAHHNPAWVALEPTSAYHLPLLKLLAENRLQVALVNPYHLAAFRKAKGERQKTDRQDALLLARYAQVYHEDLRAYTLPPETLRELKALVGYREDLAGRERTILNQMEAAEWAGSKEVLALLQKELACVKGLLGEVEARIQALLATLPEAEVLMALPGVGPQVAAAVLALLPPELWGRAKRAASYAGLIPEREESGKSVERSRLSKKGPPLLRRKLYMGALVAVRHDPEMRAFYHRLLSRGKRKKQALVAVAHKLLRRMMGRLREYYATQLDQGVA
>NC_006462.1|WP_011229147.1|147019_148930_+|hypothetical-protein
MQAPVYLCLLGNDPAPAYLGLKVVEREAGRVAKAVFYSFPAWNEEYGKKRQAFFRLLSEKGVLYEERPLEKGLEEAEAREVWVNLTGGAKYWAVRFLGHWRRPGARVFLVEGHRALEAPRALFLWPREEERSLEAEALTLEEYARLYLEPLGEAWERVSPPGAFPPGAQAARLPGREGGVFVVHRGLPYWYWVRPHLGGEAKDMSRKALSAFSGEAKRLGGQLCLPVVPYHKAHLRSRHPKERENVFARWRAWAREYGVFLVDPGRPLEEEVASLIKGKASKKALPLPQEGPLLLALVSEQAVPLYAAYLHAGPREVYLLTTPEMESRLRWAEAFFRGKGVRVHRSFLSGPWALREVRDLLAPVVEEALRRGHPVHANLNSGTTAMALGLYLALRDGARAHYLDGDRLLLLDGGEAEVPWEEGRPEDLLALRGYRFEEEYPDARPDPGLLALAEEILRRWDEVQTSWEASPLVRRFLKFWKKRFGQAFPPKRLSRLKGLPLEYAVYSHLNAHLAPKGGQARMGGHLVPLGGNEALAPQSTEVDGVFFHRGALWFVECKPTDEGLRERAPIMAELVRSVGGVEARGLMVARRWRGAPPPASPNLVYMALEGGEGVGVYRFPEELEKALSRNPAPRRG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_006462_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_006462_4

135156-136099

TypeIII

III-A

Consensus_repeat	Method
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	PILER-CR
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	CRISPRCasFinder
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	CRT

12 spacers

cas1,csx1,cas2,cas10,csm2gr11,csm3gr7,csm4gr5,csm5gr7

The CRISPR arrays of NC_006462_4

>merge|NC_006462|4|135156-136099|PILER-CR,CRISPRCasFinder,CRT
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGACTGCTCTAATCGGGCCTGTTCGGCTATGGCCTTGGGGCTCGTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGACACAACCCGCCCAAAGGGAATGCCGCTAGCCCCAGACACATGTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGACCAGTCCCACCCCTCGTGGGGGGCGGCCCTGTCGTCGGTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGACCGCACCCTCCTTCCGAGCTTCCACCCGGCGTACATGGCCGTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGACTTCAGCAGACCGAAGTGTCTTCCGTTGCGAACAGTGTAGGTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGACCCTCATCAGCGCATCTAGAGCCTGAATTATCCTCATTTCTTCGTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGACGCCATCACCGTGAGGCCGCCCTCCACCAGCTCCCCCTCCAGTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGACTTTCTTAATTACGAGCCAGTCATTCGGATAAACCATGAGAGTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGACTGAAAGTTTCGGTGGTCCCCCCCGCCCTCCACCAGCGGAGTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGACCCGCAGCTGGGGCAAGTGCAACCGCAGTAGCTCATACTCCGTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGACTTGGCGGTCAGGGTTTGGTACCGCACCGTGTTCGGCGTTAGTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGACTTCTTGATTATCCTGACCTTGTCCTTCATCTTTGACCTCCTTGTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGCC

>NC_006462|4|2|135156-136099|PILER-CR
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	TGCTCTAATCGGGCCTGTTCGGCTATGGCCTTGGGGCTC
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	ACAACCCGCCCAAAGGGAATGCCGCTAGCCCCAGACACAT
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	CAGTCCCACCCCTCGTGGGGGGCGGCCCTGTCGTCG
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	CGCACCCTCCTTCCGAGCTTCCACCCGGCGTACATGGCC
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	TTCAGCAGACCGAAGTGTCTTCCGTTGCGAACAGTGTAG
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	CCTCATCAGCGCATCTAGAGCCTGAATTATCCTCATTTCTTC
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	GCCATCACCGTGAGGCCGCCCTCCACCAGCTCCCCCTCCA
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	TTTCTTAATTACGAGCCAGTCATTCGGATAAACCATGAGA
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	TGAAAGTTTCGGTGGTCCCCCCCGCCCTCCACCAGCGGA
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	CCGCAGCTGGGGCAAGTGCAACCGCAGTAGCTCATACTCC
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	TTGGCGGTCAGGGTTTGGTACCGCACCGTGTTCGGCGTTA
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	TTCTTGATTATCCTGACCTTGTCCTTCATCTTTGACCTCCTT
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGCC

>NC_006462|4|3|135156-136099|CRISPRCasFinder
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	TGCTCTAATCGGGCCTGTTCGGCTATGGCCTTGGGGCTC
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	ACAACCCGCCCAAAGGGAATGCCGCTAGCCCCAGACACAT
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	CAGTCCCACCCCTCGTGGGGGGCGGCCCTGTCGTCG
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	CGCACCCTCCTTCCGAGCTTCCACCCGGCGTACATGGCC
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	TTCAGCAGACCGAAGTGTCTTCCGTTGCGAACAGTGTAG
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	CCTCATCAGCGCATCTAGAGCCTGAATTATCCTCATTTCTTC
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	GCCATCACCGTGAGGCCGCCCTCCACCAGCTCCCCCTCCA
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	TTTCTTAATTACGAGCCAGTCATTCGGATAAACCATGAGA
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	TGAAAGTTTCGGTGGTCCCCCCCGCCCTCCACCAGCGGA
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	CCGCAGCTGGGGCAAGTGCAACCGCAGTAGCTCATACTCC
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	TTGGCGGTCAGGGTTTGGTACCGCACCGTGTTCGGCGTTA
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	TTCTTGATTATCCTGACCTTGTCCTTCATCTTTGACCTCCTT
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGCC

>NC_006462|4|3|135156-136099|CRT
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	TGCTCTAATCGGGCCTGTTCGGCTATGGCCTTGGGGCTC
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	ACAACCCGCCCAAAGGGAATGCCGCTAGCCCCAGACACAT
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	CAGTCCCACCCCTCGTGGGGGGCGGCCCTGTCGTCG
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	CGCACCCTCCTTCCGAGCTTCCACCCGGCGTACATGGCC
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	TTCAGCAGACCGAAGTGTCTTCCGTTGCGAACAGTGTAG
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	CCTCATCAGCGCATCTAGAGCCTGAATTATCCTCATTTCTTC
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	GCCATCACCGTGAGGCCGCCCTCCACCAGCTCCCCCTCCA
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	TTTCTTAATTACGAGCCAGTCATTCGGATAAACCATGAGA
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	TGAAAGTTTCGGTGGTCCCCCCCGCCCTCCACCAGCGGA
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	CCGCAGCTGGGGCAAGTGCAACCGCAGTAGCTCATACTCC
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	TTGGCGGTCAGGGTTTGGTACCGCACCGTGTTCGGCGTTA
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	TTCTTGATTATCCTGACCTTGTCCTTCATCTTTGACCTCCTT
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGCC

Protein	Signature genes	Signature genes Name	Protein_function
NC_006462.1\|WP_011229147.1\|147019_148930_+\|hypothetical-protein	unknown	unknown	unknown
NC_006462.1\|WP_011229156.1\|129693_131226_+\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|215257
NC_006462.1\|WP_011229153.1\|133965_134919_-\|IS110-like-element-IS1000A-family-transposase	unknown	unknown	gnl\|CDD\|376564
NC_006462.1\|WP_011229151.1\|139290_140016_+\|type-III-A-CRISPR-associated-RAMP-protein-Csm3	csm3gr7	cd09684_csm3gr7_CAS-III-A:CAS-III-D	gnl\|CDD\|187815
NC_006462.1\|WP_011229148.1\|142062_143457_+\|type-III-A-CRISPR-associated-protein-Csm6	csx1	cd09747_csx1_CAS-III	gnl\|CDD\|378236
NC_006462.1\|WP_011229152.1\|136456_138874_+\|type-III-A-CRISPR-associated-protein-Cas10/Csm1	cas10	cd09680_cas10_CAS-III	gnl\|CDD\|274209
NC_006462.1\|WP_164926115.1\|133474_133714_-\|hypothetical-protein	unknown	unknown	unknown
NC_006462.1\|WP_011174458.1\|140897_142052_+\|type-III-A-CRISPR-associated-RAMP-protein-Csm5	csm5gr7	cd09662_csm5gr7_CAS-III-A	gnl\|CDD\|273863
NC_006462.1\|WP_011228296.1\|144853_145807_-\|IS110-like-element-IS1000B-family-transposase	unknown	unknown	gnl\|CDD\|376564
NC_006462.1\|WP_011229158.1\|127397_128072_-\|glycerophosphodiester-phosphodiesterase	unknown	unknown	gnl\|CDD\|176499
NC_006462.1\|WP_011174453.1\|148900_149422_-\|hypothetical-protein	unknown	unknown	unknown
NC_006462.1\|WP_011229159.1\|125926_127396_-\|Na/Pi-cotransporter-family-protein	unknown	unknown	gnl\|CDD\|224202
NC_006462.1\|WP_011229155.1\|131245_132451_+\|TIGR02710-family-CRISPR-associated-protein	csx1	cd09702_csx1_CAS-III	gnl\|CDD\|274263
NC_006462.1\|WP_011229154.1\|132454_133402_+\|CRISPR-associated-endonuclease-Cas1	cas1	cd09634_cas1_CAS-I:CAS-II:CAS-III:CAS-V	gnl\|CDD\|187766
NC_006462.1\|WP_011229157.1\|128206_129694_+\|glycerol-kinase-GlpK	unknown	unknown	gnl\|CDD\|198361
NC_006462.1\|WP_011229150.1\|140025_140901_+\|hypothetical-protein	csm4gr5	mkCas0089_csm4gr5_CAS-III-A:CAS-III-D	gnl\|CDD\|187794
NC_006462.1\|WP_024119885.1\|124593_124740_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|176198
NC_006462.1\|WP_011229160.1\|124776_126021_+\|multidrug-effflux-MFS-transporter	unknown	unknown	gnl\|CDD\|340878
NC_006462.1\|WP_011174461.1\|138874_139279_+\|type-III-A-CRISPR-associated-protein-Csm2	csm2gr11	cd09647_csm2gr11_CAS-III-A	gnl\|CDD\|187778
NC_006462.1\|WP_011174463.1\|136128_136401_+\|CRISPR-associated-endonuclease-Cas2	cas2	mkCas0081_cas2_CAS-I:CAS-II:CAS-III	gnl\|CDD\|187856

Protein	Function_ID	Function_description	E-value
NC_006462.1\|WP_011229156.1\|129693_131226_+\|FAD-dependent-oxidoreductase	gnl\|CDD\|215257	PLN02464, PLN02464, glycerol-3-phosphate dehydrogenase.	2.8258e-162
NC_006462.1\|WP_011229153.1\|133965_134919_-\|IS110-like-element-IS1000A-family-transposase	gnl\|CDD\|376564	pfam01548, DEDD_Tnp_IS110, Transposase. Transposase proteins are necessary for efficient DNA transposition. This family includes an amino-terminal region of the pilin gene inverting protein (PIVML) and of members of the IS111A/IS1328/IS1533 family of transposases. The C-terminus is represented by family pfam02371.	3.27877e-28
NC_006462.1\|WP_011229151.1\|139290_140016_+\|type-III-A-CRISPR-associated-RAMP-protein-Csm3	gnl\|CDD\|187815	cd09684, Csm3_III-A, CRISPR/Cas system-associated RAMP superfamily protein Csm3. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; RAMP superfamily protein.	4.10911e-103
NC_006462.1\|WP_011229148.1\|142062_143457_+\|type-III-A-CRISPR-associated-protein-Csm6	gnl\|CDD\|378236	pfam09670, Cas_Cas02710, CRISPR-associated protein (Cas_Cas02710). Members of this family are found, exclusively in the vicinity of CRISPR repeats and other CRISPR-associated (cas) genes, in Methanothermobacter thermautotrophicus (Methanobacterium thermoformicicum), Thermus thermophilus (Deinococcus-Thermus), Chloroflexus aurantiacus (Chloroflexi), and Thermomicrobium roseum (Thermomicrobia).	2.23057e-125
NC_006462.1\|WP_011229152.1\|136456_138874_+\|type-III-A-CRISPR-associated-protein-Cas10/Csm1	gnl\|CDD\|274209	TIGR02578, CRISPR-associated_protein_Cas10/Csm1, CRISPR-associated protein Cas10/Csm1, subtype III-A/MTUBE. The family is designated Csm2, for CRISPR/Cas Subtype Mtube Protein 2. A typical example is TM1811 from Thermotoga maritima. CRISPR are Clustered Regularly Interspaced Short Palindromic Repeats. This protein family belongs to a conserved gene cluster regularly found near CRISPR repeats.	0
NC_006462.1\|WP_011174458.1\|140897_142052_+\|type-III-A-CRISPR-associated-RAMP-protein-Csm5	gnl\|CDD\|273863	TIGR01899, cas_TM1807_csm5, CRISPR type III-A/MTUBE-associated RAMP protein Csm5. CRISPR is a term for Clustered Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR associated) proteins. Members of this cas gene family are found in the mtube subtype of CRISPR/cas locus and designated Csm5, for CRISPR/cas Subtype Mtube, protein 5.	1.01226e-19
NC_006462.1\|WP_011228296.1\|144853_145807_-\|IS110-like-element-IS1000B-family-transposase	gnl\|CDD\|376564	pfam01548, DEDD_Tnp_IS110, Transposase. Transposase proteins are necessary for efficient DNA transposition. This family includes an amino-terminal region of the pilin gene inverting protein (PIVML) and of members of the IS111A/IS1328/IS1533 family of transposases. The C-terminus is represented by family pfam02371.	2.28212e-29
NC_006462.1\|WP_011229158.1\|127397_128072_-\|glycerophosphodiester-phosphodiesterase	gnl\|CDD\|176499	cd08556, GDPD, Glycerophosphodiester phosphodiesterase domain as found in prokaryota and eukaryota, and similar proteins. The typical glycerophosphodiester phosphodiesterase domain (GDPD) consists of a TIM barrel and a small insertion domain named the GDPD-insertion (GDPD-I) domain, which is specific for GDPD proteins. This family corresponds to both typical GDPD domain and GDPD-like domain which lacks the GDPD-I region. Members in this family mainly consist of a large family of prokaryotic and eukaryotic glycerophosphodiester phosphodiesterases (GP-GDEs, EC 3.1.4.46), and a number of uncharacterized homologs. Sphingomyelinases D (SMases D) (sphingomyelin phosphodiesterase D, EC 3.1.4.41) from spider venom, SMases D-like proteins, and phospholipase D (PLD) from several pathogenic bacteria are also included in this family. GDPD plays an essential role in glycerol metabolism and catalyzes the hydrolysis of glycerophosphodiesters to sn-glycerol-3-phosphate (G3P) and the corresponding alcohols are major sources of carbon and phosphate. Its catalytic mechanism is based on the metal ion-dependent acid-base reaction, which is similar to that of phosphoinositide-specific phospholipases C (PI-PLCs, EC 3.1.4.11). Both, GDPD related proteins and PI-PLCs, belong to the superfamily of PI-PLC-like phosphodiesterases.	5.95697e-59
NC_006462.1\|WP_011229159.1\|125926_127396_-\|Na/Pi-cotransporter-family-protein	gnl\|CDD\|224202	COG1283, NptA, Na+/phosphate symporter [Inorganic ion transport and metabolism].	1.68827e-39
NC_006462.1\|WP_011229155.1\|131245_132451_+\|TIGR02710-family-CRISPR-associated-protein	gnl\|CDD\|274263	TIGR02710, conserved_hypothetical_protein, CRISPR-associated protein, TIGR02710 family. Members of this family are found, exclusively in the vicinity of CRISPR repeats and other CRISPR-associated (cas) genes, in Methanothermobacter thermautotrophicus (Archaea), Thermus thermophilus (Deinococcus-Thermus), Chloroflexus aurantiacus (Chloroflexi), and Thermomicrobium roseum (Thermomicrobia).	8.33434e-162
NC_006462.1\|WP_011229154.1\|132454_133402_+\|CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|187766	cd09634, Cas1_I-II-III, CRISPR/Cas system-associated protein Cas1. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas1 is the most universal CRISPR system protein thought to be involved in spacer integration; Cas1 is metal-dependent deoxyribonuclease, also binds RNA; Shown to possess a unique fold consisting of a N-terminal beta-strand domain and a C-terminal alpha-helical domain.	1.16225e-102
NC_006462.1\|WP_011229157.1\|128206_129694_+\|glycerol-kinase-GlpK	gnl\|CDD\|198361	cd07786, FGGY_EcGK_like, Escherichia coli glycerol kinase-like proteins; belongs to the FGGY family of carbohydrate kinases. This subgroup is composed of mostly bacterial and archaeal glycerol kinases (GK), including the well characterized proteins from Escherichia coli (EcGK), Thermococcus kodakaraensis (TkGK), and Enterococcus casseliflavus (EnGK). GKs contain two large domains separated by a deep cleft that forms the active site. This model includes both the N-terminal domain, which adopts a ribonuclease H-like fold, and the structurally related C-terminal domain. The high affinity ATP binding site of EcGK is created only by a substrate-induced conformational change, which is initiated by protein-protein interactions through complex formation with enzyme IIAGlc (also known as IIIGlc), the glucose-specific phosphocarrier protein of the phosphotransferase system (PTS). EcGK exists in a dimer-tetramer equilibrium. IIAGlc binds to both EcGK dimer and tetramer, and inhibits the uptake and subsequent metabolism of glycerol and maltose. Another well-known allosteric regulator of EcGK is fructose 1,6-bisphosphate (FBP), which binds to the EcGK tetramer and plays an essential role in the stabilization of the inactive tetrameric form. EcGK requires Mg2+ for its enzymatic activity. Members in this subgroup belong to the FGGY family of carbohydrate kinases.	0
NC_006462.1\|WP_011229150.1\|140025_140901_+\|hypothetical-protein	gnl\|CDD\|187794	cd09663, Csm4_III-A, CRISPR/Cas system-associated RAMP superfamily protein Csm4. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; RAMP superfamily protein.	3.841e-11
NC_006462.1\|WP_024119885.1\|124593_124740_+\|hypothetical-protein	gnl\|CDD\|176198	cd08236, sugar_DH, NAD(P)-dependent sugar dehydrogenases. This group contains proteins identified as sorbitol dehydrogenases and other sugar dehydrogenases of the medium-chain dehydrogenase/reductase family (MDR), which includes zinc-dependent alcohol dehydrogenase and related proteins. Sorbitol and aldose reductase are NAD(+) binding proteins of the polyol pathway, which interconverts glucose and fructose. Sorbitol dehydrogenase is tetrameric and has a single catalytic zinc per subunit. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Related proteins include threonine dehydrogenase, formaldehyde dehydrogenase, and butanediol dehydrogenase. The medium chain alcohol dehydrogenase family (MDR) has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Horse liver alcohol dehydrogenase is a dimeric enzyme and each subunit has two domains. The NAD binding domain is in a Rossmann fold and the catalytic domain contains a zinc ion to which substrates bind. There is a cleft between the domains that closes upon formation of the ternary complex.	0.00382704
NC_006462.1\|WP_011229160.1\|124776_126021_+\|multidrug-effflux-MFS-transporter	gnl\|CDD\|340878	cd17320, MFS_MdfA_MDR_like, Multidrug transporter MdfA and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This family is composed of bacterial multidrug resistance (MDR) transporters including several proteins from Escherichia coli such as MdfA (also called chloramphenicol resistance pump Cmr), EmrD, MdtM, MdtL, bicyclomycin resistance protein (also called sulfonamide resistance protein), and the uncharacterized inner membrane transport protein YdhC. EmrD is a proton-dependent secondary transporter, first identified as an efflux pump for uncouplers of oxidative phosphorylation. It expels a range of drug molecules and amphipathic compounds across the inner membrane of E. coli. Similarly, MdfA is a secondary multidrug transporter that exports a broad spectrum of structurally and electrically dissimilar toxic compounds. These MDR transporters are drug/H+ antiporters (DHA) belonging to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	6.46861e-79
NC_006462.1\|WP_011174461.1\|138874_139279_+\|type-III-A-CRISPR-associated-protein-Csm2	gnl\|CDD\|187778	cd09647, Csm2_III-A, CRISPR/Cas system-associated protein Csm2. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Small alpha-helical protein; signature gene for subtype III-A.	5.43062e-18
NC_006462.1\|WP_011174463.1\|136128_136401_+\|CRISPR-associated-endonuclease-Cas2	gnl\|CDD\|187856	cd09725, Cas2_I_II_III, CRISPR/Cas system-associated protein Cas2. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas2 is present in majority of CRISPR/Cas systems along with Cas1; RNAse specific to U-rich regions; Possesses an RRM/ferredoxin fold.	2.97709e-24

>NC_006462.1|WP_011229153.1|133965_134919_-|IS110-like-element-IS1000A-family-transposase
MTFAGIDVSKTHLDLALVSNSPKPTRLRFPNSPEGRQALLAALAHHNPAWVALEPTGAYHLPLLKLLAENRLQVALVNPYHLAAFRKAKGERQKTDRQDALLLARYAQVYHGELWAYTLPPEALRELKALVGYREDLAGRERAILNQMEAAEWAGSKEVLALLQKELACVKGLLGEVEARIQALLATLPEAEVLMALPGVGPQVAAAVLALLPPELWGRAKRAASYAGLIPEREESGKSVERSRLSKKGPPLLRRKLYMGALVAVRHDPEMRAFYHRLLSRGKRKKQALVAVAHKLLRRMMGRLREYYATQLDQGVA
>NC_006462.1|WP_164926115.1|133474_133714_-|hypothetical-protein
MRKMKLGICTRRIMGVFEGLHQWKATGERGDEKKKRIFAFRKGKTGFQDPRPEVRVGKSIAHTATLHQVKISAKKRLPK
>NC_006462.1|WP_011229154.1|132454_133402_+|CRISPR-associated-endonuclease-Cas1
MTLHLTRQGATLRLRQGRLLLEEEGREVAGFPARQVRSVALWGNVRLSTPALVFLLRQGVPVFFYSLEGFLHGVAGAYPDPHPAHLRAQFAAEGLPLARAFVVGKLRSALALLERHRLPEAGGVVEALARAEGASELERLRGAEGEGSRVYFQGLARLLGPYGFGGRTRRPPRDPVNAALSYGYALLLGRVLVAVRLAGLHPEVGFLHAEGRRSPALALDLMEEFRVPVVDQVVLSAFRRGLLTPSHAEVREGGVYLNEEGRRRLIQLFEERLLEGVSHPLGFRKPLGETIEVQAQRLKAALLGRGRYTPFYLWR
>NC_006462.1|WP_011229155.1|131245_132451_+|TIGR02710-family-CRISPR-associated-protein
MKVLILTVGTTREPLEVALAEHAPQGVVFLASQASHPVAAELVRDYGGSFRHHTLLLEDAESLMEAYQKALLALRKALEWEATAIVADLTGGTKPMAAGLVLALTGRGVVFSYVGGEARDPGTGRVLAGKERLRLLEDPTARLGLKEWAGFTRAWNALNLGMALAELESLLRRDLSPSEARFYGAMKGVVEGLMEWDRFRHREAWERLSVHLPLALAVAEAWGHGAKVRVLKGLEALLPHLKGIVEAGPKPTFLLLQDLLANAERRAALGRFDDALARLYRALELAVEADVHERLGFSLKDPRTWPEGFPEGLRERILKPRGLMDLLDAAFDLDLAFGEQGTLAQRLYGEKNRLQALLQRRHESILAHGTRPVGEEDYTALRDFLMRLDERLRPLPPWPRF
>NC_006462.1|WP_011229156.1|129693_131226_+|FAD-dependent-oxidoreductase
MDREALLERLKEPFDLLVLGGGATGAGVLWEATLRGLKAALVEAGDFASGTSSRSTKLLHGGVRYLELAFKRLDRRQLKLVVDALHERKVVMDLAPHLAKPLTLVTPLFRPLEIPYYTLGLKLYDLLAGKRRLAPSRYLPPEEVARLFPDLPKTLGGVAYQDGQFADFRLNLALVLSALERGAVALNHAEATALLLEGGRVRGAVVRDGLSGKEVEVRAKAVVNATGSLADRVRRLLDPHLPPLLTASSGVHLVLDYPLEAGLLVPKTRDGRVLFLLPYRGMALLGTTDLPAEPASCPLPREEEVAYLLEEIRPYLGDVSGRVRAVWSGLRPLVGKGETKLLVRDHYIEERRGLYTLVGGKWTTFRLMALDLVERLAKDLGLALPPSKSHATPLLGAGPRPPLPLPEEAARRLWETYGTLAPEVLALGDRPLLPGLPYLEGEVVWAVRRELARKPLDVLARRMGLAFLDQEKTREALPKVVELMAGLLGWDERERALRLKEAEEGLPGLC
>NC_006462.1|WP_011229157.1|128206_129694_+|glycerol-kinase-GlpK
MAFLLALDQGTTSSRAILFTLEGRPVAVAKREFRQLYPKPGWVEHDPLEIWETTLWAAREVLRRAGAEAGEVLALGITNQRETTLLWDRKTGKPLHNAIVWQDRRTTPLCEALRAKGLEPLFRERTGLLFDPYFSGTKLVWLLENVPGLKARAEGGGVAFGTVDTWLIWNLTGGKVHATDPTNASRTLLFNLHTLAWDPELLEALGIPAALLPEVRPSDGDFGETLPELLGAPVPIRGVLGDQQAALFGQAALGGGEGKCTYGTGAFLLLNTGKRPVLSEKGLLATVAWSLGGRATYALEGSLFVAGAAVGWLKEVGLIRESAEVEALAASVEDTGDVYFVPAFTGLGAPYWDPYARGTLLGLTRGTSRAHLARAALEGVAFQVRDVVLAMEEEAGVRLKVLKADGGMAQNRLFLKIQADLLGVPVAVPEVTETTALGAALMAGVGAGALSPEDVAGRFREAERFLPTMPEGRREALYRRWREAVERAKGWAREG
>NC_006462.1|WP_011229158.1|127397_128072_-|glycerophosphodiester-phosphodiesterase
MTAFRQRPLRLGHRGAPLKAKENTLESFRLALEAGLDGVELDVWPTRDGVFAVRHDPDTPLGPVFQVDYADLKAQEPDLPRLEEVLALKEAFPQAVFNVELKSFPGLGEEAARRLAALLRGREGVWVSSFDPLALLALRKAAPGLPLGFLMAEDHSALLPCLGVEAVHPHHALVTEEAVAGWRKRGLFVVAWTVNEEGEARRLLALGLDGLIGDRPEVLLPLGG
>NC_006462.1|WP_011229159.1|125926_127396_-|Na/Pi-cotransporter-family-protein
MALLGILALLYLGTLLVTEGAGGLVGPSGRRLLSRLRGFPLGLAALLLGAASGSGTGLSLLGRGLLQVGVLPLYEAALLALGGTLGATVLVAVAGLGNRTLAFAALSLALALEVLKRGQGANRLLFGLGLLFLGLDLARGEALGTGAWLGSLPPLALFLAGLLLAFAVGSANLVALLALGLAGEGVGPEGTLALVLGGGVGCTGPVLLRSTPESLRLGLVLLFHRLALALPLLFAPNPGVFPAHAGFHALAFLAFPLAYPLWERLAARLAPSPKPLAPKYLRPEALNDPLLAQGLALRELARIGDAARHMLEGVLKALVQETGHEAELLPLEEKVDRLSREVLVYVAKLPQDTPALPLLKAASELEHLADLAKRALRKAERLWTQGVTFSPEGKAELARIVGRTLARLERALTALATGNRALAERVLAEYPEVLAEVEASREAHLRRLRDRVETRASTLTHLDLLLLLEELNLGVNRLARLVEEIHKEG
>NC_006462.1|WP_011229160.1|124776_126021_+|multidrug-effflux-MFS-transporter
MGPLEELLFLGTLMALGAFSIDVMLPALEATAHRYGTSPTAAQLVVGLYFLGFALGQLLWGPLMDALGRRKVLRGALFGFSLAALATVAAPGFSLLLAARFVQGFFAASFRIGVTASIRDRYRGEAMARRLSYALLVLMVAPVLAPALGVALLALGPWAPYALPAFLGLLALLWSGRFRETLPEEARRPLRLASLGEGALLVLRDRRAGLYALALGGVFGILYAYLAASAELYKAHLGLSNPAFALAFGATGLVLAGANLLGPQVVARLGLGKALRRAVAGLLALLLFLPLHALAPRPFPFWLHLTLVLLLVVFTFPNAQARALEGLGKVAGLAASFTGFLSTLLAALLGTLVGQASGGAPLPFSLGLLGLGVLAFAAVFLAEASPLCGSPPPGGPGGSPPGSAPPGGGGGPGG
>NC_006462.1|WP_024119885.1|124593_124740_+|hypothetical-protein
MDRQGGPAYLREGRVRVEPLVSEAVPLEALPGHFQNRLQGRIQTLVRF
>NC_006462.1|WP_011174463.1|136128_136401_+|CRISPR-associated-endonuclease-Cas2
MGKRLYAVAYDIPDDTRRVKLANLLKSYGERVQLSVFECYLDERLLEDLRRRARRLLDLGQDALRIYPVAGQVEVLGVGPLPELREVQVL
>NC_006462.1|WP_011229152.1|136456_138874_+|type-III-A-CRISPR-associated-protein-Cas10/Csm1
MLGDGLSVALAGLLHDVGKLYSRARWGERDDQVPDRTHTAYTAHFVREHAGLFRGAGLDPDWLARTASRHHEGWRDRPQYRPETPEEWCVALADTYASKEREEGEGGGSPPEVPLSPPFRRLLLGGEEGREGGYSPVGAGGRVGLEAGGLYPEERPNVSKDVYKRLLERLEGRLEEMARFSLGKEALVLNLALALQETLSLVPSDTQSEPDVSLYDHLRLTAAIAHALWLFHGGSPSAQNLRQDGEKFLLVVGDMGGIQGHIYRIAGAEAGVGGIAKRLRARSLEVSLAAEAMALGLLWRLGLTSLNRILGAGGKFYLLLPNTEEARAALEGTREAWGRWALKRGGSLVPHLAWVAFRGQDFRDFAALLKRLHEALAREKLRPFAFLASTGGVLGAPLRPCAACGLEPARRDEPGSLCPDCEREAALGARLPRSDRVGFFLEEAPRPYLDFPGLKVGLGGPLEGAFHLFRARLDFAPWPDPSEAKPLLGHLPRVEHALKAKGWSLEAYRAWAEEEGLLEDEEPHPEKVLTFAELAALSEGAPYLGALMLDADRMGEAFATGFRREGRDLATPSRLAALSRTLEVFFTTEVLTLLEEPRRYRERLGWDDLEAQRKEARYPLLYSVYSGGDDLFLLGPWDALLDFALDLERLYRLFTRHPRLTLSGGFLLVPPSLPVPELARLLGEAEKRAKAEGRERLFLFGQAVPWETLRGLRAWAEGLRQDLRAERVSRAQVYRWLLLWRRFSPLEDPGERMRYKPLLAYALRRVRERDEEAWKRYLKLLDHQDPAWAYLPVWVQWALYRERRV
>NC_006462.1|WP_011174461.1|138874_139279_+|type-III-A-CRISPR-associated-protein-Csm2
MPALEFFKDKERGVLDPKVFERAREVAEGLARGKLKSSQFRNYFAELRALENRFERERRKEGEELAFARLVPQLELLRAKLFYNTRSQGPLRDAKEFVEFMEEALEAGKRSPKDFEAMMKYVEAVLAYFYALAK
>NC_006462.1|WP_011229151.1|139290_140016_+|type-III-A-CRISPR-associated-RAMP-protein-Csm3
MKLKKVIRIRSVLLAKTGLRIGMSRDQMAIGDLDNPVVRNPLTDEPYIPGSSLKGKLRYLLEWSLGGDYILKAKERQVYASPDPKDPVARIFGLAPENDERSLAVARERGPTRLLVRDAYLTEDAKEALERTSARGGLYTEIKQEVFIPRLGGNANPRTTERVPAGARFRVEMTYRVLDDLDEEYFGKYLLRALELLELDGLGGHISRGYGQVYFLHPERLTEDQEGWPLKERLKVEEVVL
>NC_006462.1|WP_011229150.1|140025_140901_+|hypothetical-protein
MRATLFRLYFQGPLKALPRAPTLLGHLFWWYRYTHGREALEELLERFRQEPPFRLSSVYPEGWLPRPKLPPVQVEETTLRKALKSLSLVRLDTFQALAERGEEALLEAPEVQGKARPPEMRRLRRTRVGVDRAAGTARPGVLFTQEYLFPDPRTPYALYVLGEAPFDLGEALAFVGEMGYGGQASLGLGRFRVEGPFAVELPEAKEPNAYATLAPGPLEEALYYEVEPYWGRLGGAYVGARPFKRPYLRAKEGSVYRGPTHRLLEVTPTEPPEAGARVWEALVVFPLGVRV
>NC_006462.1|WP_011174458.1|140897_142052_+|type-III-A-CRISPR-associated-RAMP-protein-Csm5
MRFLRSFRLELEALSPVHVGTGEAYPAYAYVPDFARKAVHLLDPAALLLALPEARRRQYLEKVAQGPKAAQEVLRYLLEEDQLPREAVLHTLPASKAFLEALRSATEEALLEYRPLPRSPLGAYLPGSSVKGALRTAWLFHVLVREGKVAVFDRKEGVWRLRAWREGDGGTHVYPSRNPSLYENQAFEGAVLGYAREGKGRRMSLDLYRDPFRAVRLSDSGPVETFLNRLGVFHPHKDTSRMVLLAETFRIGTRFALTLRYHEGLSRDGDGERGVSMPIPPEDLVRALRDYYGKVAEWEEGFAEEHRLKRALEVYRALRERLQDPEAFPLRVGFGSGRLALRLALLLPEDHPEAQEPKTRKTAGAQNPVDGYPLGWMVGRLEPL
>NC_006462.1|WP_011229148.1|142062_143457_+|type-III-A-CRISPR-associated-protein-Csm6
MEDLDALWERYREAVRAGGNPQALYQEMVWPALLALWREKPRVYPFPQAFAVSVHTLGTSPEATALAILGAGAERVYVLHTPESARFLPRLRQDTGKDLYPVEIGKSDVEAIYREVKRLLEKHPEVPVALDLTSGTKAMSAGLAAAGFFFQRFYPKVRVVYVDNEDYDPELRRPRAGTEKLRILPNPHEALAEVDALFAKELYGKGEFGQAAAYFRGMVGRTGNQAYALYALLAEMYRAWRALDFGEALKAGRKLLGQLSQNVWLNHPLNARREALEAQVALLEAVDRFLKARDFALKEGVYGLARTLLHLAQEAKEEAAVLAALYAYRALELLLQERLALLGRRAEAPGLSPEEAEALRKALAELLGVLPEEVRLPAKLGLLDLLAFLRLKGDEALGRLSLAELRGLAGALKGRNSALLVHGFDVPSPKAVEGIARLAQGLLQDLEARTALGPLSPEPVPLGF
>NC_006462.1|WP_011228296.1|144853_145807_-|IS110-like-element-IS1000B-family-transposase
MTFAGIDVSKTHLDLALVSNSPKPTRLRFPNSPEGRQALLAALAHHNPAWVALEPTSAYHLPLLKLLAENRLQVALVNPYHLAAFRKAKGERQKTDRQDALLLARYAQVYHEDLRAYTLPPETLRELKALVGYREDLAGRERTILNQMEAAEWAGSKEVLALLQKELACVKGLLGEVEARIQALLATLPEAEVLMALPGVGPQVAAAVLALLPPELWGRAKRAASYAGLIPEREESGKSVERSRLSKKGPPLLRRKLYMGALVAVRHDPEMRAFYHRLLSRGKRKKQALVAVAHKLLRRMMGRLREYYATQLDQGVA
>NC_006462.1|WP_011229147.1|147019_148930_+|hypothetical-protein
MQAPVYLCLLGNDPAPAYLGLKVVEREAGRVAKAVFYSFPAWNEEYGKKRQAFFRLLSEKGVLYEERPLEKGLEEAEAREVWVNLTGGAKYWAVRFLGHWRRPGARVFLVEGHRALEAPRALFLWPREEERSLEAEALTLEEYARLYLEPLGEAWERVSPPGAFPPGAQAARLPGREGGVFVVHRGLPYWYWVRPHLGGEAKDMSRKALSAFSGEAKRLGGQLCLPVVPYHKAHLRSRHPKERENVFARWRAWAREYGVFLVDPGRPLEEEVASLIKGKASKKALPLPQEGPLLLALVSEQAVPLYAAYLHAGPREVYLLTTPEMESRLRWAEAFFRGKGVRVHRSFLSGPWALREVRDLLAPVVEEALRRGHPVHANLNSGTTAMALGLYLALRDGARAHYLDGDRLLLLDGGEAEVPWEEGRPEDLLALRGYRFEEEYPDARPDPGLLALAEEILRRWDEVQTSWEASPLVRRFLKFWKKRFGQAFPPKRLSRLKGLPLEYAVYSHLNAHLAPKGGQARMGGHLVPLGGNEALAPQSTEVDGVFFHRGALWFVECKPTDEGLRERAPIMAELVRSVGGVEARGLMVARRWRGAPPPASPNLVYMALEGGEGVGVYRFPEELEKALSRNPAPRRG
>NC_006462.1|WP_011174453.1|148900_149422_-|hypothetical-protein
MEALWQRTGDPLGDFIRLVLLVEELLERLGAPKEDTLGAKLRSGAAEAFFQSHPEGPALRGRLWRLVELRNAVLHERAEVPSWAFSEGRDLAARLLAAVERQGFYSREEWTARMAFLEAPAPPTPQAFPEVIPPERARSPEAEERPPGAWKTLPFPRRPLAKRALAPPRRRIP

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_006462_5

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_006462_5

144129-144843

TypeIII

III-A

Consensus_repeat	Method
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	PILER-CR
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	CRISPRCasFinder
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	CRT

9 spacers

csx1,csm5gr7,csm4gr5,csm3gr7,csm2gr11,cas10,cas2,cas1,cmr3gr5,cmr1gr7,cmr4gr7

The CRISPR arrays of NC_006462_5

>merge|NC_006462|5|144129-144843|PILER-CR,CRISPRCasFinder,CRT
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGACCGGAGGGGCCCCCTTCTCCCCCCGGGGCGGCATTTTCCCGGGTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGACTCCCGAGGCCCGGTAGTGGGCCGTTGACCTCGGGCGCCTCCGGTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGACGACCTTGAGGAGGGCTCCGAGTCTTTTCAGGGCGGGTGTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGACAACCCTCCGCGCCATCGCCTCCCGCCTCTACCACCTCTGTTGCAAGGGATTGAGCCCTGTAAGGGGATTGCGACCCGTAGATAAGGCGCCCGGGGACGACCACGTCAAGGCGCAGTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGACCGGGGATGTAGTCCCCGGAGCTAGCCGGGGGAGGACCTGTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGACGGTGCGAGGGGGTGGACCGCTAGTTGCGCCTCTATTCAAGATGTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGACCCGGGAAGGCCGTGGGCTCGGGCACCGCCGCCCCGAGGTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGACCACAGAGCGGCCCTTTGGGGTGGGTTAGAAGAAGAAGAAGTTGCAAGGGATTGAGCCCCGTAAGGGGATTGATACT

>NC_006462|5|3|144129-144767|PILER-CR
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	CGGAGGGGCCCCCTTCTCCCCCCGGGGCGGCATTTTCCCGG
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	TCCCGAGGCCCGGTAGTGGGCCGTTGACCTCGGGCGCCTCCG
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	GACCTTGAGGAGGGCTCCGAGTCTTTTCAGGGCGGGT
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	AACCCTCCGCGCCATCGCCTCCCGCCTCTACCACCTCT
GTTGCAAGGGATTGAGCCCTGTAAGGGGATTGCGAC	CCGTAGATAAGGCGCCCGGGGACGACCACGTCAAGGCGCA
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	CGGGGATGTAGTCCCCGGAGCTAGCCGGGGGAGGACCT
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	GGTGCGAGGGGGTGGACCGCTAGTTGCGCCTCTATTCAAGAT
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	CCGGGAAGGCCGTGGGCTCGGGCACCGCCGCCCCGAG
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC

>NC_006462|5|4|144129-144843|CRISPRCasFinder
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	CGGAGGGGCCCCCTTCTCCCCCCGGGGCGGCATTTTCCCGG
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	TCCCGAGGCCCGGTAGTGGGCCGTTGACCTCGGGCGCCTCCG
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	GACCTTGAGGAGGGCTCCGAGTCTTTTCAGGGCGGGT
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	AACCCTCCGCGCCATCGCCTCCCGCCTCTACCACCTCT
GTTGCAAGGGATTGAGCCCTGTAAGGGGATTGCGAC	CCGTAGATAAGGCGCCCGGGGACGACCACGTCAAGGCGCA
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	CGGGGATGTAGTCCCCGGAGCTAGCCGGGGGAGGACCT
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	GGTGCGAGGGGGTGGACCGCTAGTTGCGCCTCTATTCAAGAT
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	CCGGGAAGGCCGTGGGCTCGGGCACCGCCGCCCCGAG
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	CACAGAGCGGCCCTTTGGGGTGGGTTAGAAGAAGAAGAA
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGATACT

>NC_006462|5|4|144129-144842|CRT
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	CGGAGGGGCCCCCTTCTCCCCCCGGGGCGGCATTTTCCCGG
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	TCCCGAGGCCCGGTAGTGGGCCGTTGACCTCGGGCGCCTCCG
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	GACCTTGAGGAGGGCTCCGAGTCTTTTCAGGGCGGGT
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	AACCCTCCGCGCCATCGCCTCCCGCCTCTACCACCTCT
GTTGCAAGGGATTGAGCCCTGTAAGGGGATTGCGAC	CCGTAGATAAGGCGCCCGGGGACGACCACGTCAAGGCGCA
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	CGGGGATGTAGTCCCCGGAGCTAGCCGGGGGAGGACCT
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	GGTGCGAGGGGGTGGACCGCTAGTTGCGCCTCTATTCAAGAT
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	CCGGGAAGGCCGTGGGCTCGGGCACCGCCGCCCCGAG
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	CACAGAGCGGCCCTTTGGGGTGGGTTAGAAGAAGAAGAA
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGATAC

Protein	Signature genes	Signature genes Name	Protein_function
NC_006462.1\|WP_011229147.1\|147019_148930_+\|hypothetical-protein	unknown	unknown	unknown
NC_006462.1\|WP_011229142.1\|154435_155623_+\|type-III-B-CRISPR-module-RAMP-protein-Cmr1	cmr1gr7	COG1367_cmr1gr7_CAS-III-B	gnl\|CDD\|224286
NC_006462.1\|WP_011174452.1\|149426_150146_-\|hypothetical-protein	unknown	unknown	unknown
NC_006462.1\|WP_011229143.1\|153353_154439_+\|CRISPR-associated-protein-Cmr3	cmr3gr5	cd09748_cmr3gr5_CAS-III-B	gnl\|CDD\|187879
NC_006462.1\|WP_011229144.1\|151609_153364_+\|type-III-B-CRISPR-associated-protein-Cas10/Cmr2	cas10	cls000742_cas10_CAS-III	gnl\|CDD\|274208
NC_006462.1\|WP_011229153.1\|133965_134919_-\|IS110-like-element-IS1000A-family-transposase	unknown	unknown	gnl\|CDD\|376564
NC_006462.1\|WP_011229151.1\|139290_140016_+\|type-III-A-CRISPR-associated-RAMP-protein-Csm3	csm3gr7	cd09684_csm3gr7_CAS-III-A:CAS-III-D	gnl\|CDD\|187815
NC_006462.1\|WP_011174458.1\|140897_142052_+\|type-III-A-CRISPR-associated-RAMP-protein-Csm5	csm5gr7	cd09662_csm5gr7_CAS-III-A	gnl\|CDD\|273863
NC_006462.1\|WP_011228296.1\|144853_145807_-\|IS110-like-element-IS1000B-family-transposase	unknown	unknown	gnl\|CDD\|376564
NC_006462.1\|WP_164926115.1\|133474_133714_-\|hypothetical-protein	unknown	unknown	unknown
NC_006462.1\|WP_011229148.1\|142062_143457_+\|type-III-A-CRISPR-associated-protein-Csm6	csx1	cd09747_csx1_CAS-III	gnl\|CDD\|378236
NC_006462.1\|WP_011229146.1\|150114_151080_-\|hypothetical-protein	unknown	unknown	unknown
NC_006462.1\|WP_011174461.1\|138874_139279_+\|type-III-A-CRISPR-associated-protein-Csm2	csm2gr11	cd09647_csm2gr11_CAS-III-A	gnl\|CDD\|187778
NC_006462.1\|WP_011174453.1\|148900_149422_-\|hypothetical-protein	unknown	unknown	unknown
NC_006462.1\|WP_011229141.1\|155638_156499_+\|type-III-B-CRISPR-module-RAMP-protein-Cmr4	cmr4gr7	cd09682_cmr4gr7_CAS-III-B	gnl\|CDD\|274210
NC_006462.1\|WP_011229154.1\|132454_133402_+\|CRISPR-associated-endonuclease-Cas1	cas1	cd09634_cas1_CAS-I:CAS-II:CAS-III:CAS-V	gnl\|CDD\|187766
NC_006462.1\|WP_011229145.1\|151072_151483_-\|hypothetical-protein	unknown	unknown	unknown
NC_006462.1\|WP_011229150.1\|140025_140901_+\|hypothetical-protein	csm4gr5	mkCas0089_csm4gr5_CAS-III-A:CAS-III-D	gnl\|CDD\|187794
NC_006462.1\|WP_011229152.1\|136456_138874_+\|type-III-A-CRISPR-associated-protein-Cas10/Csm1	cas10	cd09680_cas10_CAS-III	gnl\|CDD\|274209
NC_006462.1\|WP_011174463.1\|136128_136401_+\|CRISPR-associated-endonuclease-Cas2	cas2	mkCas0081_cas2_CAS-I:CAS-II:CAS-III	gnl\|CDD\|187856

Protein	Cas_name	Cas_description	E-value	Identity	Coverage
NC_006462.1\|WP_011229144.1\|151609_153364_+\|type-III-B-CRISPR-associated-protein-Cas10/Cmr2	cas10	cls000742_cas10_CAS-III	3.1e-131	433.6	0.0
NC_006462.1\|WP_011229151.1\|139290_140016_+\|type-III-A-CRISPR-associated-RAMP-protein-Csm3	csm3gr7	cd09684_csm3gr7_CAS-III-A:CAS-III-D	1.6e-79	261.4	0.0
NC_006462.1\|WP_011174458.1\|140897_142052_+\|type-III-A-CRISPR-associated-RAMP-protein-Csm5	csm5gr7	cd09662_csm5gr7_CAS-III-A	8.1e-24	79.2	0.0
NC_006462.1\|WP_011229142.1\|154435_155623_+\|type-III-B-CRISPR-module-RAMP-protein-Cmr1	cmr1gr7	COG1367_cmr1gr7_CAS-III-B	3.1e-31	103.4	0.0
NC_006462.1\|WP_011229143.1\|153353_154439_+\|CRISPR-associated-protein-Cmr3	cmr3gr5	cd09748_cmr3gr5_CAS-III-B	1e-96	319.1	7.0
NC_006462.1\|WP_011229148.1\|142062_143457_+\|type-III-A-CRISPR-associated-protein-Csm6	csx1	cd09747_csx1_CAS-III	3.4e-104	343.4	0.0
NC_006462.1\|WP_011174461.1\|138874_139279_+\|type-III-A-CRISPR-associated-protein-Csm2	csm2gr11	cd09647_csm2gr11_CAS-III-A	1.3e-25	84.9	2.6
NC_006462.1\|WP_011229154.1\|132454_133402_+\|CRISPR-associated-endonuclease-Cas1	cas1	cd09634_cas1_CAS-I:CAS-II:CAS-III:CAS-V	3.3e-81	267.4	0.0
NC_006462.1\|WP_011229141.1\|155638_156499_+\|type-III-B-CRISPR-module-RAMP-protein-Cmr4	cmr4gr7	cd09682_cmr4gr7_CAS-III-B	4.3e-85	280.4	0.0
NC_006462.1\|WP_011229150.1\|140025_140901_+\|hypothetical-protein	csm4gr5	mkCas0089_csm4gr5_CAS-III-A:CAS-III-D	1.9e-60	199.5	0.0
NC_006462.1\|WP_011229152.1\|136456_138874_+\|type-III-A-CRISPR-associated-protein-Cas10/Csm1	cas10	cd09680_cas10_CAS-III	9.7e-165	544.4	0.0
NC_006462.1\|WP_011174463.1\|136128_136401_+\|CRISPR-associated-endonuclease-Cas2	cas2	mkCas0081_cas2_CAS-I:CAS-II:CAS-III	7.3e-51	165.3	0.9

Protein	Function_ID	Function_description	E-value
NC_006462.1\|WP_011229142.1\|154435_155623_+\|type-III-B-CRISPR-module-RAMP-protein-Cmr1	gnl\|CDD\|224286	COG1367, COG1367, CRISPR system related protein, RAMP superfamily [Defense mechanisms].	5.37625e-29
NC_006462.1\|WP_011229144.1\|151609_153364_+\|type-III-B-CRISPR-associated-protein-Cas10/Cmr2	gnl\|CDD\|274208	TIGR02577, thermophile-specific_DNA_repair_system, CRISPR-associated protein Cas10/Cmr2, subtype III-B. This model represent a Crm2 family of the CRISPR-associated RAMP module, a set of six genes recurring found together in prokaryotic genomes. This gene cluster is found only in species with CRISPR repeats, usually near the repeats themselves. Because most of the six (but not this family) contain RAMP domains, and because its appearance in a genome appears to depend on other CRISPR-associated Cas genes, the set is designated the CRISPR RAMP module. This protein, typified by TM1794 from Thermotoga maritima, is designated Crm2, for CRISPR RAMP Module protein 2.	2.85434e-128
NC_006462.1\|WP_011229153.1\|133965_134919_-\|IS110-like-element-IS1000A-family-transposase	gnl\|CDD\|376564	pfam01548, DEDD_Tnp_IS110, Transposase. Transposase proteins are necessary for efficient DNA transposition. This family includes an amino-terminal region of the pilin gene inverting protein (PIVML) and of members of the IS111A/IS1328/IS1533 family of transposases. The C-terminus is represented by family pfam02371.	3.27877e-28
NC_006462.1\|WP_011229151.1\|139290_140016_+\|type-III-A-CRISPR-associated-RAMP-protein-Csm3	gnl\|CDD\|187815	cd09684, Csm3_III-A, CRISPR/Cas system-associated RAMP superfamily protein Csm3. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; RAMP superfamily protein.	4.10911e-103
NC_006462.1\|WP_011174458.1\|140897_142052_+\|type-III-A-CRISPR-associated-RAMP-protein-Csm5	gnl\|CDD\|273863	TIGR01899, cas_TM1807_csm5, CRISPR type III-A/MTUBE-associated RAMP protein Csm5. CRISPR is a term for Clustered Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR associated) proteins. Members of this cas gene family are found in the mtube subtype of CRISPR/cas locus and designated Csm5, for CRISPR/cas Subtype Mtube, protein 5.	1.01226e-19
NC_006462.1\|WP_011228296.1\|144853_145807_-\|IS110-like-element-IS1000B-family-transposase	gnl\|CDD\|376564	pfam01548, DEDD_Tnp_IS110, Transposase. Transposase proteins are necessary for efficient DNA transposition. This family includes an amino-terminal region of the pilin gene inverting protein (PIVML) and of members of the IS111A/IS1328/IS1533 family of transposases. The C-terminus is represented by family pfam02371.	2.28212e-29
NC_006462.1\|WP_011229143.1\|153353_154439_+\|CRISPR-associated-protein-Cmr3	gnl\|CDD\|187879	cd09748, Cmr3_III-B, CRISPR/Cas system-associated RAMP superfamily protein Cmr3. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; RAMP superfamily protein; This protein is a subunit of Cmr complex.	1.38214e-94
NC_006462.1\|WP_011229148.1\|142062_143457_+\|type-III-A-CRISPR-associated-protein-Csm6	gnl\|CDD\|378236	pfam09670, Cas_Cas02710, CRISPR-associated protein (Cas_Cas02710). Members of this family are found, exclusively in the vicinity of CRISPR repeats and other CRISPR-associated (cas) genes, in Methanothermobacter thermautotrophicus (Methanobacterium thermoformicicum), Thermus thermophilus (Deinococcus-Thermus), Chloroflexus aurantiacus (Chloroflexi), and Thermomicrobium roseum (Thermomicrobia).	2.23057e-125
NC_006462.1\|WP_011174461.1\|138874_139279_+\|type-III-A-CRISPR-associated-protein-Csm2	gnl\|CDD\|187778	cd09647, Csm2_III-A, CRISPR/Cas system-associated protein Csm2. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Small alpha-helical protein; signature gene for subtype III-A.	5.43062e-18
NC_006462.1\|WP_011229154.1\|132454_133402_+\|CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|187766	cd09634, Cas1_I-II-III, CRISPR/Cas system-associated protein Cas1. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas1 is the most universal CRISPR system protein thought to be involved in spacer integration; Cas1 is metal-dependent deoxyribonuclease, also binds RNA; Shown to possess a unique fold consisting of a N-terminal beta-strand domain and a C-terminal alpha-helical domain.	1.16225e-102
NC_006462.1\|WP_011229141.1\|155638_156499_+\|type-III-B-CRISPR-module-RAMP-protein-Cmr4	gnl\|CDD\|274210	TIGR02580, putative_CRISPR-associated_protein, CRISPR type III-B/RAMP module RAMP protein Cmr4. This model represents a CRISPR-associated protein from the family that includes TM1792 of Thermotoga maritima. This family is part of the broad RAMP superfamily (pfam03787) collection of CRISPR-associated proteins. It is the fourth of a recurring set of six proteins, four of are in the RAMP superfamily, that we designate the CRISPR RAMP module.	7.78032e-105
NC_006462.1\|WP_011229150.1\|140025_140901_+\|hypothetical-protein	gnl\|CDD\|187794	cd09663, Csm4_III-A, CRISPR/Cas system-associated RAMP superfamily protein Csm4. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; RAMP superfamily protein.	3.841e-11
NC_006462.1\|WP_011229152.1\|136456_138874_+\|type-III-A-CRISPR-associated-protein-Cas10/Csm1	gnl\|CDD\|274209	TIGR02578, CRISPR-associated_protein_Cas10/Csm1, CRISPR-associated protein Cas10/Csm1, subtype III-A/MTUBE. The family is designated Csm2, for CRISPR/Cas Subtype Mtube Protein 2. A typical example is TM1811 from Thermotoga maritima. CRISPR are Clustered Regularly Interspaced Short Palindromic Repeats. This protein family belongs to a conserved gene cluster regularly found near CRISPR repeats.	0
NC_006462.1\|WP_011174463.1\|136128_136401_+\|CRISPR-associated-endonuclease-Cas2	gnl\|CDD\|187856	cd09725, Cas2_I_II_III, CRISPR/Cas system-associated protein Cas2. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas2 is present in majority of CRISPR/Cas systems along with Cas1; RNAse specific to U-rich regions; Possesses an RRM/ferredoxin fold.	2.97709e-24

>NC_006462.1|WP_011229148.1|142062_143457_+|type-III-A-CRISPR-associated-protein-Csm6
MEDLDALWERYREAVRAGGNPQALYQEMVWPALLALWREKPRVYPFPQAFAVSVHTLGTSPEATALAILGAGAERVYVLHTPESARFLPRLRQDTGKDLYPVEIGKSDVEAIYREVKRLLEKHPEVPVALDLTSGTKAMSAGLAAAGFFFQRFYPKVRVVYVDNEDYDPELRRPRAGTEKLRILPNPHEALAEVDALFAKELYGKGEFGQAAAYFRGMVGRTGNQAYALYALLAEMYRAWRALDFGEALKAGRKLLGQLSQNVWLNHPLNARREALEAQVALLEAVDRFLKARDFALKEGVYGLARTLLHLAQEAKEEAAVLAALYAYRALELLLQERLALLGRRAEAPGLSPEEAEALRKALAELLGVLPEEVRLPAKLGLLDLLAFLRLKGDEALGRLSLAELRGLAGALKGRNSALLVHGFDVPSPKAVEGIARLAQGLLQDLEARTALGPLSPEPVPLGF
>NC_006462.1|WP_011174458.1|140897_142052_+|type-III-A-CRISPR-associated-RAMP-protein-Csm5
MRFLRSFRLELEALSPVHVGTGEAYPAYAYVPDFARKAVHLLDPAALLLALPEARRRQYLEKVAQGPKAAQEVLRYLLEEDQLPREAVLHTLPASKAFLEALRSATEEALLEYRPLPRSPLGAYLPGSSVKGALRTAWLFHVLVREGKVAVFDRKEGVWRLRAWREGDGGTHVYPSRNPSLYENQAFEGAVLGYAREGKGRRMSLDLYRDPFRAVRLSDSGPVETFLNRLGVFHPHKDTSRMVLLAETFRIGTRFALTLRYHEGLSRDGDGERGVSMPIPPEDLVRALRDYYGKVAEWEEGFAEEHRLKRALEVYRALRERLQDPEAFPLRVGFGSGRLALRLALLLPEDHPEAQEPKTRKTAGAQNPVDGYPLGWMVGRLEPL
>NC_006462.1|WP_011229150.1|140025_140901_+|hypothetical-protein
MRATLFRLYFQGPLKALPRAPTLLGHLFWWYRYTHGREALEELLERFRQEPPFRLSSVYPEGWLPRPKLPPVQVEETTLRKALKSLSLVRLDTFQALAERGEEALLEAPEVQGKARPPEMRRLRRTRVGVDRAAGTARPGVLFTQEYLFPDPRTPYALYVLGEAPFDLGEALAFVGEMGYGGQASLGLGRFRVEGPFAVELPEAKEPNAYATLAPGPLEEALYYEVEPYWGRLGGAYVGARPFKRPYLRAKEGSVYRGPTHRLLEVTPTEPPEAGARVWEALVVFPLGVRV
>NC_006462.1|WP_011229151.1|139290_140016_+|type-III-A-CRISPR-associated-RAMP-protein-Csm3
MKLKKVIRIRSVLLAKTGLRIGMSRDQMAIGDLDNPVVRNPLTDEPYIPGSSLKGKLRYLLEWSLGGDYILKAKERQVYASPDPKDPVARIFGLAPENDERSLAVARERGPTRLLVRDAYLTEDAKEALERTSARGGLYTEIKQEVFIPRLGGNANPRTTERVPAGARFRVEMTYRVLDDLDEEYFGKYLLRALELLELDGLGGHISRGYGQVYFLHPERLTEDQEGWPLKERLKVEEVVL
>NC_006462.1|WP_011174461.1|138874_139279_+|type-III-A-CRISPR-associated-protein-Csm2
MPALEFFKDKERGVLDPKVFERAREVAEGLARGKLKSSQFRNYFAELRALENRFERERRKEGEELAFARLVPQLELLRAKLFYNTRSQGPLRDAKEFVEFMEEALEAGKRSPKDFEAMMKYVEAVLAYFYALAK
>NC_006462.1|WP_011229152.1|136456_138874_+|type-III-A-CRISPR-associated-protein-Cas10/Csm1
MLGDGLSVALAGLLHDVGKLYSRARWGERDDQVPDRTHTAYTAHFVREHAGLFRGAGLDPDWLARTASRHHEGWRDRPQYRPETPEEWCVALADTYASKEREEGEGGGSPPEVPLSPPFRRLLLGGEEGREGGYSPVGAGGRVGLEAGGLYPEERPNVSKDVYKRLLERLEGRLEEMARFSLGKEALVLNLALALQETLSLVPSDTQSEPDVSLYDHLRLTAAIAHALWLFHGGSPSAQNLRQDGEKFLLVVGDMGGIQGHIYRIAGAEAGVGGIAKRLRARSLEVSLAAEAMALGLLWRLGLTSLNRILGAGGKFYLLLPNTEEARAALEGTREAWGRWALKRGGSLVPHLAWVAFRGQDFRDFAALLKRLHEALAREKLRPFAFLASTGGVLGAPLRPCAACGLEPARRDEPGSLCPDCEREAALGARLPRSDRVGFFLEEAPRPYLDFPGLKVGLGGPLEGAFHLFRARLDFAPWPDPSEAKPLLGHLPRVEHALKAKGWSLEAYRAWAEEEGLLEDEEPHPEKVLTFAELAALSEGAPYLGALMLDADRMGEAFATGFRREGRDLATPSRLAALSRTLEVFFTTEVLTLLEEPRRYRERLGWDDLEAQRKEARYPLLYSVYSGGDDLFLLGPWDALLDFALDLERLYRLFTRHPRLTLSGGFLLVPPSLPVPELARLLGEAEKRAKAEGRERLFLFGQAVPWETLRGLRAWAEGLRQDLRAERVSRAQVYRWLLLWRRFSPLEDPGERMRYKPLLAYALRRVRERDEEAWKRYLKLLDHQDPAWAYLPVWVQWALYRERRV
>NC_006462.1|WP_011174463.1|136128_136401_+|CRISPR-associated-endonuclease-Cas2
MGKRLYAVAYDIPDDTRRVKLANLLKSYGERVQLSVFECYLDERLLEDLRRRARRLLDLGQDALRIYPVAGQVEVLGVGPLPELREVQVL
>NC_006462.1|WP_011229153.1|133965_134919_-|IS110-like-element-IS1000A-family-transposase
MTFAGIDVSKTHLDLALVSNSPKPTRLRFPNSPEGRQALLAALAHHNPAWVALEPTGAYHLPLLKLLAENRLQVALVNPYHLAAFRKAKGERQKTDRQDALLLARYAQVYHGELWAYTLPPEALRELKALVGYREDLAGRERAILNQMEAAEWAGSKEVLALLQKELACVKGLLGEVEARIQALLATLPEAEVLMALPGVGPQVAAAVLALLPPELWGRAKRAASYAGLIPEREESGKSVERSRLSKKGPPLLRRKLYMGALVAVRHDPEMRAFYHRLLSRGKRKKQALVAVAHKLLRRMMGRLREYYATQLDQGVA
>NC_006462.1|WP_164926115.1|133474_133714_-|hypothetical-protein
MRKMKLGICTRRIMGVFEGLHQWKATGERGDEKKKRIFAFRKGKTGFQDPRPEVRVGKSIAHTATLHQVKISAKKRLPK
>NC_006462.1|WP_011229154.1|132454_133402_+|CRISPR-associated-endonuclease-Cas1
MTLHLTRQGATLRLRQGRLLLEEEGREVAGFPARQVRSVALWGNVRLSTPALVFLLRQGVPVFFYSLEGFLHGVAGAYPDPHPAHLRAQFAAEGLPLARAFVVGKLRSALALLERHRLPEAGGVVEALARAEGASELERLRGAEGEGSRVYFQGLARLLGPYGFGGRTRRPPRDPVNAALSYGYALLLGRVLVAVRLAGLHPEVGFLHAEGRRSPALALDLMEEFRVPVVDQVVLSAFRRGLLTPSHAEVREGGVYLNEEGRRRLIQLFEERLLEGVSHPLGFRKPLGETIEVQAQRLKAALLGRGRYTPFYLWR
>NC_006462.1|WP_011228296.1|144853_145807_-|IS110-like-element-IS1000B-family-transposase
MTFAGIDVSKTHLDLALVSNSPKPTRLRFPNSPEGRQALLAALAHHNPAWVALEPTSAYHLPLLKLLAENRLQVALVNPYHLAAFRKAKGERQKTDRQDALLLARYAQVYHEDLRAYTLPPETLRELKALVGYREDLAGRERTILNQMEAAEWAGSKEVLALLQKELACVKGLLGEVEARIQALLATLPEAEVLMALPGVGPQVAAAVLALLPPELWGRAKRAASYAGLIPEREESGKSVERSRLSKKGPPLLRRKLYMGALVAVRHDPEMRAFYHRLLSRGKRKKQALVAVAHKLLRRMMGRLREYYATQLDQGVA
>NC_006462.1|WP_011229147.1|147019_148930_+|hypothetical-protein
MQAPVYLCLLGNDPAPAYLGLKVVEREAGRVAKAVFYSFPAWNEEYGKKRQAFFRLLSEKGVLYEERPLEKGLEEAEAREVWVNLTGGAKYWAVRFLGHWRRPGARVFLVEGHRALEAPRALFLWPREEERSLEAEALTLEEYARLYLEPLGEAWERVSPPGAFPPGAQAARLPGREGGVFVVHRGLPYWYWVRPHLGGEAKDMSRKALSAFSGEAKRLGGQLCLPVVPYHKAHLRSRHPKERENVFARWRAWAREYGVFLVDPGRPLEEEVASLIKGKASKKALPLPQEGPLLLALVSEQAVPLYAAYLHAGPREVYLLTTPEMESRLRWAEAFFRGKGVRVHRSFLSGPWALREVRDLLAPVVEEALRRGHPVHANLNSGTTAMALGLYLALRDGARAHYLDGDRLLLLDGGEAEVPWEEGRPEDLLALRGYRFEEEYPDARPDPGLLALAEEILRRWDEVQTSWEASPLVRRFLKFWKKRFGQAFPPKRLSRLKGLPLEYAVYSHLNAHLAPKGGQARMGGHLVPLGGNEALAPQSTEVDGVFFHRGALWFVECKPTDEGLRERAPIMAELVRSVGGVEARGLMVARRWRGAPPPASPNLVYMALEGGEGVGVYRFPEELEKALSRNPAPRRG
>NC_006462.1|WP_011174453.1|148900_149422_-|hypothetical-protein
MEALWQRTGDPLGDFIRLVLLVEELLERLGAPKEDTLGAKLRSGAAEAFFQSHPEGPALRGRLWRLVELRNAVLHERAEVPSWAFSEGRDLAARLLAAVERQGFYSREEWTARMAFLEAPAPPTPQAFPEVIPPERARSPEAEERPPGAWKTLPFPRRPLAKRALAPPRRRIP
>NC_006462.1|WP_011174452.1|149426_150146_-|hypothetical-protein
MTAWLLSLALNLPFLGGPQEYQILVALGCSAPRHVQNGYREMLAHEVLPRLAEKVTTTQVRLTLAPITGRSYTAPARVLETPNPLSTPRFQLEEAKKTFQKEALRTFDELRKRAAAECSRGTEIIGALKAAGERARKPGRILVLAHGFEQSELMNLYDYRLKLEKREVRQGLLQRVKARLGLPNLKDQEVCIAGITAGNDNNANARLTTSIKAFWEELIQASGGRLVGYGTTPRVCPFL
>NC_006462.1|WP_011229146.1|150114_151080_-|hypothetical-protein
MLNGFRVLRSYWVGRRDGKALSRKHASLAYLTPNPYPEQLKEWFRRWMEGLARRYLAKRAKLEERLALVRHQRKALEKVVGQDEPTPEVFGGYHFRYGLLGLVFLGEAYYNKMAMDTLEMNQLEAFIIGAVATIGLFWLGHAAGNEYRKGNLPLSLILGIPPLLVVILFAALRFSWTQRMAAIHGNPAPSIYGFLALMAIGLLLVSLTFYLGYRSPHEREVLLRRLFLTAQKERRIWERLRGLNRGAERALDHLLAHYRENVAAYWRGFARAWPQWDPAPEFVGHIPPLNRPALPPLDLEAPTDPLTQGSAHDRLAPEPRP
>NC_006462.1|WP_011229145.1|151072_151483_-|hypothetical-protein
MFWRRMGPEEARVRLLLLREGVRQKVGALEARLAKRKAPLEKALKEYRGVLEHLRRLEAEGRYPEAVLRPALAREELRIRYAEGEIARLEEAHRQAVAQLVSRARLKAARLAALAQMEEALDRFFPTPETKEEAHA
>NC_006462.1|WP_011229144.1|151609_153364_+|type-III-B-CRISPR-associated-protein-Cas10/Cmr2
MEHLLAIALGPVQEFIATARRTRDLYAGSRLLSEAAARAAKALAREVGAKNLIFPAPEDEAGLERLAGAGIPNVLLVRVPEGKDPRGLGEQALGAARDYLRERAEEVLGPRRDLLFWREALAQVEDLLEGYYAYLPLEGDYPRARERLMALLAARKNTRDFAPVSWGSPAYKSSLDGARESVLRLPEKEADHLRVRLGLRPGEYLAGPDLLKRWWKAGHGFLSTTHMAALPFWEGVRRAGLEAVLKEALEELGGLVGEEARAEVRHPVLRDTPFGEWDVRLLYESRLEEFPSLAEDPGLLEKARDRLRALWRRLFPKVRVPPGAYYALLHADGDRMGETLDGLPSPEAHRRFSNALALGFAAQVKDIVEAHGGGLVYSGGDDVLALLPLHTALMAARALADRFREAMAPFGREGRAPSLSVGLAVVHHLEPLQDALDLARRAEKWAKEGEPKRNALCVAYSPRSGAERLVRGRWDENPPLTRRLLRYADLLRAGEVPSRAAYELLALVREAGEALSGEALVAEALRILGRKEMKRAYREELEAWLRTGEDVRRLAEELILARPFAEALDQAGVPVESREVWDAH
>NC_006462.1|WP_011229143.1|153353_154439_+|CRISPR-associated-protein-Cmr3
MLIEPRDPLIVRDGRPFTNSPGARAKSLPFPLPQTLAGAYRTRRALLEGLPLPERAEEVLRWGLRGPLLAEEGEGGWRLLAPRPLDALKLGEALYPLRPLELPQGAGTNLPEGLSPVGLPSPALKEKPAPLPAFWYWESFLEWLLQDAPAGFAPRGHEGPVPETRTHVALDPAAQTAREGFLFQTSGLEFVRGRRRLALVLWPEGPEPEGVFPLGGERRLAFWQKGGPGVPPLPEEVVAGLLRHRAARLVFLTPAFLGEAYLPKGRAFQGASVVAAVVGRPLAVSGWNLKEGKPKPSRRAVPAGSVYFVRLPEAWGEGEVRDWAEKVWFQNLSEEEQDRRDGFGLAALGLWDGKLRRWEEA
>NC_006462.1|WP_011229142.1|154435_155623_+|type-III-B-CRISPR-module-RAMP-protein-Cmr1
MRRAFREAFSPRRKEEGGVLVRRDGARVLAWERTYTLLTPLFGGGVEPREADPVSVVRATAVRGHLRFWWRAVRGWRAGGSLERLWELESALFGSAGEGGASPLSVEVEVLREGEKVGIAQYGRAVQWYLGFPLRGDKEWAPVKEGVAFRLRLRFPEKVGELNFWEELEAALWAWETFGGIGARTRRGFGALLPQGAGVPGEEEIREKLRQYGQKAGWPEGVPHLTPKSFVRVVPLSWRELAERYQAFRQARPGGDPRSPGRSYWPEPDGVRRLTGRHAPHHLPRHPVHKFPRAHFGLPIIFHFKDRGDPPDTTLRLKEADRRASPLLFRPLGEGQKPCVVAVLEGARFPGEKLVLEGKDGRTWDVDPWLTPEEAQKIPVLGGEVDPVLAFVKSL
>NC_006462.1|WP_011229141.1|155638_156499_+|type-III-B-CRISPR-module-RAMP-protein-Cmr4
MSHVALLFLHALSPLHAGTGQGIGAIDLPIAREKATGIPYLPGSSLKGVLRDRASAWDRDTLFAVFGPDTENASEHAGAVQVGDAKLLLLPVRSLYGVFALVASPYLLERFRREALMAGLQPPGVPGLQDPTRVLLAPGSRLLGDGEKVYLEDLDLKAQGEEGVAAWERWLAERTEAPVLGRLAVVHDDLMGFLLETATEVVARIRLDDETKTVAKGALWYEESLPAESLLYALVRADRSFRKGKELPPEGVWALFRGVLEEGGGVLQLGGKATVGRGLCRIVVGR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_006462_6

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_006462_6

146042-146983

TypeIII

III-A

Consensus_repeat	Method
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	CRISPRCasFinder
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	CRT

12 spacers

csx1,csm5gr7,csm4gr5,csm3gr7,csm2gr11,cas10,cas2,cmr3gr5,cmr1gr7,cmr4gr7,cmr5gr11

The CRISPR arrays of NC_006462_6

>merge|NC_006462|6|146042-146983|CRISPRCasFinder,CRT
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGACTTCGAAGCGCCCCGCCCCGAGGCACTTCCCACACCCTTTCCCGTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGACGTGCTCCTTCAAACTCCTCTCCAGAGCCTCCTGGATCAGTTCATGTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGACACTCCCTCTACGCCCCCTAACTCGCGGTACGCGAAGAGGGGTTGCAAGAGATTGAGCCCCGTAAGGGGATTGCGACGACAGGTAAGGGTGTAGAGGTCGTCCAGCTTCATAAGTTGCAAGAGATTGAGCCCCGTAAGGGGATTGCGACAAGTGAGGATGTACCCCCGCCCCTTGAGCTTCTTCTCGTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGACCTTTGCGCCGCGCGGCCTAGCGCCGACCGCGTATCCCGTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGACCTTTAAGGGAGTCGCCTTCGCCCACGTCTTCCTTGGTGTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGACATTCTCCAACGAACCATGAGATTCACCCCCTTTGAGATTCGTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGACGCGAGGAGCCGCCGCACCCCGATGATGCGCCCCTGGTCGTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGACTCCTTCTTTGGGCCAGCTGATGCCCCAGGCAAGCCCCGGTGTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGACGCTTCTCCGTTGCGCTGAGTTCGCCGTTGCTCCAGACATGGGTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGACGTGTGGCCGCGGCTGCGCGCCGCGCGGCCCTTGCGCCCATGCGTTGCAAGGGATTGAGCCCCGTAAGGGGATGGCCTC

>NC_006462|6|5|146042-146983|CRISPRCasFinder
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	TTCGAAGCGCCCCGCCCCGAGGCACTTCCCACACCCTTTCCC
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	GTGCTCCTTCAAACTCCTCTCCAGAGCCTCCTGGATCAGTTCAT
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	ACTCCCTCTACGCCCCCTAACTCGCGGTACGCGAAGAGGG
GTTGCAAGAGATTGAGCCCCGTAAGGGGATTGCGAC	GACAGGTAAGGGTGTAGAGGTCGTCCAGCTTCATAA
GTTGCAAGAGATTGAGCCCCGTAAGGGGATTGCGAC	AAGTGAGGATGTACCCCCGCCCCTTGAGCTTCTTCTC
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	CTTTGCGCCGCGCGGCCTAGCGCCGACCGCGTATCCC
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	CTTTAAGGGAGTCGCCTTCGCCCACGTCTTCCTTGGT
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	ATTCTCCAACGAACCATGAGATTCACCCCCTTTGAGATTC
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	GCGAGGAGCCGCCGCACCCCGATGATGCGCCCCTGGTC
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	TCCTTCTTTGGGCCAGCTGATGCCCCAGGCAAGCCCCGGT
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	GCTTCTCCGTTGCGCTGAGTTCGCCGTTGCTCCAGACATGG
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	GTGTGGCCGCGGCTGCGCGCCGCGCGGCCCTTGCGCCCATGC
GTTGCAAGGGATTGAGCCCCGTAAGGGGATGGCCTC

>NC_006462|6|5|146042-146983|CRT
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	TTCGAAGCGCCCCGCCCCGAGGCACTTCCCACACCCTTTCCC
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	GTGCTCCTTCAAACTCCTCTCCAGAGCCTCCTGGATCAGTTCAT
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	ACTCCCTCTACGCCCCCTAACTCGCGGTACGCGAAGAGGG
GTTGCAAGAGATTGAGCCCCGTAAGGGGATTGCGAC	GACAGGTAAGGGTGTAGAGGTCGTCCAGCTTCATAA
GTTGCAAGAGATTGAGCCCCGTAAGGGGATTGCGAC	AAGTGAGGATGTACCCCCGCCCCTTGAGCTTCTTCTC
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	CTTTGCGCCGCGCGGCCTAGCGCCGACCGCGTATCCC
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	CTTTAAGGGAGTCGCCTTCGCCCACGTCTTCCTTGGT
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	ATTCTCCAACGAACCATGAGATTCACCCCCTTTGAGATTC
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	GCGAGGAGCCGCCGCACCCCGATGATGCGCCCCTGGTC
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	TCCTTCTTTGGGCCAGCTGATGCCCCAGGCAAGCCCCGGT
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	GCTTCTCCGTTGCGCTGAGTTCGCCGTTGCTCCAGACATGG
GTTGCAAGGGATTGAGCCCCGTAAGGGGATTGCGAC	GTGTGGCCGCGGCTGCGCGCCGCGCGGCCCTTGCGCCCATGC
GTTGCAAGGGATTGAGCCCCGTAAGGGGATGGCCTC

Protein	Signature genes	Signature genes Name	Protein_function
NC_006462.1\|WP_011229142.1\|154435_155623_+\|type-III-B-CRISPR-module-RAMP-protein-Cmr1	cmr1gr7	COG1367_cmr1gr7_CAS-III-B	gnl\|CDD\|224286
NC_006462.1\|WP_011174452.1\|149426_150146_-\|hypothetical-protein	unknown	unknown	unknown
NC_006462.1\|WP_011229143.1\|153353_154439_+\|CRISPR-associated-protein-Cmr3	cmr3gr5	cd09748_cmr3gr5_CAS-III-B	gnl\|CDD\|187879
NC_006462.1\|WP_011229144.1\|151609_153364_+\|type-III-B-CRISPR-associated-protein-Cas10/Cmr2	cas10	cls000742_cas10_CAS-III	gnl\|CDD\|274208
NC_006462.1\|WP_011229140.1\|156502_156847_+\|type-III-B-CRISPR-module-associated-protein-Cmr5	cmr5gr11	cd09749_cmr5gr11_CAS-III-B	gnl\|CDD\|378242
NC_006462.1\|WP_011229153.1\|133965_134919_-\|IS110-like-element-IS1000A-family-transposase	unknown	unknown	gnl\|CDD\|376564
NC_006462.1\|WP_011229151.1\|139290_140016_+\|type-III-A-CRISPR-associated-RAMP-protein-Csm3	csm3gr7	cd09684_csm3gr7_CAS-III-A:CAS-III-D	gnl\|CDD\|187815
NC_006462.1\|WP_011174458.1\|140897_142052_+\|type-III-A-CRISPR-associated-RAMP-protein-Csm5	csm5gr7	cd09662_csm5gr7_CAS-III-A	gnl\|CDD\|273863
NC_006462.1\|WP_011229147.1\|147019_148930_+\|hypothetical-protein	unknown	unknown	unknown
NC_006462.1\|WP_164926115.1\|133474_133714_-\|hypothetical-protein	unknown	unknown	unknown
NC_006462.1\|WP_011229148.1\|142062_143457_+\|type-III-A-CRISPR-associated-protein-Csm6	csx1	cd09747_csx1_CAS-III	gnl\|CDD\|378236
NC_006462.1\|WP_011229146.1\|150114_151080_-\|hypothetical-protein	unknown	unknown	unknown
NC_006462.1\|WP_011174461.1\|138874_139279_+\|type-III-A-CRISPR-associated-protein-Csm2	csm2gr11	cd09647_csm2gr11_CAS-III-A	gnl\|CDD\|187778
NC_006462.1\|WP_011174453.1\|148900_149422_-\|hypothetical-protein	unknown	unknown	unknown
NC_006462.1\|WP_011229141.1\|155638_156499_+\|type-III-B-CRISPR-module-RAMP-protein-Cmr4	cmr4gr7	cd09682_cmr4gr7_CAS-III-B	gnl\|CDD\|274210
NC_006462.1\|WP_011229145.1\|151072_151483_-\|hypothetical-protein	unknown	unknown	unknown
NC_006462.1\|WP_011229150.1\|140025_140901_+\|hypothetical-protein	csm4gr5	mkCas0089_csm4gr5_CAS-III-A:CAS-III-D	gnl\|CDD\|187794
NC_006462.1\|WP_011228296.1\|144853_145807_-\|IS110-like-element-IS1000B-family-transposase	unknown	unknown	gnl\|CDD\|376564
NC_006462.1\|WP_011229152.1\|136456_138874_+\|type-III-A-CRISPR-associated-protein-Cas10/Csm1	cas10	cd09680_cas10_CAS-III	gnl\|CDD\|274209
NC_006462.1\|WP_011174463.1\|136128_136401_+\|CRISPR-associated-endonuclease-Cas2	cas2	mkCas0081_cas2_CAS-I:CAS-II:CAS-III	gnl\|CDD\|187856

Protein	Cas_name	Cas_description	E-value	Identity	Coverage
NC_006462.1\|WP_011229144.1\|151609_153364_+\|type-III-B-CRISPR-associated-protein-Cas10/Cmr2	cas10	cls000742_cas10_CAS-III	3.1e-131	433.6	0.0
NC_006462.1\|WP_011229151.1\|139290_140016_+\|type-III-A-CRISPR-associated-RAMP-protein-Csm3	csm3gr7	cd09684_csm3gr7_CAS-III-A:CAS-III-D	1.6e-79	261.4	0.0
NC_006462.1\|WP_011174458.1\|140897_142052_+\|type-III-A-CRISPR-associated-RAMP-protein-Csm5	csm5gr7	cd09662_csm5gr7_CAS-III-A	8.1e-24	79.2	0.0
NC_006462.1\|WP_011229142.1\|154435_155623_+\|type-III-B-CRISPR-module-RAMP-protein-Cmr1	cmr1gr7	COG1367_cmr1gr7_CAS-III-B	3.1e-31	103.4	0.0
NC_006462.1\|WP_011229143.1\|153353_154439_+\|CRISPR-associated-protein-Cmr3	cmr3gr5	cd09748_cmr3gr5_CAS-III-B	1e-96	319.1	7.0
NC_006462.1\|WP_011229148.1\|142062_143457_+\|type-III-A-CRISPR-associated-protein-Csm6	csx1	cd09747_csx1_CAS-III	3.4e-104	343.4	0.0
NC_006462.1\|WP_011174461.1\|138874_139279_+\|type-III-A-CRISPR-associated-protein-Csm2	csm2gr11	cd09647_csm2gr11_CAS-III-A	1.3e-25	84.9	2.6
NC_006462.1\|WP_011229140.1\|156502_156847_+\|type-III-B-CRISPR-module-associated-protein-Cmr5	cmr5gr11	cd09749_cmr5gr11_CAS-III-B	2.1e-32	106.7	2.4
NC_006462.1\|WP_011229141.1\|155638_156499_+\|type-III-B-CRISPR-module-RAMP-protein-Cmr4	cmr4gr7	cd09682_cmr4gr7_CAS-III-B	4.3e-85	280.4	0.0
NC_006462.1\|WP_011229150.1\|140025_140901_+\|hypothetical-protein	csm4gr5	mkCas0089_csm4gr5_CAS-III-A:CAS-III-D	1.9e-60	199.5	0.0
NC_006462.1\|WP_011229152.1\|136456_138874_+\|type-III-A-CRISPR-associated-protein-Cas10/Csm1	cas10	cd09680_cas10_CAS-III	9.7e-165	544.4	0.0
NC_006462.1\|WP_011174463.1\|136128_136401_+\|CRISPR-associated-endonuclease-Cas2	cas2	mkCas0081_cas2_CAS-I:CAS-II:CAS-III	7.3e-51	165.3	0.9

Protein	Function_ID	Function_description	E-value
NC_006462.1\|WP_011229142.1\|154435_155623_+\|type-III-B-CRISPR-module-RAMP-protein-Cmr1	gnl\|CDD\|224286	COG1367, COG1367, CRISPR system related protein, RAMP superfamily [Defense mechanisms].	5.37625e-29
NC_006462.1\|WP_011229144.1\|151609_153364_+\|type-III-B-CRISPR-associated-protein-Cas10/Cmr2	gnl\|CDD\|274208	TIGR02577, thermophile-specific_DNA_repair_system, CRISPR-associated protein Cas10/Cmr2, subtype III-B. This model represent a Crm2 family of the CRISPR-associated RAMP module, a set of six genes recurring found together in prokaryotic genomes. This gene cluster is found only in species with CRISPR repeats, usually near the repeats themselves. Because most of the six (but not this family) contain RAMP domains, and because its appearance in a genome appears to depend on other CRISPR-associated Cas genes, the set is designated the CRISPR RAMP module. This protein, typified by TM1794 from Thermotoga maritima, is designated Crm2, for CRISPR RAMP Module protein 2.	2.85434e-128
NC_006462.1\|WP_011229153.1\|133965_134919_-\|IS110-like-element-IS1000A-family-transposase	gnl\|CDD\|376564	pfam01548, DEDD_Tnp_IS110, Transposase. Transposase proteins are necessary for efficient DNA transposition. This family includes an amino-terminal region of the pilin gene inverting protein (PIVML) and of members of the IS111A/IS1328/IS1533 family of transposases. The C-terminus is represented by family pfam02371.	3.27877e-28
NC_006462.1\|WP_011229151.1\|139290_140016_+\|type-III-A-CRISPR-associated-RAMP-protein-Csm3	gnl\|CDD\|187815	cd09684, Csm3_III-A, CRISPR/Cas system-associated RAMP superfamily protein Csm3. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; RAMP superfamily protein.	4.10911e-103
NC_006462.1\|WP_011174458.1\|140897_142052_+\|type-III-A-CRISPR-associated-RAMP-protein-Csm5	gnl\|CDD\|273863	TIGR01899, cas_TM1807_csm5, CRISPR type III-A/MTUBE-associated RAMP protein Csm5. CRISPR is a term for Clustered Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR associated) proteins. Members of this cas gene family are found in the mtube subtype of CRISPR/cas locus and designated Csm5, for CRISPR/cas Subtype Mtube, protein 5.	1.01226e-19
NC_006462.1\|WP_011228296.1\|144853_145807_-\|IS110-like-element-IS1000B-family-transposase	gnl\|CDD\|376564	pfam01548, DEDD_Tnp_IS110, Transposase. Transposase proteins are necessary for efficient DNA transposition. This family includes an amino-terminal region of the pilin gene inverting protein (PIVML) and of members of the IS111A/IS1328/IS1533 family of transposases. The C-terminus is represented by family pfam02371.	2.28212e-29
NC_006462.1\|WP_011229143.1\|153353_154439_+\|CRISPR-associated-protein-Cmr3	gnl\|CDD\|187879	cd09748, Cmr3_III-B, CRISPR/Cas system-associated RAMP superfamily protein Cmr3. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; RAMP superfamily protein; This protein is a subunit of Cmr complex.	1.38214e-94
NC_006462.1\|WP_011229148.1\|142062_143457_+\|type-III-A-CRISPR-associated-protein-Csm6	gnl\|CDD\|378236	pfam09670, Cas_Cas02710, CRISPR-associated protein (Cas_Cas02710). Members of this family are found, exclusively in the vicinity of CRISPR repeats and other CRISPR-associated (cas) genes, in Methanothermobacter thermautotrophicus (Methanobacterium thermoformicicum), Thermus thermophilus (Deinococcus-Thermus), Chloroflexus aurantiacus (Chloroflexi), and Thermomicrobium roseum (Thermomicrobia).	2.23057e-125
NC_006462.1\|WP_011229140.1\|156502_156847_+\|type-III-B-CRISPR-module-associated-protein-Cmr5	gnl\|CDD\|378242	pfam09701, Cas_Cmr5, CRISPR-associated protein (Cas_Cmr5). CRISPR is a term for Clustered, Regularly Interspaced Short Palindromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family, represented by TM1791.1 of Thermotoga maritima, is found in both archaeal and bacterial species.	6.23944e-32
NC_006462.1\|WP_011229141.1\|155638_156499_+\|type-III-B-CRISPR-module-RAMP-protein-Cmr4	gnl\|CDD\|274210	TIGR02580, putative_CRISPR-associated_protein, CRISPR type III-B/RAMP module RAMP protein Cmr4. This model represents a CRISPR-associated protein from the family that includes TM1792 of Thermotoga maritima. This family is part of the broad RAMP superfamily (pfam03787) collection of CRISPR-associated proteins. It is the fourth of a recurring set of six proteins, four of are in the RAMP superfamily, that we designate the CRISPR RAMP module.	7.78032e-105
NC_006462.1\|WP_011229150.1\|140025_140901_+\|hypothetical-protein	gnl\|CDD\|187794	cd09663, Csm4_III-A, CRISPR/Cas system-associated RAMP superfamily protein Csm4. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; RAMP superfamily protein.	3.841e-11
NC_006462.1\|WP_011174461.1\|138874_139279_+\|type-III-A-CRISPR-associated-protein-Csm2	gnl\|CDD\|187778	cd09647, Csm2_III-A, CRISPR/Cas system-associated protein Csm2. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Small alpha-helical protein; signature gene for subtype III-A.	5.43062e-18
NC_006462.1\|WP_011229152.1\|136456_138874_+\|type-III-A-CRISPR-associated-protein-Cas10/Csm1	gnl\|CDD\|274209	TIGR02578, CRISPR-associated_protein_Cas10/Csm1, CRISPR-associated protein Cas10/Csm1, subtype III-A/MTUBE. The family is designated Csm2, for CRISPR/Cas Subtype Mtube Protein 2. A typical example is TM1811 from Thermotoga maritima. CRISPR are Clustered Regularly Interspaced Short Palindromic Repeats. This protein family belongs to a conserved gene cluster regularly found near CRISPR repeats.	0
NC_006462.1\|WP_011174463.1\|136128_136401_+\|CRISPR-associated-endonuclease-Cas2	gnl\|CDD\|187856	cd09725, Cas2_I_II_III, CRISPR/Cas system-associated protein Cas2. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas2 is present in majority of CRISPR/Cas systems along with Cas1; RNAse specific to U-rich regions; Possesses an RRM/ferredoxin fold.	2.97709e-24

>NC_006462.1|WP_011228296.1|144853_145807_-|IS110-like-element-IS1000B-family-transposase
MTFAGIDVSKTHLDLALVSNSPKPTRLRFPNSPEGRQALLAALAHHNPAWVALEPTSAYHLPLLKLLAENRLQVALVNPYHLAAFRKAKGERQKTDRQDALLLARYAQVYHEDLRAYTLPPETLRELKALVGYREDLAGRERTILNQMEAAEWAGSKEVLALLQKELACVKGLLGEVEARIQALLATLPEAEVLMALPGVGPQVAAAVLALLPPELWGRAKRAASYAGLIPEREESGKSVERSRLSKKGPPLLRRKLYMGALVAVRHDPEMRAFYHRLLSRGKRKKQALVAVAHKLLRRMMGRLREYYATQLDQGVA
>NC_006462.1|WP_011229148.1|142062_143457_+|type-III-A-CRISPR-associated-protein-Csm6
MEDLDALWERYREAVRAGGNPQALYQEMVWPALLALWREKPRVYPFPQAFAVSVHTLGTSPEATALAILGAGAERVYVLHTPESARFLPRLRQDTGKDLYPVEIGKSDVEAIYREVKRLLEKHPEVPVALDLTSGTKAMSAGLAAAGFFFQRFYPKVRVVYVDNEDYDPELRRPRAGTEKLRILPNPHEALAEVDALFAKELYGKGEFGQAAAYFRGMVGRTGNQAYALYALLAEMYRAWRALDFGEALKAGRKLLGQLSQNVWLNHPLNARREALEAQVALLEAVDRFLKARDFALKEGVYGLARTLLHLAQEAKEEAAVLAALYAYRALELLLQERLALLGRRAEAPGLSPEEAEALRKALAELLGVLPEEVRLPAKLGLLDLLAFLRLKGDEALGRLSLAELRGLAGALKGRNSALLVHGFDVPSPKAVEGIARLAQGLLQDLEARTALGPLSPEPVPLGF
>NC_006462.1|WP_011174458.1|140897_142052_+|type-III-A-CRISPR-associated-RAMP-protein-Csm5
MRFLRSFRLELEALSPVHVGTGEAYPAYAYVPDFARKAVHLLDPAALLLALPEARRRQYLEKVAQGPKAAQEVLRYLLEEDQLPREAVLHTLPASKAFLEALRSATEEALLEYRPLPRSPLGAYLPGSSVKGALRTAWLFHVLVREGKVAVFDRKEGVWRLRAWREGDGGTHVYPSRNPSLYENQAFEGAVLGYAREGKGRRMSLDLYRDPFRAVRLSDSGPVETFLNRLGVFHPHKDTSRMVLLAETFRIGTRFALTLRYHEGLSRDGDGERGVSMPIPPEDLVRALRDYYGKVAEWEEGFAEEHRLKRALEVYRALRERLQDPEAFPLRVGFGSGRLALRLALLLPEDHPEAQEPKTRKTAGAQNPVDGYPLGWMVGRLEPL
>NC_006462.1|WP_011229150.1|140025_140901_+|hypothetical-protein
MRATLFRLYFQGPLKALPRAPTLLGHLFWWYRYTHGREALEELLERFRQEPPFRLSSVYPEGWLPRPKLPPVQVEETTLRKALKSLSLVRLDTFQALAERGEEALLEAPEVQGKARPPEMRRLRRTRVGVDRAAGTARPGVLFTQEYLFPDPRTPYALYVLGEAPFDLGEALAFVGEMGYGGQASLGLGRFRVEGPFAVELPEAKEPNAYATLAPGPLEEALYYEVEPYWGRLGGAYVGARPFKRPYLRAKEGSVYRGPTHRLLEVTPTEPPEAGARVWEALVVFPLGVRV
>NC_006462.1|WP_011229151.1|139290_140016_+|type-III-A-CRISPR-associated-RAMP-protein-Csm3
MKLKKVIRIRSVLLAKTGLRIGMSRDQMAIGDLDNPVVRNPLTDEPYIPGSSLKGKLRYLLEWSLGGDYILKAKERQVYASPDPKDPVARIFGLAPENDERSLAVARERGPTRLLVRDAYLTEDAKEALERTSARGGLYTEIKQEVFIPRLGGNANPRTTERVPAGARFRVEMTYRVLDDLDEEYFGKYLLRALELLELDGLGGHISRGYGQVYFLHPERLTEDQEGWPLKERLKVEEVVL
>NC_006462.1|WP_011174461.1|138874_139279_+|type-III-A-CRISPR-associated-protein-Csm2
MPALEFFKDKERGVLDPKVFERAREVAEGLARGKLKSSQFRNYFAELRALENRFERERRKEGEELAFARLVPQLELLRAKLFYNTRSQGPLRDAKEFVEFMEEALEAGKRSPKDFEAMMKYVEAVLAYFYALAK
>NC_006462.1|WP_011229152.1|136456_138874_+|type-III-A-CRISPR-associated-protein-Cas10/Csm1
MLGDGLSVALAGLLHDVGKLYSRARWGERDDQVPDRTHTAYTAHFVREHAGLFRGAGLDPDWLARTASRHHEGWRDRPQYRPETPEEWCVALADTYASKEREEGEGGGSPPEVPLSPPFRRLLLGGEEGREGGYSPVGAGGRVGLEAGGLYPEERPNVSKDVYKRLLERLEGRLEEMARFSLGKEALVLNLALALQETLSLVPSDTQSEPDVSLYDHLRLTAAIAHALWLFHGGSPSAQNLRQDGEKFLLVVGDMGGIQGHIYRIAGAEAGVGGIAKRLRARSLEVSLAAEAMALGLLWRLGLTSLNRILGAGGKFYLLLPNTEEARAALEGTREAWGRWALKRGGSLVPHLAWVAFRGQDFRDFAALLKRLHEALAREKLRPFAFLASTGGVLGAPLRPCAACGLEPARRDEPGSLCPDCEREAALGARLPRSDRVGFFLEEAPRPYLDFPGLKVGLGGPLEGAFHLFRARLDFAPWPDPSEAKPLLGHLPRVEHALKAKGWSLEAYRAWAEEEGLLEDEEPHPEKVLTFAELAALSEGAPYLGALMLDADRMGEAFATGFRREGRDLATPSRLAALSRTLEVFFTTEVLTLLEEPRRYRERLGWDDLEAQRKEARYPLLYSVYSGGDDLFLLGPWDALLDFALDLERLYRLFTRHPRLTLSGGFLLVPPSLPVPELARLLGEAEKRAKAEGRERLFLFGQAVPWETLRGLRAWAEGLRQDLRAERVSRAQVYRWLLLWRRFSPLEDPGERMRYKPLLAYALRRVRERDEEAWKRYLKLLDHQDPAWAYLPVWVQWALYRERRV
>NC_006462.1|WP_011174463.1|136128_136401_+|CRISPR-associated-endonuclease-Cas2
MGKRLYAVAYDIPDDTRRVKLANLLKSYGERVQLSVFECYLDERLLEDLRRRARRLLDLGQDALRIYPVAGQVEVLGVGPLPELREVQVL
>NC_006462.1|WP_011229153.1|133965_134919_-|IS110-like-element-IS1000A-family-transposase
MTFAGIDVSKTHLDLALVSNSPKPTRLRFPNSPEGRQALLAALAHHNPAWVALEPTGAYHLPLLKLLAENRLQVALVNPYHLAAFRKAKGERQKTDRQDALLLARYAQVYHGELWAYTLPPEALRELKALVGYREDLAGRERAILNQMEAAEWAGSKEVLALLQKELACVKGLLGEVEARIQALLATLPEAEVLMALPGVGPQVAAAVLALLPPELWGRAKRAASYAGLIPEREESGKSVERSRLSKKGPPLLRRKLYMGALVAVRHDPEMRAFYHRLLSRGKRKKQALVAVAHKLLRRMMGRLREYYATQLDQGVA
>NC_006462.1|WP_164926115.1|133474_133714_-|hypothetical-protein
MRKMKLGICTRRIMGVFEGLHQWKATGERGDEKKKRIFAFRKGKTGFQDPRPEVRVGKSIAHTATLHQVKISAKKRLPK
>NC_006462.1|WP_011229147.1|147019_148930_+|hypothetical-protein
MQAPVYLCLLGNDPAPAYLGLKVVEREAGRVAKAVFYSFPAWNEEYGKKRQAFFRLLSEKGVLYEERPLEKGLEEAEAREVWVNLTGGAKYWAVRFLGHWRRPGARVFLVEGHRALEAPRALFLWPREEERSLEAEALTLEEYARLYLEPLGEAWERVSPPGAFPPGAQAARLPGREGGVFVVHRGLPYWYWVRPHLGGEAKDMSRKALSAFSGEAKRLGGQLCLPVVPYHKAHLRSRHPKERENVFARWRAWAREYGVFLVDPGRPLEEEVASLIKGKASKKALPLPQEGPLLLALVSEQAVPLYAAYLHAGPREVYLLTTPEMESRLRWAEAFFRGKGVRVHRSFLSGPWALREVRDLLAPVVEEALRRGHPVHANLNSGTTAMALGLYLALRDGARAHYLDGDRLLLLDGGEAEVPWEEGRPEDLLALRGYRFEEEYPDARPDPGLLALAEEILRRWDEVQTSWEASPLVRRFLKFWKKRFGQAFPPKRLSRLKGLPLEYAVYSHLNAHLAPKGGQARMGGHLVPLGGNEALAPQSTEVDGVFFHRGALWFVECKPTDEGLRERAPIMAELVRSVGGVEARGLMVARRWRGAPPPASPNLVYMALEGGEGVGVYRFPEELEKALSRNPAPRRG
>NC_006462.1|WP_011174453.1|148900_149422_-|hypothetical-protein
MEALWQRTGDPLGDFIRLVLLVEELLERLGAPKEDTLGAKLRSGAAEAFFQSHPEGPALRGRLWRLVELRNAVLHERAEVPSWAFSEGRDLAARLLAAVERQGFYSREEWTARMAFLEAPAPPTPQAFPEVIPPERARSPEAEERPPGAWKTLPFPRRPLAKRALAPPRRRIP
>NC_006462.1|WP_011174452.1|149426_150146_-|hypothetical-protein
MTAWLLSLALNLPFLGGPQEYQILVALGCSAPRHVQNGYREMLAHEVLPRLAEKVTTTQVRLTLAPITGRSYTAPARVLETPNPLSTPRFQLEEAKKTFQKEALRTFDELRKRAAAECSRGTEIIGALKAAGERARKPGRILVLAHGFEQSELMNLYDYRLKLEKREVRQGLLQRVKARLGLPNLKDQEVCIAGITAGNDNNANARLTTSIKAFWEELIQASGGRLVGYGTTPRVCPFL
>NC_006462.1|WP_011229146.1|150114_151080_-|hypothetical-protein
MLNGFRVLRSYWVGRRDGKALSRKHASLAYLTPNPYPEQLKEWFRRWMEGLARRYLAKRAKLEERLALVRHQRKALEKVVGQDEPTPEVFGGYHFRYGLLGLVFLGEAYYNKMAMDTLEMNQLEAFIIGAVATIGLFWLGHAAGNEYRKGNLPLSLILGIPPLLVVILFAALRFSWTQRMAAIHGNPAPSIYGFLALMAIGLLLVSLTFYLGYRSPHEREVLLRRLFLTAQKERRIWERLRGLNRGAERALDHLLAHYRENVAAYWRGFARAWPQWDPAPEFVGHIPPLNRPALPPLDLEAPTDPLTQGSAHDRLAPEPRP
>NC_006462.1|WP_011229145.1|151072_151483_-|hypothetical-protein
MFWRRMGPEEARVRLLLLREGVRQKVGALEARLAKRKAPLEKALKEYRGVLEHLRRLEAEGRYPEAVLRPALAREELRIRYAEGEIARLEEAHRQAVAQLVSRARLKAARLAALAQMEEALDRFFPTPETKEEAHA
>NC_006462.1|WP_011229144.1|151609_153364_+|type-III-B-CRISPR-associated-protein-Cas10/Cmr2
MEHLLAIALGPVQEFIATARRTRDLYAGSRLLSEAAARAAKALAREVGAKNLIFPAPEDEAGLERLAGAGIPNVLLVRVPEGKDPRGLGEQALGAARDYLRERAEEVLGPRRDLLFWREALAQVEDLLEGYYAYLPLEGDYPRARERLMALLAARKNTRDFAPVSWGSPAYKSSLDGARESVLRLPEKEADHLRVRLGLRPGEYLAGPDLLKRWWKAGHGFLSTTHMAALPFWEGVRRAGLEAVLKEALEELGGLVGEEARAEVRHPVLRDTPFGEWDVRLLYESRLEEFPSLAEDPGLLEKARDRLRALWRRLFPKVRVPPGAYYALLHADGDRMGETLDGLPSPEAHRRFSNALALGFAAQVKDIVEAHGGGLVYSGGDDVLALLPLHTALMAARALADRFREAMAPFGREGRAPSLSVGLAVVHHLEPLQDALDLARRAEKWAKEGEPKRNALCVAYSPRSGAERLVRGRWDENPPLTRRLLRYADLLRAGEVPSRAAYELLALVREAGEALSGEALVAEALRILGRKEMKRAYREELEAWLRTGEDVRRLAEELILARPFAEALDQAGVPVESREVWDAH
>NC_006462.1|WP_011229143.1|153353_154439_+|CRISPR-associated-protein-Cmr3
MLIEPRDPLIVRDGRPFTNSPGARAKSLPFPLPQTLAGAYRTRRALLEGLPLPERAEEVLRWGLRGPLLAEEGEGGWRLLAPRPLDALKLGEALYPLRPLELPQGAGTNLPEGLSPVGLPSPALKEKPAPLPAFWYWESFLEWLLQDAPAGFAPRGHEGPVPETRTHVALDPAAQTAREGFLFQTSGLEFVRGRRRLALVLWPEGPEPEGVFPLGGERRLAFWQKGGPGVPPLPEEVVAGLLRHRAARLVFLTPAFLGEAYLPKGRAFQGASVVAAVVGRPLAVSGWNLKEGKPKPSRRAVPAGSVYFVRLPEAWGEGEVRDWAEKVWFQNLSEEEQDRRDGFGLAALGLWDGKLRRWEEA
>NC_006462.1|WP_011229142.1|154435_155623_+|type-III-B-CRISPR-module-RAMP-protein-Cmr1
MRRAFREAFSPRRKEEGGVLVRRDGARVLAWERTYTLLTPLFGGGVEPREADPVSVVRATAVRGHLRFWWRAVRGWRAGGSLERLWELESALFGSAGEGGASPLSVEVEVLREGEKVGIAQYGRAVQWYLGFPLRGDKEWAPVKEGVAFRLRLRFPEKVGELNFWEELEAALWAWETFGGIGARTRRGFGALLPQGAGVPGEEEIREKLRQYGQKAGWPEGVPHLTPKSFVRVVPLSWRELAERYQAFRQARPGGDPRSPGRSYWPEPDGVRRLTGRHAPHHLPRHPVHKFPRAHFGLPIIFHFKDRGDPPDTTLRLKEADRRASPLLFRPLGEGQKPCVVAVLEGARFPGEKLVLEGKDGRTWDVDPWLTPEEAQKIPVLGGEVDPVLAFVKSL
>NC_006462.1|WP_011229141.1|155638_156499_+|type-III-B-CRISPR-module-RAMP-protein-Cmr4
MSHVALLFLHALSPLHAGTGQGIGAIDLPIAREKATGIPYLPGSSLKGVLRDRASAWDRDTLFAVFGPDTENASEHAGAVQVGDAKLLLLPVRSLYGVFALVASPYLLERFRREALMAGLQPPGVPGLQDPTRVLLAPGSRLLGDGEKVYLEDLDLKAQGEEGVAAWERWLAERTEAPVLGRLAVVHDDLMGFLLETATEVVARIRLDDETKTVAKGALWYEESLPAESLLYALVRADRSFRKGKELPPEGVWALFRGVLEEGGGVLQLGGKATVGRGLCRIVVGR
>NC_006462.1|WP_011229140.1|156502_156847_+|type-III-B-CRISPR-module-associated-protein-Cmr5
MRTRSQVWAQKAYEKVREAAKGEGRGEYRDMALKLPVLVRQAGLSQALAFVDSRGKEAHKALGNDLAQVLGYRDLRELAEAAREAELLQYLRLTREVLAAAEWFKRFAQALIEE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_006462_7

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_006462_7

189507-190947

TypeI-E

I-E,II-B

Consensus_repeat	Method
CGGTCCATCCCCACGTGCGTGGGGACTAC	CRISPRCasFinder
CGGTCCATCCCCACGTGCGTGGGGACTAC	CRT
CGGTCCATCCCCACGTGCGTGGGGACTAC	PILER-CR

23 spacers

WYL,cas3,cas8e,cse2gr11,cas7,cas5,cas6e,cas1,cas2

The CRISPR arrays of NC_006462_7

>merge|NC_006462|7|189507-190947|CRISPRCasFinder,CRT,PILER-CR
CCGTCCATCCCCACGTGCGTGGGGACTACTCGTCCGCAAGCTCGTCGGGCACCTCCTCCGGCGGTCCATCCCCACGTGTGTGGGGACTACGCCGGAGGCCCGGCCCGGAGGGGTCGTAAGACCCGGTCCATCCCCACGCGCGTGGGGACTACGCCCCCGCGGGAGCGGCGCGCCTTGCTAGAGGACGGTCCATCCCCACGTGCGTGGGGACTACGACCGCTTCACGTCCCGGAGTCGTGTCAGGGGCGGTCCATCCCCACGTGCGTGGGGACTACTTGCCATTACTATTACTACCGGCAACATCGCCGGTCCATCCCCACGTGCGTGGGGACTACGGCGTGGCCGGAGGGGGTGCCGAATGGCTAAGCGGTCCATCCCCACGTGCGTGGGGACTACGTGGAGGTCTACGCCGGGAACCGATTTTTCACCGGTCCATCCCCACGTGCGTGGGGACTACGGCCCGGAGCATGGCCTGCAGGACGGCGGAGGGCGGTCCATCCCCACGTGCGTGGGGACTACGGCCCGGGTCCTGGGCCACGGCTGGGCTAAAGGCGGTCCATCCCCACGTGCGTGGGGACTACCGGAGGAGCCACAGGTAGGCCGCCCGGGCCAGCGGTCCATCCCCACGTGCGTGGGGACTACCCGAGTGGGTCGTCCGCCTCGTTGAGTACCCTCGGTCCATCCCCACGTGCGTGGGGACTACGAGGCGCTGCTGAGCCCCAAGGCACTACGGCCCCGGTCCATCCCCACGTGCGTGGGGACTACGCCTCCACACCAGGCCACCAGGTCTGCGGCCCCCGGTCCATCCCCACGTGCGTGGGGACTACCCCTCTTGTTCTCTCTGGCCGCCCAACGAGGTCGGTCCATCCCCACGTGCGTGGGGACTACCACCCCCTTGGCCTTGGGCTTATAGCGCTAACCCGGTCCATCCCCACGTGCGTGGGGACTACGCTCGCAAGCTTGAGGATAAACTGGATAGGGCCCGGTCCATCCCCACGTGCGTGGGGACTACCCTAGCCTCCTGTGACGGGTGGGGGCTGTCAGCGGTCCATCCCCACGTGCGTGGGGACTACGGTGGAGAATCAGCCCGTTGAGGAGGTTGCCTACGGTCCATCCCCACGTGCGTGGGGACTACTAGACAAAGGTCGTCTTATATTCTGCGTCCGGCCGGTCCATCCCCACGTGCGTGGGGACTACTTGCAGATAGGCGATGTTGGCGGCGATGACCTCGGTCCATCCCCACGTGCGTGGGGACTACGGAGTGGCGGCCGCGAAGCGGGCCAGGTCTACCGGTCCATCCCCACGTGCGTGGGGACTACAGAGAGCTCGTAAAGGGCCCCGGCCAAATCGTCGGTCCATCCCCACGTGCGTGGGGACTACGCGGGTCACCTCGGAGTAGGAGCGGGTGGCGTCGGTCCATCCCCACGTGCGTGGGGACTAC

>NC_006462|7|6|189507-190947|CRISPRCasFinder
CCGTCCATCCCCACGTGCGTGGGGACTAC	TCGTCCGCAAGCTCGTCGGGCACCTCCTCCGG
CGGTCCATCCCCACGTGTGTGGGGACTAC	GCCGGAGGCCCGGCCCGGAGGGGTCGTAAGACC
CGGTCCATCCCCACGCGCGTGGGGACTAC	GCCCCCGCGGGAGCGGCGCGCCTTGCTAGAGGA
CGGTCCATCCCCACGTGCGTGGGGACTAC	GACCGCTTCACGTCCCGGAGTCGTGTCAGGGG
CGGTCCATCCCCACGTGCGTGGGGACTAC	TTGCCATTACTATTACTACCGGCAACATCGC
CGGTCCATCCCCACGTGCGTGGGGACTAC	GGCGTGGCCGGAGGGGGTGCCGAATGGCTAAG
CGGTCCATCCCCACGTGCGTGGGGACTAC	GTGGAGGTCTACGCCGGGAACCGATTTTTCAC
CGGTCCATCCCCACGTGCGTGGGGACTAC	GGCCCGGAGCATGGCCTGCAGGACGGCGGAGGG
CGGTCCATCCCCACGTGCGTGGGGACTAC	GGCCCGGGTCCTGGGCCACGGCTGGGCTAAAGG
CGGTCCATCCCCACGTGCGTGGGGACTAC	CGGAGGAGCCACAGGTAGGCCGCCCGGGCCAG
CGGTCCATCCCCACGTGCGTGGGGACTAC	CCGAGTGGGTCGTCCGCCTCGTTGAGTACCCT
CGGTCCATCCCCACGTGCGTGGGGACTAC	GAGGCGCTGCTGAGCCCCAAGGCACTACGGCCC
CGGTCCATCCCCACGTGCGTGGGGACTAC	GCCTCCACACCAGGCCACCAGGTCTGCGGCCCC
CGGTCCATCCCCACGTGCGTGGGGACTAC	CCCTCTTGTTCTCTCTGGCCGCCCAACGAGGT
CGGTCCATCCCCACGTGCGTGGGGACTAC	CACCCCCTTGGCCTTGGGCTTATAGCGCTAACC
CGGTCCATCCCCACGTGCGTGGGGACTAC	GCTCGCAAGCTTGAGGATAAACTGGATAGGGCC
CGGTCCATCCCCACGTGCGTGGGGACTAC	CCTAGCCTCCTGTGACGGGTGGGGGCTGTCAG
CGGTCCATCCCCACGTGCGTGGGGACTAC	GGTGGAGAATCAGCCCGTTGAGGAGGTTGCCTA
CGGTCCATCCCCACGTGCGTGGGGACTAC	TAGACAAAGGTCGTCTTATATTCTGCGTCCGGC
CGGTCCATCCCCACGTGCGTGGGGACTAC	TTGCAGATAGGCGATGTTGGCGGCGATGACCT
CGGTCCATCCCCACGTGCGTGGGGACTAC	GGAGTGGCGGCCGCGAAGCGGGCCAGGTCTAC
CGGTCCATCCCCACGTGCGTGGGGACTAC	AGAGAGCTCGTAAAGGGCCCCGGCCAAATCGT
CGGTCCATCCCCACGTGCGTGGGGACTAC	GCGGGTCACCTCGGAGTAGGAGCGGGTGGCGT
CGGTCCATCCCCACGTGCGTGGGGACTAC

>NC_006462|7|6|189507-190947|CRT
CCGTCCATCCCCACGTGCGTGGGGACTAC	TCGTCCGCAAGCTCGTCGGGCACCTCCTCCGG
CGGTCCATCCCCACGTGTGTGGGGACTAC	GCCGGAGGCCCGGCCCGGAGGGGTCGTAAGACC
CGGTCCATCCCCACGCGCGTGGGGACTAC	GCCCCCGCGGGAGCGGCGCGCCTTGCTAGAGGA
CGGTCCATCCCCACGTGCGTGGGGACTAC	GACCGCTTCACGTCCCGGAGTCGTGTCAGGGG
CGGTCCATCCCCACGTGCGTGGGGACTAC	TTGCCATTACTATTACTACCGGCAACATCGC
CGGTCCATCCCCACGTGCGTGGGGACTAC	GGCGTGGCCGGAGGGGGTGCCGAATGGCTAAG
CGGTCCATCCCCACGTGCGTGGGGACTAC	GTGGAGGTCTACGCCGGGAACCGATTTTTCAC
CGGTCCATCCCCACGTGCGTGGGGACTAC	GGCCCGGAGCATGGCCTGCAGGACGGCGGAGGG
CGGTCCATCCCCACGTGCGTGGGGACTAC	GGCCCGGGTCCTGGGCCACGGCTGGGCTAAAGG
CGGTCCATCCCCACGTGCGTGGGGACTAC	CGGAGGAGCCACAGGTAGGCCGCCCGGGCCAG
CGGTCCATCCCCACGTGCGTGGGGACTAC	CCGAGTGGGTCGTCCGCCTCGTTGAGTACCCT
CGGTCCATCCCCACGTGCGTGGGGACTAC	GAGGCGCTGCTGAGCCCCAAGGCACTACGGCCC
CGGTCCATCCCCACGTGCGTGGGGACTAC	GCCTCCACACCAGGCCACCAGGTCTGCGGCCCC
CGGTCCATCCCCACGTGCGTGGGGACTAC	CCCTCTTGTTCTCTCTGGCCGCCCAACGAGGT
CGGTCCATCCCCACGTGCGTGGGGACTAC	CACCCCCTTGGCCTTGGGCTTATAGCGCTAACC
CGGTCCATCCCCACGTGCGTGGGGACTAC	GCTCGCAAGCTTGAGGATAAACTGGATAGGGCC
CGGTCCATCCCCACGTGCGTGGGGACTAC	CCTAGCCTCCTGTGACGGGTGGGGGCTGTCAG
CGGTCCATCCCCACGTGCGTGGGGACTAC	GGTGGAGAATCAGCCCGTTGAGGAGGTTGCCTA
CGGTCCATCCCCACGTGCGTGGGGACTAC	TAGACAAAGGTCGTCTTATATTCTGCGTCCGGC
CGGTCCATCCCCACGTGCGTGGGGACTAC	TTGCAGATAGGCGATGTTGGCGGCGATGACCT
CGGTCCATCCCCACGTGCGTGGGGACTAC	GGAGTGGCGGCCGCGAAGCGGGCCAGGTCTAC
CGGTCCATCCCCACGTGCGTGGGGACTAC	AGAGAGCTCGTAAAGGGCCCCGGCCAAATCGT
CGGTCCATCCCCACGTGCGTGGGGACTAC	GCGGGTCACCTCGGAGTAGGAGCGGGTGGCGT
CGGTCCATCCCCACGTGCGTGGGGACTAC

>NC_006462|7|4|189509-190947|PILER-CR
GTCCATCCCCACGTGCGTGGGGACTACTC	GTCCGCAAGCTCGTCGGGCACCTCCTCCGGCG
GTCCATCCCCACGTGTGTGGGGACTACGC	CGGAGGCCCGGCCCGGAGGGGTCGTAAGACCCG
GTCCATCCCCACGCGCGTGGGGACTACGC	CCCCGCGGGAGCGGCGCGCCTTGCTAGAGGACG
GTCCATCCCCACGTGCGTGGGGACTACGA	CCGCTTCACGTCCCGGAGTCGTGTCAGGGGCG
GTCCATCCCCACGTGCGTGGGGACTACTT	GCCATTACTATTACTACCGGCAACATCGCCG
GTCCATCCCCACGTGCGTGGGGACTACGG	CGTGGCCGGAGGGGGTGCCGAATGGCTAAGCG
GTCCATCCCCACGTGCGTGGGGACTACGT	GGAGGTCTACGCCGGGAACCGATTTTTCACCG
GTCCATCCCCACGTGCGTGGGGACTACGG	CCCGGAGCATGGCCTGCAGGACGGCGGAGGGCG
GTCCATCCCCACGTGCGTGGGGACTACGG	CCCGGGTCCTGGGCCACGGCTGGGCTAAAGGCG
GTCCATCCCCACGTGCGTGGGGACTACCG	GAGGAGCCACAGGTAGGCCGCCCGGGCCAGCG
GTCCATCCCCACGTGCGTGGGGACTACCC	GAGTGGGTCGTCCGCCTCGTTGAGTACCCTCG
GTCCATCCCCACGTGCGTGGGGACTACGA	GGCGCTGCTGAGCCCCAAGGCACTACGGCCCCG
GTCCATCCCCACGTGCGTGGGGACTACGC	CTCCACACCAGGCCACCAGGTCTGCGGCCCCCG
GTCCATCCCCACGTGCGTGGGGACTACCC	CTCTTGTTCTCTCTGGCCGCCCAACGAGGTCG
GTCCATCCCCACGTGCGTGGGGACTACCA	CCCCCTTGGCCTTGGGCTTATAGCGCTAACCCG
GTCCATCCCCACGTGCGTGGGGACTACGC	TCGCAAGCTTGAGGATAAACTGGATAGGGCCCG
GTCCATCCCCACGTGCGTGGGGACTACCC	TAGCCTCCTGTGACGGGTGGGGGCTGTCAGCG
GTCCATCCCCACGTGCGTGGGGACTACGG	TGGAGAATCAGCCCGTTGAGGAGGTTGCCTACG
GTCCATCCCCACGTGCGTGGGGACTACTA	GACAAAGGTCGTCTTATATTCTGCGTCCGGCCG
GTCCATCCCCACGTGCGTGGGGACTACTT	GCAGATAGGCGATGTTGGCGGCGATGACCTCG
GTCCATCCCCACGTGCGTGGGGACTACGG	AGTGGCGGCCGCGAAGCGGGCCAGGTCTACCG
GTCCATCCCCACGTGCGTGGGGACTACAG	AGAGCTCGTAAAGGGCCCCGGCCAAATCGTCG
GTCCATCCCCACGTGCGTGGGGACTACGC	GGGTCACCTCGGAGTAGGAGCGGGTGGCGTCG
GTCCATCCCCACGTGCGTGGGGACTAC

Protein	Signature genes	Signature genes Name	Protein_function
NC_006462.1\|WP_011229128.1\|169094_170792_-\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224099
NC_006462.1\|WP_011229112.1\|198796_199432_+\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	cas6e	cd09664_cas6e_CAS-I-E	gnl\|CDD\|187795
NC_006462.1\|WP_011229123.1\|176641_179347_+\|DUF11-domain-containing-protein	unknown	unknown	gnl\|CDD\|307488
NC_006462.1\|WP_011229120.1\|187762_188458_-\|hypothetical-protein	unknown	unknown	unknown
NC_006462.1\|WP_081481500.1\|173361_173856_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227063
NC_006462.1\|WP_011229119.1\|188502_189447_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|334588
NC_006462.1\|WP_164926127.1\|194944_196444_+\|type-I-E-CRISPR-associated-protein-Cse1/CasA	cas8e	cd09669_cas8e_CAS-I-E	gnl\|CDD\|274192
NC_006462.1\|WP_011229111.1\|199441_200419_+\|type-I-E-CRISPR-associated-endonuclease-Cas1	cas1	cd09719_cas1_CAS-I-E	gnl\|CDD\|274693
NC_006462.1\|WP_011229129.1\|167972_169079_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|226361
NC_006462.1\|WP_011229122.1\|179343_184731_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226973
NC_006462.1\|WP_011229113.1\|198063_198810_+\|type-I-E-CRISPR-associated-protein-Cas5/CasD	cas5	cd09756_cas5_CAS-I-E	gnl\|CDD\|378243
NC_006462.1\|WP_011229117.1\|192123_194886_+\|CRISPR-associated-helicase/endonuclease-Cas3	cas3	cd09639_cas3_CAS-I	gnl\|CDD\|182031
NC_006462.1\|WP_011229124.1\|173869_176536_+\|DUF11-domain-containing-protein	unknown	unknown	gnl\|CDD\|224387
NC_006462.1\|WP_011229109.1\|202081_202834_-\|LamB/YcsF-family-protein	unknown	unknown	gnl\|CDD\|377121
NC_006462.1\|WP_011229127.1\|170801_171878_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|224753
NC_006462.1\|WP_011229121.1\|184727_187718_+\|DUF11-domain-containing-protein	unknown	unknown	gnl\|CDD\|273634
NC_006462.1\|WP_011229118.1\|191137_192127_+\|transcriptional-regulator	WYL	pfam13280_WYL_CAS-I:CAS-III	gnl\|CDD\|379100
NC_006462.1\|WP_164926117.1\|200372_200750_+\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	cas2	pfam09707_cas2_CAS-I-E	gnl\|CDD\|378244
NC_006462.1\|WP_011229115.1\|196440_196950_+\|type-I-E-CRISPR-associated-protein-Cse2/CasB	cse2gr11	cd09670_cse2gr11_CAS-I-E	gnl\|CDD\|237559
NC_006462.1\|WP_011229114.1\|196946_198062_+\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	cas7	pfam09344_cas7_CAS-I-E	gnl\|CDD\|378153

Protein	Function_ID	Function_description	E-value
NC_006462.1\|WP_011229128.1\|169094_170792_-\|iron-ABC-transporter-permease	gnl\|CDD\|224099	COG1178, ThiP, ABC-type Fe3+ transport system, permease component [Inorganic ion transport and metabolism].	1.45384e-84
NC_006462.1\|WP_011229112.1\|198796_199432_+\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	gnl\|CDD\|187795	cd09664, Cas6_I-E, CRISPR/Cas system-associated RAMP superfamily protein Cas6e. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas6e is an endoribonuclease that generates crRNA; This family is specific for CRISPR/Cas system I-E subtype; Homologous to Cas6 (RAMP superfamily protein); Possesses double RRM/ferredoxin fold; also known as Cse3 family.	4.43057e-73
NC_006462.1\|WP_011229123.1\|176641_179347_+\|DUF11-domain-containing-protein	gnl\|CDD\|307488	pfam01345, DUF11, Domain of unknown function DUF11. A domain of unknown function found in multiple copies in several archaebacterial proteins. Conserved N-terminal lysine and C-terminal asparagine with central asp/glu suggests that many of these domain may contain an isopeptide bond.	1.36042e-08
NC_006462.1\|WP_081481500.1\|173361_173856_+\|hypothetical-protein	gnl\|CDD\|227063	COG4719, COG4719, Uncharacterized protein conserved in bacteria [Function unknown].	1.20197e-12
NC_006462.1\|WP_011229119.1\|188502_189447_-\|hypothetical-protein	gnl\|CDD\|334588	pfam01555, N6_N4_Mtase, DNA methylase. Members of this family are DNA methylases. The family contains both N-4 cytosine-specific DNA methylases and N-6 Adenine-specific DNA methylases.	3.17893e-06
NC_006462.1\|WP_164926127.1\|194944_196444_+\|type-I-E-CRISPR-associated-protein-Cse1/CasA	gnl\|CDD\|274192	TIGR02547, CRISPR_system_Cascade_subunit_CasA, CRISPR type I-E/ECOLI-associated protein CasA/Cse1. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This model family, represented by CT1972 from Chlorobium tepidum, is found in Ecoli subtype CRISPR/Cas regions of many bacteria, most of which are mesophiles, and not in Archaea. It is designated Cse1.	1.52361e-140
NC_006462.1\|WP_011229111.1\|199441_200419_+\|type-I-E-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|274693	TIGR03638, cas1_ECOLI, CRISPR-associated endonuclease Cas1, subtype I-E/ECOLI. The CRISPR-associated protein Cas1 is virtually universal to CRISPR systems. CRISPR, an acronym for Clustered Regularly Interspaced Short Palindromic Repeats, is prokaryotic immunity system for foreign DNA, mostly from phage. CRISPR systems belong to different subtypes, distinguished by both nature of the repeats, the makeup of the cohort of associated Cas proteins, and by molecular phylogeny within the more universal Cas proteins such as this one. This model is of type EXCEPTION and provides more specific information than the EQUIVALOG model TIGR00287. It describes the Cas1 protein particular to the ECOLI subtype of CRISPR/Cas system.	6.00322e-145
NC_006462.1\|WP_011229129.1\|167972_169079_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|226361	COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism].	3.28665e-130
NC_006462.1\|WP_011229122.1\|179343_184731_+\|hypothetical-protein	gnl\|CDD\|226973	COG4625, COG4625, Uncharacterized protein with a C-terminal OMP (outer membrane protein) domain [Function unknown].	7.36853e-07
NC_006462.1\|WP_011229113.1\|198063_198810_+\|type-I-E-CRISPR-associated-protein-Cas5/CasD	gnl\|CDD\|378243	pfam09704, Cas_Cas5d, CRISPR-associated protein (Cas_Cas5). CRISPR is a term for Clustered, Regularly Interspaced Short Palindromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This small Cas family is represented by CT1134 of Chlorobium tepidum.	3.08993e-54
NC_006462.1\|WP_011229121.1\|184727_187718_+\|DUF11-domain-containing-protein	gnl\|CDD\|273634	TIGR01451, unnamed_protein_product, conserved repeat domain. This model represents the conserved region of about 53 amino acids shared between regions, usually repeated, of proteins from a small number of phylogenetically distant prokaryotes. Examples include a 132-residue region found repeated in three of the five longest proteins of Bacillus anthracis, a 131-residue repeat in a cell wall-anchored protein of Enterococcus faecalis, and a 120-residue repeat in Methanobacterium thermoautotrophicum. A similar region is found in some Chlamydial outer membrane proteins.	2.21017e-08
NC_006462.1\|WP_011229124.1\|173869_176536_+\|DUF11-domain-containing-protein	gnl\|CDD\|224387	COG1470, COG1470, Predicted membrane protein [Function unknown].	1.02171e-07
NC_006462.1\|WP_011229109.1\|202081_202834_-\|LamB/YcsF-family-protein	gnl\|CDD\|377121	pfam03746, LamB_YcsF, LamB/YcsF family. This family includes LamB. The lam locus of Aspergillus nidulans consists of two divergently transcribed genes, lamA and lamB, involved in the utilisation of lactams such as 2-pyrrolidinone. Both genes are under the control of the positive regulatory gene amdR and are subject to carbon and nitrogen metabolite repression. The exact molecular function of the proteins in this family is unknown.	7.70874e-140
NC_006462.1\|WP_011229127.1\|170801_171878_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|224753	COG1840, AfuA, ABC-type Fe3+ transport system, periplasmic component [Inorganic ion transport and metabolism].	1.53187e-40
NC_006462.1\|WP_011229117.1\|192123_194886_+\|CRISPR-associated-helicase/endonuclease-Cas3	gnl\|CDD\|182031	PRK09694, PRK09694, CRISPR-associated helicase/endonuclease Cas3.	1.93821e-104
NC_006462.1\|WP_011229118.1\|191137_192127_+\|transcriptional-regulator	gnl\|CDD\|379100	pfam13280, WYL, WYL domain. WYL is a Sm-like SH3 beta-barrel fold containing domain. It is a member of the WYL-like superfamily, named for three conserved amino acids found in a subset of the superfamily. However, these residues are not strongly conserved throughout the family. Rather, the conservation pattern includes four basic residues and a position often occupied by a cysteine, which are predicted to line a ligand-binding groove typical of the Sm-like SH3 beta-barrels. A WYL domain protein (sll7009) is a negative regulator of the I-D CRISPR-Cas system in Synechocystis sp. It is predicted to be a ligand-sensing domain that could bind negatively charged ligands, such as nucleotides or nucleic acid fragments, to regulate CRISPR-Cas and other defense systems such as the abortive infection AbiG system.	7.52188e-34
NC_006462.1\|WP_164926117.1\|200372_200750_+\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	gnl\|CDD\|378244	pfam09707, Cas_Cas2CT1978, CRISPR-associated protein (Cas_Cas2CT1978). This entry represents a minor branch of the Cas2 family of CRISPR-associated protein which are found in IPR003799. Cas proteins are found adjacent to a characteristic short, palindromic repeat cluster termed CRISPR, a probable mobile DNA element.	5.58088e-38
NC_006462.1\|WP_011229115.1\|196440_196950_+\|type-I-E-CRISPR-associated-protein-Cse2/CasB	gnl\|CDD\|237559	PRK13921, PRK13921, CRISPR-associated Cse2 family protein; Provisional.	1.42913e-76
NC_006462.1\|WP_011229114.1\|196946_198062_+\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	gnl\|CDD\|378153	pfam09344, Cas_CT1975, CT1975-like protein. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family is represented by CT1975 of Chlorobium tepidum.	5.3335e-155

>NC_006462.1|WP_011229119.1|188502_189447_-|hypothetical-protein
MKRNAWEVYGEVLKTARELGLEGEEQEVAKALLAWPKERFHALAARVGLKAKYLRHDLLPIAFLPEPLREALQGGLPLREAHRLHRLLKRGELSLQDLTGKDPKALMALPARPGEVDPRLPVWFFPPEPWEEALPMAVARALVQLYTREGELVLDPMAGRGTVVEAARALDRRAWGGDIAPRGPLVERADIRDLPRRFRKEAALVVLHPPTFSTWLREEGYREEAEERYGEYIRHISSFLDLCRPTLAPGGKLVLVARPRRTLTPKDLEAGHDFFLAPWERALAEADFRPLSYHLAVSQDGRQDWHLFVGEPRG
>NC_006462.1|WP_011229120.1|187762_188458_-|hypothetical-protein
MAYSGWGYDPEMAAFWQELVEVYAPLAHGIPIRWRVGTKVHQAAAWRKEKGVWTVELSPLLFSRYPIFLARRYGLPMGLPPLHALVRVLEEARTLEVEEGLPGGAVLYRLPLPGPAPEGSEAWREVELEALLAEGGRLLEREAASAAEAQALAEEAKELALRLQAHPLGESDRALALLTVLEAFRKAMERLAARYEAWASDRVAREGTAYAAHLSFPQRLARLRYRDRTGE
>NC_006462.1|WP_011229121.1|184727_187718_+|DUF11-domain-containing-protein
MSVWTRTAPVLLVLLLGLAQAQVVTPFAKRYETNDRGDIRMVGNTLMCASGSGVYGCNTSTMNNPSANNNVSMVFLNADPTNPSWPSGRGGSSAAQLNLPSGAQVLWAGLYWGARADPSASGRNTIYLKPPGAVDYQAVPGTLLGTITNAGTPSSRPYVAFADVTSQVRSAGSGTYWVGGILAQTGNSGLGFYAGWSLVVVYRDPNATLKNLVVYDGLATVSDGNDVSITLSGFLTPLVGAVNARVGAVAFEGDGGLTGDRLLLNGSSLSDAQNPQNNFFNSSISYLGTRFTQKTPDFVNQMAVDVDLVDATGKLSNGATSATVTFTSSGDIYFPVVMAFAVDLYLPDLITTFTKTASDLNGGDLLVGDHLEYAVSFSNTGLDGATNVVVVDPIPAGTQYVPGSLRVVQNAAAAPTGTFTDAPGDDIAEYSPSCPEAGGGPCVRFRLGTGANASQGGLVLPGEGAEVRFRVQVLPSAAGQTISNTAKVSYNAQTLGTGYSQEATSSASVTVVGFTLAGQVYHDLEPNGLKSSGESWSDGATVWVKLLQGGSVVAQAQVDPGSGVFSFTGVAPGSYTLFLDNNNDPSDTTPTPPPGWLFVNPPSGSLNVSVSQDLSGLDFGLFHGARLVGTVFYDDGEGGGAANDAWQTGGERGVSGVAVTAQGSGTRSATTDGQGRYVLYIPWNFGPFTLSHPLRPATGWNDGSTAHPVSGWSEAQSPAFPTLDAGAIAGTEVARNFGVVRESRLYPPQTGQAASPGVVVYAHLYRPGTLGGLTLSLANAPSWTVQVRVDGNCDGDFDDPGEGFASLPQTLPVGPSWPREADGSLKACALEVRVLVPPGVPAGAVDVTLLQGALSWANNPGVVDLRSLADTTTVSGGEVRLEKRVRNVSQGTGFGTLGEGRPGEVLEYCVAYRNLGTASVSQFVLTDPVPFFTDPLPSVPDYGGKAIRWSHGSATLYLTASQGDDAGEVSGGVVRVEVGNVGPGEAGEVCYRAQIR
>NC_006462.1|WP_011229122.1|179343_184731_+|hypothetical-protein
MKRVFALVLLLLPALAQPVARELKATVVGDGVGWETHAFRIWLVIPEKGRVRLDLFSPGFDPTDYRSALLGKPELGDERYDGGKGELKATFRLYRDGKPLREMAFGVEPHRWVPFFEGEMEAGVYLFESELLGNGKNAFVLRVEAPSFKLSLDPKPQLILDVFTQTTTLRLLPDERGRVWVEPLGVYSEGPLEVAFYDEDGPEELRARVRYEDGSVEERPVSGDRGWTTYTKRPGLALFGFTQPPTARQHSNTVAFRVGACTSLENGVLKAIPPGEARARVVDEEGKPLPVPVEEKDRVFRPLLPEGASLLRVEARGAVFVQEGWAEVGCPGGEVTFVVRLPKPPAPERPPQGEVRFRVAVALPGGDLPAKATLRLGDLEAPVDGERTLALPRGRYPLAVLAEGARVEAPQEVEVLPGKRQEVLVRLLPEVALSLAPKEVYLRVGEEGEVVLTATTPYPGLLPAELSLELPEGLTPLGASRAQGPLTKDRPFQLRVRFLAEKEGTYALSGLLAPWGLRAEGRAVVVRPATFRLVKEALTPEVEAGGVARFRVTVVNEGDEEGRAVLVDRFLGTEERREVFLKAKEGRSYEFAFPVPLEAQGTLVNRAELSTGEKAEAGVRVLRPKAHLERSLPHRVYLPGEEVVLSFLVENRGEAPMRYVLEDACPDWLSPLEPARFEGYLKPGEEALHAYRARVLLGPEAEGACAATLRTPTETLRAEVALKRRPLLLEKEADPPRLLEGGQGVFRLRVRNPADHRVEVELRDIPGKGLGMDPWSERVALEAGEERVFTLPFRAEAVGELENGLSAFLGETPAAFPVKAKVAVLPVLVPERTSVVRLPFRVEGEGDALLLGFKPPEGAEYSPGSARLDGRPVEEPRVLPDGTLVWRLPFAREGLLTLTLLHTRALPPLPEPALTLLRLDRELPLKGGLRLRDYEGAKPLSAKRKGPIREPMDGAIVQQEAVALRIEAPLGPIAVRVNGLEVEGRLLGEAQYDEERKVQRLAYYGVPLRPGRNVIEVEGPGFYDKVEVFRPGPPKDLVLEPVRLRADGRTPLEFRLKAVDGMGLPTGFGLATLEADPEPIAPDASLLEPGYQVLLRDGVGTVMLKPLLTPKEVRLRARFNKLEKTFRLFAGGAQEPLWLAQGSVGVAYDPEEGRPRLFGLARGYVEAPLEGGFLQGALDTTGGLSQTPEAGFFPITGSGEEARRPLASDDPVALRYTTPEYTLAYERGPLAPGLGEATALRLATRGDARVEAFLALLPKGSVREEIVPDGTAFYRLSGSPAPGSLRLFLVEGGRTRALEAGVDYTYDFLSGEIVLARPLAPFTPEFAPVRLVAEYAPLSAPREELALGAQAAYEAGPWRFGLGGYLRLDLQGFASQGYALGASLAYGEGGSEVGLEAAFAGKWRFGLSAALSEGPLEARGNLAYEEGGEVQGAFRAAYDLGPGAVALEHTTPGRTGLVYEAKLARGFRFGLGAGYAWREGGLYLLGRAAYQEGRARFGLSHAYLLSGGQETRLDLLWPLGEALEAEGSLAYLWGEGLQGAFGLRQRLGSANLALSYQLPTASGEGNRARFGLEAPLPLTENLSANLGLYALYAFSGGQGELGGSLGLRYAREGLVATFGVEGALGPKLTLRGGAAGSLDPENTLGLDFALSLLPEAKGRFSLAYALRASDLSLLTYHRYATETGLLEGQLAAAYAPFPAFSVRPAFGYRYPFPDPEGATYALGLYATLFPTELLGLGGGASYTFQPATGASDLSFSVEGTLRLSPLWLSLGYQFGPSLFAPEGVYLRLDVFGGSR
>NC_006462.1|WP_011229123.1|176641_179347_+|DUF11-domain-containing-protein
MGRGMGRRWRGASGWAFALTLLLSVAFALTPAGTVIRNQAVAEASGERYLSNVAETRVQAVCRPLLFPDGTPEAPALRASAAPGGWVHLPYRLKNGGNAPYTFALSHVLHGTSSWVPEAVRFYLDVNANALSDPGEPEVSEVALGMGEEVALVLALKVPATASGSLFITPVATCPGGEEDGENYARVEASGILEPSLFLAKAASPAALLPGERATFTLTLRNLGTGEARGPILLSDPLAGLEGLRYVPGSARAPKGILEFFDGAAWRTEEPPSVLGVRLRLERLLPGEEATLSFQVEALPTASPGPRENRALAEGPGGPAEGVAVLEVLPLYRHHLGPGGNPKALPGGEGSGDDLQEARGLAGQPYCFRHTLLNEGTAQDRYRIRVEGAPGRLLTLQGTPLPEPVPLGPGESLDFLACFDAKEAGVLEATLVAASLGGGGENRTRDRLEVLPAEALVLRKEADPAPGTTLKAGDLFTYALVVENRFAPLPNARVEDRLPPWVEFLEASGGSYDPESHAVVFLLDPLPLGETRLWVRVRVKADTPDDTLLQNRFTLTSESTPNPLVSNEVRHPVLSVNLALSKEVAPKEAAPGDLLTYTLKVTNPASTPLEVRLEDTPNPRLAYLEGSARGGRCGGSLNPLEPVREGASLRWTLTLGPKESFCLEYRMRVLPGAPATLVNVAEAQGLSAQGAATARVQARAQVRVRLGPLGLERGVLLGRVYLDVNEDGRYDPGNDVPLPGARVVLANGWQTLTDREGRYAFRDLEPGVWQVMLDPASAPFPPLPHPEALGEGYRHGVRVQGLSVSDFPLKAPKGFLEAYRETTLRFGPLTLEKRLLPLKEGFRVVLLLRSQEPLEDLTVRDPQPDGTEKTFHFALFSGEEVLEYALEEPYMSDPEVRWRYP
>NC_006462.1|WP_011229124.1|173869_176536_+|DUF11-domain-containing-protein
MKRVGFISLLLALVLGLAYAMTPAGTAIQNQASASYIDSANQPRTATSNLVTTIVQQVYAFSITPNGTEPSPGQTKNALPGGQVVFSYVVTNNGNGTDTINLATAQGTADNFDLLSPTIYRDANCNGTLDAGETAPITGVTLGMGQSACVLVVATVPSSATGGQYGNLNLEGTSAGDATVTDTDNWARAAATTAAALTASKAASPAGSVSPGDTITYTISGQNVGGSPAYGISVTVDSTSKTGILIADTIPTGLTVSATPTGYAGAGTVTYVYDDGTGWKTLTSSDLPLTGNGTVKIGMLIEGTGDFFPVGAQYTFSFAATVPSAASAGTSYTNSATVQFDANGDGDAADSGETVTTNTTTNTVGASYNVAVGPYGYPEAGASGSYTAGGYAVARSGDTQTIASAYSGTTVVFRHTLKNTGNTADSFTLSFSGAPSGWACQLVADDLTTPISGPVGPIAAGGTYDFALKCAIPANYTTSSAVSLTVTATSVNDTAKSDTTTDTVNEVLLGYAVDLARKDHAGDGDPTNDNPPAQSANPGQTVYFPVEVYNAGNNPDSYTLSASVPTGWSVVFYPDTNCDGTPDGAPVTNTGIVNPGNKACFVAAVSVPAGTAPGANPVSFTATSTTVGTVSDTISTAVNVNLLAQVRLDPDRSGTVTSPGTITYTHTLLNNSNAPAYCDISGDGGSHGWTYQYSTDGTSWYGALADVYAAPNGGTQAIYVRVLVPAGEPVGRVDVNTVTARCDVTTGSPDNTYEATDTATETTTIVGGELRLQKSVDKATAYPGETLTYTIVAENIGTGDLKKVIVADPVPSYTTFVSVSATATGFSGTYTVLYSTDGTTWSTTAPTSVPTGGTVYVGVDTNGDNAITDADLMPPAARITITLQVQVQ
>NC_006462.1|WP_081481500.1|173361_173856_+|hypothetical-protein
MRWKSVLGLAVLLLASLALAQALTLDLRPYLVKVVEGKEVYEANPLAVRPGDVLEWRLVAENRAQGDLRQVALVIPIPKETYYLEGSAKPLQVGGTIVPPEFSFDGGKTFGRPPLKKRIRVVENGKEVEKEVEVKPEEYTHARWVIPVLSKGDKVMVSLRTIVR
>NC_006462.1|WP_011229127.1|170801_171878_-|ABC-transporter-substrate-binding-protein
MRRAILWFVALAIASVLAQQSRPASDPQVVEAARKEGRLIIYSSTDQSSAQALLDDFRKLYPFIQIEYNDLGTQAIYDRFVSETAAGASSADLLWSSAMELQVKLASEGYALPYDSPEAKNWPANARLGNLAYSTTLEPAVVVYNKRFLKPEEVPTTREGLARLLQEPRMRGRVATWDPERSAVGFTILKADYDRFPAFQELARAFGKAQAALYSSTGAAFEKVISGEHYLAYGFFGSYALLRQRTVKDLGIAYLTDGTVAIQRVAFINKRAAHPNAAKLFLDYLLSLRGQNLMAYTALIFARRETVVGEATPQALYKAVGGKDKVYAIPVSTEILKNLDPAERMRFLTFWRQAVRGQ
>NC_006462.1|WP_011229128.1|169094_170792_-|iron-ABC-transporter-permease
MVRKAPLAPSVPWPLALLTGAVGLLVLAPIGILVYQSLLTAPFFAPAKRFALEAYRYVLHDPYFLEALKNSFLIGLGMVLIAVPLGSLFAFLVTKTDLPFARLFELLLLAPIFISAIILGIGFIVAFGPSGVVSGWVESLLGHVPWTIYTLPAIAVIAGLTHVPYVYLYVASTIQNVDASLEEAARVAGARPYQVALSVTLPLVRPALVYSGALMLLLGFELFGLPLVLGDAKGIMVVTTYLYRLTAITGTSAYHLMAAVSVLIVLIAFTLVLLQRYLVGRMEGRYVAIGARGYRTERLPLGRLRYVWAFALALYLLVAVVLPVLGVVFRSLVTSWGPGVDLREVFTVGHYADVFKLPNLSRAVTNTLWVAALGGLLALAFYLLIALGIQRGRGFGRVLDYLAGLPRAVPGLIMGLAFLWIFLFFKPIAPWRNTLFALVLAYTVVWMPYGVRLLTAALLQVGREVEEAARIAGASPVRAFLHGTLPLLKGGVLTAWFLLFIQFVREYSTGVYLMTAGTEVLGAQIVALWGTGAVDVIAALATLQVLIVSGVFVLANRLGVRPQGL
>NC_006462.1|WP_011229129.1|167972_169079_-|ABC-transporter-ATP-binding-protein
MVRKALDGQEVVTASAETLRVEALEVRLGENLVLKEVDLAVEPGEIVALLGPSGSGKTTLLRAVAGLLRPTGGRILLGKEVFFDGKKGVFLPPERRNLGLVFQSYALWPQRTVYENVAYGLRLRKVPEKAVRERVLGLLDRLGLTGLERRYPGALSGGQQQRVSLARALAYDPKLLLLDEPLSNLDAKLRDQARVWLRETLKATGKAALFVTHDQGEAMAIADRIALLNEGRMEQVGTPEELYRNPKTLFVADFLGNPNVVEALVVGLEGSTARLELAGFPLRARAMGALVPGRLAKLVLRPEALRPAGVGEVNALEGALAHSLYLGSHYEHWVRVGDALLRFYSPLPLGEARVRLAVDPEAALAYPG
>NC_006462.1|WP_011229118.1|191137_192127_+|transcriptional-regulator
MGQEAKSARLLQMAEALKLRPMRVGELARRFGVSERTVERDLEALLELGFPVERLARGLYRIADRPPSLHPIEALALFAAGRLLYHQAPTRQYRMALDKLARMLPEPLRGLLLRSTQGLEARQGESRTLEMVARALLERRVLAFEYRSGGSKNWRPKELLVYFLEANRANLGLYAIGYERTYHRAVLTFKLSRMRHARLLDESYEIPQDFDPNAYLRRAWGVVGVREKGVEVRLRFAPEAAWRVLEGDYPGLHLEEELPDGSLLARLEAAPFKGGVPWEVLAWVQSFGPRVEVLSPPELRRLWLEEAERVLALYGNRQEVSGSPPKVRA
>NC_006462.1|WP_011229117.1|192123_194886_+|CRISPR-associated-helicase/endonuclease-Cas3
MSVEEAALALWAKSGNPFHPLLAHMLDTAAVALAVLRMEPPRTRALYAEDWGLPEEGALAWAAALVGLHDLGKASPVFQAGWEEGKERVQRAGLPFGELLDWVAHGVFTELFLRRLLKEKGLPERAANDLAAALGAHHGFPANAEEKSRARRHLRTEDPLWKEARRWLLEEVFRRLGAPLPPSQGNGEARPEAVLRVMALASFADWVASDPSLFPYGRDPRRGDYLKEALRLAQEALNRLGWPAFAKAQRREFGELFPYIPKPNALQESVPALLEGACTPVLLLVEAPMGMGKTEAALYAHHLLQAGLGHRGLYVALPTQATANGLFPRVRGFLERLGEGSRLELQLQHGTALLNPHYAGLLERAAPRQVGEEEEGGAVASAWFSARKRAMLAPYGVGTLDQALLGVLRVKHHFVRLWGLMNRVVVLDEVHAYDVYTSGLLQALLRWLRALGSSAVVMTATLPPSRRRALLEAWAGEEVEGQDLGPYPRVVLVGEGVKARSLPPAREVEVALEVLREVDVEPLAQRLKGALPGAVGAIVNTVDRAQDLYRALGEGTPLTLEELARRLGGISGGQAWEEVRQALPERGGEVVGKVLTDGTLVFLLHARFPAEERALRGSVVLALFGKGGPRPPRAILVATQVAEQSLDLDFDLLYTDLAPIDLLFQRSGRLHRHERPRPEEHARPRLLLGVPEDLDFGKPLYWDKVYEDYVLLATWRALSGRDRLRVPGDLEALLEEIYEGENPESFPEGLRERAKKSLKALQERRDREANTARRLSLSELDRLLAYWDEGALVAQERLEDDEEKAETQRLLTRLGDPSVAVVPLFRVGEGLFLDREGRRRAPLKGEVSREEAEALFRRAVRLSRFPLPQELLKEEPPPAWRKSGLLRGLRPLEVGRVFRSGERAFQVELDPELGVVYLPV
>NC_006462.1|WP_164926127.1|194944_196444_+|type-I-E-CRISPR-associated-protein-Cse1/CasA
MEKFNLIDEPWIPVLKGGRVVEVGIGEALLRAHEFARIETPSPLEEAVLHRLLLAVLHRALSGPRCPEDVLDWWRKGGFPQDPIRDYLNRFRDRFFLFHPEAPFLQVADLPEENPLPWSKLLPELASGNNPTLFDHTTEENLPKATYAQAARALLVHQAFAPGGLLRRYGVGSAKDAPVARPALFLPTGQNLLETLLLNLVPYTPEDDAPIWEVPPLRLGDLEGARTKWPLTGRTRVYTWPARGVRLLDEGDGVRFMGYGPGVEPLEATHRDPMVAQRLDAKGNLLVLRLSEERSFWRDFSAMLPRQGGKVAATLEHAENLQGELEDEGLEGRITLRVLGQVSDQAKVLDIRREVYPLPSGLLTPKAEENLEKALKMAEELGQGLKHLAQEVAKAVVGERDRGHGRSPYLEELTKLANSLPLERLYWHALDGAFPRFFARVEEEASLDLWREALRGAALEAWKATRRFLGTGARHLKALAQGEQEFGRLLGELGEEVRT
>NC_006462.1|WP_011229115.1|196440_196950_+|type-I-E-CRISPR-associated-protein-Cse2/CasB
MSPGERFLDWLKRLQGQKAWTAARAAFRRSLAFPPGAYPRAMPYVEPFLAKGDWRQEEREAHYLVAALYALKDGDHQVGRTLARALWEKAQGSASVEKRFLALLEADRDQIAFRLRQAVALVEGGIDFARLLDDLLRWFSPERHVQARWAREYYGAGASEEEKKKEVEA
>NC_006462.1|WP_011229114.1|196946_198062_+|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC
MKLLEVHILQTVAPSNLNRDDTGSPKDALFGGFRRARISSQAQKRAVRVAFRDWPLLSEEERAVRTKRLVEELLRRLAGVEEELARRAIENALNALGFGVKEGRTEYLLFLGNRELDALAQGIRENLEALSGEVKGKKKAEVPPELKKALERVLDGGKAVDLALFGRMLADRPELGVDAAAQVAHALSTHKVDREFDFYTAVDDLNPKEDTGAGMMGDVEFYSATLYRYAVVDLDKLVENLQGDKELALKGVLAFLEAFALTLPSGKQNSFAAHNPPLFVAFRAGEGMPRNLATAFEAPLRPKEEVPLSRLSAEALLKEWAKFDRVYGPLEPEWKGALDLTGAEGDGVPRLENLKALKEKAAEAVKALLGV
>NC_006462.1|WP_011229113.1|198063_198810_+|type-I-E-CRISPR-associated-protein-Cas5/CasD
MPTLLIRLQGPLQSWGTRSRFDHRDTWPYPTKSGVVGLLAAALGRDRREDVSDLAALRMGVRVDRKGVLKVDYQTAQFVYRTEGYVAVSTPKEREWLSRYTKTPIRVDERNATVTSKRYFLSDAAFLVGLEGERALLEALHRALKNPRFPLYLGRKSYVPSPPPYLPDGLVEAPLAEALEGYPYLLGGKPPEDLLLALEAEEGRLVYDQPAGPFSERRFAARFVREEVLPKERVPEGPPAWEVARVAH
>NC_006462.1|WP_011229112.1|198796_199432_+|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE
MWLTKLVLNPASRAARRDLANPYEMHRTLSKAVSRALEEGRERLLWRLEPARGLEPPVVLVQTLTEPDWSVLDEGYAQVFPPKPFHPALKPGQRLRFRLRANPAKRLAATGKRVALKTPAEKVAWLERRLEEGGFRLLEGERGPWVQILQDTFLEVRRKKDGEEAGKLLQVQAVLFEGRLEVVDPERALATLRRGVGPGKALGLGLLSVAP
>NC_006462.1|WP_011229111.1|199441_200419_+|type-I-E-CRISPR-associated-endonuclease-Cas1
MPPVSSARNLKELPKFRDGLSYLYVEHAVVEREAGGIGIYDQEGLTLAPVAGLGVLFLGPGTRITHAAVRLLAENGCTVAWVGEGMARFYAQGLGDTRSAARFYRQARAWADPALHLEVVMRLYRMRFSEPLPEGLTLEQVRGLEGVRVRNAYARWSRETGVPWYGRSYDRGNWRAADPVNRALSAGASYLYGLAHAAIVSLGFSPALGFIHTGKLLSFVYDIADLYKADYLVPAAFRTVAESEEAVERRVRRALREAIQEGRLLERMAEDLLNLFRGLGLPEEEDPVEEDPTRPGGLWDLEGEVEGGVAYGGDDPGEGAEEPEG
>NC_006462.1|WP_164926117.1|200372_200750_+|type-I-E-CRISPR-associated-endoribonuclease-Cas2
MVVMILEKVPRSLRGDLTRFLVEVDTGVFVGRVSATVRELLWERAVEKAEGGRVALAYRTNNEQGFALRLHGYPDRFLRDFDGIVLVSVRNAEAVRKAEKLSRQVERYKKRLAKGSEGDLESQSP
>NC_006462.1|WP_011229109.1|202081_202834_-|LamB/YcsF-family-protein
MKVDLNADAGESYGAFAYGHDREIFPLVSSANLACGFHGGSPGRILEAVRLAKAHGVAVGAHPGFPDLVGFGRREMALSPEEVYADVLYQIGALSAFLKAEGLPLHHVKPHGALYLKACRDRETARAIALAVKAFDPGLPLVVLPGTVYEEEARKAGLRVVLEAFPERAYLRSGQLAPRSMPGSWITDPEEAARRALRMVLEGKVEALDGGEVAVRADTLCIHGDNPNAPEVARAVREALEQAGVEVRAF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_006462_8

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_006462_8

200811-202078

TypeI-E

I-E,II-B

Consensus_repeat	Method
GTAGTCCCCACGCGTGTGGGGATGGACCG	PILER-CR
GTAGTCCCCACGCGTGTGGGGATGGACCG	CRISPRCasFinder
GTAGTCCCCACGCGTGTGGGGATGGACCG	CRT

20 spacers

cas2,cas1,cas6e,cas5,cas7,cse2gr11,cas8e,cas3,WYL

The CRISPR arrays of NC_006462_8

>merge|NC_006462|8|200811-202078|PILER-CR,CRISPRCasFinder,CRT
GTAGTCCCCACGCGTGTGGGGATGGACCGGCTGGCCTGCAGGACCTCCAGCATCTGGCGGGGTAGTCCCCACGCGTGTGGGGATGGACCGGCCCTAGACTCGGGCTATCCCGCCATCAGCGGCGTAGTCCCCACGCGTGTGGGGATGGACCGCCAGCGGATGGCGTCCTCATAGCGCATGCGCAGTAGTCCCCACGCGTGTGGGGATGGACCGGCAACCCCAGGGTTCAGGGGTTCAGTCGCCCATGTAGTCCCCACGCGTGTGGGGATGGACCGTTCACCCAGCTTGACGGCGCCATCATTTCCCACGTAGTCCCCACGCGTGTGGGGATGGACCGGCCATCCCGAAGCCGTGCGGGTTGCCTTCCCACGTAGTCCCCACGCGTGTGGGGATGGACCGCTATCTTTCGCGAACTACCGGGCTTGGGCCGCGTAGTCCCCACGCGTGTGGGGATGGACCGTAGGCCATCGTGTCTAGGGAGGGGTTAGACCCGTAGTCCCCACGCGTGTGGGGATGGACCGGACGGTAGACCCCGAGACCGGGGAAATCCTGGAGTAGTCCCCACGCGTGTGGGGATGGACCGGAAAGCCCGAACTCATGGCGGACCGCGAACACGTAGTCCCCACGCGTGTGGGGATGGACCGTGCCCCTCTGGCGGCCTAAGGAGGGTCATAAGCGTAGTCCCCACGCGTGTGGGGATGGACCAGACGACATCCTTAGCGCCCTCCTCATGGCCCTACGTAGTCCCCACGCGTGTGGGGATGGACCGGTTCCGGCCTCCACCCTCCGGTACGCGGAGAAGTAGTCCCCACGCGTGTGGGGATGGACCGACCATGAGCGGCGAGTTAGGGTGCGAAATCGGGGTAGTCCCCACGCGTGTGGGGATGGACCGGAGGCTCGCGGAGAAGGCCGCCACCTGCTCCCCGTAGTCCCCACGCGTGTGGGGATGGACCGTCCGACCCGCGCCGCCTCCTCTCTCTCTCCCTGGTAGTCCCCACGCGTGTGGGGATGGACCGACTCGGGAGCCAAGACGTAGGTGGAGAACCGCCGTAGTCCCCACGCGTGTGGGGATGGACCGGACATGACCCCCGAGCAGCGCCGCGCCCTCAAGCGTAGTCCCCACGCGTGTGGGGATGGACCGGTGGAGTCTTCCCCTTCCTCTTCTGGCCCCCAGCGTAGTCCCCACGCGTGTGGGGATGGACCGAGCTCCCGCTTGAGCTCGTCCAGGAGGTACTTCGCGTAGTCCCCACGCATGTGGGGATGGGCCG

>NC_006462|8|5|200811-202014|PILER-CR
GTAGTCCCCACGCGTGTGGGGATGGACCG	GCTGGCCTGCAGGACCTCCAGCATCTGGCGGG
GTAGTCCCCACGCGTGTGGGGATGGACCG	GCCCTAGACTCGGGCTATCCCGCCATCAGCGGC
GTAGTCCCCACGCGTGTGGGGATGGACCG	CCAGCGGATGGCGTCCTCATAGCGCATGCGCA
GTAGTCCCCACGCGTGTGGGGATGGACCG	GCAACCCCAGGGTTCAGGGGTTCAGTCGCCCAT
GTAGTCCCCACGCGTGTGGGGATGGACCG	TTCACCCAGCTTGACGGCGCCATCATTTCCCAC
GTAGTCCCCACGCGTGTGGGGATGGACCG	GCCATCCCGAAGCCGTGCGGGTTGCCTTCCCAC
GTAGTCCCCACGCGTGTGGGGATGGACCG	CTATCTTTCGCGAACTACCGGGCTTGGGCCGC
GTAGTCCCCACGCGTGTGGGGATGGACCG	TAGGCCATCGTGTCTAGGGAGGGGTTAGACCC
GTAGTCCCCACGCGTGTGGGGATGGACCG	GACGGTAGACCCCGAGACCGGGGAAATCCTGGA
GTAGTCCCCACGCGTGTGGGGATGGACCG	GAAAGCCCGAACTCATGGCGGACCGCGAACAC
GTAGTCCCCACGCGTGTGGGGATGGACCG	TGCCCCTCTGGCGGCCTAAGGAGGGTCATAAGC
GTAGTCCCCACGCGTGTGGGGATGGACCA	GACGACATCCTTAGCGCCCTCCTCATGGCCCTAC
GTAGTCCCCACGCGTGTGGGGATGGACCG	GTTCCGGCCTCCACCCTCCGGTACGCGGAGAA
GTAGTCCCCACGCGTGTGGGGATGGACCG	ACCATGAGCGGCGAGTTAGGGTGCGAAATCGGG
GTAGTCCCCACGCGTGTGGGGATGGACCG	GAGGCTCGCGGAGAAGGCCGCCACCTGCTCCCC
GTAGTCCCCACGCGTGTGGGGATGGACCG	TCCGACCCGCGCCGCCTCCTCTCTCTCTCCCTG
GTAGTCCCCACGCGTGTGGGGATGGACCG	ACTCGGGAGCCAAGACGTAGGTGGAGAACCGCC
GTAGTCCCCACGCGTGTGGGGATGGACCG	GACATGACCCCCGAGCAGCGCCGCGCCCTCAAGC
GTAGTCCCCACGCGTGTGGGGATGGACCG	GTGGAGTCTTCCCCTTCCTCTTCTGGCCCCCAGC
GTAGTCCCCACGCGTGTGGGGATGGACCG

>NC_006462|8|7|200811-202078|CRISPRCasFinder
GTAGTCCCCACGCGTGTGGGGATGGACCG	GCTGGCCTGCAGGACCTCCAGCATCTGGCGGG
GTAGTCCCCACGCGTGTGGGGATGGACCG	GCCCTAGACTCGGGCTATCCCGCCATCAGCGGC
GTAGTCCCCACGCGTGTGGGGATGGACCG	CCAGCGGATGGCGTCCTCATAGCGCATGCGCA
GTAGTCCCCACGCGTGTGGGGATGGACCG	GCAACCCCAGGGTTCAGGGGTTCAGTCGCCCAT
GTAGTCCCCACGCGTGTGGGGATGGACCG	TTCACCCAGCTTGACGGCGCCATCATTTCCCAC
GTAGTCCCCACGCGTGTGGGGATGGACCG	GCCATCCCGAAGCCGTGCGGGTTGCCTTCCCAC
GTAGTCCCCACGCGTGTGGGGATGGACCG	CTATCTTTCGCGAACTACCGGGCTTGGGCCGC
GTAGTCCCCACGCGTGTGGGGATGGACCG	TAGGCCATCGTGTCTAGGGAGGGGTTAGACCC
GTAGTCCCCACGCGTGTGGGGATGGACCG	GACGGTAGACCCCGAGACCGGGGAAATCCTGGA
GTAGTCCCCACGCGTGTGGGGATGGACCG	GAAAGCCCGAACTCATGGCGGACCGCGAACAC
GTAGTCCCCACGCGTGTGGGGATGGACCG	TGCCCCTCTGGCGGCCTAAGGAGGGTCATAAGC
GTAGTCCCCACGCGTGTGGGGATGGACCA	GACGACATCCTTAGCGCCCTCCTCATGGCCCTAC
GTAGTCCCCACGCGTGTGGGGATGGACCG	GTTCCGGCCTCCACCCTCCGGTACGCGGAGAA
GTAGTCCCCACGCGTGTGGGGATGGACCG	ACCATGAGCGGCGAGTTAGGGTGCGAAATCGGG
GTAGTCCCCACGCGTGTGGGGATGGACCG	GAGGCTCGCGGAGAAGGCCGCCACCTGCTCCCC
GTAGTCCCCACGCGTGTGGGGATGGACCG	TCCGACCCGCGCCGCCTCCTCTCTCTCTCCCTG
GTAGTCCCCACGCGTGTGGGGATGGACCG	ACTCGGGAGCCAAGACGTAGGTGGAGAACCGCC
GTAGTCCCCACGCGTGTGGGGATGGACCG	GACATGACCCCCGAGCAGCGCCGCGCCCTCAAGC
GTAGTCCCCACGCGTGTGGGGATGGACCG	GTGGAGTCTTCCCCTTCCTCTTCTGGCCCCCAGC
GTAGTCCCCACGCGTGTGGGGATGGACCG	AGCTCCCGCTTGAGCTCGTCCAGGAGGTACTTCGC
GTAGTCCCCACGCATGTGGGGATGGGCCG

>NC_006462|8|7|200811-202078|CRT
GTAGTCCCCACGCGTGTGGGGATGGACCG	GCTGGCCTGCAGGACCTCCAGCATCTGGCGGG
GTAGTCCCCACGCGTGTGGGGATGGACCG	GCCCTAGACTCGGGCTATCCCGCCATCAGCGGC
GTAGTCCCCACGCGTGTGGGGATGGACCG	CCAGCGGATGGCGTCCTCATAGCGCATGCGCA
GTAGTCCCCACGCGTGTGGGGATGGACCG	GCAACCCCAGGGTTCAGGGGTTCAGTCGCCCAT
GTAGTCCCCACGCGTGTGGGGATGGACCG	TTCACCCAGCTTGACGGCGCCATCATTTCCCAC
GTAGTCCCCACGCGTGTGGGGATGGACCG	GCCATCCCGAAGCCGTGCGGGTTGCCTTCCCAC
GTAGTCCCCACGCGTGTGGGGATGGACCG	CTATCTTTCGCGAACTACCGGGCTTGGGCCGC
GTAGTCCCCACGCGTGTGGGGATGGACCG	TAGGCCATCGTGTCTAGGGAGGGGTTAGACCC
GTAGTCCCCACGCGTGTGGGGATGGACCG	GACGGTAGACCCCGAGACCGGGGAAATCCTGGA
GTAGTCCCCACGCGTGTGGGGATGGACCG	GAAAGCCCGAACTCATGGCGGACCGCGAACAC
GTAGTCCCCACGCGTGTGGGGATGGACCG	TGCCCCTCTGGCGGCCTAAGGAGGGTCATAAGC
GTAGTCCCCACGCGTGTGGGGATGGACCA	GACGACATCCTTAGCGCCCTCCTCATGGCCCTAC
GTAGTCCCCACGCGTGTGGGGATGGACCG	GTTCCGGCCTCCACCCTCCGGTACGCGGAGAA
GTAGTCCCCACGCGTGTGGGGATGGACCG	ACCATGAGCGGCGAGTTAGGGTGCGAAATCGGG
GTAGTCCCCACGCGTGTGGGGATGGACCG	GAGGCTCGCGGAGAAGGCCGCCACCTGCTCCCC
GTAGTCCCCACGCGTGTGGGGATGGACCG	TCCGACCCGCGCCGCCTCCTCTCTCTCTCCCTG
GTAGTCCCCACGCGTGTGGGGATGGACCG	ACTCGGGAGCCAAGACGTAGGTGGAGAACCGCC
GTAGTCCCCACGCGTGTGGGGATGGACCG	GACATGACCCCCGAGCAGCGCCGCGCCCTCAAGC
GTAGTCCCCACGCGTGTGGGGATGGACCG	GTGGAGTCTTCCCCTTCCTCTTCTGGCCCCCAGC
GTAGTCCCCACGCGTGTGGGGATGGACCG	AGCTCCCGCTTGAGCTCGTCCAGGAGGTACTTCGC
GTAGTCCCCACGCATGTGGGGATGGGCCG

Protein	Signature genes	Signature genes Name	Protein_function
NC_006462.1\|WP_011229112.1\|198796_199432_+\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	cas6e	cd09664_cas6e_CAS-I-E	gnl\|CDD\|187795
NC_006462.1\|WP_011229109.1\|202081_202834_-\|LamB/YcsF-family-protein	unknown	unknown	gnl\|CDD\|377121
NC_006462.1\|WP_008633600.1\|212787_213243_-\|PIN-domain-containing-protein	unknown	unknown	gnl\|CDD\|379205
NC_006462.1\|WP_008630619.1\|213741_214431_-\|IS5-like-element-ISTth7-family-transposase	unknown	unknown	gnl\|CDD\|376573
NC_006462.1\|WP_008633599.1\|213223_213466_-\|AbrB/MazE/SpoVT-family-DNA-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|273625
NC_006462.1\|WP_011229119.1\|188502_189447_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|334588
NC_006462.1\|WP_164926127.1\|194944_196444_+\|type-I-E-CRISPR-associated-protein-Cse1/CasA	cas8e	cd09669_cas8e_CAS-I-E	gnl\|CDD\|274192
NC_006462.1\|WP_011229111.1\|199441_200419_+\|type-I-E-CRISPR-associated-endonuclease-Cas1	cas1	cd09719_cas1_CAS-I-E	gnl\|CDD\|274693
NC_006462.1\|WP_011229102.1\|212350_212731_-\|ParA-family-protein	unknown	unknown	gnl\|CDD\|224113
NC_006462.1\|WP_011229099.1\|215118_215520_+\|acyl-CoA-thioesterase	unknown	unknown	gnl\|CDD\|224523
NC_006462.1\|WP_011229113.1\|198063_198810_+\|type-I-E-CRISPR-associated-protein-Cas5/CasD	cas5	cd09756_cas5_CAS-I-E	gnl\|CDD\|378243
NC_006462.1\|WP_164926118.1\|206339_207572_+\|LamG-domain-containing-protein	unknown	unknown	gnl\|CDD\|379155
NC_006462.1\|WP_011229108.1\|202861_203707_-\|formate-dehydrogenase-accessory-sulfurtransferase-FdhD	unknown	unknown	gnl\|CDD\|234823
NC_006462.1\|WP_011229117.1\|192123_194886_+\|CRISPR-associated-helicase/endonuclease-Cas3	cas3	cd09639_cas3_CAS-I	gnl\|CDD\|182031
NC_006462.1\|WP_011229118.1\|191137_192127_+\|transcriptional-regulator	WYL	pfam13280_WYL_CAS-I:CAS-III	gnl\|CDD\|379100
NC_006462.1\|WP_164926117.1\|200372_200750_+\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	cas2	pfam09707_cas2_CAS-I-E	gnl\|CDD\|378244
NC_006462.1\|WP_164926128.1\|207849_210417_+\|HEAT-repeat-domain-containing-protein	unknown	unknown	gnl\|CDD\|237512
NC_006462.1\|WP_011229115.1\|196440_196950_+\|type-I-E-CRISPR-associated-protein-Cse2/CasB	cse2gr11	cd09670_cse2gr11_CAS-I-E	gnl\|CDD\|237559
NC_006462.1\|WP_011229107.1\|203703_205989_-\|FdhF/YdeP-family-oxidoreductase	unknown	unknown	gnl\|CDD\|239168
NC_006462.1\|WP_011229114.1\|196946_198062_+\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	cas7	pfam09344_cas7_CAS-I-E	gnl\|CDD\|378153

Protein	Function_ID	Function_description	E-value
NC_006462.1\|WP_011229112.1\|198796_199432_+\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	gnl\|CDD\|187795	cd09664, Cas6_I-E, CRISPR/Cas system-associated RAMP superfamily protein Cas6e. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas6e is an endoribonuclease that generates crRNA; This family is specific for CRISPR/Cas system I-E subtype; Homologous to Cas6 (RAMP superfamily protein); Possesses double RRM/ferredoxin fold; also known as Cse3 family.	4.43057e-73
NC_006462.1\|WP_011229109.1\|202081_202834_-\|LamB/YcsF-family-protein	gnl\|CDD\|377121	pfam03746, LamB_YcsF, LamB/YcsF family. This family includes LamB. The lam locus of Aspergillus nidulans consists of two divergently transcribed genes, lamA and lamB, involved in the utilisation of lactams such as 2-pyrrolidinone. Both genes are under the control of the positive regulatory gene amdR and are subject to carbon and nitrogen metabolite repression. The exact molecular function of the proteins in this family is unknown.	7.70874e-140
NC_006462.1\|WP_008633600.1\|212787_213243_-\|PIN-domain-containing-protein	gnl\|CDD\|379205	pfam13470, PIN_3, PIN domain. Members of this family of bacterial domains are predicted to be RNases (from similarities to 5'-exonucleases).	5.16695e-08
NC_006462.1\|WP_008630619.1\|213741_214431_-\|IS5-like-element-ISTth7-family-transposase	gnl\|CDD\|376573	pfam01609, DDE_Tnp_1, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction. This family contains transposases for IS4, IS421, IS5377, IS427, IS402, IS1355, IS5, which was original isolated in bacteriophage lambda.	0.00046212
NC_006462.1\|WP_008633599.1\|213223_213466_-\|AbrB/MazE/SpoVT-family-DNA-binding-domain-containing-protein	gnl\|CDD\|273625	TIGR01439, Uncharacterized_protein_Mb2626, looped-hinge helix DNA binding domain, AbrB family. This DNA-binding domain family includes AbrB, a transition state regulator in Bacillus subtilis, whose DNA-binding domain structure in solution was determined by NMR. The domain binds DNA as a dimer in what is termed a looped-hinge helix fold. Some members of the family have two copies of the domain in tandem. The domain is found usually at the N-terminus of a small protein. This model excludes members of family TIGR02609. [Regulatory functions, DNA interactions].	0.000519482
NC_006462.1\|WP_011229119.1\|188502_189447_-\|hypothetical-protein	gnl\|CDD\|334588	pfam01555, N6_N4_Mtase, DNA methylase. Members of this family are DNA methylases. The family contains both N-4 cytosine-specific DNA methylases and N-6 Adenine-specific DNA methylases.	3.17893e-06
NC_006462.1\|WP_164926127.1\|194944_196444_+\|type-I-E-CRISPR-associated-protein-Cse1/CasA	gnl\|CDD\|274192	TIGR02547, CRISPR_system_Cascade_subunit_CasA, CRISPR type I-E/ECOLI-associated protein CasA/Cse1. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This model family, represented by CT1972 from Chlorobium tepidum, is found in Ecoli subtype CRISPR/Cas regions of many bacteria, most of which are mesophiles, and not in Archaea. It is designated Cse1.	1.52361e-140
NC_006462.1\|WP_011229111.1\|199441_200419_+\|type-I-E-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|274693	TIGR03638, cas1_ECOLI, CRISPR-associated endonuclease Cas1, subtype I-E/ECOLI. The CRISPR-associated protein Cas1 is virtually universal to CRISPR systems. CRISPR, an acronym for Clustered Regularly Interspaced Short Palindromic Repeats, is prokaryotic immunity system for foreign DNA, mostly from phage. CRISPR systems belong to different subtypes, distinguished by both nature of the repeats, the makeup of the cohort of associated Cas proteins, and by molecular phylogeny within the more universal Cas proteins such as this one. This model is of type EXCEPTION and provides more specific information than the EQUIVALOG model TIGR00287. It describes the Cas1 protein particular to the ECOLI subtype of CRISPR/Cas system.	6.00322e-145
NC_006462.1\|WP_011229102.1\|212350_212731_-\|ParA-family-protein	gnl\|CDD\|224113	COG1192, Soj, ATPases involved in chromosome partitioning [Cell division and chromosome partitioning].	5.51358e-14
NC_006462.1\|WP_011229099.1\|215118_215520_+\|acyl-CoA-thioesterase	gnl\|CDD\|224523	COG1607, COG1607, Acyl-CoA hydrolase [Lipid metabolism].	8.42967e-46
NC_006462.1\|WP_011229113.1\|198063_198810_+\|type-I-E-CRISPR-associated-protein-Cas5/CasD	gnl\|CDD\|378243	pfam09704, Cas_Cas5d, CRISPR-associated protein (Cas_Cas5). CRISPR is a term for Clustered, Regularly Interspaced Short Palindromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This small Cas family is represented by CT1134 of Chlorobium tepidum.	3.08993e-54
NC_006462.1\|WP_164926118.1\|206339_207572_+\|LamG-domain-containing-protein	gnl\|CDD\|379155	pfam13385, Laminin_G_3, Concanavalin A-like lectin/glucanases superfamily. This domain belongs to the Concanavalin A-like lectin/glucanases superfamily.	0.000282688
NC_006462.1\|WP_011229108.1\|202861_203707_-\|formate-dehydrogenase-accessory-sulfurtransferase-FdhD	gnl\|CDD\|234823	PRK00724, PRK00724, formate dehydrogenase accessory sulfurtransferase FdhD.	2.73186e-89
NC_006462.1\|WP_011229117.1\|192123_194886_+\|CRISPR-associated-helicase/endonuclease-Cas3	gnl\|CDD\|182031	PRK09694, PRK09694, CRISPR-associated helicase/endonuclease Cas3.	1.93821e-104
NC_006462.1\|WP_011229118.1\|191137_192127_+\|transcriptional-regulator	gnl\|CDD\|379100	pfam13280, WYL, WYL domain. WYL is a Sm-like SH3 beta-barrel fold containing domain. It is a member of the WYL-like superfamily, named for three conserved amino acids found in a subset of the superfamily. However, these residues are not strongly conserved throughout the family. Rather, the conservation pattern includes four basic residues and a position often occupied by a cysteine, which are predicted to line a ligand-binding groove typical of the Sm-like SH3 beta-barrels. A WYL domain protein (sll7009) is a negative regulator of the I-D CRISPR-Cas system in Synechocystis sp. It is predicted to be a ligand-sensing domain that could bind negatively charged ligands, such as nucleotides or nucleic acid fragments, to regulate CRISPR-Cas and other defense systems such as the abortive infection AbiG system.	7.52188e-34
NC_006462.1\|WP_164926117.1\|200372_200750_+\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	gnl\|CDD\|378244	pfam09707, Cas_Cas2CT1978, CRISPR-associated protein (Cas_Cas2CT1978). This entry represents a minor branch of the Cas2 family of CRISPR-associated protein which are found in IPR003799. Cas proteins are found adjacent to a characteristic short, palindromic repeat cluster termed CRISPR, a probable mobile DNA element.	5.58088e-38
NC_006462.1\|WP_164926128.1\|207849_210417_+\|HEAT-repeat-domain-containing-protein	gnl\|CDD\|237512	PRK13800, PRK13800, fumarate reductase/succinate dehydrogenase flavoprotein subunit.	9.6295e-10
NC_006462.1\|WP_011229115.1\|196440_196950_+\|type-I-E-CRISPR-associated-protein-Cse2/CasB	gnl\|CDD\|237559	PRK13921, PRK13921, CRISPR-associated Cse2 family protein; Provisional.	1.42913e-76
NC_006462.1\|WP_011229107.1\|203703_205989_-\|FdhF/YdeP-family-oxidoreductase	gnl\|CDD\|239168	cd02767, MopB_ydeP, The MopB_ydeP CD includes a group of related uncharacterized bacterial molybdopterin-binding oxidoreductase-like domains with a putative molybdopterin cofactor binding site. These members belong to the molybdopterin_binding (MopB) superfamily of proteins.	0
NC_006462.1\|WP_011229114.1\|196946_198062_+\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	gnl\|CDD\|378153	pfam09344, Cas_CT1975, CT1975-like protein. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family is represented by CT1975 of Chlorobium tepidum.	5.3335e-155

>NC_006462.1|WP_164926117.1|200372_200750_+|type-I-E-CRISPR-associated-endoribonuclease-Cas2
MVVMILEKVPRSLRGDLTRFLVEVDTGVFVGRVSATVRELLWERAVEKAEGGRVALAYRTNNEQGFALRLHGYPDRFLRDFDGIVLVSVRNAEAVRKAEKLSRQVERYKKRLAKGSEGDLESQSP
>NC_006462.1|WP_011229111.1|199441_200419_+|type-I-E-CRISPR-associated-endonuclease-Cas1
MPPVSSARNLKELPKFRDGLSYLYVEHAVVEREAGGIGIYDQEGLTLAPVAGLGVLFLGPGTRITHAAVRLLAENGCTVAWVGEGMARFYAQGLGDTRSAARFYRQARAWADPALHLEVVMRLYRMRFSEPLPEGLTLEQVRGLEGVRVRNAYARWSRETGVPWYGRSYDRGNWRAADPVNRALSAGASYLYGLAHAAIVSLGFSPALGFIHTGKLLSFVYDIADLYKADYLVPAAFRTVAESEEAVERRVRRALREAIQEGRLLERMAEDLLNLFRGLGLPEEEDPVEEDPTRPGGLWDLEGEVEGGVAYGGDDPGEGAEEPEG
>NC_006462.1|WP_011229112.1|198796_199432_+|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE
MWLTKLVLNPASRAARRDLANPYEMHRTLSKAVSRALEEGRERLLWRLEPARGLEPPVVLVQTLTEPDWSVLDEGYAQVFPPKPFHPALKPGQRLRFRLRANPAKRLAATGKRVALKTPAEKVAWLERRLEEGGFRLLEGERGPWVQILQDTFLEVRRKKDGEEAGKLLQVQAVLFEGRLEVVDPERALATLRRGVGPGKALGLGLLSVAP
>NC_006462.1|WP_011229113.1|198063_198810_+|type-I-E-CRISPR-associated-protein-Cas5/CasD
MPTLLIRLQGPLQSWGTRSRFDHRDTWPYPTKSGVVGLLAAALGRDRREDVSDLAALRMGVRVDRKGVLKVDYQTAQFVYRTEGYVAVSTPKEREWLSRYTKTPIRVDERNATVTSKRYFLSDAAFLVGLEGERALLEALHRALKNPRFPLYLGRKSYVPSPPPYLPDGLVEAPLAEALEGYPYLLGGKPPEDLLLALEAEEGRLVYDQPAGPFSERRFAARFVREEVLPKERVPEGPPAWEVARVAH
>NC_006462.1|WP_011229114.1|196946_198062_+|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC
MKLLEVHILQTVAPSNLNRDDTGSPKDALFGGFRRARISSQAQKRAVRVAFRDWPLLSEEERAVRTKRLVEELLRRLAGVEEELARRAIENALNALGFGVKEGRTEYLLFLGNRELDALAQGIRENLEALSGEVKGKKKAEVPPELKKALERVLDGGKAVDLALFGRMLADRPELGVDAAAQVAHALSTHKVDREFDFYTAVDDLNPKEDTGAGMMGDVEFYSATLYRYAVVDLDKLVENLQGDKELALKGVLAFLEAFALTLPSGKQNSFAAHNPPLFVAFRAGEGMPRNLATAFEAPLRPKEEVPLSRLSAEALLKEWAKFDRVYGPLEPEWKGALDLTGAEGDGVPRLENLKALKEKAAEAVKALLGV
>NC_006462.1|WP_011229115.1|196440_196950_+|type-I-E-CRISPR-associated-protein-Cse2/CasB
MSPGERFLDWLKRLQGQKAWTAARAAFRRSLAFPPGAYPRAMPYVEPFLAKGDWRQEEREAHYLVAALYALKDGDHQVGRTLARALWEKAQGSASVEKRFLALLEADRDQIAFRLRQAVALVEGGIDFARLLDDLLRWFSPERHVQARWAREYYGAGASEEEKKKEVEA
>NC_006462.1|WP_164926127.1|194944_196444_+|type-I-E-CRISPR-associated-protein-Cse1/CasA
MEKFNLIDEPWIPVLKGGRVVEVGIGEALLRAHEFARIETPSPLEEAVLHRLLLAVLHRALSGPRCPEDVLDWWRKGGFPQDPIRDYLNRFRDRFFLFHPEAPFLQVADLPEENPLPWSKLLPELASGNNPTLFDHTTEENLPKATYAQAARALLVHQAFAPGGLLRRYGVGSAKDAPVARPALFLPTGQNLLETLLLNLVPYTPEDDAPIWEVPPLRLGDLEGARTKWPLTGRTRVYTWPARGVRLLDEGDGVRFMGYGPGVEPLEATHRDPMVAQRLDAKGNLLVLRLSEERSFWRDFSAMLPRQGGKVAATLEHAENLQGELEDEGLEGRITLRVLGQVSDQAKVLDIRREVYPLPSGLLTPKAEENLEKALKMAEELGQGLKHLAQEVAKAVVGERDRGHGRSPYLEELTKLANSLPLERLYWHALDGAFPRFFARVEEEASLDLWREALRGAALEAWKATRRFLGTGARHLKALAQGEQEFGRLLGELGEEVRT
>NC_006462.1|WP_011229117.1|192123_194886_+|CRISPR-associated-helicase/endonuclease-Cas3
MSVEEAALALWAKSGNPFHPLLAHMLDTAAVALAVLRMEPPRTRALYAEDWGLPEEGALAWAAALVGLHDLGKASPVFQAGWEEGKERVQRAGLPFGELLDWVAHGVFTELFLRRLLKEKGLPERAANDLAAALGAHHGFPANAEEKSRARRHLRTEDPLWKEARRWLLEEVFRRLGAPLPPSQGNGEARPEAVLRVMALASFADWVASDPSLFPYGRDPRRGDYLKEALRLAQEALNRLGWPAFAKAQRREFGELFPYIPKPNALQESVPALLEGACTPVLLLVEAPMGMGKTEAALYAHHLLQAGLGHRGLYVALPTQATANGLFPRVRGFLERLGEGSRLELQLQHGTALLNPHYAGLLERAAPRQVGEEEEGGAVASAWFSARKRAMLAPYGVGTLDQALLGVLRVKHHFVRLWGLMNRVVVLDEVHAYDVYTSGLLQALLRWLRALGSSAVVMTATLPPSRRRALLEAWAGEEVEGQDLGPYPRVVLVGEGVKARSLPPAREVEVALEVLREVDVEPLAQRLKGALPGAVGAIVNTVDRAQDLYRALGEGTPLTLEELARRLGGISGGQAWEEVRQALPERGGEVVGKVLTDGTLVFLLHARFPAEERALRGSVVLALFGKGGPRPPRAILVATQVAEQSLDLDFDLLYTDLAPIDLLFQRSGRLHRHERPRPEEHARPRLLLGVPEDLDFGKPLYWDKVYEDYVLLATWRALSGRDRLRVPGDLEALLEEIYEGENPESFPEGLRERAKKSLKALQERRDREANTARRLSLSELDRLLAYWDEGALVAQERLEDDEEKAETQRLLTRLGDPSVAVVPLFRVGEGLFLDREGRRRAPLKGEVSREEAEALFRRAVRLSRFPLPQELLKEEPPPAWRKSGLLRGLRPLEVGRVFRSGERAFQVELDPELGVVYLPV
>NC_006462.1|WP_011229118.1|191137_192127_+|transcriptional-regulator
MGQEAKSARLLQMAEALKLRPMRVGELARRFGVSERTVERDLEALLELGFPVERLARGLYRIADRPPSLHPIEALALFAAGRLLYHQAPTRQYRMALDKLARMLPEPLRGLLLRSTQGLEARQGESRTLEMVARALLERRVLAFEYRSGGSKNWRPKELLVYFLEANRANLGLYAIGYERTYHRAVLTFKLSRMRHARLLDESYEIPQDFDPNAYLRRAWGVVGVREKGVEVRLRFAPEAAWRVLEGDYPGLHLEEELPDGSLLARLEAAPFKGGVPWEVLAWVQSFGPRVEVLSPPELRRLWLEEAERVLALYGNRQEVSGSPPKVRA
>NC_006462.1|WP_011229119.1|188502_189447_-|hypothetical-protein
MKRNAWEVYGEVLKTARELGLEGEEQEVAKALLAWPKERFHALAARVGLKAKYLRHDLLPIAFLPEPLREALQGGLPLREAHRLHRLLKRGELSLQDLTGKDPKALMALPARPGEVDPRLPVWFFPPEPWEEALPMAVARALVQLYTREGELVLDPMAGRGTVVEAARALDRRAWGGDIAPRGPLVERADIRDLPRRFRKEAALVVLHPPTFSTWLREEGYREEAEERYGEYIRHISSFLDLCRPTLAPGGKLVLVARPRRTLTPKDLEAGHDFFLAPWERALAEADFRPLSYHLAVSQDGRQDWHLFVGEPRG
>NC_006462.1|WP_011229109.1|202081_202834_-|LamB/YcsF-family-protein
MKVDLNADAGESYGAFAYGHDREIFPLVSSANLACGFHGGSPGRILEAVRLAKAHGVAVGAHPGFPDLVGFGRREMALSPEEVYADVLYQIGALSAFLKAEGLPLHHVKPHGALYLKACRDRETARAIALAVKAFDPGLPLVVLPGTVYEEEARKAGLRVVLEAFPERAYLRSGQLAPRSMPGSWITDPEEAARRALRMVLEGKVEALDGGEVAVRADTLCIHGDNPNAPEVARAVREALEQAGVEVRAF
>NC_006462.1|WP_011229108.1|202861_203707_-|formate-dehydrogenase-accessory-sulfurtransferase-FdhD
MKGKARVRVARLEGGRWREVRDEVAAEAPLEIRLRYRDEVASLGVVLRTPGQDAELAAGLLYTEGLLQDPKEVLAIAPCADGSLPPEAREGVIQVFLRHPLPPPPRRHLALTAACGACGREALPDPGRLGLSPPPPLAVDPDLLLALPERLGEAQRLFRATGGLHAAALFDREGRLVALREDVGRHNALDKLIGWAFLQGKLPLHDHILLVSGRAGYELLVKAVAAGIPVFCAVSAPTSLAVALAQAYGLTLVGFLRPGRMNVYAGRERVGPPRGLPNPCG
>NC_006462.1|WP_011229107.1|203703_205989_-|FdhF/YdeP-family-oxidoreductase
MAWLNPFWSSPKAYVRPPKRGLAPELWASRIPFTHLENFYEVFRALWENRDNLPYAWRILKDGVCDGCALGTSGLEDWTLHGVHLCNVRLRLLRLNTLPPLDPKVLEDVEALKGRKSRELRRLGRLPYPMLRRKGERGFRRVSWDEAMGLATEYLRRHLPEGAFFYLTSRGVPNETYYVVQKAVRALGCNHVDNAARICHSPSTVVLKEALGVAATTCSYTDLIGTDLVVFLGSNVANNQPVMMKYLYHAKKAGTKVAVVNPYREPGMERYFVPSDLESALFGTRIADRFFQILPGGDIAFLHGAAKWMLEEGWVDPGFIRAHTAGFEAYKALLEAIPFAELEKAAGVSREEMRAFAEMVGRAERAVFVWGMGITQHTHGEDNVRAIVNLALLKGFVGREGCGLMPIRGHSGVQGGAEMGAYATAFPGGLPVNPENARRLAELWGFPVPDRPGLTTPEALDRALEGRLGVLWAIGGDFREVMPDPEAVEEALRRVPLRVHQDIVLSSQMLLEPGECVLLLPATTRYEVPGGVTETSTERRVIFSPEIPGPRPPEARPEWEVFQELVHRLRPELKDRFRFASTAEIREEIARVIPLYEGIQRFKAKGDQFQYGGRRLCEGWRFPTPDGKAHFRPVPLPQKEVPEGAFRVVTRRGKQFNSIVHEDQDPLTGAFRDAVYMNPKDAARLGLKPGDPVVLENAFGRYAGRVYLAEVKEGTLEVHWPEGNVLVDPKARSPLAHIPAYKEILAHLRRGEAEAPSPLRP
>NC_006462.1|WP_164926118.1|206339_207572_+|LamG-domain-containing-protein
MRYRLICWMLLGWFIAGYGYAQIRGGAETARFEPGDRILYQEDLSGTPIGSQVEGWEILQGSYEVAEFQDRRWFRPLAYNTHILRRMDFPQDFSVEFTTYLFEPGEAELRVFLHTEEDIKRGVGPDGYAQVYLKIFRTGNRDGFWFATWNATNRRWQVVVEDPRRLPPDTPHNVALQVRGGRLNLFIDGERVATTPFRPDAPLRAISFRFLSRKGHELPYKDRPALLDGIRIAGYSRPVGRATGGVFLYWMFPGGQENLPQLQAAQNQTISSSTALDALGGEPRTVEGTLVPVDLPANPFAPGEVRVRAEGQAWQAFVRRLRADLEAVRQAGGGLIIVGDGGDGRTERERRLLANQRAIAFAAWLARQGIGNPQNLLSIVADNGGYESIFFVVNNGGYRGIVSLRMQPRR
>NC_006462.1|WP_164926128.1|207849_210417_+|HEAT-repeat-domain-containing-protein
MVERLQHIYGMIAPALAVMDPPLAETLFVRVPLTWATSDDAIRRKQGLAVLILSWELFFGYEQQEILLQALPSVLAQAATWPEEAFEAILSFLADRVTLSSEAHLPDSLPEAFVERLRRHQGNYAWRLPDILALDTTETGTDRLIAWAQSPPPLPPSLAAYRQRWREAFLAKLDGRRLTLEQKRRVVALLSDPGLRDAVFRLVRTWRHRGEPLPPPPPESLPLLEEWAVREHCEEAVRLLAAAGQEGLTRLFRVAMEDLRDRDAPIREPRPCEWDRWSALFAHAEAIADRIGAAYREGPTPRLLRLLARAGRWEVVLEALSSPEAALRREAAFLLALAVAPEEDALARTGDAGQGQALVASWQKRPELHPRAREALRQALRDEDPNVQREALRALLFLGDETAWPVLLAALRVENENRFQTFLSGFRPALTDSLARALAEVARGDPSEALRRRAVVLLGRAEPGPWQAAVEPVLQQLLRDPDQEVRRAAAEYFAAVPAREVATTAALLEATRDAHMYVRHAAAIALGLARGWTPELVDRLEVRLREGDPDANVVRALEDAYPHALRRAPGAVDRLLAIVLERKGPARWRKALAEGPQADAAVAWELLKRLEARPLKDWAPVPPGFGPGLLQRMVEFFVRAEEDPPPLGIIGHLVPREMLDPFLIRRALEDPEASLGHRLWLIQQALEIPEDLREGVWQLLMQALREEEGGEMTLALLGRWGFDGVRRLVEELWGEPETLRHVARHLRQQEELGKLQMAAGNVGGPRLPEPTAEDLPWVEATLARLAPGARDPRLEPLVDLLGLWNLGNDSALRKAAFRYRIPQLLLRHLADPHECRAVAEVVGSLFGRGVTPRCR
>NC_006462.1|WP_011229102.1|212350_212731_-|ParA-family-protein
MKGYGVVVVDTPPALRSEALEAVLRAADYAVLPTPPAPLDLEALVETVRKAVRPLGVAYRVLLTRVDPRSLGEALEAQTALMEAGVPAFHAFVRAYKAHERAALDGKPITRWRGPNAREGRVRIYV
>NC_006462.1|WP_008633600.1|212787_213243_-|PIN-domain-containing-protein
MPPSPVRLHRLFLDANVLFAACWQEGRAQALLELAPRAKVLLLTSPHALEEARRNLEAKRPEALECLQRIRERVQTVPEAPMALVRKALAEGLPLKDAPILAAAWKAGAEALVTGDRRHFGHLMGKRVRGLWVVSLAEALAGVMGLLEDKG
>NC_006462.1|WP_008633599.1|213223_213466_-|AbrB/MazE/SpoVT-family-DNA-binding-domain-containing-protein
MELAKLSRKGQLSIPKRLLKALGVEGEAYFLVELAPEGGLLLRPAGVYPLEVYTEERLQELLAEDTLTEEERARLAALAR
>NC_006462.1|WP_008630619.1|213741_214431_-|IS5-like-element-ISTth7-family-transposase
MRPSWRGFPGNWRPISPRSPRRKAKRLRTRRRHTWRRFPPLYLMDTTGLAYRSKDRLLRFRRGKEVRRVRGHARLLALMRWDRERRLLWPWGGVVGEGYAPDPRLGGEVLRRFPPSRGWLLADAGFDGKEVWGVLGEAGVRPVIRLRGGGEAREEARVRAREGWDPEVYRFRGVVEGVFGGMKTRLGGGYLWERKPWTAMARALLELIAYGLRVLLSLLPPPPGYKAIY
>NC_006462.1|WP_011229099.1|215118_215520_+|acyl-CoA-thioesterase
MRETRMVYPVFPGETNHYGTLFGGTVLAWMDQAAFVAATRHARKKVVTVHADAVDFKRPVPLGAIVELVARLKEVGRTSMRVEVEMWVEPVKEGEEAYLAARGGFVLVAVDERGRPSPVPPLEGGEAHAPHGP

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_006462_9

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_006462_9

227324-228238

Unclear

Consensus_repeat	Method
GTTTCAATCCTCTACGAGGCTGACGGGGTTTGCAACG	CRISPRCasFinder
GTTTCAATCCTCTACGAGGCTGACGGGGTTTGCAAC	CRT
GTTTCAATCCTCTACGAGGCTGACGGGGTTTGCAAC	PILER-CR

12 spacers

cas2,cas1,cas4,WYL,cas8b5,cas5,cas3,cas6

The CRISPR arrays of NC_006462_9

>merge|NC_006462|9|227324-228238|CRISPRCasFinder,CRT,PILER-CR
TGGCCAATCCTCTACGAGGCTAACGAGGTTTGCAACCATCGCTGTTCACCCTCCTTTCGGCCTTCATCCTATGTTTCAATCCTCTACGAGGCTGACGAGGTTTGCAACTCCCAAGGGGGGGCTTCACCCCGCGAACAACGCACTCGCCGTTTCAATCCTCTACGAGGCTGACGGGGTTTGCAACGGGGCTCACCCCCCAACCCCATACCCCCCCGGATGGGTTTCAATCCTCTACGAGGCTGACGGGGTTTGCAACGGAGTCCGGCGATGAGGGCGTAGAAGCGCCCATTCCTGTTTCAATCCTCTACGAGGCTGACGGGGTTTGCAACGCGGATAGGGCATAGCGATAGGGTGGCCGTAGTGGGGTTTCAATCCTCTACGAGGCTGACGGGGTTTGCAACGGGTACATCACATGGGCGGACGTGGTGAAGAGGAGGGTTTCAATCCTCTACGAGGCTGACGGGGTTTGCAACCCAAAAGACCAAAAGGGCGATAAGGATGCTTATCACTCAGTTTCAATCCTCTACGAGGCTGACGGGGTTTGCAACCAGGAGGGCCGCCGGGGAGTAGCTGGGCTGGGCCCGGTTTCAATCCTCTACGAGGCTGACGGGGTTTGCAACGCTGGTGGACGAGCTGGCTGAGGGGCTTCCCAAGCCGTTTCAATCCTCTACGAGGCTGACGGGGTTTGCAACGGAGGCCCCCCTGGACTGGAGAGAGGGGTATCGGCTGTTTCAATCCTCTACGAGGCTGACGGGGTTTGCAACGTGGCAGCGGTGCCAGATTGACAACGTGGACTACAACGTTTCAATCCTCTACGAGGCTGACGGGGTTTGCAACAGGATTAGGTTGTGCTGTTCAGCCTCCCTTTCCACAACCCAGTTTCAATCCTCTACGAGGCTGACGGGGTTTGCAACG

>NC_006462|9|8|227324-228238|CRISPRCasFinder
TGGCCAATCCTCTACGAGGCTAACGAGGTTTGCAACC	ATCGCTGTTCACCCTCCTTTCGGCCTTCATCCTAT
GTTTCAATCCTCTACGAGGCTGACGAGGTTTGCAACT	CCCAAGGGGGGGCTTCACCCCGCGAACAACGCACTCGCC
GTTTCAATCCTCTACGAGGCTGACGGGGTTTGCAACG	GGGCTCACCCCCCAACCCCATACCCCCCCGGATGG
GTTTCAATCCTCTACGAGGCTGACGGGGTTTGCAACG	GAGTCCGGCGATGAGGGCGTAGAAGCGCCCATTCCT
GTTTCAATCCTCTACGAGGCTGACGGGGTTTGCAACG	CGGATAGGGCATAGCGATAGGGTGGCCGTAGTGGG
GTTTCAATCCTCTACGAGGCTGACGGGGTTTGCAACG	GGTACATCACATGGGCGGACGTGGTGAAGAGGAGG
GTTTCAATCCTCTACGAGGCTGACGGGGTTTGCAACC	CAAAAGACCAAAAGGGCGATAAGGATGCTTATCACTCA
GTTTCAATCCTCTACGAGGCTGACGGGGTTTGCAACC	AGGAGGGCCGCCGGGGAGTAGCTGGGCTGGGCCCG
GTTTCAATCCTCTACGAGGCTGACGGGGTTTGCAACG	CTGGTGGACGAGCTGGCTGAGGGGCTTCCCAAGCC
GTTTCAATCCTCTACGAGGCTGACGGGGTTTGCAACG	GAGGCCCCCCTGGACTGGAGAGAGGGGTATCGGCT
GTTTCAATCCTCTACGAGGCTGACGGGGTTTGCAACG	TGGCAGCGGTGCCAGATTGACAACGTGGACTACAAC
GTTTCAATCCTCTACGAGGCTGACGGGGTTTGCAACA	GGATTAGGTTGTGCTGTTCAGCCTCCCTTTCCACAACCCA
GTTTCAATCCTCTACGAGGCTGACGGGGTTTGCAACG

>NC_006462|9|8|227324-228237|CRT
TGGCCAATCCTCTACGAGGCTAACGAGGTTTGCAAC	CATCGCTGTTCACCCTCCTTTCGGCCTTCATCCTAT
GTTTCAATCCTCTACGAGGCTGACGAGGTTTGCAAC	TCCCAAGGGGGGGCTTCACCCCGCGAACAACGCACTCGCC
GTTTCAATCCTCTACGAGGCTGACGGGGTTTGCAAC	GGGGCTCACCCCCCAACCCCATACCCCCCCGGATGG
GTTTCAATCCTCTACGAGGCTGACGGGGTTTGCAAC	GGAGTCCGGCGATGAGGGCGTAGAAGCGCCCATTCCT
GTTTCAATCCTCTACGAGGCTGACGGGGTTTGCAAC	GCGGATAGGGCATAGCGATAGGGTGGCCGTAGTGGG
GTTTCAATCCTCTACGAGGCTGACGGGGTTTGCAAC	GGGTACATCACATGGGCGGACGTGGTGAAGAGGAGG
GTTTCAATCCTCTACGAGGCTGACGGGGTTTGCAAC	CCAAAAGACCAAAAGGGCGATAAGGATGCTTATCACTCA
GTTTCAATCCTCTACGAGGCTGACGGGGTTTGCAAC	CAGGAGGGCCGCCGGGGAGTAGCTGGGCTGGGCCCG
GTTTCAATCCTCTACGAGGCTGACGGGGTTTGCAAC	GCTGGTGGACGAGCTGGCTGAGGGGCTTCCCAAGCC
GTTTCAATCCTCTACGAGGCTGACGGGGTTTGCAAC	GGAGGCCCCCCTGGACTGGAGAGAGGGGTATCGGCT
GTTTCAATCCTCTACGAGGCTGACGGGGTTTGCAAC	GTGGCAGCGGTGCCAGATTGACAACGTGGACTACAAC
GTTTCAATCCTCTACGAGGCTGACGGGGTTTGCAAC	AGGATTAGGTTGTGCTGTTCAGCCTCCCTTTCCACAACCCA
GTTTCAATCCTCTACGAGGCTGACGGGGTTTGCAAC

>NC_006462|9|6|227396-228237|PILER-CR
GTTTCAATCCTCTACGAGGCTGACGAGGTTTGCAAC	TCCCAAGGGGGGGCTTCACCCCGCGAACAACGCACTCGCC
GTTTCAATCCTCTACGAGGCTGACGGGGTTTGCAAC	GGGGCTCACCCCCCAACCCCATACCCCCCCGGATGG
GTTTCAATCCTCTACGAGGCTGACGGGGTTTGCAAC	GGAGTCCGGCGATGAGGGCGTAGAAGCGCCCATTCCT
GTTTCAATCCTCTACGAGGCTGACGGGGTTTGCAAC	GCGGATAGGGCATAGCGATAGGGTGGCCGTAGTGGG
GTTTCAATCCTCTACGAGGCTGACGGGGTTTGCAAC	GGGTACATCACATGGGCGGACGTGGTGAAGAGGAGG
GTTTCAATCCTCTACGAGGCTGACGGGGTTTGCAAC	CCAAAAGACCAAAAGGGCGATAAGGATGCTTATCACTCA
GTTTCAATCCTCTACGAGGCTGACGGGGTTTGCAAC	CAGGAGGGCCGCCGGGGAGTAGCTGGGCTGGGCCCG
GTTTCAATCCTCTACGAGGCTGACGGGGTTTGCAAC	GCTGGTGGACGAGCTGGCTGAGGGGCTTCCCAAGCC
GTTTCAATCCTCTACGAGGCTGACGGGGTTTGCAAC	GGAGGCCCCCCTGGACTGGAGAGAGGGGTATCGGCT
GTTTCAATCCTCTACGAGGCTGACGGGGTTTGCAAC	GTGGCAGCGGTGCCAGATTGACAACGTGGACTACAAC
GTTTCAATCCTCTACGAGGCTGACGGGGTTTGCAAC	AGGATTAGGTTGTGCTGTTCAGCCTCCCTTTCCACAACCCA
GTTTCAATCCTCTACGAGGCTGACGGGGTTTGCAAC

Protein	Signature genes	Signature genes Name	Protein_function
NC_006462.1\|WP_011229078.1\|234738_235653_+\|hypothetical-protein	cas5	cls000047_cas5_CAS-I-B	unknown
NC_006462.1\|WP_011174371.1\|228476_228761_-\|CRISPR-associated-endonuclease-Cas2	cas2	cd09725_cas2_CAS-I:CAS-II:CAS-III:CAS-V	gnl\|CDD\|187856
NC_006462.1\|WP_024118773.1\|230675_231659_+\|WYL-domain-containing-protein	WYL	pfam13280_WYL_CAS-I:CAS-III	gnl\|CDD\|379100
NC_006462.1\|WP_164926129.1\|226782_227091_-\|antibiotic-biosynthesis-monooxygenase	unknown	unknown	gnl\|CDD\|225209
NC_006462.1\|WP_164926120.1\|228757_229735_-\|CRISPR-associated-endonuclease-Cas1	cas1	cd09634_cas1_CAS-I:CAS-II:CAS-III:CAS-V	gnl\|CDD\|187766
NC_006462.1\|WP_011229077.1\|235619_238073_+\|CRISPR-associated-helicase-Cas3'	cas3	cd09639_cas3_CAS-I	gnl\|CDD\|224124
NC_006462.1\|WP_011229088.1\|223369_224146_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224045
NC_006462.1\|WP_008633012.1\|240848_241262_-\|type-II-toxin-antitoxin-system-VapC-family-toxin	unknown	unknown	gnl\|CDD\|224761
NC_006462.1\|WP_011229082.1\|229725_230310_-\|CRISPR-associated-protein-Cas4	cas4	cd09637_cas4_CAS-I:CAS-II:CAS-V	gnl\|CDD\|273040
NC_006462.1\|WP_011227798.1\|239305_240526_-\|IS256-like-element-ISTth4-family-transposase	unknown	unknown	gnl\|CDD\|307151
NC_006462.1\|WP_011229087.1\|224138_225164_-\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223682
NC_006462.1\|WP_011229092.1\|220782_220968_+\|hypothetical-protein	unknown	unknown	unknown
NC_006462.1\|WP_011229094.1\|219417_220035_+\|anti-sigma-E-factor	unknown	unknown	gnl\|CDD\|237558
NC_006462.1\|WP_011229076.1\|238072_238867_+\|CRISPR-associated-endoribonuclease-Cas6	cas6	cd09652_cas6_CAS-I:CAS-III	gnl\|CDD\|273848
NC_006462.1\|WP_011229093.1\|220113_220734_+\|ferritin-like-domain-containing-protein	unknown	unknown	gnl\|CDD\|372666
NC_006462.1\|WP_011229085.1\|226169_226790_-\|DUF3386-family-protein	unknown	unknown	gnl\|CDD\|371771
NC_006462.1\|WP_011229086.1\|225267_226173_-\|hemin-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|238569
NC_006462.1\|WP_011229080.1\|231676_233977_+\|hypothetical-protein	cas8b5	mkCas0131_cas8b5_CAS-I-B	gnl\|CDD\|235175
NC_006462.1\|WP_011229091.1\|221277_222462_-\|c-type-cytochrome	unknown	unknown	gnl\|CDD\|226019
NC_006462.1\|WP_011229089.1\|223065_223380_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NC_006462.1\|WP_011174371.1\|228476_228761_-\|CRISPR-associated-endonuclease-Cas2	gnl\|CDD\|187856	cd09725, Cas2_I_II_III, CRISPR/Cas system-associated protein Cas2. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas2 is present in majority of CRISPR/Cas systems along with Cas1; RNAse specific to U-rich regions; Possesses an RRM/ferredoxin fold.	1.78454e-25
NC_006462.1\|WP_024118773.1\|230675_231659_+\|WYL-domain-containing-protein	gnl\|CDD\|379100	pfam13280, WYL, WYL domain. WYL is a Sm-like SH3 beta-barrel fold containing domain. It is a member of the WYL-like superfamily, named for three conserved amino acids found in a subset of the superfamily. However, these residues are not strongly conserved throughout the family. Rather, the conservation pattern includes four basic residues and a position often occupied by a cysteine, which are predicted to line a ligand-binding groove typical of the Sm-like SH3 beta-barrels. A WYL domain protein (sll7009) is a negative regulator of the I-D CRISPR-Cas system in Synechocystis sp. It is predicted to be a ligand-sensing domain that could bind negatively charged ligands, such as nucleotides or nucleic acid fragments, to regulate CRISPR-Cas and other defense systems such as the abortive infection AbiG system.	2.4479e-40
NC_006462.1\|WP_164926129.1\|226782_227091_-\|antibiotic-biosynthesis-monooxygenase	gnl\|CDD\|225209	COG2329, COG2329, Uncharacterized enzyme involved in biosynthesis of extracellular polysaccharides [General function prediction only].	2.17455e-29
NC_006462.1\|WP_164926120.1\|228757_229735_-\|CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|187766	cd09634, Cas1_I-II-III, CRISPR/Cas system-associated protein Cas1. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas1 is the most universal CRISPR system protein thought to be involved in spacer integration; Cas1 is metal-dependent deoxyribonuclease, also binds RNA; Shown to possess a unique fold consisting of a N-terminal beta-strand domain and a C-terminal alpha-helical domain.	2.95301e-114
NC_006462.1\|WP_011229077.1\|235619_238073_+\|CRISPR-associated-helicase-Cas3'	gnl\|CDD\|224124	COG1203, COG1203, CRISPR-associated helicase Cas3 [Defense mechanisms].	2.57584e-43
NC_006462.1\|WP_011229088.1\|223369_224146_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224045	COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism].	7.40186e-86
NC_006462.1\|WP_008633012.1\|240848_241262_-\|type-II-toxin-antitoxin-system-VapC-family-toxin	gnl\|CDD\|224761	COG1848, COG1848, Predicted nucleic acid-binding protein, contains PIN domain [General function prediction only].	7.21335e-08
NC_006462.1\|WP_011229086.1\|225267_226173_-\|hemin-ABC-transporter-substrate-binding-protein	gnl\|CDD\|238569	cd01149, HutB, Hemin binding protein HutB. These proteins have been shown to function as initial receptors in ABC transport of hemin and hemoproteins in many eubacterial species. They belong to the TroA superfamily of periplasmic metal binding proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind the metal ion in the cleft between these domains.	7.32494e-84
NC_006462.1\|WP_011227798.1\|239305_240526_-\|IS256-like-element-ISTth4-family-transposase	gnl\|CDD\|307151	pfam00872, Transposase_mut, Transposase, Mutator family.	1.06039e-89
NC_006462.1\|WP_011229087.1\|224138_225164_-\|iron-ABC-transporter-permease	gnl\|CDD\|223682	COG0609, FepD, ABC-type Fe3+-siderophore transport system, permease component [Inorganic ion transport and metabolism].	1.48972e-78
NC_006462.1\|WP_011229094.1\|219417_220035_+\|anti-sigma-E-factor	gnl\|CDD\|237558	PRK13920, PRK13920, putative anti-sigmaE protein; Provisional.	3.85142e-70
NC_006462.1\|WP_011229076.1\|238072_238867_+\|CRISPR-associated-endoribonuclease-Cas6	gnl\|CDD\|273848	TIGR01877, CRISPR-associated_endoribonuclease_Cas6_1, CRISPR-associated endoribonuclease Cas6. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This broadly distributed, highly divergent Cas family is now characterized as an endoribonuclease that generates guide RNAs for host defense against phage and other invaders. The family contains a C-terminal motif GXGXXXXXGXG, where the each X between two Gly is hydrophobic and the spacer XXXXX contains (usually) one Arg or Lys. The seed alignment for the current version of this model has gappy columns removed. Members of this protein family are found associated with several different CRISPR/cas system subtypes, and consequently we designate this family Cas6.	5.35996e-33
NC_006462.1\|WP_011229093.1\|220113_220734_+\|ferritin-like-domain-containing-protein	gnl\|CDD\|372666	pfam13668, Ferritin_2, Ferritin-like domain. This family contains ferritins and other ferritin-like proteins such as members of the DPS family and bacterioferritins.	5.40366e-30
NC_006462.1\|WP_011229085.1\|226169_226790_-\|DUF3386-family-protein	gnl\|CDD\|371771	pfam11866, DUF3386, Protein of unknown function (DUF3386). This family of proteins are functionally uncharacterized. This protein is found in bacteria and eukaryotes. Proteins in this family are about 220 amino acids in length.	1.26368e-19
NC_006462.1\|WP_011229082.1\|229725_230310_-\|CRISPR-associated-protein-Cas4	gnl\|CDD\|273040	TIGR00372, conserved_hypothetical_protein, CRISPR-associated protein Cas4. This model represents a family of proteins associated with CRISPR repeats in a wide set of prokaryotic genomes. This scope of this model has been broadened since it was first built to describe an archaeal subset only. The function of the protein is undefined. Distantly related proteins, excluded from this model, include ORFs from Mycobacteriophage D29 and Sulfolobus islandicus filamentous virus and a region of the Schizosaccharomyces pombe DNA replication helicase Dna2p.	2.12986e-36
NC_006462.1\|WP_011229080.1\|231676_233977_+\|hypothetical-protein	gnl\|CDD\|235175	PRK03918, PRK03918, DNA double-strand break repair ATPase Rad50.	3.28983e-06
NC_006462.1\|WP_011229091.1\|221277_222462_-\|c-type-cytochrome	gnl\|CDD\|226019	COG3488, COG3488, Predicted thiol oxidoreductase [Energy production and conversion].	8.85241e-116

>NC_006462.1|WP_164926129.1|226782_227091_-|antibiotic-biosynthesis-monooxygenase
MNRIPVRPEYAEQFEEAFRQRARLVDRMPGFIRNLVLRPKNPGDPYVVMTLWESEEAFRAWTESPAFKEGHARSGTLPKEAFLGPNRLEAFEVVLDSEGRDG
>NC_006462.1|WP_011229085.1|226169_226790_-|DUF3386-family-protein
MVETPPAWVLLKRARERIYTLPPDFPGFRARLGLCLDGVWYVGAVEAEGFAPKTLGLFGEAGAIAEKELGSLLGHRRPAPFEEGEGRYPMRLFAEGPLGTGIALEDPFRSRIWVKEGRLALIERHLPEGSFRIHLETWREVGERLLPHRFLLVHRDPRGHLLKVERFRDEYAQVGPYWLPVEREVVVEGEGLGVLVLRLEEVEVKG
>NC_006462.1|WP_011229086.1|225267_226173_-|hemin-ABC-transporter-substrate-binding-protein
MRRLLLLLGVFGALASAQSYRVVDARGKVVEVRSVERIVSLDGITTEILFALGVGEKVVGRDDSSYYPPEAQRLPSVGYQFRLSAEGILSLKPTLVIGREDVRPKEVVEQLERAGVAVVLVPTEPSVEGAKAKIRTVAQAVGRVEQGEALVRALERDLLLLRAFQAQHAAKGKLRALFLYLRGPGTTFVCGEGSTPVGVMELAGLENAAKGIRECQPMTAESVVAARPEVIVVFKKGLESVGGLEGLLKLPGVAQTPAGQKRKVVAMDDLYLGSFGPRAGRAALDLFRAAYLQEGFVEVGP
>NC_006462.1|WP_011229087.1|224138_225164_-|iron-ABC-transporter-permease
MVGLFPRFRRYRLALLGFSLALPLTLLLGAGLGAYPIPPLAIPGILLRGEGVEYQVLVALRLPRVLGAAVVGGLLALAGAVLQGLFRNPLVDPGLIGVSSGAALGAALFIVLVPGAGPLEVYALPLFAFLGGLLATSLLWRLAQSPWGTQVTILLLSGIALNALVGAGIGLLTFLATEEELRSLTFWTLGGFSALTWRLLLVGVPFAFLAFALLLPLARPLNALALGEREAFHLGIDLERLKRRAVAGAALGVGVAVALAGGVGFLGLVAPHLFRLLAGPDHRYLLPGSALLGGSLAVLADLLARTLAAPAEIPVGVVTALLGGPFFLYLVLRHKREVYRA
>NC_006462.1|WP_011229088.1|223369_224146_-|ABC-transporter-ATP-binding-protein
MLKVQNLGYRVGERWLLRGVDLAVGEGEFLAVLGPNGSGKTTLLRLLAGELRPTEGEVFLLGEPLAVYGPQALARQRAVLSQVREMAFPYTAYEVAFLGRLPHLVGRERPLDHRKTLEALERVRALSLKERLFPSLSGGEAMRVEVARLLNQEARLLLDEPTNHLDPRYALELLCLFRALAYEGKGVVAVLHDLNLAGLFADRVLLLKEGRAVAYGPPQAVLHPGLLEEVYEVAFSVLGQPGGPTFWVPLPREVVRGA
>NC_006462.1|WP_011229089.1|223065_223380_-|hypothetical-protein
MEPEHAEVVARLSEGRYLARCSCNGGTYHLHWDAATFRLTPEGLTFLAQVLEDLLAQGNDEGAVWLGSVGLRFRKGEGWGLLRLLRQGLLPGKEPPRALLRHLN
>NC_006462.1|WP_011229091.1|221277_222462_-|c-type-cytochrome
MGMRRLLLGLLPLLLAGLPARYLVQDASSRAFGHPLPGLPEEALEAFRLGDQAFQRVFVREDGLGPRFVHQSCAGCHVGDGRGRPLFAERSEALVRTRAPDGQSPHPLFGFQLQDHALPGHTPEGRVELYWEEVEGRYPDGTPYRLRRPRLRVLDPEGKPVPGAYSLRIAPPVFGAGLLEKVPEAAILALEDPQDQDGDGISGRAARLEGGLGRFGWKASTTSLLEQSALAYREDMGLSTPLFPEEGRAEVSEEELERVTFYVAHLAVPAPRHLPEDLRGKRLFREVGCASCHRERLGGLPAYTDLLLHDMGEALADGVAEGAASPAEWRTPPLWGIGLTRKVLGEEVYLHDGRAQSLEEAILWHGGEAEEAKRRFMALPKADREALLRFLRGL
>NC_006462.1|WP_011229092.1|220782_220968_+|hypothetical-protein
MEGLFYLAATGRLSELNQVGGNAQILLPPGFNGTSPVPGLTGDLLDLADRRMYRAKRRKKG
>NC_006462.1|WP_011229093.1|220113_220734_+|ferritin-like-domain-containing-protein
MERILARRQFMRVLTATGLSAAFAGSLLDRALAAHGGPSDADILQLALTAEYLAVDAYTKSLFGGFQGLVKDYLEAALTQEEAHVKALRDTLSALGVKPVEKPSFVYPVEFLPRNQLAILRLLNALEDAFVGAYLGALPLIQSKDVLKAAGAILGNEAAHRATVRASRILLGDQELPGPRSPADRAFEVAITPEEAQKAVSGFIRK
>NC_006462.1|WP_011229094.1|219417_220035_+|anti-sigma-E-factor
MSPEEVRELLPLYALGALTPEERARVEEALKRYPELWPEAKALLETAAELAAGLPQEPVPRGLEERVLRRIRPRRLPFLPLLARAAAVLAFLLVGYGAYFGLSWTLSLGAPTTRVYALVGPEGTPVGRAVVRGDGEALVVLKAPAPAGRVYQAWGLGKGDPVPLPTFRLPLKVVRLPEGAEALAVSLEPPGGSQRPTEILGLPRP
>NC_006462.1|WP_011174371.1|228476_228761_-|CRISPR-associated-endonuclease-Cas2
MRELYLVIAYDTPDDRRRARLAKLLKGFGERRQYSVFEARLTREQWAHLKGKLEALVNKEEDVLAVYFLPPEAVGRTWRIGHEGLKRLEDPDFV
>NC_006462.1|WP_164926120.1|228757_229735_-|CRISPR-associated-endonuclease-Cas1
MGVVYVLENEAYLSKEGGTLKVSRRAGREVLLQKPLIAVEEIVILGNAVVTPALLKHCAQEGVGIHYLSPTGTYYAGLTRTPSKNAPARVAQFKAYLEPTWKLALAQRFVLGKIRNGLVFLRRNGAEGWERLKEALLEAERAQDEEALRGAEGRAADLYFRAFAELLPEEFAFGERSRRPPRDPANSLLSLAYTLLAKECESALLVAGLDPYVGYLHEVRYGRPSLALDLMEEFRSVLADSVVLSLLNNRRVTLEDFDDSEGFPRLRKEAWPKFLRAWEGRLNERIQHPLLGKRLAYREILLAQARILVKHLLGELPRYEPFAVR
>NC_006462.1|WP_011229082.1|229725_230310_-|CRISPR-associated-protein-Cas4
MGHGGAVEYLPLSKVNTVVYCPRRFYLEYVLGEAHANHHLIEGHYLHERAYTEPGEESGLWVWSDRLGLLGVVDRLEWRRGEACPVEYKLGRAKEEAYLSDAVQLAAQALCLRESRGIKARRGFVYYHKSHTRREVVFTPELFRAVEAAVVRMRALLQSPRPPRVEVPPSKCEGCSVRGACQPELWRKGVAGWA
>NC_006462.1|WP_024118773.1|230675_231659_+|WYL-domain-containing-protein
MESRLPDFLRLLRESPKGLPVREIAARLGVRRQSVYRLRDKAQSLGVWVETHGENPEVPPGWMRLEAPLEVTVRLTLEEAEALRAAVERMEPLTPLAKRALERLALRTLAAPGKDRQDPVVYTPLADEYPPGLFERAVRAIRERRTCQVTYKNAKGEVKTYRFDPYALIARDPHLYLVGANHNSRRAGHDPVKDLRLDQILDLRLTRERFRKPRFDVRAYAQRRFRAFAGEGAPVRVRVRFSPEKAGFIRRTRRHPTQVVEDLPDGSVVWQVEVPLSEDLVHFIVGYGPHATVLEPEELRRRVVAWAKGAVAANEGVLSPEGVTGLD
>NC_006462.1|WP_011229080.1|231676_233977_+|hypothetical-protein
MERVMVQASTVARAKRLVADVRFGEAPREALLAYKEALDEPEFAAFLERIDPRIVRYLRVAPGGSQALSDPKGKDLLLYLHPLPGERQMRAAYEVAIEGFLEHLEAKGYPVVERGAGWVKAYVSPKAPSLDLEGAWKAYIEEAFSLEGLSARLLPLLNSVRLAGRGISAPKVPVPTLGARDFLAAWYLANLLSVKERLAWRDQEIRRLEEEASRLPEGSEKSRKLRELEKRRQDQEKELKKYGGELRKKWEEIVREEEKRAEKRRKLEERLQRAKPKDRPRLENELLALEPPLAEWALEGLEKAKDDPGRLWTWLDPESPEAPGAIQRLKPYLGRFGPLAKGQLNTAVGNKFTKILEELLRLLSLSSPDVEVPPLVSETPFALDLRDPGDKADVCYGCGRPLGKDKLKASKLVFASPSQRLQSGNGQEEPWVCPSCAALALLSPIKPGEGSVLVQVGSYGAPEAAKHFARLLVTGTLHVAAGRYLLLNSPQVGGKPLAQALGRVVYALQALGQEVNPKVLERFPFYLVEGAQEIPLPPRALWLSHVLQRAFASRPDEGGEVNRPLGEALRYALGDLPWHALYTLARRYGRVADRFSLEDGLMRYASLLEKEVGMKENTDLSQRFRDVAGLTGLLSAWVGYVEGQVGRNSQEAKRAVVKLLDNLERPGDFLYVAAYHLDSTQARLYEAGGAFFYQEAKRLLQEAGARAQEAEEGSGRFLTVSQDDLHRVYAHLAARYPGKAWEGFIYEVRLSLASRFPQYIRMEKEG
>NC_006462.1|WP_011229078.1|234738_235653_+|hypothetical-protein
MPPKEKRFSSATGGGRPWRRFGGWPRLLWRRTFRLWLPLPNMHAIALRIRPTSALTFRVLPGSILDIATYPFVPPTTLSGWLRRLFWAQEGLLPPDQREGNTPRFYVLPRRYLPLGAYPVGEWRVHRTHRHGPRAFTHSEFSRLRREGKPPKGGDLQLHTWEYLLAEEFLGAVLAEKEEDLRRLQGLVGYGAKLGKEGFAYLEAVGEPLEVRLEEGDAPFTPVRAEAWGGAIQGAYPLYRFRFGEAEDPDPASPDPSPVIGYEGAYFVLPRGRGLAKGFSLEGRFFAWDLVEFLWARASGGSSS
>NC_006462.1|WP_011229077.1|235619_238073_+|CRISPR-associated-helicase-Cas3'
MGEGIGRVFFLKDEVGFQPLSNHQGLVVKLLESWREGDEPLALSPKTKERLLLAARYHDDGKRFTFHIVPDGKGGLTYSFRGHRFRVAQAVQDPYAQALIRGHHDYSTREVVNLAADFLEEGLGHRFPEDLFLLMMADQLEAELAVRLWQRRAGEVRPFVEFDLLPDGEGGFLLDPWPFRVDEVALDFLVYFHPYRGEEAKVVEGWGRALVGALEEGKVPEAFREEKRRVRLRPWAAGARKADDPEAFYDRFGLKPTPFQREVFKVAEGDPAHLLLAPTGTGKTEAAAFPALARGERLVFVLPTRSLVDDLEGRFRCYLKILAQEEGRPKALVVDTGHRQARFRFSPDGQEEATKERHLYHADVILTTLDKLLYRYFGYAEGVKSYTFPRRIHDRRTLFVFDEVHLYEATAWVNFRHLIASLYKAGVRFLVMSATMPGTYREELLLEGTLEHPAAKRPSRVLRYMPQGNPMEIIQSHRGKRVLVVLEEVKEAAELYKRLKGEGVFLYHGRLAEGQRRRVFGEVKRRDKAQEPYLLITTPAIEVGVDLDAEVLVTTLCPPENLLQRLGRVNRRGGGQGEAYVVGETYPDYLGSLPEGYLELLKALDGQDLAQGGEERLRQAIRYPKYLDPRAETFFEALQDYVYGLDLTQEPLHRKGFVATRGWTPSVRLRQGEDEVEVPIDRLVGRKEELTPVRVVERLLTDGETGNRRREEVPLRSGELYGRELVLNYPYPYDPELGFVELPKVFQRLRHPDPQRVQLLYAPEKDAGEAPEGVMDTDQVTGGGRRVLWYLGESAWAEPAKSGEVAEETEEEEEEGD
>NC_006462.1|WP_011229076.1|238072_238867_+|CRISPR-associated-endoribonuclease-Cas6
MPQAVVLELVGEKPPLYPARYAHGLFFALLSRVSPELAQKLHEAPRKPFTLAPLPRAGPEGATLKGTLRLRLTTLDDGLFAPFLRALLEAAPDGLPLGDSSYRLARVLATREGHPLAGATSWEELKEAPKREKATFRFLTPTVFATSKPGGRTRYTPLPDPRLIAGSLLDKWQAHSPFPYNPKEEAALRELFELDLEVAGFRNLRFHRVQAGKGFFPGFTGEATLRLWSQSLEAQEALGRLHALAFFSGVGAKTPYGMGLAVPL
>NC_006462.1|WP_011227798.1|239305_240526_-|IS256-like-element-ISTth4-family-transposase
MFNRGAHLGTRRCPVDQDTLRILLREAVRETVAEVLQTVLELDRTAFLQVHGGRRNGYYPRKLETTFGQVDLKVPRDRESRYYPAFLKPYARRLVDVGEVAVALYAAGVSQRKAAEILSLLLGHRYSHETLSALTDEVLEAAGAFRTRPLPEEMAFVYLDGLSLKVFREGEGIVRESVYVALGIAPNGERRVLGFWLLPTESALGWEGVLGELWQRGLRRVLLFVTDGLPGLPEAIRRVYPQAEWQRCVVHGVRWSLSQVRSRDRALLAEDLRRVYGAESREEALGALEEVKAAWGSRYPGVVGLWVQDSGAFLRFYGYPKVLWPYLRSTNLMERFIRELRRGTKVRDHKFPKEEAVYKLLYLESERQEGRWAERKLKGFSEVKEVLEKMLQERYAPRTQTLTQSP
>NC_006462.1|WP_008633012.1|240848_241262_-|type-II-toxin-antitoxin-system-VapC-family-toxin
MIPERLVLDAGPLIALLHRSDPDHEEAVRGFRRLAEGGARLFLPMPVLFEVFKWLLFQAGPKAAREGLAKVEEGVVVVPFTLEDLEEVCLLLARLPGWGGTLEDTGVALLALRLGAPVWTLNYRDLGAFPALRFWTP

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NC_006462_10

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NC_006462_10

239108-239211

Unclear

Consensus_repeat	Method
GTTGCAAACCTCGTTAGCCTCGTAGAGGATTGA	CRISPRCasFinder

1 spacers

cas6,cas3,cas5,cas8b5,WYL,cas4,cas1,cas2

The CRISPR arrays of NC_006462_10

>merge|NC_006462|10|239108-239211|CRISPRCasFinder
GTTGCAAACCTCGTTAGCCTCGTAGAGGATTGAAACATGGACTTCCTGCACGAGCCCTTCGAGCTCGCCATGTTGCAAACCTCGTTAGCCTCGTAGAGGATTGA

>NC_006462|10|9|239108-239211|CRISPRCasFinder
GTTGCAAACCTCGTTAGCCTCGTAGAGGATTGA	AACATGGACTTCCTGCACGAGCCCTTCGAGCTCGCCAT
GTTGCAAACCTCGTTAGCCTCGTAGAGGATTGA

Protein	Signature genes	Signature genes Name	Protein_function
NC_006462.1\|WP_011229078.1\|234738_235653_+\|hypothetical-protein	cas5	cls000047_cas5_CAS-I-B	unknown
NC_006462.1\|WP_164926120.1\|228757_229735_-\|CRISPR-associated-endonuclease-Cas1	cas1	cd09634_cas1_CAS-I:CAS-II:CAS-III:CAS-V	gnl\|CDD\|187766
NC_006462.1\|WP_024119813.1\|244423_245263_-\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|132386
NC_006462.1\|WP_008633012.1\|240848_241262_-\|type-II-toxin-antitoxin-system-VapC-family-toxin	unknown	unknown	gnl\|CDD\|224761
NC_006462.1\|WP_011229068.1\|247777_248473_-\|4-oxalocrotonate-decarboxylase	unknown	unknown	gnl\|CDD\|226480
NC_006462.1\|WP_164926129.1\|226782_227091_-\|antibiotic-biosynthesis-monooxygenase	unknown	unknown	gnl\|CDD\|225209
NC_006462.1\|WP_011174371.1\|228476_228761_-\|CRISPR-associated-endonuclease-Cas2	cas2	cd09725_cas2_CAS-I:CAS-II:CAS-III:CAS-V	gnl\|CDD\|187856
NC_006462.1\|WP_011229077.1\|235619_238073_+\|CRISPR-associated-helicase-Cas3'	cas3	cd09639_cas3_CAS-I	gnl\|CDD\|224124
NC_006462.1\|WP_011229073.1\|243209_244172_+\|recombinase-XerD	unknown	unknown	gnl\|CDD\|227308
NC_006462.1\|WP_024118773.1\|230675_231659_+\|WYL-domain-containing-protein	WYL	pfam13280_WYL_CAS-I:CAS-III	gnl\|CDD\|379100
NC_006462.1\|WP_164926121.1\|241795_242710_-\|hypothetical-protein	unknown	unknown	unknown
NC_006462.1\|WP_011229071.1\|245273_245456_-\|hypothetical-protein	unknown	unknown	unknown
NC_006462.1\|WP_011229076.1\|238072_238867_+\|CRISPR-associated-endoribonuclease-Cas6	cas6	cd09652_cas6_CAS-I:CAS-III	gnl\|CDD\|273848
NC_006462.1\|WP_011229085.1\|226169_226790_-\|DUF3386-family-protein	unknown	unknown	gnl\|CDD\|371771
NC_006462.1\|WP_011229070.1\|245474_246251_-\|2-hydroxypenta-2,4-dienoate-hydratase	unknown	unknown	gnl\|CDD\|132264
NC_006462.1\|WP_011229082.1\|229725_230310_-\|CRISPR-associated-protein-Cas4	cas4	cd09637_cas4_CAS-I:CAS-II:CAS-V	gnl\|CDD\|273040
NC_006462.1\|WP_011229080.1\|231676_233977_+\|hypothetical-protein	cas8b5	mkCas0131_cas8b5_CAS-I-B	gnl\|CDD\|235175
NC_006462.1\|WP_008631365.1\|241258_241474_-\|ribbon-helix-helix-protein,-CopG-family	unknown	unknown	unknown
NC_006462.1\|WP_011227798.1\|239305_240526_-\|IS256-like-element-ISTth4-family-transposase	unknown	unknown	gnl\|CDD\|307151
NC_006462.1\|WP_011229069.1\|246258_247767_-\|aldehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143412

Protein	Function_ID	Function_description	E-value
NC_006462.1\|WP_164926120.1\|228757_229735_-\|CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|187766	cd09634, Cas1_I-II-III, CRISPR/Cas system-associated protein Cas1. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas1 is the most universal CRISPR system protein thought to be involved in spacer integration; Cas1 is metal-dependent deoxyribonuclease, also binds RNA; Shown to possess a unique fold consisting of a N-terminal beta-strand domain and a C-terminal alpha-helical domain.	2.95301e-114
NC_006462.1\|WP_024119813.1\|244423_245263_-\|alpha/beta-fold-hydrolase	gnl\|CDD\|132386	TIGR03343, 2-hydroxy-6-oxo-6-phenylhexa-24-dienoate_hydrolase, 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase. Members of this family are 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase, or HOPD hydrolase, the BphD protein of biphenyl degradation. BphD acts on the product of ring meta-cleavage by BphC. Many species carrying bphC and bphD are capable of degrading polychlorinated biphenyls as well as biphenyl itself.	1.45897e-40
NC_006462.1\|WP_008633012.1\|240848_241262_-\|type-II-toxin-antitoxin-system-VapC-family-toxin	gnl\|CDD\|224761	COG1848, COG1848, Predicted nucleic acid-binding protein, contains PIN domain [General function prediction only].	7.21335e-08
NC_006462.1\|WP_164926129.1\|226782_227091_-\|antibiotic-biosynthesis-monooxygenase	gnl\|CDD\|225209	COG2329, COG2329, Uncharacterized enzyme involved in biosynthesis of extracellular polysaccharides [General function prediction only].	2.17455e-29
NC_006462.1\|WP_011174371.1\|228476_228761_-\|CRISPR-associated-endonuclease-Cas2	gnl\|CDD\|187856	cd09725, Cas2_I_II_III, CRISPR/Cas system-associated protein Cas2. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas2 is present in majority of CRISPR/Cas systems along with Cas1; RNAse specific to U-rich regions; Possesses an RRM/ferredoxin fold.	1.78454e-25
NC_006462.1\|WP_011229077.1\|235619_238073_+\|CRISPR-associated-helicase-Cas3'	gnl\|CDD\|224124	COG1203, COG1203, CRISPR-associated helicase Cas3 [Defense mechanisms].	2.57584e-43
NC_006462.1\|WP_011229070.1\|245474_246251_-\|2-hydroxypenta-2,4-dienoate-hydratase	gnl\|CDD\|132264	TIGR03220, 2-hydroxypenta-24-dienoate_hydratase, 2-oxopent-4-enoate hydratase. Members of this protein family are 2-oxopent-4-enoate hydratase, which is also called 2-hydroxypent-2,4-dienoate hydratase. It is closely related to another gene found in the same operon, 4-oxalocrotonate decarboxylase, with which it interacts closely.	2.68893e-95
NC_006462.1\|WP_024118773.1\|230675_231659_+\|WYL-domain-containing-protein	gnl\|CDD\|379100	pfam13280, WYL, WYL domain. WYL is a Sm-like SH3 beta-barrel fold containing domain. It is a member of the WYL-like superfamily, named for three conserved amino acids found in a subset of the superfamily. However, these residues are not strongly conserved throughout the family. Rather, the conservation pattern includes four basic residues and a position often occupied by a cysteine, which are predicted to line a ligand-binding groove typical of the Sm-like SH3 beta-barrels. A WYL domain protein (sll7009) is a negative regulator of the I-D CRISPR-Cas system in Synechocystis sp. It is predicted to be a ligand-sensing domain that could bind negatively charged ligands, such as nucleotides or nucleic acid fragments, to regulate CRISPR-Cas and other defense systems such as the abortive infection AbiG system.	2.4479e-40
NC_006462.1\|WP_011229073.1\|243209_244172_+\|recombinase-XerD	gnl\|CDD\|227308	COG4974, XerD, Site-specific recombinase XerD [DNA replication, recombination, and repair].	5.02617e-08
NC_006462.1\|WP_011229076.1\|238072_238867_+\|CRISPR-associated-endoribonuclease-Cas6	gnl\|CDD\|273848	TIGR01877, CRISPR-associated_endoribonuclease_Cas6_1, CRISPR-associated endoribonuclease Cas6. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This broadly distributed, highly divergent Cas family is now characterized as an endoribonuclease that generates guide RNAs for host defense against phage and other invaders. The family contains a C-terminal motif GXGXXXXXGXG, where the each X between two Gly is hydrophobic and the spacer XXXXX contains (usually) one Arg or Lys. The seed alignment for the current version of this model has gappy columns removed. Members of this protein family are found associated with several different CRISPR/cas system subtypes, and consequently we designate this family Cas6.	5.35996e-33
NC_006462.1\|WP_011229085.1\|226169_226790_-\|DUF3386-family-protein	gnl\|CDD\|371771	pfam11866, DUF3386, Protein of unknown function (DUF3386). This family of proteins are functionally uncharacterized. This protein is found in bacteria and eukaryotes. Proteins in this family are about 220 amino acids in length.	1.26368e-19
NC_006462.1\|WP_011229068.1\|247777_248473_-\|4-oxalocrotonate-decarboxylase	gnl\|CDD\|226480	COG3971, COG3971, 2-keto-4-pentenoate hydratase [Secondary metabolites biosynthesis, transport, and catabolism].	1.39879e-28
NC_006462.1\|WP_011229082.1\|229725_230310_-\|CRISPR-associated-protein-Cas4	gnl\|CDD\|273040	TIGR00372, conserved_hypothetical_protein, CRISPR-associated protein Cas4. This model represents a family of proteins associated with CRISPR repeats in a wide set of prokaryotic genomes. This scope of this model has been broadened since it was first built to describe an archaeal subset only. The function of the protein is undefined. Distantly related proteins, excluded from this model, include ORFs from Mycobacteriophage D29 and Sulfolobus islandicus filamentous virus and a region of the Schizosaccharomyces pombe DNA replication helicase Dna2p.	2.12986e-36
NC_006462.1\|WP_011229080.1\|231676_233977_+\|hypothetical-protein	gnl\|CDD\|235175	PRK03918, PRK03918, DNA double-strand break repair ATPase Rad50.	3.28983e-06
NC_006462.1\|WP_011227798.1\|239305_240526_-\|IS256-like-element-ISTth4-family-transposase	gnl\|CDD\|307151	pfam00872, Transposase_mut, Transposase, Mutator family.	1.06039e-89
NC_006462.1\|WP_011229069.1\|246258_247767_-\|aldehyde-dehydrogenase	gnl\|CDD\|143412	cd07093, ALDH_F8_HMSADH, Human aldehyde dehydrogenase family 8 member A1-like. In humans, the aldehyde dehydrogenase family 8 member A1 (ALDH8A1) protein functions to convert 9-cis-retinal to 9-cis-retinoic acid and has a preference for NAD+. Also included in this CD is the 2-hydroxymuconic semialdehyde dehydrogenase (HMSADH) which catalyzes the conversion of 2-hydroxymuconic semialdehyde to 4-oxalocrotonate, a step in the meta cleavage pathway of aromatic hydrocarbons in bacteria. Such HMSADHs seen here are: XylG of the TOL plasmid pWW0 of Pseudomonas putida, TomC of Burkholderia cepacia G4, and AphC of Comamonas testosterone.	0

>NC_006462.1|WP_011229076.1|238072_238867_+|CRISPR-associated-endoribonuclease-Cas6
MPQAVVLELVGEKPPLYPARYAHGLFFALLSRVSPELAQKLHEAPRKPFTLAPLPRAGPEGATLKGTLRLRLTTLDDGLFAPFLRALLEAAPDGLPLGDSSYRLARVLATREGHPLAGATSWEELKEAPKREKATFRFLTPTVFATSKPGGRTRYTPLPDPRLIAGSLLDKWQAHSPFPYNPKEEAALRELFELDLEVAGFRNLRFHRVQAGKGFFPGFTGEATLRLWSQSLEAQEALGRLHALAFFSGVGAKTPYGMGLAVPL
>NC_006462.1|WP_011229077.1|235619_238073_+|CRISPR-associated-helicase-Cas3'
MGEGIGRVFFLKDEVGFQPLSNHQGLVVKLLESWREGDEPLALSPKTKERLLLAARYHDDGKRFTFHIVPDGKGGLTYSFRGHRFRVAQAVQDPYAQALIRGHHDYSTREVVNLAADFLEEGLGHRFPEDLFLLMMADQLEAELAVRLWQRRAGEVRPFVEFDLLPDGEGGFLLDPWPFRVDEVALDFLVYFHPYRGEEAKVVEGWGRALVGALEEGKVPEAFREEKRRVRLRPWAAGARKADDPEAFYDRFGLKPTPFQREVFKVAEGDPAHLLLAPTGTGKTEAAAFPALARGERLVFVLPTRSLVDDLEGRFRCYLKILAQEEGRPKALVVDTGHRQARFRFSPDGQEEATKERHLYHADVILTTLDKLLYRYFGYAEGVKSYTFPRRIHDRRTLFVFDEVHLYEATAWVNFRHLIASLYKAGVRFLVMSATMPGTYREELLLEGTLEHPAAKRPSRVLRYMPQGNPMEIIQSHRGKRVLVVLEEVKEAAELYKRLKGEGVFLYHGRLAEGQRRRVFGEVKRRDKAQEPYLLITTPAIEVGVDLDAEVLVTTLCPPENLLQRLGRVNRRGGGQGEAYVVGETYPDYLGSLPEGYLELLKALDGQDLAQGGEERLRQAIRYPKYLDPRAETFFEALQDYVYGLDLTQEPLHRKGFVATRGWTPSVRLRQGEDEVEVPIDRLVGRKEELTPVRVVERLLTDGETGNRRREEVPLRSGELYGRELVLNYPYPYDPELGFVELPKVFQRLRHPDPQRVQLLYAPEKDAGEAPEGVMDTDQVTGGGRRVLWYLGESAWAEPAKSGEVAEETEEEEEEGD
>NC_006462.1|WP_011229078.1|234738_235653_+|hypothetical-protein
MPPKEKRFSSATGGGRPWRRFGGWPRLLWRRTFRLWLPLPNMHAIALRIRPTSALTFRVLPGSILDIATYPFVPPTTLSGWLRRLFWAQEGLLPPDQREGNTPRFYVLPRRYLPLGAYPVGEWRVHRTHRHGPRAFTHSEFSRLRREGKPPKGGDLQLHTWEYLLAEEFLGAVLAEKEEDLRRLQGLVGYGAKLGKEGFAYLEAVGEPLEVRLEEGDAPFTPVRAEAWGGAIQGAYPLYRFRFGEAEDPDPASPDPSPVIGYEGAYFVLPRGRGLAKGFSLEGRFFAWDLVEFLWARASGGSSS
>NC_006462.1|WP_011229080.1|231676_233977_+|hypothetical-protein
MERVMVQASTVARAKRLVADVRFGEAPREALLAYKEALDEPEFAAFLERIDPRIVRYLRVAPGGSQALSDPKGKDLLLYLHPLPGERQMRAAYEVAIEGFLEHLEAKGYPVVERGAGWVKAYVSPKAPSLDLEGAWKAYIEEAFSLEGLSARLLPLLNSVRLAGRGISAPKVPVPTLGARDFLAAWYLANLLSVKERLAWRDQEIRRLEEEASRLPEGSEKSRKLRELEKRRQDQEKELKKYGGELRKKWEEIVREEEKRAEKRRKLEERLQRAKPKDRPRLENELLALEPPLAEWALEGLEKAKDDPGRLWTWLDPESPEAPGAIQRLKPYLGRFGPLAKGQLNTAVGNKFTKILEELLRLLSLSSPDVEVPPLVSETPFALDLRDPGDKADVCYGCGRPLGKDKLKASKLVFASPSQRLQSGNGQEEPWVCPSCAALALLSPIKPGEGSVLVQVGSYGAPEAAKHFARLLVTGTLHVAAGRYLLLNSPQVGGKPLAQALGRVVYALQALGQEVNPKVLERFPFYLVEGAQEIPLPPRALWLSHVLQRAFASRPDEGGEVNRPLGEALRYALGDLPWHALYTLARRYGRVADRFSLEDGLMRYASLLEKEVGMKENTDLSQRFRDVAGLTGLLSAWVGYVEGQVGRNSQEAKRAVVKLLDNLERPGDFLYVAAYHLDSTQARLYEAGGAFFYQEAKRLLQEAGARAQEAEEGSGRFLTVSQDDLHRVYAHLAARYPGKAWEGFIYEVRLSLASRFPQYIRMEKEG
>NC_006462.1|WP_024118773.1|230675_231659_+|WYL-domain-containing-protein
MESRLPDFLRLLRESPKGLPVREIAARLGVRRQSVYRLRDKAQSLGVWVETHGENPEVPPGWMRLEAPLEVTVRLTLEEAEALRAAVERMEPLTPLAKRALERLALRTLAAPGKDRQDPVVYTPLADEYPPGLFERAVRAIRERRTCQVTYKNAKGEVKTYRFDPYALIARDPHLYLVGANHNSRRAGHDPVKDLRLDQILDLRLTRERFRKPRFDVRAYAQRRFRAFAGEGAPVRVRVRFSPEKAGFIRRTRRHPTQVVEDLPDGSVVWQVEVPLSEDLVHFIVGYGPHATVLEPEELRRRVVAWAKGAVAANEGVLSPEGVTGLD
>NC_006462.1|WP_011229082.1|229725_230310_-|CRISPR-associated-protein-Cas4
MGHGGAVEYLPLSKVNTVVYCPRRFYLEYVLGEAHANHHLIEGHYLHERAYTEPGEESGLWVWSDRLGLLGVVDRLEWRRGEACPVEYKLGRAKEEAYLSDAVQLAAQALCLRESRGIKARRGFVYYHKSHTRREVVFTPELFRAVEAAVVRMRALLQSPRPPRVEVPPSKCEGCSVRGACQPELWRKGVAGWA
>NC_006462.1|WP_164926120.1|228757_229735_-|CRISPR-associated-endonuclease-Cas1
MGVVYVLENEAYLSKEGGTLKVSRRAGREVLLQKPLIAVEEIVILGNAVVTPALLKHCAQEGVGIHYLSPTGTYYAGLTRTPSKNAPARVAQFKAYLEPTWKLALAQRFVLGKIRNGLVFLRRNGAEGWERLKEALLEAERAQDEEALRGAEGRAADLYFRAFAELLPEEFAFGERSRRPPRDPANSLLSLAYTLLAKECESALLVAGLDPYVGYLHEVRYGRPSLALDLMEEFRSVLADSVVLSLLNNRRVTLEDFDDSEGFPRLRKEAWPKFLRAWEGRLNERIQHPLLGKRLAYREILLAQARILVKHLLGELPRYEPFAVR
>NC_006462.1|WP_011174371.1|228476_228761_-|CRISPR-associated-endonuclease-Cas2
MRELYLVIAYDTPDDRRRARLAKLLKGFGERRQYSVFEARLTREQWAHLKGKLEALVNKEEDVLAVYFLPPEAVGRTWRIGHEGLKRLEDPDFV
>NC_006462.1|WP_164926129.1|226782_227091_-|antibiotic-biosynthesis-monooxygenase
MNRIPVRPEYAEQFEEAFRQRARLVDRMPGFIRNLVLRPKNPGDPYVVMTLWESEEAFRAWTESPAFKEGHARSGTLPKEAFLGPNRLEAFEVVLDSEGRDG
>NC_006462.1|WP_011229085.1|226169_226790_-|DUF3386-family-protein
MVETPPAWVLLKRARERIYTLPPDFPGFRARLGLCLDGVWYVGAVEAEGFAPKTLGLFGEAGAIAEKELGSLLGHRRPAPFEEGEGRYPMRLFAEGPLGTGIALEDPFRSRIWVKEGRLALIERHLPEGSFRIHLETWREVGERLLPHRFLLVHRDPRGHLLKVERFRDEYAQVGPYWLPVEREVVVEGEGLGVLVLRLEEVEVKG
>NC_006462.1|WP_011227798.1|239305_240526_-|IS256-like-element-ISTth4-family-transposase
MFNRGAHLGTRRCPVDQDTLRILLREAVRETVAEVLQTVLELDRTAFLQVHGGRRNGYYPRKLETTFGQVDLKVPRDRESRYYPAFLKPYARRLVDVGEVAVALYAAGVSQRKAAEILSLLLGHRYSHETLSALTDEVLEAAGAFRTRPLPEEMAFVYLDGLSLKVFREGEGIVRESVYVALGIAPNGERRVLGFWLLPTESALGWEGVLGELWQRGLRRVLLFVTDGLPGLPEAIRRVYPQAEWQRCVVHGVRWSLSQVRSRDRALLAEDLRRVYGAESREEALGALEEVKAAWGSRYPGVVGLWVQDSGAFLRFYGYPKVLWPYLRSTNLMERFIRELRRGTKVRDHKFPKEEAVYKLLYLESERQEGRWAERKLKGFSEVKEVLEKMLQERYAPRTQTLTQSP
>NC_006462.1|WP_008633012.1|240848_241262_-|type-II-toxin-antitoxin-system-VapC-family-toxin
MIPERLVLDAGPLIALLHRSDPDHEEAVRGFRRLAEGGARLFLPMPVLFEVFKWLLFQAGPKAAREGLAKVEEGVVVVPFTLEDLEEVCLLLARLPGWGGTLEDTGVALLALRLGAPVWTLNYRDLGAFPALRFWTP
>NC_006462.1|WP_008631365.1|241258_241474_-|ribbon-helix-helix-protein,-CopG-family
MRVTIYLPDHLAQEVEAYRKARPGLSLSALVRELLERELVKRPEALLEVAGLVERAELSAREHDALIREER
>NC_006462.1|WP_164926121.1|241795_242710_-|hypothetical-protein
MKRWLLALTALVLVACSGLQGSEPPGASSPWREVSSGTSDTLTGVAYGNGVFVAVGGASGKSTILVSRDGQSWTRVSYDAQSFLNGIAYDNGLFVAVGFDETILTSPDGYSWTKVHGTGSALQYLNGVAYGGGRWVATGAFSQLLVSQDAGASAWQRVNLDAQGLEGVAYGNGRFVVSGQLGRLFTSTDGLAWQAVSSGTDANLGNAVFGGGRFLVFVPYRGEALTSTDGLTWTRVSGLGARAATYANGRWVAVGWGEKAFLSQDGLRWSEEPLPGYRSLNAVAYGNGLYVAVGDYGHILIRRE
>NC_006462.1|WP_011229073.1|243209_244172_+|recombinase-XerD
MREGLGLEVWDHPEERRRVVGEALARWDEALLKEALWAYLVRHRKKPDRAAPHYVGYFVRWLALKGRRWPHLEPEDPKAFLLEAKEKGFPGGERGPMAWSTVERARASLRHLFPFLDWAGHPMPSHVRLPSRQELPVVAPSRAMPEEAYRDLLEKAGAYPLAYWRPLLRVLLVLLGEVGLTVKEAVELWQEDVREKVLLVRGAKLREVPLSPLAREVLADWLPQRAFLASHQPLPYPHLLLKPAPGKNRGKPLGLEEAKWILTEFADFAGVKAEGKRRADLALPLRWRAIRRFLKEGHPREKVAYWTGMKSLVVPGWGEE
>NC_006462.1|WP_024119813.1|244423_245263_-|alpha/beta-fold-hydrolase
MESVKVATGPFLTHLHRAGEGEAVLFIHGSGPGATGLSNWQLALPELGRDFLCLAPDLVGYGESTHPEPPPRGARAWMRLWVDQLLGLLDALGLERAHLVGNSLGGAIALHLLMEAPERFGRVVLMGPVGGPFRLTPELDRIWGFYEDPTLSAMRNAIRWFAFDEGFVRDRLEEIARMRLEAALRPEVRRSFEAMWPRPRQEAIDQLVVPPSALKRMDHPVLILHGYRDGIVPIETSLYLMEHLPNAHLVLLGRTGHWVQIEQAATFHRLVRAFLKGEL
>NC_006462.1|WP_011229071.1|245273_245456_-|hypothetical-protein
MLEVLVSREKPLTREEREALKEEAEAIFQEVLGTPKGRLRVFVLEEAPKGDEAQSPSRWA
>NC_006462.1|WP_011229070.1|245474_246251_-|2-hydroxypenta-2,4-dienoate-hydratase
MRPETFAEELERAWEERRPIEPLSDRGLKGIEAAYRVQEAWNALRLGKGDRVVGRKIGLTSKAVQEQLGVDQPDFGNLWESRFFGVGERVEVEARLFLQPRVEGELAFLIGRRLEGPGVTPQEVLAATEAVAFAIEIVDSRIRDWRIRIEDTIADNASYGGFVVGPWEKALLEEDLSALGLVLYKNGEPVAQGAGAACLGHPARAVAWLTNTLAAFGVALEPGDIVMSGAWAPVQPAGPGDLFTLVGTGGRALSLRFA
>NC_006462.1|WP_011229069.1|246258_247767_-|aldehyde-dehydrogenase
MVEPKIYKETVERLEALGFPFRLPLEVTHYIGGEFVRGENFFPVVYPATGEVIGTAPEGREKEVEQAVAAAKEAFKKWSKMPPSQRRPYLRRFAEKIREYKPVFEVLETLDVGRPIHENRLGYVDRMANNIEFFADFAVTHGSEAYPMENGYINYVLRFPVGVAALITPWNMPSMLATWKIGPTLAFGNTAVLKPAEFTPLGAWLLAKCAHEAGLPPGVFNVVHGFGPDSAGELLTKHPDVRLISFTGETTTGKIIMKNASDTLKRLSMELGGKAPNLIFESADLDRAVEVTMRASFFNQGEVCLAGSRLLVQRSVYEPFLERLVKAARSLKVGDPLDPETRMGALIAEEHLNKVMSYVEIARETATILTGGRRPELPHPFDKGYFLEPTVVVDVKPSDKVCQEEIFGPMVVVMPFDTEEEAIELANNTPYGLNAIVQTRDVGQAVRVSEALEVGTVWVNDWFVRDLRVPFGGAKQSGIGREGGHYGYEFYYETKNVCIANR
>NC_006462.1|WP_011229068.1|247777_248473_-|4-oxalocrotonate-decarboxylase
MTLLEAVEKARAERRTLSGGRDWGVGLEEAYRIQEALFPGPLKGYKLGLVSEAKQRQMGIAEPIFGRVHPGMLLERVVLEAFVQPRLEPEVAVVLKEDLPPGASVGEAYRAVGGYFLAVDVLDSVWEGYRFTLPEVVADNTSGGGFLLGRRRFSRLPQGSLRAYLNGEKVAEGPVEALGDPGRRLLWLAERVGGLRAGQVVFLGSPAQAVPLARGVLEVWGGGDVLLARVV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NC_006462_1	1.1\|18080\|38\|NC_006462\|CRISPRCasFinder,CRT	18080-18117	38	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	18080-18117	0	1.0
NC_006462_1	1.2\|18154\|38\|NC_006462\|CRISPRCasFinder,CRT	18154-18191	38	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	18154-18191	0	1.0
NC_006462_1	1.3\|18228\|40\|NC_006462\|CRISPRCasFinder,CRT	18228-18267	40	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	18228-18267	0	1.0
NC_006462_1	1.4\|18086\|36\|NC_006462\|PILER-CR	18086-18121	36	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	18082-18117	0	1.0
NC_006462_1	1.5\|18160\|36\|NC_006462\|PILER-CR	18160-18195	36	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	18156-18191	0	1.0
NC_006462_1	1.6\|18234\|38\|NC_006462\|PILER-CR	18234-18271	38	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	18230-18267	0	1.0
NC_006462_2	2.1\|113562\|38\|NC_006462\|CRT	113562-113599	38	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	113562-113599	0	1.0
NC_006462_2	2.1\|113562\|38\|NC_006462\|CRT	113562-113599	38	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	113675-113712	0	1.0
NC_006462_2	2.1\|113562\|38\|NC_006462\|CRT	113562-113599	38	NZ_LR027520	Thermus thermophilus isolate TTHNAR1 plasmid 4, complete sequence	183901-183938	0	1.0
NC_006462_2	2.2\|113618\|39\|NC_006462\|CRT	113618-113656	39	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	113618-113656	0	1.0
NC_006462_2	2.3\|113675\|38\|NC_006462\|CRT	113675-113712	38	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	113562-113599	0	1.0
NC_006462_2	2.3\|113675\|38\|NC_006462\|CRT	113675-113712	38	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	113675-113712	0	1.0
NC_006462_2	2.3\|113675\|38\|NC_006462\|CRT	113675-113712	38	NZ_LR027520	Thermus thermophilus isolate TTHNAR1 plasmid 4, complete sequence	183901-183938	0	1.0
NC_006462_3	3.1\|133802\|41\|NC_006462\|CRISPRCasFinder	133802-133842	41	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	133802-133842	0	1.0
NC_006462_3	3.2\|133879\|40\|NC_006462\|CRISPRCasFinder	133879-133918	40	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	133879-133918	0	1.0
NC_006462_4	4.1\|135192\|39\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	135192-135230	39	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	135192-135230	0	1.0
NC_006462_4	4.2\|135267\|40\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	135267-135306	40	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	135267-135306	0	1.0
NC_006462_4	4.3\|135343\|36\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	135343-135378	36	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	135343-135378	0	1.0
NC_006462_4	4.4\|135415\|39\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	135415-135453	39	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	135415-135453	0	1.0
NC_006462_4	4.5\|135490\|39\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	135490-135528	39	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	135490-135528	0	1.0
NC_006462_4	4.6\|135565\|42\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	135565-135606	42	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	135565-135606	0	1.0
NC_006462_4	4.7\|135643\|40\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	135643-135682	40	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	135643-135682	0	1.0
NC_006462_4	4.8\|135719\|40\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	135719-135758	40	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	135719-135758	0	1.0
NC_006462_4	4.9\|135795\|39\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	135795-135833	39	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	135795-135833	0	1.0
NC_006462_4	4.10\|135870\|40\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	135870-135909	40	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	135870-135909	0	1.0
NC_006462_4	4.11\|135946\|40\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	135946-135985	40	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	135946-135985	0	1.0
NC_006462_4	4.12\|136022\|42\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	136022-136063	42	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	136022-136063	0	1.0
NC_006462_5	5.1\|144165\|41\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	144165-144205	41	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	144165-144205	0	1.0
NC_006462_5	5.2\|144242\|42\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	144242-144283	42	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	144242-144283	0	1.0
NC_006462_5	5.3\|144320\|37\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	144320-144356	37	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	144320-144356	0	1.0
NC_006462_5	5.4\|144393\|38\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	144393-144430	38	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	144393-144430	0	1.0
NC_006462_5	5.5\|144467\|40\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	144467-144506	40	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	144467-144506	0	1.0
NC_006462_5	5.6\|144543\|38\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	144543-144580	38	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	144543-144580	0	1.0
NC_006462_5	5.7\|144617\|42\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	144617-144658	42	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	144617-144658	0	1.0
NC_006462_5	5.8\|144695\|37\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	144695-144731	37	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	144695-144731	0	1.0
NC_006462_5	5.9\|144768\|39\|NC_006462\|CRISPRCasFinder,CRT	144768-144806	39	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	144768-144806	0	1.0
NC_006462_6	6.1\|146078\|42\|NC_006462\|CRISPRCasFinder,CRT	146078-146119	42	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	146078-146119	0	1.0
NC_006462_6	6.1\|146078\|42\|NC_006462\|CRISPRCasFinder,CRT	146078-146119	42	NC_005838	Thermus thermophilus HB27 plasmid pTT27, complete sequence	100714-100755	0	1.0
NC_006462_6	6.2\|146156\|44\|NC_006462\|CRISPRCasFinder,CRT	146156-146199	44	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	146156-146199	0	1.0
NC_006462_6	6.2\|146156\|44\|NC_006462\|CRISPRCasFinder,CRT	146156-146199	44	NC_005838	Thermus thermophilus HB27 plasmid pTT27, complete sequence	100792-100835	0	1.0
NC_006462_6	6.3\|146236\|40\|NC_006462\|CRISPRCasFinder,CRT	146236-146275	40	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	146236-146275	0	1.0
NC_006462_6	6.3\|146236\|40\|NC_006462\|CRISPRCasFinder,CRT	146236-146275	40	NC_005838	Thermus thermophilus HB27 plasmid pTT27, complete sequence	100949-100988	0	1.0
NC_006462_6	6.4\|146312\|36\|NC_006462\|CRISPRCasFinder,CRT	146312-146347	36	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	146312-146347	0	1.0
NC_006462_6	6.4\|146312\|36\|NC_006462\|CRISPRCasFinder,CRT	146312-146347	36	NC_005838	Thermus thermophilus HB27 plasmid pTT27, complete sequence	101025-101060	0	1.0
NC_006462_6	6.5\|146384\|37\|NC_006462\|CRISPRCasFinder,CRT	146384-146420	37	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	146384-146420	0	1.0
NC_006462_6	6.5\|146384\|37\|NC_006462\|CRISPRCasFinder,CRT	146384-146420	37	NC_005838	Thermus thermophilus HB27 plasmid pTT27, complete sequence	101097-101133	0	1.0
NC_006462_6	6.6\|146457\|37\|NC_006462\|CRISPRCasFinder,CRT	146457-146493	37	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	146457-146493	0	1.0
NC_006462_6	6.6\|146457\|37\|NC_006462\|CRISPRCasFinder,CRT	146457-146493	37	NC_005838	Thermus thermophilus HB27 plasmid pTT27, complete sequence	101170-101206	0	1.0
NC_006462_6	6.7\|146530\|37\|NC_006462\|CRISPRCasFinder,CRT	146530-146566	37	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	146530-146566	0	1.0
NC_006462_6	6.7\|146530\|37\|NC_006462\|CRISPRCasFinder,CRT	146530-146566	37	NC_005838	Thermus thermophilus HB27 plasmid pTT27, complete sequence	101243-101279	0	1.0
NC_006462_6	6.8\|146603\|40\|NC_006462\|CRISPRCasFinder,CRT	146603-146642	40	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	146603-146642	0	1.0
NC_006462_6	6.9\|146679\|38\|NC_006462\|CRISPRCasFinder,CRT	146679-146716	38	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	146679-146716	0	1.0
NC_006462_6	6.9\|146679\|38\|NC_006462\|CRISPRCasFinder,CRT	146679-146716	38	NC_005838	Thermus thermophilus HB27 plasmid pTT27, complete sequence	101316-101353	0	1.0
NC_006462_6	6.10\|146753\|40\|NC_006462\|CRISPRCasFinder,CRT	146753-146792	40	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	146753-146792	0	1.0
NC_006462_6	6.10\|146753\|40\|NC_006462\|CRISPRCasFinder,CRT	146753-146792	40	NC_005838	Thermus thermophilus HB27 plasmid pTT27, complete sequence	101390-101429	0	1.0
NC_006462_6	6.11\|146829\|41\|NC_006462\|CRISPRCasFinder,CRT	146829-146869	41	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	146829-146869	0	1.0
NC_006462_6	6.11\|146829\|41\|NC_006462\|CRISPRCasFinder,CRT	146829-146869	41	NC_005838	Thermus thermophilus HB27 plasmid pTT27, complete sequence	101466-101506	0	1.0
NC_006462_6	6.12\|146906\|42\|NC_006462\|CRISPRCasFinder,CRT	146906-146947	42	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	146906-146947	0	1.0
NC_006462_6	6.12\|146906\|42\|NC_006462\|CRISPRCasFinder,CRT	146906-146947	42	NC_005838	Thermus thermophilus HB27 plasmid pTT27, complete sequence	101543-101584	0	1.0
NC_006462_7	7.1\|189536\|32\|NC_006462\|CRISPRCasFinder,CRT	189536-189567	32	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	189536-189567	0	1.0
NC_006462_7	7.2\|189597\|33\|NC_006462\|CRISPRCasFinder,CRT	189597-189629	33	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	189597-189629	0	1.0
NC_006462_7	7.3\|189659\|33\|NC_006462\|CRISPRCasFinder,CRT	189659-189691	33	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	189659-189691	0	1.0
NC_006462_7	7.4\|189721\|32\|NC_006462\|CRISPRCasFinder,CRT	189721-189752	32	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	189721-189752	0	1.0
NC_006462_7	7.5\|189782\|31\|NC_006462\|CRISPRCasFinder,CRT	189782-189812	31	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	189782-189812	0	1.0
NC_006462_7	7.6\|189842\|32\|NC_006462\|CRISPRCasFinder,CRT	189842-189873	32	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	189842-189873	0	1.0
NC_006462_7	7.7\|189903\|32\|NC_006462\|CRISPRCasFinder,CRT	189903-189934	32	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	189903-189934	0	1.0
NC_006462_7	7.8\|189964\|33\|NC_006462\|CRISPRCasFinder,CRT	189964-189996	33	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	189964-189996	0	1.0
NC_006462_7	7.9\|190026\|33\|NC_006462\|CRISPRCasFinder,CRT	190026-190058	33	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	190026-190058	0	1.0
NC_006462_7	7.10\|190088\|32\|NC_006462\|CRISPRCasFinder,CRT	190088-190119	32	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	190088-190119	0	1.0
NC_006462_7	7.11\|190149\|32\|NC_006462\|CRISPRCasFinder,CRT	190149-190180	32	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	190149-190180	0	1.0
NC_006462_7	7.12\|190210\|33\|NC_006462\|CRISPRCasFinder,CRT	190210-190242	33	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	190210-190242	0	1.0
NC_006462_7	7.13\|190272\|33\|NC_006462\|CRISPRCasFinder,CRT	190272-190304	33	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	190272-190304	0	1.0
NC_006462_7	7.14\|190334\|32\|NC_006462\|CRISPRCasFinder,CRT	190334-190365	32	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	190334-190365	0	1.0
NC_006462_7	7.15\|190395\|33\|NC_006462\|CRISPRCasFinder,CRT	190395-190427	33	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	190395-190427	0	1.0
NC_006462_7	7.16\|190457\|33\|NC_006462\|CRISPRCasFinder,CRT	190457-190489	33	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	190457-190489	0	1.0
NC_006462_7	7.17\|190519\|32\|NC_006462\|CRISPRCasFinder,CRT	190519-190550	32	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	190519-190550	0	1.0
NC_006462_7	7.18\|190580\|33\|NC_006462\|CRISPRCasFinder,CRT	190580-190612	33	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	190580-190612	0	1.0
NC_006462_7	7.19\|190642\|33\|NC_006462\|CRISPRCasFinder,CRT	190642-190674	33	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	190642-190674	0	1.0
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	190704-190735	0	1.0
NC_006462_7	7.21\|190765\|32\|NC_006462\|CRISPRCasFinder,CRT	190765-190796	32	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	190765-190796	0	1.0
NC_006462_7	7.22\|190826\|32\|NC_006462\|CRISPRCasFinder,CRT	190826-190857	32	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	190826-190857	0	1.0
NC_006462_7	7.23\|190887\|32\|NC_006462\|CRISPRCasFinder,CRT	190887-190918	32	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	190887-190918	0	1.0
NC_006462_7	7.24\|189538\|32\|NC_006462\|PILER-CR	189538-189569	32	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	189536-189567	0	1.0
NC_006462_7	7.25\|189599\|33\|NC_006462\|PILER-CR	189599-189631	33	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	189597-189629	0	1.0
NC_006462_7	7.26\|189661\|33\|NC_006462\|PILER-CR	189661-189693	33	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	189659-189691	0	1.0
NC_006462_7	7.27\|189723\|32\|NC_006462\|PILER-CR	189723-189754	32	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	189721-189752	0	1.0
NC_006462_7	7.28\|189784\|31\|NC_006462\|PILER-CR	189784-189814	31	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	189782-189812	0	1.0
NC_006462_7	7.29\|189844\|32\|NC_006462\|PILER-CR	189844-189875	32	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	189842-189873	0	1.0
NC_006462_7	7.30\|189905\|32\|NC_006462\|PILER-CR	189905-189936	32	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	189903-189934	0	1.0
NC_006462_7	7.31\|189966\|33\|NC_006462\|PILER-CR	189966-189998	33	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	189964-189996	0	1.0
NC_006462_7	7.32\|190028\|33\|NC_006462\|PILER-CR	190028-190060	33	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	190026-190058	0	1.0
NC_006462_7	7.33\|190090\|32\|NC_006462\|PILER-CR	190090-190121	32	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	190088-190119	0	1.0
NC_006462_7	7.34\|190151\|32\|NC_006462\|PILER-CR	190151-190182	32	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	190149-190180	0	1.0
NC_006462_7	7.35\|190212\|33\|NC_006462\|PILER-CR	190212-190244	33	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	190210-190242	0	1.0
NC_006462_7	7.36\|190274\|33\|NC_006462\|PILER-CR	190274-190306	33	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	190272-190304	0	1.0
NC_006462_7	7.37\|190336\|32\|NC_006462\|PILER-CR	190336-190367	32	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	190334-190365	0	1.0
NC_006462_7	7.38\|190397\|33\|NC_006462\|PILER-CR	190397-190429	33	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	190395-190427	0	1.0
NC_006462_7	7.39\|190459\|33\|NC_006462\|PILER-CR	190459-190491	33	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	190457-190489	0	1.0
NC_006462_7	7.40\|190521\|32\|NC_006462\|PILER-CR	190521-190552	32	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	190519-190550	0	1.0
NC_006462_7	7.41\|190582\|33\|NC_006462\|PILER-CR	190582-190614	33	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	190580-190612	0	1.0
NC_006462_7	7.42\|190644\|33\|NC_006462\|PILER-CR	190644-190676	33	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	190642-190674	0	1.0
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	190704-190735	0	1.0
NC_006462_7	7.44\|190767\|32\|NC_006462\|PILER-CR	190767-190798	32	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	190765-190796	0	1.0
NC_006462_7	7.45\|190828\|32\|NC_006462\|PILER-CR	190828-190859	32	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	190826-190857	0	1.0
NC_006462_7	7.46\|190889\|32\|NC_006462\|PILER-CR	190889-190920	32	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	190887-190918	0	1.0
NC_006462_8	8.1\|200840\|32\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	200840-200871	32	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	200840-200871	0	1.0
NC_006462_8	8.2\|200901\|33\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	200901-200933	33	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	200901-200933	0	1.0
NC_006462_8	8.3\|200963\|32\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	200963-200994	32	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	200963-200994	0	1.0
NC_006462_8	8.4\|201024\|33\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	201024-201056	33	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	201024-201056	0	1.0
NC_006462_8	8.5\|201086\|33\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	201086-201118	33	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	201086-201118	0	1.0
NC_006462_8	8.6\|201148\|33\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	201148-201180	33	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	201148-201180	0	1.0
NC_006462_8	8.7\|201210\|32\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	201210-201241	32	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	201210-201241	0	1.0
NC_006462_8	8.8\|201271\|32\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	201271-201302	32	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	201271-201302	0	1.0
NC_006462_8	8.9\|201332\|33\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	201332-201364	33	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	201332-201364	0	1.0
NC_006462_8	8.10\|201394\|32\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	201394-201425	32	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	201394-201425	0	1.0
NC_006462_8	8.11\|201455\|33\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	201455-201487	33	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	201455-201487	0	1.0
NC_006462_8	8.12\|201517\|34\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	201517-201550	34	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	201517-201550	0	1.0
NC_006462_8	8.13\|201580\|32\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	201580-201611	32	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	201580-201611	0	1.0
NC_006462_8	8.14\|201641\|33\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	201641-201673	33	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	201641-201673	0	1.0
NC_006462_8	8.15\|201703\|33\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	201703-201735	33	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	201703-201735	0	1.0
NC_006462_8	8.16\|201765\|33\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	201765-201797	33	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	201765-201797	0	1.0
NC_006462_8	8.17\|201827\|33\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	201827-201859	33	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	201827-201859	0	1.0
NC_006462_8	8.18\|201889\|34\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	201889-201922	34	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	201889-201922	0	1.0
NC_006462_8	8.19\|201952\|34\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	201952-201985	34	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	201952-201985	0	1.0
NC_006462_8	8.20\|202015\|35\|NC_006462\|CRISPRCasFinder,CRT	202015-202049	35	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	202015-202049	0	1.0
NC_006462_9	9.1\|227361\|35\|NC_006462\|CRISPRCasFinder	227361-227395	35	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	227361-227395	0	1.0
NC_006462_9	9.2\|227433\|39\|NC_006462\|CRISPRCasFinder	227433-227471	39	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	227433-227471	0	1.0
NC_006462_9	9.3\|227509\|35\|NC_006462\|CRISPRCasFinder	227509-227543	35	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	227509-227543	0	1.0
NC_006462_9	9.4\|227581\|36\|NC_006462\|CRISPRCasFinder	227581-227616	36	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	227581-227616	0	1.0
NC_006462_9	9.5\|227654\|35\|NC_006462\|CRISPRCasFinder	227654-227688	35	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	227654-227688	0	1.0
NC_006462_9	9.6\|227726\|35\|NC_006462\|CRISPRCasFinder	227726-227760	35	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	227726-227760	0	1.0
NC_006462_9	9.7\|227798\|38\|NC_006462\|CRISPRCasFinder	227798-227835	38	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	227798-227835	0	1.0
NC_006462_9	9.8\|227873\|35\|NC_006462\|CRISPRCasFinder	227873-227907	35	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	227873-227907	0	1.0
NC_006462_9	9.9\|227945\|35\|NC_006462\|CRISPRCasFinder	227945-227979	35	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	227945-227979	0	1.0
NC_006462_9	9.9\|227945\|35\|NC_006462\|CRISPRCasFinder	227945-227979	35	NZ_AP019802	Thermus thermophilus strain HC11 plasmid pHC11, complete sequence	53602-53636	0	1.0
NC_006462_9	9.10\|228017\|35\|NC_006462\|CRISPRCasFinder	228017-228051	35	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	228017-228051	0	1.0
NC_006462_9	9.10\|228017\|35\|NC_006462\|CRISPRCasFinder	228017-228051	35	NZ_AP019802	Thermus thermophilus strain HC11 plasmid pHC11, complete sequence	53530-53564	0	1.0
NC_006462_9	9.11\|228089\|36\|NC_006462\|CRISPRCasFinder	228089-228124	36	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	228089-228124	0	1.0
NC_006462_9	9.12\|228162\|40\|NC_006462\|CRISPRCasFinder	228162-228201	40	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	228162-228201	0	1.0
NC_006462_9	9.13\|227360\|36\|NC_006462\|CRT	227360-227395	36	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	227360-227395	0	1.0
NC_006462_9	9.14\|227432\|40\|NC_006462\|CRT,PILER-CR	227432-227471	40	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	227432-227471	0	1.0
NC_006462_9	9.15\|227508\|36\|NC_006462\|CRT,PILER-CR	227508-227543	36	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	227508-227543	0	1.0
NC_006462_9	9.16\|227580\|37\|NC_006462\|CRT,PILER-CR	227580-227616	37	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	227580-227616	0	1.0
NC_006462_9	9.17\|227653\|36\|NC_006462\|CRT,PILER-CR	227653-227688	36	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	227653-227688	0	1.0
NC_006462_9	9.18\|227725\|36\|NC_006462\|CRT,PILER-CR	227725-227760	36	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	227725-227760	0	1.0
NC_006462_9	9.19\|227797\|39\|NC_006462\|CRT,PILER-CR	227797-227835	39	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	227797-227835	0	1.0
NC_006462_9	9.20\|227872\|36\|NC_006462\|CRT,PILER-CR	227872-227907	36	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	227872-227907	0	1.0
NC_006462_9	9.21\|227944\|36\|NC_006462\|CRT,PILER-CR	227944-227979	36	NZ_AP019802	Thermus thermophilus strain HC11 plasmid pHC11, complete sequence	53602-53637	0	1.0
NC_006462_9	9.21\|227944\|36\|NC_006462\|CRT,PILER-CR	227944-227979	36	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	227944-227979	0	1.0
NC_006462_9	9.22\|228016\|36\|NC_006462\|CRT,PILER-CR	228016-228051	36	NZ_AP019802	Thermus thermophilus strain HC11 plasmid pHC11, complete sequence	53530-53565	0	1.0
NC_006462_9	9.22\|228016\|36\|NC_006462\|CRT,PILER-CR	228016-228051	36	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	228016-228051	0	1.0
NC_006462_9	9.23\|228088\|37\|NC_006462\|CRT,PILER-CR	228088-228124	37	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	228088-228124	0	1.0
NC_006462_9	9.24\|228161\|41\|NC_006462\|CRT,PILER-CR	228161-228201	41	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	228161-228201	0	1.0
NC_006462_10	10.1\|239141\|38\|NC_006462\|CRISPRCasFinder	239141-239178	38	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	239141-239178	0	1.0
NC_006462_2	2.1\|113562\|38\|NC_006462\|CRT	113562-113599	38	NZ_LR027520	Thermus thermophilus isolate TTHNAR1 plasmid 4, complete sequence	184014-184051	1	0.974
NC_006462_2	2.1\|113562\|38\|NC_006462\|CRT	113562-113599	38	NZ_CP014142	Thermus parvatiensis strain RL plasmid pTP143, complete sequence	119660-119697	1	0.974
NC_006462_2	2.1\|113562\|38\|NC_006462\|CRT	113562-113599	38	NC_005838	Thermus thermophilus HB27 plasmid pTT27, complete sequence	81057-81094	1	0.974
NC_006462_2	2.1\|113562\|38\|NC_006462\|CRT	113562-113599	38	NC_005838	Thermus thermophilus HB27 plasmid pTT27, complete sequence	81170-81207	1	0.974
NC_006462_2	2.1\|113562\|38\|NC_006462\|CRT	113562-113599	38	NZ_AP019802	Thermus thermophilus strain HC11 plasmid pHC11, complete sequence	239068-239105	1	0.974
NC_006462_2	2.1\|113562\|38\|NC_006462\|CRT	113562-113599	38	NZ_AP019802	Thermus thermophilus strain HC11 plasmid pHC11, complete sequence	239181-239218	1	0.974
NC_006462_2	2.1\|113562\|38\|NC_006462\|CRT	113562-113599	38	NC_017588	Thermus thermophilus JL-18 plasmid pTTJL1801, complete sequence	224529-224566	1	0.974
NC_006462_2	2.1\|113562\|38\|NC_006462\|CRT	113562-113599	38	NC_017588	Thermus thermophilus JL-18 plasmid pTTJL1801, complete sequence	224642-224679	1	0.974
NC_006462_2	2.1\|113562\|38\|NC_006462\|CRT	113562-113599	38	NC_017273	Thermus thermophilus SG0.5JP17-16 plasmid pTHTHE1601, complete sequence	265726-265763	1	0.974
NC_006462_2	2.1\|113562\|38\|NC_006462\|CRT	113562-113599	38	NC_017273	Thermus thermophilus SG0.5JP17-16 plasmid pTHTHE1601, complete sequence	265839-265876	1	0.974
NC_006462_2	2.1\|113562\|38\|NC_006462\|CRT	113562-113599	38	NZ_AP019795	Thermus thermophilus strain AA2-29 plasmid pAA229, complete sequence	124040-124077	1	0.974
NC_006462_2	2.1\|113562\|38\|NC_006462\|CRT	113562-113599	38	NZ_AP019795	Thermus thermophilus strain AA2-29 plasmid pAA229, complete sequence	124153-124190	1	0.974
NC_006462_2	2.1\|113562\|38\|NC_006462\|CRT	113562-113599	38	NZ_AP019793	Thermus thermophilus strain AA2-20 plasmid pAA220, complete sequence	153454-153491	1	0.974
NC_006462_2	2.1\|113562\|38\|NC_006462\|CRT	113562-113599	38	NZ_AP019793	Thermus thermophilus strain AA2-20 plasmid pAA220, complete sequence	153567-153604	1	0.974
NC_006462_2	2.2\|113618\|39\|NC_006462\|CRT	113618-113656	39	NC_017273	Thermus thermophilus SG0.5JP17-16 plasmid pTHTHE1601, complete sequence	265782-265820	1	0.974
NC_006462_2	2.2\|113618\|39\|NC_006462\|CRT	113618-113656	39	NZ_CP014142	Thermus parvatiensis strain RL plasmid pTP143, complete sequence	119716-119754	1	0.974
NC_006462_2	2.2\|113618\|39\|NC_006462\|CRT	113618-113656	39	NC_005838	Thermus thermophilus HB27 plasmid pTT27, complete sequence	81113-81151	1	0.974
NC_006462_2	2.2\|113618\|39\|NC_006462\|CRT	113618-113656	39	NZ_AP019802	Thermus thermophilus strain HC11 plasmid pHC11, complete sequence	239124-239162	1	0.974
NC_006462_2	2.2\|113618\|39\|NC_006462\|CRT	113618-113656	39	NC_017588	Thermus thermophilus JL-18 plasmid pTTJL1801, complete sequence	224585-224623	1	0.974
NC_006462_2	2.2\|113618\|39\|NC_006462\|CRT	113618-113656	39	NZ_AP019795	Thermus thermophilus strain AA2-29 plasmid pAA229, complete sequence	124096-124134	1	0.974
NC_006462_2	2.2\|113618\|39\|NC_006462\|CRT	113618-113656	39	NZ_LR027520	Thermus thermophilus isolate TTHNAR1 plasmid 4, complete sequence	183957-183995	1	0.974
NC_006462_2	2.2\|113618\|39\|NC_006462\|CRT	113618-113656	39	NZ_AP019793	Thermus thermophilus strain AA2-20 plasmid pAA220, complete sequence	153510-153548	1	0.974
NC_006462_2	2.3\|113675\|38\|NC_006462\|CRT	113675-113712	38	NZ_LR027520	Thermus thermophilus isolate TTHNAR1 plasmid 4, complete sequence	184014-184051	1	0.974
NC_006462_2	2.3\|113675\|38\|NC_006462\|CRT	113675-113712	38	NZ_CP014142	Thermus parvatiensis strain RL plasmid pTP143, complete sequence	119660-119697	1	0.974
NC_006462_2	2.3\|113675\|38\|NC_006462\|CRT	113675-113712	38	NC_005838	Thermus thermophilus HB27 plasmid pTT27, complete sequence	81057-81094	1	0.974
NC_006462_2	2.3\|113675\|38\|NC_006462\|CRT	113675-113712	38	NC_005838	Thermus thermophilus HB27 plasmid pTT27, complete sequence	81170-81207	1	0.974
NC_006462_2	2.3\|113675\|38\|NC_006462\|CRT	113675-113712	38	NZ_AP019802	Thermus thermophilus strain HC11 plasmid pHC11, complete sequence	239068-239105	1	0.974
NC_006462_2	2.3\|113675\|38\|NC_006462\|CRT	113675-113712	38	NZ_AP019802	Thermus thermophilus strain HC11 plasmid pHC11, complete sequence	239181-239218	1	0.974
NC_006462_2	2.3\|113675\|38\|NC_006462\|CRT	113675-113712	38	NC_017588	Thermus thermophilus JL-18 plasmid pTTJL1801, complete sequence	224529-224566	1	0.974
NC_006462_2	2.3\|113675\|38\|NC_006462\|CRT	113675-113712	38	NC_017588	Thermus thermophilus JL-18 plasmid pTTJL1801, complete sequence	224642-224679	1	0.974
NC_006462_2	2.3\|113675\|38\|NC_006462\|CRT	113675-113712	38	NC_017273	Thermus thermophilus SG0.5JP17-16 plasmid pTHTHE1601, complete sequence	265726-265763	1	0.974
NC_006462_2	2.3\|113675\|38\|NC_006462\|CRT	113675-113712	38	NC_017273	Thermus thermophilus SG0.5JP17-16 plasmid pTHTHE1601, complete sequence	265839-265876	1	0.974
NC_006462_2	2.3\|113675\|38\|NC_006462\|CRT	113675-113712	38	NZ_AP019795	Thermus thermophilus strain AA2-29 plasmid pAA229, complete sequence	124040-124077	1	0.974
NC_006462_2	2.3\|113675\|38\|NC_006462\|CRT	113675-113712	38	NZ_AP019795	Thermus thermophilus strain AA2-29 plasmid pAA229, complete sequence	124153-124190	1	0.974
NC_006462_2	2.3\|113675\|38\|NC_006462\|CRT	113675-113712	38	NZ_AP019793	Thermus thermophilus strain AA2-20 plasmid pAA220, complete sequence	153454-153491	1	0.974
NC_006462_2	2.3\|113675\|38\|NC_006462\|CRT	113675-113712	38	NZ_AP019793	Thermus thermophilus strain AA2-20 plasmid pAA220, complete sequence	153567-153604	1	0.974
NC_006462_2	2.4\|113731\|61\|NC_006462\|CRT	113731-113791	61	NC_006462	Thermus thermophilus HB8 plasmid pTT27, complete sequence	113731-113791	1	0.984
NC_006462_2	2.4\|113731\|61\|NC_006462\|CRT	113731-113791	61	NC_017588	Thermus thermophilus JL-18 plasmid pTTJL1801, complete sequence	224698-224758	1	0.984
NC_006462_8	8.4\|201024\|33\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	201024-201056	33	NC_017588	Thermus thermophilus JL-18 plasmid pTTJL1801, complete sequence	52898-52930	1	0.97
NC_006462_9	9.4\|227581\|36\|NC_006462\|CRISPRCasFinder	227581-227616	36	NZ_LR027519	Thermus thermophilus isolate TTHNAR1 plasmid 3, complete sequence	28281-28316	1	0.972
NC_006462_9	9.6\|227726\|35\|NC_006462\|CRISPRCasFinder	227726-227760	35	MH673671	Thermus phage phiKo, complete genome	3543-3577	1	0.971
NC_006462_9	9.16\|227580\|37\|NC_006462\|CRT,PILER-CR	227580-227616	37	NZ_LR027519	Thermus thermophilus isolate TTHNAR1 plasmid 3, complete sequence	28280-28316	1	0.973
NC_006462_9	9.18\|227725\|36\|NC_006462\|CRT,PILER-CR	227725-227760	36	MH673671	Thermus phage phiKo, complete genome	3543-3578	1	0.972
NC_006462_2	2.1\|113562\|38\|NC_006462\|CRT	113562-113599	38	NZ_CP014142	Thermus parvatiensis strain RL plasmid pTP143, complete sequence	119773-119810	2	0.947
NC_006462_2	2.3\|113675\|38\|NC_006462\|CRT	113675-113712	38	NZ_CP014142	Thermus parvatiensis strain RL plasmid pTP143, complete sequence	119773-119810	2	0.947
NC_006462_9	9.5\|227654\|35\|NC_006462\|CRISPRCasFinder	227654-227688	35	MH673671	Thermus phage phiKo, complete genome	6308-6342	2	0.943
NC_006462_9	9.17\|227653\|36\|NC_006462\|CRT,PILER-CR	227653-227688	36	MH673671	Thermus phage phiKo, complete genome	6308-6343	2	0.944
NC_006462_10	10.1\|239141\|38\|NC_006462\|CRISPRCasFinder	239141-239178	38	NC_017590	Thermus thermophilus JL-18 plasmid pTTJL1802, complete sequence	126682-126719	2	0.947
NC_006462_10	10.1\|239141\|38\|NC_006462\|CRISPRCasFinder	239141-239178	38	NC_017273	Thermus thermophilus SG0.5JP17-16 plasmid pTHTHE1601, complete sequence	47667-47704	3	0.921
NC_006462_10	10.1\|239141\|38\|NC_006462\|CRISPRCasFinder	239141-239178	38	NZ_LR027519	Thermus thermophilus isolate TTHNAR1 plasmid 3, complete sequence	56554-56591	3	0.921
NC_006462_2	2.1\|113562\|38\|NC_006462\|CRT	113562-113599	38	NZ_CP010826	Thermus aquaticus Y51MC23 plasmid pTA78, complete sequence	41275-41312	6	0.842
NC_006462_2	2.1\|113562\|38\|NC_006462\|CRT	113562-113599	38	NZ_CP010826	Thermus aquaticus Y51MC23 plasmid pTA78, complete sequence	41354-41391	6	0.842
NC_006462_2	2.3\|113675\|38\|NC_006462\|CRT	113675-113712	38	NZ_CP010826	Thermus aquaticus Y51MC23 plasmid pTA78, complete sequence	41275-41312	6	0.842
NC_006462_2	2.3\|113675\|38\|NC_006462\|CRT	113675-113712	38	NZ_CP010826	Thermus aquaticus Y51MC23 plasmid pTA78, complete sequence	41354-41391	6	0.842
NC_006462_7	7.21\|190765\|32\|NC_006462\|CRISPRCasFinder,CRT	190765-190796	32	NZ_CP009293	Novosphingobium pentaromativorans US6-1 plasmid pLA4, complete sequence	14910-14941	6	0.812
NC_006462_7	7.44\|190767\|32\|NC_006462\|PILER-CR	190767-190798	32	NZ_CP009293	Novosphingobium pentaromativorans US6-1 plasmid pLA4, complete sequence	14910-14941	6	0.812
NC_006462_8	8.1\|200840\|32\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	200840-200871	32	NC_012529	Deinococcus deserti VCD115 plasmid 2, complete sequence	10722-10753	6	0.812
NC_006462_8	8.1\|200840\|32\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	200840-200871	32	NC_014718	Paraburkholderia rhizoxinica HKI 454 plasmid pBRH01, complete sequence	135470-135501	6	0.812
NC_006462_8	8.18\|201889\|34\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	201889-201922	34	LC473083	Cutibacterium acnes TP-CU389 plasmid pTZC1 DNA, complete sequence	1859-1892	6	0.824
NC_006462_7	7.1\|189536\|32\|NC_006462\|CRISPRCasFinder,CRT	189536-189567	32	NZ_CP040819	Paraoceanicella profunda strain D4M1 plasmid pD4M1A, complete sequence	291654-291685	7	0.781
NC_006462_7	7.1\|189536\|32\|NC_006462\|CRISPRCasFinder,CRT	189536-189567	32	MK494119	Mycobacterium Phage Niklas, complete genome	40996-41027	7	0.781
NC_006462_7	7.1\|189536\|32\|NC_006462\|CRISPRCasFinder,CRT	189536-189567	32	MK310138	Mycobacterium phage Shaobing, complete genome	40972-41003	7	0.781
NC_006462_7	7.1\|189536\|32\|NC_006462\|CRISPRCasFinder,CRT	189536-189567	32	MF185722	Mycobacterium phage Peanam, complete genome	40954-40985	7	0.781
NC_006462_7	7.6\|189842\|32\|NC_006462\|CRISPRCasFinder,CRT	189842-189873	32	NZ_CP037896	Thermaerobacter sp. FW80 plasmid unnamed1, complete sequence	37516-37547	7	0.781
NC_006462_7	7.8\|189964\|33\|NC_006462\|CRISPRCasFinder,CRT	189964-189996	33	NZ_LR134452	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 10, complete sequence	77216-77248	7	0.788
NC_006462_7	7.9\|190026\|33\|NC_006462\|CRISPRCasFinder,CRT	190026-190058	33	NZ_CP010660	Phaeobacter piscinae strain P71 plasmid pP71_d, complete sequence	53740-53772	7	0.788
NC_006462_7	7.11\|190149\|32\|NC_006462\|CRISPRCasFinder,CRT	190149-190180	32	NC_009620	Sinorhizobium medicae WSM419 plasmid pSMED01, complete sequence	341253-341284	7	0.781
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NC_010333	Caulobacter sp. K31 plasmid pCAUL02, complete sequence	121155-121186	7	0.781
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP032322	Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence	1539595-1539626	7	0.781
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	1161415-1161446	7	0.781
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	1511860-1511891	7	0.781
NC_006462_7	7.24\|189538\|32\|NC_006462\|PILER-CR	189538-189569	32	NZ_CP040819	Paraoceanicella profunda strain D4M1 plasmid pD4M1A, complete sequence	291654-291685	7	0.781
NC_006462_7	7.24\|189538\|32\|NC_006462\|PILER-CR	189538-189569	32	MK494119	Mycobacterium Phage Niklas, complete genome	40996-41027	7	0.781
NC_006462_7	7.24\|189538\|32\|NC_006462\|PILER-CR	189538-189569	32	MK310138	Mycobacterium phage Shaobing, complete genome	40972-41003	7	0.781
NC_006462_7	7.24\|189538\|32\|NC_006462\|PILER-CR	189538-189569	32	MF185722	Mycobacterium phage Peanam, complete genome	40954-40985	7	0.781
NC_006462_7	7.29\|189844\|32\|NC_006462\|PILER-CR	189844-189875	32	NZ_CP037896	Thermaerobacter sp. FW80 plasmid unnamed1, complete sequence	37516-37547	7	0.781
NC_006462_7	7.31\|189966\|33\|NC_006462\|PILER-CR	189966-189998	33	NZ_LR134452	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 10, complete sequence	77216-77248	7	0.788
NC_006462_7	7.32\|190028\|33\|NC_006462\|PILER-CR	190028-190060	33	NZ_CP010660	Phaeobacter piscinae strain P71 plasmid pP71_d, complete sequence	53740-53772	7	0.788
NC_006462_7	7.34\|190151\|32\|NC_006462\|PILER-CR	190151-190182	32	NC_009620	Sinorhizobium medicae WSM419 plasmid pSMED01, complete sequence	341253-341284	7	0.781
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NC_010333	Caulobacter sp. K31 plasmid pCAUL02, complete sequence	121155-121186	7	0.781
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP032322	Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence	1539595-1539626	7	0.781
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	1161415-1161446	7	0.781
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	1511860-1511891	7	0.781
NC_006462_8	8.1\|200840\|32\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	200840-200871	32	NZ_CP024423	Paracoccus yeei strain TT13 plasmid pTT13-1, complete sequence	80650-80681	7	0.781
NC_006462_8	8.1\|200840\|32\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	200840-200871	32	NZ_CP020441	Paracoccus yeei strain FDAARGOS_252 plasmid unnamed1, complete sequence	123135-123166	7	0.781
NC_006462_8	8.1\|200840\|32\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	200840-200871	32	NZ_CP044080	Paracoccus yeei strain FDAARGOS_643 plasmid unnamed3, complete sequence	109660-109691	7	0.781
NC_006462_8	8.1\|200840\|32\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	200840-200871	32	NZ_CP031079	Paracoccus yeei strain CCUG 32053 plasmid pYEE1, complete sequence	111548-111579	7	0.781
NC_006462_8	8.1\|200840\|32\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	200840-200871	32	NZ_CP041045	Paracoccus sp. AK26 plasmid pAK1, complete sequence	366469-366500	7	0.781
NC_006462_8	8.1\|200840\|32\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	200840-200871	32	NZ_CP051681	Cohnella sp. MFER-1 plasmid unnamed1	13067-13098	7	0.781
NC_006462_8	8.3\|200963\|32\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	200963-200994	32	NZ_CP020951	Rhizobium sp. CIAT894 plasmid pRheCIAT894d, complete sequence	176368-176399	7	0.781
NC_006462_8	8.3\|200963\|32\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	200963-200994	32	NZ_CP034813	Paracoccus sp. Arc7-R13 plasmid unnamed2, complete sequence	96979-97010	7	0.781
NC_006462_8	8.16\|201765\|33\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	201765-201797	33	MG652450	Ralstonia phage RsoP1IDN, complete genome	5268-5300	7	0.788
NC_006462_7	7.1\|189536\|32\|NC_006462\|CRISPRCasFinder,CRT	189536-189567	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	4103591-4103622	8	0.75
NC_006462_7	7.1\|189536\|32\|NC_006462\|CRISPRCasFinder,CRT	189536-189567	32	NZ_CP051472	Rhodobacter sphaeroides strain CH10 plasmid pRspCH10C, complete sequence	59608-59639	8	0.75
NC_006462_7	7.1\|189536\|32\|NC_006462\|CRISPRCasFinder,CRT	189536-189567	32	NZ_CP012965	Rhodobacter sphaeroides strain MBTLJ-8 plasmid unnamed, complete sequence	59053-59084	8	0.75
NC_006462_7	7.1\|189536\|32\|NC_006462\|CRISPRCasFinder,CRT	189536-189567	32	NZ_CP030275	Rhodobacter sphaeroides 2.4.1 plasmid pC, complete sequence	20868-20899	8	0.75
NC_006462_7	7.1\|189536\|32\|NC_006462\|CRISPRCasFinder,CRT	189536-189567	32	CP047035	Rhodobacter sphaeroides strain DSM 158 plasmid pC, complete sequence	59172-59203	8	0.75
NC_006462_7	7.1\|189536\|32\|NC_006462\|CRISPRCasFinder,CRT	189536-189567	32	NZ_CP015292	Rhodobacter sphaeroides strain MBTLJ-20 plasmid d, complete sequence	72298-72329	8	0.75
NC_006462_7	7.1\|189536\|32\|NC_006462\|CRISPRCasFinder,CRT	189536-189567	32	NZ_CP047041	Rhodobacter sphaeroides strain 2.4.1 substr. H2 plasmid pC, complete sequence	59139-59170	8	0.75
NC_006462_7	7.1\|189536\|32\|NC_006462\|CRISPRCasFinder,CRT	189536-189567	32	NZ_CP015214	Rhodobacter sphaeroides strain MBTLJ-13 plasmid c, complete sequence	74385-74416	8	0.75
NC_006462_7	7.3\|189659\|33\|NC_006462\|CRISPRCasFinder,CRT	189659-189691	33	NC_019959	Mycobacterium sp. JS623 plasmid pMYCSM03, complete sequence	15873-15905	8	0.758
NC_006462_7	7.10\|190088\|32\|NC_006462\|CRISPRCasFinder,CRT	190088-190119	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	969147-969178	8	0.75
NC_006462_7	7.12\|190210\|33\|NC_006462\|CRISPRCasFinder,CRT	190210-190242	33	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	2164457-2164489	8	0.758
NC_006462_7	7.12\|190210\|33\|NC_006462\|CRISPRCasFinder,CRT	190210-190242	33	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	1462846-1462878	8	0.758
NC_006462_7	7.14\|190334\|32\|NC_006462\|CRISPRCasFinder,CRT	190334-190365	32	NC_015851	Acidithiobacillus caldus SM-1 megaplasmid, complete sequence	172814-172845	8	0.75
NC_006462_7	7.14\|190334\|32\|NC_006462\|CRISPRCasFinder,CRT	190334-190365	32	NZ_CP026329	Acidithiobacillus caldus strain MTH-04 plasmid p1, complete sequence	132074-132105	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP030127	Indioceanicola profundi strain SCSIO 08040 plasmid unnamed1, complete sequence	697587-697618	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NC_015382	Burkholderia gladioli BSR3 plasmid bgla_1p, complete sequence	151407-151438	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP032323	Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence	694868-694899	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP022363	Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence	54154-54185	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_HG938356	Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141 plasmid pHAMBI1141a, complete sequence	557606-557637	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP032341	Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence	714278-714309	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP032347	Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence	341648-341679	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP012916	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence	334326-334357	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP026282	Klebsiella oxytoca strain KONIH2 plasmid pKOR-e3cb, complete sequence	25199-25230	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP026282	Klebsiella oxytoca strain KONIH2 plasmid pKOR-e3cb, complete sequence	221098-221129	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_KY020154	Klebsiella pneumoniae strain Kpn-431cz plasmid pKpn-431cz, complete sequence	53096-53127	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_KY020154	Klebsiella pneumoniae strain Kpn-431cz plasmid pKpn-431cz, complete sequence	99195-99226	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_KX869741	Enterobacter cloacae strain 20130723 plasmid R222, complete sequence	118636-118667	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_KY270853	Raoultella ornithinolytica strain YNKP001 plasmid pYNKP001-dfrA, complete sequence	200903-200934	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_KY270855	Pseudomonas putida strain 12969 plasmid p12969-2, complete sequence	17500-17531	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_KY126370	Enterobacter cloacae subsp. cloacae strain MN201516 plasmid pOP-I, complete sequence	103541-103572	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_KY270852	Enterobacter cloacae strain T5282 plasmid pT5282-mphA, complete sequence	135136-135167	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_KY494864	Pseudomonas aeruginosa strain FFUP_PS_37 plasmid pJB37, complete sequence	16448-16479	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP014072	Klebsiella quasipneumoniae strain FDAARGOS_93 plasmid unnamed1	36526-36557	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP050835	Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-1, complete sequence	121888-121919	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP009414	Salmonella enterica strain CFSAN007428 isolate N11150 plasmid pCFSAN007428_01, complete sequence	135023-135054	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	LC486677	Serratia marcescens MRY16-414SMA plasmid pMRY16-414SMA_2 DNA, complete sequence	3738-3769	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_KU356480	Vibrio parahaemolyticus strain VPS92 plasmid pVPS92-VEB, complete sequence	298042-298073	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_KX815983	Salmonella enterica subsp. enterica serovar Dublin strain N13-01125 plasmid pN13-01125, complete sequence	148301-148332	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_KX810825	Salmonella enterica subsp. enterica serovar Typhimurium strain MU1 plasmid pIMP4-SEM1, complete sequence	223172-223203	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_KU302802	Enterobacter cloacae strain SZECL1 plasmid pNDM1_SZ2 clone ST231, complete sequence	85552-85583	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_KU302801	Enterobacter cloacae strain SZECL1 plasmid pNDM1_SZ1 clone ST231, complete sequence	85552-85583	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP035548	Salmonella enterica subsp. enterica serovar Typhimurium strain YU07-18 plasmid pYU07-18_IncA/C2, complete sequence	121974-122005	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP009411	Salmonella enterica strain CFSAN007425 isolate 22697 plasmid pCFSAN007425_01, complete sequence	136596-136627	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP009413	Salmonella enterica strain CFSAN007427 isolate N20272 plasmid pCFSAN007427_01, complete sequence	144787-144818	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_KJ588780	Achromobacter xylosoxidans strain A22732 plasmid pA22732-IMP, complete sequence	47311-47342	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_KJ909290	Aeromonas salmonicida subsp. salmonicida strain 2004-05MF26 plasmid pSN254b, complete sequence	121140-121171	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_KJ958927	Klebsiella pneumoniae strain Kpn-3002cz plasmid pS-3002cz, complete sequence	68281-68312	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_KP688397	Vibrio parahaemolyticus strain V36 plasmid pVPH1, complete sequence	111343-111374	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_KR559888	Klebsiella pneumoniae strain Kpn642 plasmid pKP-Gr642, complete sequence	129082-129113	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_KP791968	Vibrio parahaemolyticus strain 2011VPH2 plasmid pVPH2, complete sequence	22448-22479	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_KM406488	Salmonella enterica subsp. enterica serovar Paratyphi B strain R69 plasmid R69, complete sequence	3247-3278	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_KT818627	Klebsiella pneumoniae strain U25 plasmid U25P002, complete sequence	113712-113743	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_KM406490	Salmonella enterica subsp. enterica serovar Typhimurium strain 202 plasmid pSEM, complete sequence	60242-60273	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_KM406489	Serratia marcescens strain R471 plasmid R471, complete sequence	58183-58214	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_KP975076	Pseudomonas aeruginosa strain MRSN17623 plasmid pMRVIM0713, complete sequence	3448-3479	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_KP975077	Enterobacter cloacae strain MRSN17626 plasmid pMRVIM0813, complete sequence	88846-88877	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_KP294351	Escherichia coli strain CZD1527 plasmid pIGT15, complete sequence	29328-29359	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_KT207463	Escherichia coli strain VA292 plasmid pDGO100, complete sequence	3904-3935	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_KU315015	Serratia marcescens strain NCTC 50331 plasmid R1215, complete sequence	40382-40413	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NC_014368	Klebsiella pneumoniae plasmid pNL194, complete sequence	51499-51530	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	AP018454	Klebsiella pneumoniae plasmid pMRY13-133KPN_2 DNA, complete genome, strain: MRY13-133	19403-19434	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	AP018455	Klebsiella aerogenes plasmid pMRY13-134EAE_1 DNA, complete genome, strain: MRY13-134	28421-28452	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP028197	Salmonella enterica subsp. enterica serovar Concord strain CFSAN018747 plasmid pGMI14-002_1, complete sequence	21021-21052	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP025141	Klebsiella pneumoniae strain KP1768 plasmid KP1768_p1, complete sequence	115160-115191	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP032391	Salmonella enterica subsp. enterica serovar Dublin strain CVM 34981 plasmid p34981_1, complete sequence	82640-82671	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_AP022376	Providencia rettgeri strain BML2531 plasmid pBML2531, complete sequence	6183-6214	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP049911	Diaphorobacter sp. HDW4A plasmid p_unnamed1, complete sequence	126940-126971	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP011599	Phytobacter ursingii strain CAV1151 plasmid pCAV1151-83, complete sequence	51436-51467	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP011601	Phytobacter ursingii strain CAV1151 plasmid pCAV1151-296, complete sequence	208989-209020	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP017987	Klebsiella pneumoniae strain 825795-1 plasmid unnamed2, complete sequence	5017-5048	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP047309	Citrobacter freundii strain L75 plasmid pCf76, complete sequence	4268-4299	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP045742	Escherichia coli strain DH5alpha plasmid pTHNK130-1, complete sequence	56023-56054	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP013324	Klebsiella pneumoniae strain CAV1193 plasmid pCAV1193-166, complete sequence	99062-99093	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	CP052410	Klebsiella pneumoniae strain C17KP0008 plasmid pC17KP0008-3, complete sequence	26502-26533	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP010373	Escherichia coli strain 6409 plasmid p6409-202.186kb, complete sequence	129376-129407	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP019187	Salmonella enterica subsp. enterica serovar Pomona str. ATCC 10729 plasmid pATCC10729_01, complete sequence	113-144	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP023418	Klebsiella pneumoniae strain 1050 plasmid pKp1050-2, complete sequence	7414-7445	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP044256	Salmonella enterica strain CFSAN096147 plasmid pCFSAN096147, complete sequence	146296-146327	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP048305	Escherichia coli strain 9 plasmid p009_A, complete sequence	127382-127413	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP025240	Salmonella enterica subsp. enterica serovar Newport str. USDA-ARS-USMARC-1928 plasmid pSNE3-1928, complete sequence	116680-116711	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP025242	Salmonella enterica subsp. enterica serovar Newport str. USDA-ARS-USMARC-1929 plasmid pSNE1-1929, complete sequence	68193-68224	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_KX426227	Acinetobacter lwoffii strain ED23-35 plasmid pALWED1.1, complete sequence	176765-176796	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_AP018755	Klebsiella pneumoniae strain KP67 plasmid pKP6702, complete sequence	13005-13036	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP024192	Klebsiella pneumoniae isolate KSB1_5D plasmid unnamed1, complete sequence	181006-181037	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP024194	Klebsiella pneumoniae isolate KSB1_5D plasmid unnamed3, complete sequence	30482-30513	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	MN477204	Escherichia coli strain S15FP06257 plasmid unnamed, complete sequence	35241-35272	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP029447	Serratia marcescens strain CAV1761 plasmid pCAV1761-73, complete sequence	42603-42634	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP029448	Serratia marcescens strain CAV1761 plasmid pCAV1761-205, complete sequence	80435-80466	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP015373	Pandoraea pnomenusa strain MCB032 plasmid unnamed 2, complete sequence	65246-65277	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP017059	Citrobacter freundii strain SL151 plasmid unnamed2, complete sequence	147036-147067	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP021328	Raoultella ornithinolytica strain Ro24724 plasmid pRo24724, complete sequence	38557-38588	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP026242	Citrobacter freundii complex sp. CFNIH9 plasmid pCFR-eb27, complete sequence	346842-346873	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP035636	Enterobacter cloacae strain EN3600 plasmid unnamed4, complete sequence	41297-41328	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_LS992184	Citrobacter freundii isolate Citrobacter freundii str. U2785 plasmid 2, complete sequence	66039-66070	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_KJ187752	Klebsiella pneumoniae strain 7433 plasmid pTR2, complete sequence	95325-95356	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP042506	Leclercia adecarboxylata strain E1 plasmid pE1_001, complete sequence	103381-103412	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP042507	Leclercia adecarboxylata strain E1 plasmid pE1_002, complete sequence	74219-74250	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP018716	Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-2, complete sequence	91519-91550	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP018722	Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-2, complete sequence	58010-58041	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP018704	Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-2, complete sequence	83013-83044	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP029249	Salmonella enterica subsp. enterica serovar Thompson strain HFCDC-SM-846 plasmid p846, complete sequence	124732-124763	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP019559	Escherichia coli strain KSC207 plasmid pMRGN207, complete sequence	219035-219066	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP025467	Klebsiella pneumoniae strain JS187 plasmid p187-1, complete sequence	166159-166190	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NC_022078	Klebsiella pneumoniae JM45 plasmid p1, complete sequence	31874-31905	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP009883	Pantoea sp. PSNIH1 plasmid pPSP-a3e, complete sequence	246991-247022	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP010378	Enterobacter hormaechei subsp. hormaechei strain 34983 plasmid p34983-59.134kb, complete sequence	2007-2038	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_AP022377	Providencia stuartii strain BML2537 plasmid pBML2537, complete sequence	117163-117194	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	MT077884	Escherichia coli plasmid p33, complete sequence	104158-104189	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	MT077886	Escherichia coli plasmid p39, complete sequence	103381-103412	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP026170	Leclercia sp. LSNIH1 plasmid pLEC-000f, complete sequence	31434-31465	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP026171	Leclercia sp. LSNIH1 plasmid pLEC-1cb1, complete sequence	238965-238996	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP022359	Shewanella bicestrii strain JAB-1 plasmid pSHE-CTX-M, complete sequence	86339-86370	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	MN336501	Pseudomonas aeruginosa strain 164130 plasmid p4130-KPC, complete sequence	1659-1690	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_EU880929	Klebsiella pneumoniae strain INS23K plasmid pLJ1, complete sequence	21306-21337	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP048293	Escherichia coli strain CVM N18EC0432 plasmid pN18EC0432-1, complete sequence	159387-159418	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP026196	Enterobacteriaceae bacterium ENNIH1 plasmid pENT-1f0b, complete sequence	54951-54982	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP028955	Klebsiella pneumoniae strain AR_0141 plasmid unnamed2, complete sequence	12685-12716	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP033627	Klebsiella pneumoniae strain 4743 plasmid unnamed2, complete sequence	169346-169377	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP033628	Klebsiella pneumoniae strain 4743 plasmid unnamed3, complete sequence	47976-48007	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	MN423361	Leclercia sp. strain 1106151 plasmid p1106151-mcr, complete sequence	105669-105700	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	HG969996	Klebsiella pneumoniae plasmid pIT-12C47, complete sequence	28249-28280	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	CP009869	Pantoea sp. PSNIH2 plasmid pPSP-75c, complete sequence	147794-147825	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	CP033569	Acinetobacter pittii strain 2014N21-145 plasmid p2014N21-145-1, complete sequence	142350-142381	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP012682	Salmonella enterica subsp. enterica serovar Typhimurium strain 33676 plasmid p33676_IncA/C, complete sequence	130245-130276	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	CP044029	Klebsiella pneumoniae strain RJY9645 plasmid pY9645-166, complete sequence	108990-109021	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP017750	Cupriavidus sp. USMAA2-4 plasmid unnamed1, complete sequence	76054-76085	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP017750	Cupriavidus sp. USMAA2-4 plasmid unnamed1, complete sequence	317864-317895	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP020529	Enterobacter cloacae strain 174 plasmid unnamed1, complete sequence	29496-29527	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP020531	Enterobacter cloacae strain 174 plasmid unnamed3, complete sequence	34499-34530	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP032385	Salmonella enterica subsp. enterica serovar Dublin strain CVM N53043 plasmid pN53043_1, complete sequence	17226-17257	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NC_018107	Klebsiella michiganensis E718 plasmid pKOX_R1, complete sequence	30923-30954	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP010801	Ralstonia mannitolilytica strain SN82F48 plasmid pRMAN01, complete sequence	106043-106074	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP020854	Klebsiella pneumoniae strain KPN528 plasmid pKPN528-1, complete sequence	51337-51368	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP020856	Klebsiella pneumoniae strain KPN528 plasmid pKPN528-3, complete sequence	38446-38477	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NC_003384	Salmonella enterica subsp. enterica serovar Typhi str. CT18 plasmid pHCM1, complete sequence	116645-116676	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP025277	Salmonella enterica subsp. enterica strain USDA-ARS-USMARC-60984 plasmid pSJO-60984, complete sequence	110186-110217	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	LC549808	Klebsiella pneumoniae VNCKp83 plasmid pVNCKp83 DNA, complete sequence	21511-21542	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP014978	Salmonella enterica subsp. enterica serovar Typhimurium str. USDA-ARS-USMARC-1896 isolate ST03-F34 plasmid pSTY1-1896, complete sequence	117395-117426	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NC_017908	Mycobacterium abscessus subsp. bolletii F1725 plasmid BRA100, complete sequence	52841-52872	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP042480	Citrobacter freundii strain C50 plasmid pC50_002, complete sequence	78140-78171	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP031567	Enterobacter hormaechei strain 2013_1a plasmid pIncHI2-1301491, complete sequence	16445-16476	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP031563	Klebsiella pneumoniae strain 2-1 plasmid pKP21HI1, complete sequence	166702-166733	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP031564	Klebsiella pneumoniae strain 2-1 plasmid pKP21AC2, complete sequence	808-839	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP032397	Salmonella enterica subsp. enterica serovar Dublin strain CVM 22429 plasmid p22429, complete sequence	151076-151107	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP028784	Klebsiella pneumoniae strain SCKP020049 plasmid p1_020049, complete sequence	63185-63216	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	MN254970	Escherichia coli strain EC009 plasmid pEC009.1, complete sequence	136541-136572	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP014658	Salmonella enterica subsp. enterica serovar Anatum str. USDA-ARS-USMARC-1736 plasmid pSAN1-1736, complete sequence	111154-111185	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NC_019165	Klebsiella pneumoniae plasmid pKPN101-IT, complete sequence	102530-102561	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP035381	Leclercia adecarboxylata strain R25 plasmid pLA-64, complete sequence	51870-51901	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP043190	Escherichia coli O16:H48 strain PG20180175 plasmid pPG20180175.1-IncAC2, complete sequence	134609-134640	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP044142	Escherichia coli O157 strain AR-0429 plasmid pAR-0429-1, complete sequence	59409-59440	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	MN310380	Raoultella ornithinolytica strain 170602815 plasmid p602815-NR, complete sequence	95557-95588	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP025231	Salmonella enterica subsp. enterica serovar Newport str. USDA-ARS-USMARC-1924 plasmid pSNE1-1924, complete sequence	128312-128343	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP012754	Klebsiella pneumoniae strain KP617 plasmid KP-p1, complete sequence	29864-29895	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	MH909331	Leclercia adecarboxylata plasmid p707804-NDM, complete sequence	247660-247691	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP031736	Klebsiella pneumoniae subsp. pneumoniae strain Klebsiella pneumoniae plasmid pKPM502, complete sequence	77484-77515	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP018819	Klebsiella pneumoniae strain AR_0049 plasmid unitig_3, complete sequence	6625-6656	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP037966	Klebsiella pneumoniae strain SCKP020135 plasmid p1_020135, complete sequence	60902-60933	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	MF495478	Aeromonas salmonicida plasmid pS121-1b, complete sequence	84076-84107	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP038330	Escherichia coli O157:H7 strain NE 1092-2 plasmid pNE1092-3, complete sequence	61609-61640	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NC_024997	Klebsiella oxytoca plasmid pACM1, complete sequence	7716-7747	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP043215	Salmonella enterica subsp. enterica serovar Heidelberg strain SL-312 plasmid pET8.1-IncAC2, complete sequence	134609-134640	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP023250	Klebsiella pneumoniae strain CCUG 70742 plasmid pKpn70742_1	18967-18998	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	KU160531	Vibrio alginolyticus strain VAS3-1 plasmid pVAS3-1, complete sequence	144223-144254	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	CP052417	Klebsiella pneumoniae strain C16KP0189 plasmid pC16KP0189-3, complete sequence	26787-26818	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_MN433457	Pseudomonas aeruginosa strain PAB546 plasmid pNK546-KPC, complete sequence	309192-309223	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_MN433457	Pseudomonas aeruginosa strain PAB546 plasmid pNK546-KPC, complete sequence	337760-337791	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP008825	UNVERIFIED_ORG: Enterobacter cloacae ECNIH2 plasmid pKPC-272, complete sequence	107645-107676	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP028562	Aeromonas hydrophila subsp. hydrophila strain WCHAH045096 plasmid p1_045096, complete sequence	5132-5163	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP041100	Klebsiella pneumoniae subsp. pneumoniae strain KPCTRSRTH07 plasmid unnamed1, complete sequence	77037-77068	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP042483	Klebsiella pneumoniae strain C51 plasmid pC51_002, complete sequence	45542-45573	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP046330	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed1, complete sequence	134000-134031	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP046332	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed2	59886-59917	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	MN310378	Klebsiella pneumoniae strain A2293 plasmid pA2293-Ct2, complete sequence	44030-44061	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP021835	Klebsiella pneumoniae strain AR_0120 plasmid tig00000516_pilon, complete sequence	173057-173088	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP026545	Cupriavidus metallidurans strain Ni-2 plasmid unnamed1	10056-10087	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	CP034667	Proteus vulgaris strain PvSC3 plasmid pPvSC3, complete sequence	197238-197269	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP009560	Salmonella enterica subsp. enterica serovar Newport str. CVM 22425 plasmid pCVM22425, complete sequence	62236-62267	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP033574	Shewanella algae strain KC-Na-R1 plasmid pKC-Na-R1, complete sequence	80048-80079	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP035180	Klebsiella pneumoniae strain BA33875 plasmid pBA33875_IncFIB, complete sequence	222875-222906	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NC_008573	Shewanella sp. ANA-3 plasmid unnamed1, complete sequence	230833-230864	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP022696	Citrobacter farmeri strain AUSMDU00008141 plasmid pAUSMDU8141-1, complete sequence	236899-236930	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP052871	Enterobacter cloacae strain 3849 plasmid p3846_IncHI2_mcr, complete sequence	252128-252159	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP052873	Enterobacter cloacae strain 3849 plasmid p3846III, complete sequence	41482-41513	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP010351	Acinetobacter johnsonii XBB1 plasmid pXBB1-9, complete sequence	326285-326316	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP021961	Klebsiella pneumoniae strain AR_0139 plasmid tig00000006, complete sequence	15595-15626	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NC_022372	Salmonella enterica subsp. enterica serovar Typhimurium plasmid pYT3 DNA, complete sequence	64816-64847	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP028791	Klebsiella pneumoniae strain WCHKP020030 plasmid pOXA1_020030, complete sequence	165638-165669	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP028993	Klebsiella pneumoniae strain AR_0142 plasmid unnamed3, complete sequence	25440-25471	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP029135	Klebsiella pneumoniae strain AR376 plasmid unnamed1, complete sequence	46263-46294	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	CP049311	Salmonella enterica subsp. enterica serovar Heidelberg strain CVM N53023 plasmid pN53023, complete sequence	16294-16325	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	CP052554	Klebsiella pneumoniae strain A17KP0038 plasmid pA17KP0038-3, complete sequence	26494-26525	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP029396	Acinetobacter defluvii strain WCHA30 plasmid pOXA58_010030, complete sequence	299452-299483	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_LT991958	Enterobacter cloacae complex sp. isolate C45 plasmid pC45-VIM4	136350-136381	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_LT991959	Enterobacter cloacae complex sp. isolate C45 plasmid pC45-p2	48566-48597	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	KU238092	Uncultured bacterium plasmid pDTC28, complete sequence	44020-44051	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP029037	Salmonella enterica subsp. enterica serovar Senftenberg str. 361154004 plasmid unnamed, complete sequence	111671-111702	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP043856	Enterobacter hormaechei strain EB_P6_L3_02.19 plasmid pIMPIncN3_52kb, complete sequence	42162-42193	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP026974	Achromobacter insolitus strain FDAARGOS_88 plasmid unnamed1, complete sequence	62276-62307	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP044215	Klebsiella aerogenes strain KA_P10_L5_03.19 plasmid pIMPIncH12_334kb, complete sequence	136865-136896	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP026753	Klebsiella pneumoniae strain AR_0066 plasmid tig00000084_pilon, complete sequence	22078-22109	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP009562	Salmonella enterica subsp. enterica serovar Newport str. CVM 22513 plasmid pCVM22513, complete sequence	27470-27501	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP021168	Enterobacter hormaechei strain 388 plasmid p388, complete sequence	231-262	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	KM659090	Achromobacter sp. LM16 plasmid pLM16A1, complete sequence	23302-23333	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP039526	Klebsiella pneumoniae subsp. pneumoniae strain HB25-1 plasmid pHB25-1-vir, complete sequence	222638-222669	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP038464	Aeromonas hydrophila strain WCX23 plasmid unnamed, complete sequence	61674-61705	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP027044	Klebsiella pneumoniae strain 1_GR_13 plasmid IncFIB IncFII, complete sequence	100458-100489	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP029599	Klebsiella quasipneumoniae subsp. similipneumoniae strain ATCC 700603 plasmid pDA33145-77, complete sequence	34739-34770	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	CP049307	Salmonella enterica subsp. enterica serovar Heidelberg strain CVM N58631 plasmid p58631, complete sequence	220174-220205	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP032285	Acinetobacter sp. WCHA55 plasmid pOXA58_010055, complete sequence	308482-308513	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NC_019093	Escherichia coli plasmid pLST424C-61, complete sequence	17373-17404	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NC_009140	Salmonella enterica subsp. enterica serovar Newport str. SL254 plasmid pSN254, complete sequence	146572-146603	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP021688	Klebsiella pneumoniae strain AR_0146 plasmid tig00001189, complete sequence	67194-67225	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP012168	Enterobacter hormaechei subsp. steigerwaltii strain 34998 plasmid p34998-239.973kb, complete sequence	139535-139566	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP035277	Citrobacter freundii strain R17 plasmid pCFR17_1, complete sequence	94577-94608	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP021163	Enterobacter hormaechei strain 234 plasmid p234, complete sequence	40759-40790	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP038466	Aeromonas hydrophila strain 23-C-23 plasmid unnamed, complete sequence	22850-22881	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	LT009689	Klebsiella pneumoniae plasmid pIT-12C73, strain 12C73, complete sequence	100734-100765	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	JX469831	Uncultured bacterium plasmid pKSP212, complete sequence	52544-52575	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP042494	Leclercia adecarboxylata strain E61 plasmid pE61_001, complete sequence	103381-103412	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP042495	Leclercia adecarboxylata strain E61 plasmid pE61_002, complete sequence	169156-169187	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP008933	Klebsiella pneumoniae strain PMK1 plasmid pPMK1-NDM, complete sequence	220096-220127	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP032180	Citrobacter freundii strain AR_0116 plasmid unnamed2, complete sequence	36021-36052	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP009116	Klebsiella pneumoniae strain carbapenem-resistant blaNDM-1 plasmid p1, complete sequence	25245-25276	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP040696	Citrobacter freundii strain R47 plasmid pR47-309, complete sequence	58429-58460	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP040697	Citrobacter freundii strain R47 plasmid pR47-54, complete sequence	11020-11051	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP028563	Aeromonas hydrophila subsp. hydrophila strain WCHAH045096 plasmid p2_045096, complete sequence	3757-3788	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP026390	Leclercia sp. LSNIH3 plasmid pLEC-5e18, complete sequence	186566-186597	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP026391	Leclercia sp. LSNIH3 plasmid pLEC-7c0d, complete sequence	246742-246773	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NC_017645	Escherichia coli UMNK88 plasmid pUMNK88, complete sequence	130670-130701	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP009567	Salmonella enterica subsp. enterica serovar Newport str. CVM 22462 plasmid pCFSAN000934_02, complete sequence	106763-106794	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP008899	Enterobacter hormaechei subsp. hoffmannii ECNIH3 plasmid pENT-8a4, complete sequence	179877-179908	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP029142	Klebsiella michiganensis strain AR375 plasmid unnamed2, complete sequence	41172-41203	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP048381	Klebsiella variicola strain 118 plasmid p118_B-OXA1, complete sequence	24605-24636	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP007636	Vibrio cholerae strain 2012EL-2176 plasmid unnamed, complete sequence	154198-154229	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	MF344569	Pseudomonas aeruginosa plasmid p12939-PER, complete sequence	310152-310183	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP041248	Raoultella electrica strain DSM 102253 plasmid unnamed1, complete sequence	89454-89485	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP041248	Raoultella electrica strain DSM 102253 plasmid unnamed1, complete sequence	151452-151483	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP008843	Klebsiella michiganensis strain M1 plasmid pKOXM1B, complete sequence	130342-130373	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_AP019667	Klebsiella pneumoniae strain TA6363 plasmid pTMTA63632, complete sequence	24232-24263	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NC_012690	Escherichia coli plasmid peH4H, complete sequence	118193-118224	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NC_032101	Enterobacter cloacae plasmid pG6809-2, complete sequence	36763-36794	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP025964	Klebsiella pneumoniae strain WCHKP34 plasmid pIMP4_LL34, complete sequence	118532-118563	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP041052	Enterobacter hormaechei strain C126 plasmid pEnC126NDM, complete sequence	30639-30670	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP042552	Enterobacter hormaechei strain C45 plasmid pC45_001, complete sequence	103381-103412	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP042553	Enterobacter hormaechei strain C45 plasmid pC45_002, complete sequence	78140-78171	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP022156	Escherichia coli strain ABWA45 plasmid pABWA45_2, complete sequence	4819-4850	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP020068	Klebsiella pneumoniae strain AR_0068 plasmid unitig_1, complete sequence	221043-221074	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP020070	Klebsiella pneumoniae strain AR_0068 plasmid unitig_4, complete sequence	1051-1082	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP032238	Escherichia coli strain ECCWS199 plasmid pTB221, complete sequence	131332-131363	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	JN106172	Uncultured bacterium plasmid pAKD29, complete sequence	53223-53254	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	JN106173	Uncultured bacterium plasmid pAKD31, complete sequence	52342-52373	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	JN106174	Uncultured bacterium plasmid pAKD33, complete sequence	56176-56207	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP016526	Salmonella enterica subsp. enterica serovar Heidelberg strain 09-036813-1A plasmid p09-036813-1A_261, complete sequence	34421-34452	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP015991	Klebsiella pneumoniae strain BR plasmid pWSZBR, complete sequence	18669-18700	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP028929	Klebsiella pneumoniae strain AR_0153 plasmid unnamed1, complete sequence	96857-96888	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP028931	Klebsiella pneumoniae strain AR_0153 plasmid unnamed3, complete sequence	51171-51202	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP031575	Enterobacter hormaechei strain A1 plasmid pIncHI2-1502264, complete sequence	227819-227850	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP024557	Klebsiella pneumoniae strain INF164 plasmid unnamed1, complete sequence	179619-179650	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	CP050163	Escherichia coli plasmid Carbapenemase(KPC-2)_IncHI2, complete sequence	109156-109187	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP025517	Klebsiella pneumoniae strain 002SK2 plasmid p002SK2_B, complete sequence	60020-60051	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP032520	Cupriavidus oxalaticus strain T2 plasmid unnamed1, complete sequence	2838-2869	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP032520	Cupriavidus oxalaticus strain T2 plasmid unnamed1, complete sequence	76273-76304	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP032520	Cupriavidus oxalaticus strain T2 plasmid unnamed1, complete sequence	559418-559449	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP041172	Salmonella enterica subsp. enterica serovar Thompson strain SH11G0791 plasmid pSH11G0791, complete sequence	50274-50305	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP024641	Klebsiella michiganensis strain F107 plasmid unnamed1, complete sequence	44986-45017	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NC_002698	Shigella flexneri 5a virulence plasmid pWR501, complete sequence	200481-200512	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	KP294350	Uncultured bacterium plasmid pARM26, complete sequence	31158-31189	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	JN106164	Uncultured bacterium plasmid pAKD1, complete sequence	55793-55824	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	JN106165	Uncultured bacterium plasmid pAKD14, complete sequence	46826-46857	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	JN106166	Uncultured bacterium plasmid pAKD15, complete sequence	64752-64783	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	JN106168	Uncultured bacterium plasmid pAKD17, complete sequence	49957-49988	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	JN106169	Uncultured bacterium plasmid pAKD18, complete sequence	65500-65531	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP011614	Klebsiella oxytoca strain CAV1335 plasmid pCAV1335-92, complete sequence	40990-41021	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP041734	Enterobacter hormaechei subsp. steigerwaltii strain ME-1 plasmid pME-1a, complete sequence	117710-117741	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP024529	Klebsiella pneumoniae strain INF157 plasmid unnamed1, complete sequence	181006-181037	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP026230	Aeromonas sp. ASNIH1 plasmid pKPC-038c, complete sequence	46648-46679	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP024682	Citrobacter freundii strain UMH14 plasmid pUMH14_2, complete sequence	53220-53251	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP016919	Klebsiella pneumoniae isolate 11 plasmid pIncR_DHQP1300920, complete sequence	11080-11111	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP016921	Klebsiella pneumoniae isolate 11 plasmid pIncHI1B_DHQP1300920, complete sequence	264213-264244	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	CP050156	Klebsiella pneumoniae plasmid Carbapenemase(NDM-1)_IncH1B, complete sequence	209691-209722	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP017932	Klebsiella oxytoca strain CAV1015 plasmid pCAV1015-76, complete sequence	31773-31804	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP032491	Salmonella enterica subsp. enterica serovar Typhimurium strain SL26 plasmid pSL26_IncA/C2, complete sequence	117666-117697	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP032496	Salmonella enterica subsp. enterica serovar Typhimurium strain SO21 plasmid pSO21_IncA/C2, complete sequence	59567-59598	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP024522	Klebsiella pneumoniae strain INF158 plasmid unnamed1, complete sequence	181006-181037	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP024524	Klebsiella pneumoniae strain INF158 plasmid unnamed3, complete sequence	30482-30513	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP011540	Klebsiella aerogenes strain G7 plasmid pGPN1, complete sequence	47146-47177	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	MN583270	Pseudomonas aeruginosa strain NK546 plasmid pNK546b, complete sequence	16980-17011	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	MN583270	Pseudomonas aeruginosa strain NK546 plasmid pNK546b, complete sequence	221301-221332	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	MK933279	Enterobacter hormaechei strain SCNJ07 plasmid pMCR-SCNJ07, complete sequence	227222-227253	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP015139	Escherichia coli strain Ecol_732 plasmid pEC732_IMP14, complete sequence	3565-3596	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP022612	Klebsiella pneumoniae strain CDC 0106 plasmid unnamed1, complete sequence	159490-159521	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP022612	Klebsiella pneumoniae strain CDC 0106 plasmid unnamed1, complete sequence	229119-229150	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NC_021845	Salmonella enterica subsp. enterica serovar Cubana str. CFSAN002050 plasmid unnamed, complete sequence	80505-80536	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NC_005211	Serratia marcescens plasmid R478, complete sequence	107917-107948	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NC_019066	Escherichia coli plasmid pAPEC1990_61, complete sequence	131178-131209	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP017935	Klebsiella pneumoniae strain CAV1016 plasmid pCAV1016-90, complete sequence	74745-74776	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP017936	Klebsiella pneumoniae strain CAV1016 plasmid pCAV1016-76, complete sequence	46738-46769	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	CP028804	Klebsiella pneumoniae strain WCHKP7E2 plasmid pCMY2_085072, complete sequence	292904-292935	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP046347	Citrobacter portucalensis strain FDAARGOS_738 plasmid unnamed1, complete sequence	40396-40427	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP030270	Klebsiella pneumoniae subsp. pneumoniae strain SC-7 plasmid pSC7-vir, complete sequence	203622-203653	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP026154	Klebsiella pneumoniae strain F10(AN) plasmid pF10AN_1, complete sequence	17789-17820	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP026154	Klebsiella pneumoniae strain F10(AN) plasmid pF10AN_1, complete sequence	293091-293122	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	KY014465	Vibrio parahaemolyticus plasmid pVPS114, complete sequence	89829-89860	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	KY014466	Vibrio vulnificus plasmid pVVS1-per1, complete sequence	56720-56751	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP018451	Klebsiella pneumoniae strain Kp_Goe_71070 plasmid pKp_Goe_070-1, complete sequence	2473-2504	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NC_016976	Klebsiella pneumoniae plasmid pR55, complete sequence	124847-124878	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NC_016978	Comamonas testosteroni plasmid pI2, complete sequence	82406-82437	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NC_016980	Klebsiella pneumoniae plasmid pNDM-MAR, complete sequence	147961-147992	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP017451	Klebsiella sp. LTGPAF-6F plasmid unnamed1, complete sequence	347946-347977	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP043927	Klebsiella quasipneumoniae subsp. quasipneumoniae strain M17277 plasmid p17277A_477, complete sequence	224272-224303	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP011640	Serratia marcescens strain CAV1492 plasmid pCAV1492-73, complete sequence	16488-16519	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP011641	Serratia marcescens strain CAV1492 plasmid pCAV1492-199, complete sequence	37661-37692	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP020902	Klebsiella pneumoniae strain K66-45 plasmid pK66-45-1, complete sequence	218054-218085	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP045675	Klebsiella pneumoniae strain WSD411 plasmid pWSD411_2, complete sequence	151227-151258	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP025275	Salmonella enterica subsp. enterica serovar Newport str. USDA-ARS-USMARC-1923 plasmid pSNE2-1923	112065-112096	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP031103	Leclercia sp. W17 plasmid pW17-2, complete sequence	50962-50993	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP027670	Simplicispira suum strain SC1-8 plasmid unnamed1, complete sequence	19698-19729	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP040362	Klebsiella pneumoniae strain R50 plasmid pR50-74, complete sequence	71277-71308	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP042519	Citrobacter freundii strain E33 plasmid pE33_002, complete sequence	78140-78171	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP042547	Klebsiella michiganensis strain C52 plasmid pC52_002, complete sequence	102086-102117	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP046614	Klebsiella pneumoniae strain WCGKP294 plasmid pWCGKP294-2, complete sequence	210508-210539	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP029723	Klebsiella pneumoniae strain AR_0140 plasmid unnamed1, complete sequence	67697-67728	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP027173	Pseudomonas aeruginosa strain AR_0353 plasmid unnamed1, complete sequence	6480-6511	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	CP051274	Salmonella enterica subsp. enterica serovar Worthington strain OLF-FSR1_WB_Partridge_SW-37 plasmid pSW37-267109, complete sequence	244671-244702	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP038450	Aeromonas media strain R50-22 plasmid pAeme6, complete sequence	67012-67043	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_AP018748	Klebsiella pneumoniae strain KP33 plasmid pKP3301, complete sequence	88472-88503	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	CP028419	Aeromonas hydrophila strain WCX23 plasmid pWCX23_1, complete sequence	123883-123914	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP011632	Klebsiella oxytoca strain CAV1374 plasmid pCAV1374-84, complete sequence	52420-52451	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP011633	Klebsiella oxytoca strain CAV1374 plasmid pCAV1374-150, complete sequence	80609-80640	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP011634	Klebsiella oxytoca strain CAV1374 plasmid pCAV1374-228, complete sequence	54178-54209	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP011634	Klebsiella oxytoca strain CAV1374 plasmid pCAV1374-228, complete sequence	78043-78074	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP011634	Klebsiella oxytoca strain CAV1374 plasmid pCAV1374-228, complete sequence	150496-150527	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP011634	Klebsiella oxytoca strain CAV1374 plasmid pCAV1374-228, complete sequence	174361-174392	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP024550	Klebsiella pneumoniae strain INF163 plasmid unnamed1, complete sequence	149542-149573	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP018318	Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-2, complete sequence	37416-37447	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP014698	Klebsiella quasipneumoniae strain ATCC 700603 isolate K6 plasmid pKQPS2, complete sequence	75162-75193	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	MN842294	Leclercia adecarboxylata strain G426 plasmid pG426-FII, complete sequence	86603-86634	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	KF743817	Proteus mirabilis plasmid R772, complete sequence	58090-58121	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	KF743818	Bordetella bronchiseptica plasmid R906, complete sequence	54846-54877	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	CP051271	Salmonella enterica subsp. enterica serovar Worthington strain OLF-FSR1_WB_Quail_SW-70 plasmid pSW37-267106, complete sequence	228078-228109	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP032340	Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence	354001-354032	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP011595	Klebsiella oxytoca strain CAV1099 plasmid pKPC_CAV1099, complete sequence	105965-105996	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP043767	Enterobacter hormaechei strain EB_P9_L5_03.19 plasmid pIMPIncH12_331kb, complete sequence	189579-189610	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP021712	Klebsiella pneumoniae strain AR_0143 plasmid tig00000857, complete sequence	37804-37835	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP025236	Salmonella enterica subsp. enterica serovar Newport str. USDA-ARS-USMARC-1926 plasmid pSNE2-1926, complete sequence	92700-92731	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	KX957968	Vibrio alginolyticus plasmid pVAS19, complete sequence	70068-70099	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP013115	Shewanella xiamenensis strain T17 plasmid pSx1, complete sequence	158078-158109	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP013215	Klebsiella pneumoniae subsp. pneumoniae strain H11 plasmid pH11, complete sequence	245176-245207	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP053365	Klebsiella pneumoniae strain BA2275 plasmid p1, complete sequence	48697-48728	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP009570	Salmonella enterica subsp. enterica serovar Newport str. CVM N1543 isolate CFSAN000926 plasmid pCVMN1543, complete sequence	103065-103096	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP009564	Salmonella enterica subsp. enterica serovar Newport str. CVM 21550 plasmid pCVM21550, complete sequence	27075-27106	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP009563	Salmonella enterica subsp. enterica serovar Newport str. CVM 21538 plasmid pCVM21538, complete sequence	29729-29760	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NC_006525	Cupriavidus metallidurans CH34 plasmid pMOL28, complete sequence	144147-144178	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NC_020123	Citrobacter freundii strain CFSTE plasmid pT-OXA-181, complete sequence	39657-39688	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NC_024992	Klebsiella pneumoniae plasmid pKp848CTX, complete sequence	9335-9366	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP011622	Klebsiella pneumoniae strain CAV1344 plasmid pKPC_CAV1344, complete sequence	135819-135850	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP013265	Sphingobium baderi strain DE-13 plasmid pDE1, complete sequence	220463-220494	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_AP018752	Klebsiella pneumoniae strain KP64 plasmid pKP6402, complete sequence	13044-13075	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP040595	Klebsiella pneumoniae subsp. pneumoniae strain KpvST15_NDM plasmid pKpvST15, complete sequence	54346-54377	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NC_012556	Enterobacter cloacae plasmid pEC-IMPQ, complete sequence	103381-103412	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NC_012555	Enterobacter cloacae plasmid pEC-IMP, complete sequence	103381-103412	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP041209	Salmonella enterica subsp. enterica serovar Newport strain SAP18-8729 plasmid pCFSAN074384_1, complete sequence	71847-71878	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP011576	Klebsiella pneumoniae strain CAV1392 plasmid pCAV1392-50, complete sequence	38356-38387	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP042579	Enterobacter kobei strain C16 plasmid pC16_001, complete sequence	105697-105728	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NC_019906	Pseudomonas putida HB3267 plasmid pPC9, complete sequence	66382-66413	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP025578	Klebsiella pneumoniae strain 08EU827 plasmid p08EU827_2, complete sequence	75715-75746	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP006799	Klebsiella pneumoniae subsp. pneumoniae PittNDM01 plasmid p1, complete sequence	80245-80276	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP006801	Klebsiella pneumoniae subsp. pneumoniae PittNDM01 plasmid p3, complete sequence	25211-25242	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP011610	Citrobacter freundii strain CAV1321 plasmid pCAV1321-135, complete sequence	76651-76682	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP043516	Enterobacter kobei strain EB_P8_L5_01.19 plasmid pIMPIncN3_57kb, complete sequence	35009-35040	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP018689	Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-2, complete sequence	11939-11970	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NC_019116	Salmonella enterica subsp. enterica serovar Heidelberg plasmid pSH163_135, complete sequence	105266-105297	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NC_019118	Salmonella enterica subsp. enterica serovar Heidelberg plasmid pSH696_135, complete sequence	105521-105552	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NC_019121	Salmonella enterica subsp. enterica serovar Heidelberg plasmid pSH111_166, complete sequence	49784-49815	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP041935	Klebsiella pneumoniae strain KP14003 plasmid unnamed1, complete sequence	158682-158713	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP012956	Acinetobacter baumannii strain D36 plasmid pD36-4 clone GC1, complete sequence	37490-37521	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP024573	Klebsiella pneumoniae strain INF274 plasmid unnamed3, complete sequence	30482-30513	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP026234	Citrobacter freundii complex sp. CFNIH4 plasmid pCFR-4109, complete sequence	187799-187830	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP026234	Citrobacter freundii complex sp. CFNIH4 plasmid pCFR-4109, complete sequence	253407-253438	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	AP022352	Klebsiella pneumoniae E208 plasmid pE208_IMP6 DNA, complete sequence	33875-33906	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP031884	Klebsiella pneumoniae strain WCHKP095845 plasmid pNDM1_095845, complete sequence	48792-48823	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP051135	Enterobacter hormaechei strain AMS-38 plasmid pAMS-38c, complete sequence	206727-206758	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NC_012692	Escherichia coli plasmid pAR060302, complete sequence	136628-136659	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NC_012693	Salmonella enterica plasmid pAM04528, complete sequence	128312-128343	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP032842	Enterobacter hormaechei strain C15117 plasmid pSPRC-Echo1, complete sequence	103381-103412	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP024564	Klebsiella pneumoniae strain INF278 plasmid unnamed1, complete sequence	149542-149573	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP024566	Klebsiella pneumoniae strain INF278 plasmid unnamed3, complete sequence	30482-30513	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP026851	UNVERIFIED_ORG: Enterobacter cloacae strain AR_0072 plasmid unnamed1	1678-1709	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP026851	UNVERIFIED_ORG: Enterobacter cloacae strain AR_0072 plasmid unnamed1	12144-12175	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP026851	UNVERIFIED_ORG: Enterobacter cloacae strain AR_0072 plasmid unnamed1	138252-138283	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP026851	UNVERIFIED_ORG: Enterobacter cloacae strain AR_0072 plasmid unnamed1	148715-148746	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NC_019344	Serratia marcescens plasmid R830b, complete sequence	71834-71865	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NC_019380	Aeromonas hydrophila plasmid pR148, complete sequence	134893-134924	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP027425	Klebsiella oxytoca strain FDAARGOS_335 plasmid unnamed, complete sequence	190915-190946	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP046032	Salmonella sp. HNK130 plasmid pTHNK130-2, complete sequence	69907-69938	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP046034	Salmonella sp. HNK130 plasmid unnamed, complete sequence	35314-35345	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP021695	Proteus mirabilis strain AR_0155 plasmid tig00000123, complete sequence	204331-204362	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP021953	Klebsiella pneumoniae strain AR_0148 plasmid tig00000185_pilon, complete sequence	18418-18449	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP032395	Salmonella enterica subsp. enterica serovar Dublin strain CVM 22453 plasmid p22453_1, complete sequence	48585-48616	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	KY320277	Leclercia adecarboxylata strain Lec-476 plasmid pLec-476, complete sequence	149390-149421	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP042525	Citrobacter freundii strain E11 plasmid pE11_001, complete sequence	103381-103412	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_AP018830	Enterobacter hormaechei subsp. xiangfangensis strain M206 plasmid pM206-NDM1, complete sequence	13044-13075	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	CP052479	Klebsiella pneumoniae strain C16KP0050 plasmid pC16KP0050-3, complete sequence	26494-26525	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_LT991955	Enterobacter hormaechei subsp. steigerwaltii isolate C309 plasmid pC309-VIM4	112352-112383	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_LT991956	Enterobacter hormaechei subsp. steigerwaltii isolate C309 plasmid pC309-p2	30234-30265	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NC_023898	Klebsiella pneumoniae plasmid pRMH760, complete sequence	143096-143127	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	CP020502	Serratia marcescens strain BWH-23 plasmid unnamed, complete sequence	58138-58169	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP026014	Klebsiella variicola strain 13450 plasmid p13450-1, complete sequence	291149-291180	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP026018	Klebsiella pneumoniae strain 13190 plasmid p13190-2, complete sequence	54043-54074	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP022170	Aeromonas salmonicida strain S121 plasmid pS121-1a, complete sequence	86565-86596	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP025144	Klebsiella pneumoniae strain NR5632 plasmid NR5632_p1, complete sequence	115012-115043	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP025147	Klebsiella pneumoniae strain KP1766 plasmid KP1766_p1, complete sequence	120466-120497	8	0.75
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP038654	Citrobacter freundii strain 154 plasmid p154_1, complete sequence	268706-268737	8	0.75
NC_006462_7	7.21\|190765\|32\|NC_006462\|CRISPRCasFinder,CRT	190765-190796	32	NZ_CP029986	Sphingomonas sp. FARSPH plasmid p01, complete sequence	238761-238792	8	0.75
NC_006462_7	7.21\|190765\|32\|NC_006462\|CRISPRCasFinder,CRT	190765-190796	32	NZ_CP012477	Arthrobacter sp. ERGS1:01 isolate water plasmid unnamed2, complete sequence	516292-516323	8	0.75
NC_006462_7	7.21\|190765\|32\|NC_006462\|CRISPRCasFinder,CRT	190765-190796	32	NZ_AP014705	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence	672787-672818	8	0.75
NC_006462_7	7.22\|190826\|32\|NC_006462\|CRISPRCasFinder,CRT	190826-190857	32	NZ_CP026489	Streptomyces sp. 604F plasmid unnamed, complete sequence	1887-1918	8	0.75
NC_006462_7	7.24\|189538\|32\|NC_006462\|PILER-CR	189538-189569	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	4103591-4103622	8	0.75
NC_006462_7	7.24\|189538\|32\|NC_006462\|PILER-CR	189538-189569	32	NZ_CP051472	Rhodobacter sphaeroides strain CH10 plasmid pRspCH10C, complete sequence	59608-59639	8	0.75
NC_006462_7	7.24\|189538\|32\|NC_006462\|PILER-CR	189538-189569	32	NZ_CP012965	Rhodobacter sphaeroides strain MBTLJ-8 plasmid unnamed, complete sequence	59053-59084	8	0.75
NC_006462_7	7.24\|189538\|32\|NC_006462\|PILER-CR	189538-189569	32	NZ_CP030275	Rhodobacter sphaeroides 2.4.1 plasmid pC, complete sequence	20868-20899	8	0.75
NC_006462_7	7.24\|189538\|32\|NC_006462\|PILER-CR	189538-189569	32	CP047035	Rhodobacter sphaeroides strain DSM 158 plasmid pC, complete sequence	59172-59203	8	0.75
NC_006462_7	7.24\|189538\|32\|NC_006462\|PILER-CR	189538-189569	32	NZ_CP015292	Rhodobacter sphaeroides strain MBTLJ-20 plasmid d, complete sequence	72298-72329	8	0.75
NC_006462_7	7.24\|189538\|32\|NC_006462\|PILER-CR	189538-189569	32	NZ_CP047041	Rhodobacter sphaeroides strain 2.4.1 substr. H2 plasmid pC, complete sequence	59139-59170	8	0.75
NC_006462_7	7.24\|189538\|32\|NC_006462\|PILER-CR	189538-189569	32	NZ_CP015214	Rhodobacter sphaeroides strain MBTLJ-13 plasmid c, complete sequence	74385-74416	8	0.75
NC_006462_7	7.26\|189661\|33\|NC_006462\|PILER-CR	189661-189693	33	NC_019959	Mycobacterium sp. JS623 plasmid pMYCSM03, complete sequence	15873-15905	8	0.758
NC_006462_7	7.33\|190090\|32\|NC_006462\|PILER-CR	190090-190121	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	969147-969178	8	0.75
NC_006462_7	7.35\|190212\|33\|NC_006462\|PILER-CR	190212-190244	33	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	2164457-2164489	8	0.758
NC_006462_7	7.35\|190212\|33\|NC_006462\|PILER-CR	190212-190244	33	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	1462846-1462878	8	0.758
NC_006462_7	7.37\|190336\|32\|NC_006462\|PILER-CR	190336-190367	32	NC_015851	Acidithiobacillus caldus SM-1 megaplasmid, complete sequence	172814-172845	8	0.75
NC_006462_7	7.37\|190336\|32\|NC_006462\|PILER-CR	190336-190367	32	NZ_CP026329	Acidithiobacillus caldus strain MTH-04 plasmid p1, complete sequence	132074-132105	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP030127	Indioceanicola profundi strain SCSIO 08040 plasmid unnamed1, complete sequence	697587-697618	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NC_015382	Burkholderia gladioli BSR3 plasmid bgla_1p, complete sequence	151407-151438	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP032323	Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence	694868-694899	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP022363	Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence	54154-54185	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_HG938356	Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141 plasmid pHAMBI1141a, complete sequence	557606-557637	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP032341	Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence	714278-714309	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP032347	Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence	341648-341679	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP012916	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence	334326-334357	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP026282	Klebsiella oxytoca strain KONIH2 plasmid pKOR-e3cb, complete sequence	25199-25230	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP026282	Klebsiella oxytoca strain KONIH2 plasmid pKOR-e3cb, complete sequence	221098-221129	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_KY020154	Klebsiella pneumoniae strain Kpn-431cz plasmid pKpn-431cz, complete sequence	53096-53127	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_KY020154	Klebsiella pneumoniae strain Kpn-431cz plasmid pKpn-431cz, complete sequence	99195-99226	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_KX869741	Enterobacter cloacae strain 20130723 plasmid R222, complete sequence	118636-118667	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_KY270853	Raoultella ornithinolytica strain YNKP001 plasmid pYNKP001-dfrA, complete sequence	200903-200934	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_KY270855	Pseudomonas putida strain 12969 plasmid p12969-2, complete sequence	17500-17531	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_KY126370	Enterobacter cloacae subsp. cloacae strain MN201516 plasmid pOP-I, complete sequence	103541-103572	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_KY270852	Enterobacter cloacae strain T5282 plasmid pT5282-mphA, complete sequence	135136-135167	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_KY494864	Pseudomonas aeruginosa strain FFUP_PS_37 plasmid pJB37, complete sequence	16448-16479	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP014072	Klebsiella quasipneumoniae strain FDAARGOS_93 plasmid unnamed1	36526-36557	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP050835	Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-1, complete sequence	121888-121919	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP009414	Salmonella enterica strain CFSAN007428 isolate N11150 plasmid pCFSAN007428_01, complete sequence	135023-135054	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	LC486677	Serratia marcescens MRY16-414SMA plasmid pMRY16-414SMA_2 DNA, complete sequence	3738-3769	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_KU356480	Vibrio parahaemolyticus strain VPS92 plasmid pVPS92-VEB, complete sequence	298042-298073	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_KX815983	Salmonella enterica subsp. enterica serovar Dublin strain N13-01125 plasmid pN13-01125, complete sequence	148301-148332	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_KX810825	Salmonella enterica subsp. enterica serovar Typhimurium strain MU1 plasmid pIMP4-SEM1, complete sequence	223172-223203	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_KU302802	Enterobacter cloacae strain SZECL1 plasmid pNDM1_SZ2 clone ST231, complete sequence	85552-85583	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_KU302801	Enterobacter cloacae strain SZECL1 plasmid pNDM1_SZ1 clone ST231, complete sequence	85552-85583	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP035548	Salmonella enterica subsp. enterica serovar Typhimurium strain YU07-18 plasmid pYU07-18_IncA/C2, complete sequence	121974-122005	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP009411	Salmonella enterica strain CFSAN007425 isolate 22697 plasmid pCFSAN007425_01, complete sequence	136596-136627	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP009413	Salmonella enterica strain CFSAN007427 isolate N20272 plasmid pCFSAN007427_01, complete sequence	144787-144818	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_KJ588780	Achromobacter xylosoxidans strain A22732 plasmid pA22732-IMP, complete sequence	47311-47342	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_KJ909290	Aeromonas salmonicida subsp. salmonicida strain 2004-05MF26 plasmid pSN254b, complete sequence	121140-121171	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_KJ958927	Klebsiella pneumoniae strain Kpn-3002cz plasmid pS-3002cz, complete sequence	68281-68312	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_KP688397	Vibrio parahaemolyticus strain V36 plasmid pVPH1, complete sequence	111343-111374	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_KR559888	Klebsiella pneumoniae strain Kpn642 plasmid pKP-Gr642, complete sequence	129082-129113	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_KP791968	Vibrio parahaemolyticus strain 2011VPH2 plasmid pVPH2, complete sequence	22448-22479	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_KM406488	Salmonella enterica subsp. enterica serovar Paratyphi B strain R69 plasmid R69, complete sequence	3247-3278	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_KT818627	Klebsiella pneumoniae strain U25 plasmid U25P002, complete sequence	113712-113743	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_KM406490	Salmonella enterica subsp. enterica serovar Typhimurium strain 202 plasmid pSEM, complete sequence	60242-60273	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_KM406489	Serratia marcescens strain R471 plasmid R471, complete sequence	58183-58214	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_KP975076	Pseudomonas aeruginosa strain MRSN17623 plasmid pMRVIM0713, complete sequence	3448-3479	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_KP975077	Enterobacter cloacae strain MRSN17626 plasmid pMRVIM0813, complete sequence	88846-88877	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_KP294351	Escherichia coli strain CZD1527 plasmid pIGT15, complete sequence	29328-29359	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_KT207463	Escherichia coli strain VA292 plasmid pDGO100, complete sequence	3904-3935	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_KU315015	Serratia marcescens strain NCTC 50331 plasmid R1215, complete sequence	40382-40413	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NC_014368	Klebsiella pneumoniae plasmid pNL194, complete sequence	51499-51530	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	AP018454	Klebsiella pneumoniae plasmid pMRY13-133KPN_2 DNA, complete genome, strain: MRY13-133	19403-19434	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	AP018455	Klebsiella aerogenes plasmid pMRY13-134EAE_1 DNA, complete genome, strain: MRY13-134	28421-28452	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP028197	Salmonella enterica subsp. enterica serovar Concord strain CFSAN018747 plasmid pGMI14-002_1, complete sequence	21021-21052	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP025141	Klebsiella pneumoniae strain KP1768 plasmid KP1768_p1, complete sequence	115160-115191	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP032391	Salmonella enterica subsp. enterica serovar Dublin strain CVM 34981 plasmid p34981_1, complete sequence	82640-82671	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_AP022376	Providencia rettgeri strain BML2531 plasmid pBML2531, complete sequence	6183-6214	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP049911	Diaphorobacter sp. HDW4A plasmid p_unnamed1, complete sequence	126940-126971	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP011599	Phytobacter ursingii strain CAV1151 plasmid pCAV1151-83, complete sequence	51436-51467	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP011601	Phytobacter ursingii strain CAV1151 plasmid pCAV1151-296, complete sequence	208989-209020	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP017987	Klebsiella pneumoniae strain 825795-1 plasmid unnamed2, complete sequence	5017-5048	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP047309	Citrobacter freundii strain L75 plasmid pCf76, complete sequence	4268-4299	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP045742	Escherichia coli strain DH5alpha plasmid pTHNK130-1, complete sequence	56023-56054	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP013324	Klebsiella pneumoniae strain CAV1193 plasmid pCAV1193-166, complete sequence	99062-99093	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	CP052410	Klebsiella pneumoniae strain C17KP0008 plasmid pC17KP0008-3, complete sequence	26502-26533	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP010373	Escherichia coli strain 6409 plasmid p6409-202.186kb, complete sequence	129376-129407	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP019187	Salmonella enterica subsp. enterica serovar Pomona str. ATCC 10729 plasmid pATCC10729_01, complete sequence	113-144	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP023418	Klebsiella pneumoniae strain 1050 plasmid pKp1050-2, complete sequence	7414-7445	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP044256	Salmonella enterica strain CFSAN096147 plasmid pCFSAN096147, complete sequence	146296-146327	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP048305	Escherichia coli strain 9 plasmid p009_A, complete sequence	127382-127413	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP025240	Salmonella enterica subsp. enterica serovar Newport str. USDA-ARS-USMARC-1928 plasmid pSNE3-1928, complete sequence	116680-116711	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP025242	Salmonella enterica subsp. enterica serovar Newport str. USDA-ARS-USMARC-1929 plasmid pSNE1-1929, complete sequence	68193-68224	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_KX426227	Acinetobacter lwoffii strain ED23-35 plasmid pALWED1.1, complete sequence	176765-176796	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_AP018755	Klebsiella pneumoniae strain KP67 plasmid pKP6702, complete sequence	13005-13036	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP024192	Klebsiella pneumoniae isolate KSB1_5D plasmid unnamed1, complete sequence	181006-181037	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP024194	Klebsiella pneumoniae isolate KSB1_5D plasmid unnamed3, complete sequence	30482-30513	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	MN477204	Escherichia coli strain S15FP06257 plasmid unnamed, complete sequence	35241-35272	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP029447	Serratia marcescens strain CAV1761 plasmid pCAV1761-73, complete sequence	42603-42634	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP029448	Serratia marcescens strain CAV1761 plasmid pCAV1761-205, complete sequence	80435-80466	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP015373	Pandoraea pnomenusa strain MCB032 plasmid unnamed 2, complete sequence	65246-65277	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP017059	Citrobacter freundii strain SL151 plasmid unnamed2, complete sequence	147036-147067	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP021328	Raoultella ornithinolytica strain Ro24724 plasmid pRo24724, complete sequence	38557-38588	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP026242	Citrobacter freundii complex sp. CFNIH9 plasmid pCFR-eb27, complete sequence	346842-346873	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP035636	Enterobacter cloacae strain EN3600 plasmid unnamed4, complete sequence	41297-41328	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_LS992184	Citrobacter freundii isolate Citrobacter freundii str. U2785 plasmid 2, complete sequence	66039-66070	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_KJ187752	Klebsiella pneumoniae strain 7433 plasmid pTR2, complete sequence	95325-95356	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP042506	Leclercia adecarboxylata strain E1 plasmid pE1_001, complete sequence	103381-103412	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP042507	Leclercia adecarboxylata strain E1 plasmid pE1_002, complete sequence	74219-74250	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP018716	Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-2, complete sequence	91519-91550	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP018722	Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-2, complete sequence	58010-58041	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP018704	Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-2, complete sequence	83013-83044	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP029249	Salmonella enterica subsp. enterica serovar Thompson strain HFCDC-SM-846 plasmid p846, complete sequence	124732-124763	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP019559	Escherichia coli strain KSC207 plasmid pMRGN207, complete sequence	219035-219066	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP025467	Klebsiella pneumoniae strain JS187 plasmid p187-1, complete sequence	166159-166190	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NC_022078	Klebsiella pneumoniae JM45 plasmid p1, complete sequence	31874-31905	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP009883	Pantoea sp. PSNIH1 plasmid pPSP-a3e, complete sequence	246991-247022	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP010378	Enterobacter hormaechei subsp. hormaechei strain 34983 plasmid p34983-59.134kb, complete sequence	2007-2038	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_AP022377	Providencia stuartii strain BML2537 plasmid pBML2537, complete sequence	117163-117194	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	MT077884	Escherichia coli plasmid p33, complete sequence	104158-104189	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	MT077886	Escherichia coli plasmid p39, complete sequence	103381-103412	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP026170	Leclercia sp. LSNIH1 plasmid pLEC-000f, complete sequence	31434-31465	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP026171	Leclercia sp. LSNIH1 plasmid pLEC-1cb1, complete sequence	238965-238996	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP022359	Shewanella bicestrii strain JAB-1 plasmid pSHE-CTX-M, complete sequence	86339-86370	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	MN336501	Pseudomonas aeruginosa strain 164130 plasmid p4130-KPC, complete sequence	1659-1690	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_EU880929	Klebsiella pneumoniae strain INS23K plasmid pLJ1, complete sequence	21306-21337	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP048293	Escherichia coli strain CVM N18EC0432 plasmid pN18EC0432-1, complete sequence	159387-159418	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP026196	Enterobacteriaceae bacterium ENNIH1 plasmid pENT-1f0b, complete sequence	54951-54982	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP028955	Klebsiella pneumoniae strain AR_0141 plasmid unnamed2, complete sequence	12685-12716	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP033627	Klebsiella pneumoniae strain 4743 plasmid unnamed2, complete sequence	169346-169377	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP033628	Klebsiella pneumoniae strain 4743 plasmid unnamed3, complete sequence	47976-48007	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	MN423361	Leclercia sp. strain 1106151 plasmid p1106151-mcr, complete sequence	105669-105700	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	HG969996	Klebsiella pneumoniae plasmid pIT-12C47, complete sequence	28249-28280	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	CP009869	Pantoea sp. PSNIH2 plasmid pPSP-75c, complete sequence	147794-147825	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	CP033569	Acinetobacter pittii strain 2014N21-145 plasmid p2014N21-145-1, complete sequence	142350-142381	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP012682	Salmonella enterica subsp. enterica serovar Typhimurium strain 33676 plasmid p33676_IncA/C, complete sequence	130245-130276	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	CP044029	Klebsiella pneumoniae strain RJY9645 plasmid pY9645-166, complete sequence	108990-109021	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP017750	Cupriavidus sp. USMAA2-4 plasmid unnamed1, complete sequence	76054-76085	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP017750	Cupriavidus sp. USMAA2-4 plasmid unnamed1, complete sequence	317864-317895	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP020529	Enterobacter cloacae strain 174 plasmid unnamed1, complete sequence	29496-29527	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP020531	Enterobacter cloacae strain 174 plasmid unnamed3, complete sequence	34499-34530	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP032385	Salmonella enterica subsp. enterica serovar Dublin strain CVM N53043 plasmid pN53043_1, complete sequence	17226-17257	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NC_018107	Klebsiella michiganensis E718 plasmid pKOX_R1, complete sequence	30923-30954	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP010801	Ralstonia mannitolilytica strain SN82F48 plasmid pRMAN01, complete sequence	106043-106074	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP020854	Klebsiella pneumoniae strain KPN528 plasmid pKPN528-1, complete sequence	51337-51368	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP020856	Klebsiella pneumoniae strain KPN528 plasmid pKPN528-3, complete sequence	38446-38477	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NC_003384	Salmonella enterica subsp. enterica serovar Typhi str. CT18 plasmid pHCM1, complete sequence	116645-116676	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP025277	Salmonella enterica subsp. enterica strain USDA-ARS-USMARC-60984 plasmid pSJO-60984, complete sequence	110186-110217	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	LC549808	Klebsiella pneumoniae VNCKp83 plasmid pVNCKp83 DNA, complete sequence	21511-21542	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP014978	Salmonella enterica subsp. enterica serovar Typhimurium str. USDA-ARS-USMARC-1896 isolate ST03-F34 plasmid pSTY1-1896, complete sequence	117395-117426	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NC_017908	Mycobacterium abscessus subsp. bolletii F1725 plasmid BRA100, complete sequence	52841-52872	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP042480	Citrobacter freundii strain C50 plasmid pC50_002, complete sequence	78140-78171	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP031567	Enterobacter hormaechei strain 2013_1a plasmid pIncHI2-1301491, complete sequence	16445-16476	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP031563	Klebsiella pneumoniae strain 2-1 plasmid pKP21HI1, complete sequence	166702-166733	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP031564	Klebsiella pneumoniae strain 2-1 plasmid pKP21AC2, complete sequence	808-839	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP032397	Salmonella enterica subsp. enterica serovar Dublin strain CVM 22429 plasmid p22429, complete sequence	151076-151107	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP028784	Klebsiella pneumoniae strain SCKP020049 plasmid p1_020049, complete sequence	63185-63216	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	MN254970	Escherichia coli strain EC009 plasmid pEC009.1, complete sequence	136541-136572	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP014658	Salmonella enterica subsp. enterica serovar Anatum str. USDA-ARS-USMARC-1736 plasmid pSAN1-1736, complete sequence	111154-111185	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NC_019165	Klebsiella pneumoniae plasmid pKPN101-IT, complete sequence	102530-102561	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP035381	Leclercia adecarboxylata strain R25 plasmid pLA-64, complete sequence	51870-51901	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP043190	Escherichia coli O16:H48 strain PG20180175 plasmid pPG20180175.1-IncAC2, complete sequence	134609-134640	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP044142	Escherichia coli O157 strain AR-0429 plasmid pAR-0429-1, complete sequence	59409-59440	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	MN310380	Raoultella ornithinolytica strain 170602815 plasmid p602815-NR, complete sequence	95557-95588	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP025231	Salmonella enterica subsp. enterica serovar Newport str. USDA-ARS-USMARC-1924 plasmid pSNE1-1924, complete sequence	128312-128343	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP012754	Klebsiella pneumoniae strain KP617 plasmid KP-p1, complete sequence	29864-29895	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	MH909331	Leclercia adecarboxylata plasmid p707804-NDM, complete sequence	247660-247691	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP031736	Klebsiella pneumoniae subsp. pneumoniae strain Klebsiella pneumoniae plasmid pKPM502, complete sequence	77484-77515	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP018819	Klebsiella pneumoniae strain AR_0049 plasmid unitig_3, complete sequence	6625-6656	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP037966	Klebsiella pneumoniae strain SCKP020135 plasmid p1_020135, complete sequence	60902-60933	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	MF495478	Aeromonas salmonicida plasmid pS121-1b, complete sequence	84076-84107	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP038330	Escherichia coli O157:H7 strain NE 1092-2 plasmid pNE1092-3, complete sequence	61609-61640	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NC_024997	Klebsiella oxytoca plasmid pACM1, complete sequence	7716-7747	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP043215	Salmonella enterica subsp. enterica serovar Heidelberg strain SL-312 plasmid pET8.1-IncAC2, complete sequence	134609-134640	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP023250	Klebsiella pneumoniae strain CCUG 70742 plasmid pKpn70742_1	18967-18998	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	KU160531	Vibrio alginolyticus strain VAS3-1 plasmid pVAS3-1, complete sequence	144223-144254	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	CP052417	Klebsiella pneumoniae strain C16KP0189 plasmid pC16KP0189-3, complete sequence	26787-26818	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_MN433457	Pseudomonas aeruginosa strain PAB546 plasmid pNK546-KPC, complete sequence	309192-309223	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_MN433457	Pseudomonas aeruginosa strain PAB546 plasmid pNK546-KPC, complete sequence	337760-337791	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP008825	UNVERIFIED_ORG: Enterobacter cloacae ECNIH2 plasmid pKPC-272, complete sequence	107645-107676	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP028562	Aeromonas hydrophila subsp. hydrophila strain WCHAH045096 plasmid p1_045096, complete sequence	5132-5163	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP041100	Klebsiella pneumoniae subsp. pneumoniae strain KPCTRSRTH07 plasmid unnamed1, complete sequence	77037-77068	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP042483	Klebsiella pneumoniae strain C51 plasmid pC51_002, complete sequence	45542-45573	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP046330	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed1, complete sequence	134000-134031	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP046332	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed2	59886-59917	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	MN310378	Klebsiella pneumoniae strain A2293 plasmid pA2293-Ct2, complete sequence	44030-44061	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP021835	Klebsiella pneumoniae strain AR_0120 plasmid tig00000516_pilon, complete sequence	173057-173088	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP026545	Cupriavidus metallidurans strain Ni-2 plasmid unnamed1	10056-10087	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	CP034667	Proteus vulgaris strain PvSC3 plasmid pPvSC3, complete sequence	197238-197269	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP009560	Salmonella enterica subsp. enterica serovar Newport str. CVM 22425 plasmid pCVM22425, complete sequence	62236-62267	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP033574	Shewanella algae strain KC-Na-R1 plasmid pKC-Na-R1, complete sequence	80048-80079	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP035180	Klebsiella pneumoniae strain BA33875 plasmid pBA33875_IncFIB, complete sequence	222875-222906	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NC_008573	Shewanella sp. ANA-3 plasmid unnamed1, complete sequence	230833-230864	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP022696	Citrobacter farmeri strain AUSMDU00008141 plasmid pAUSMDU8141-1, complete sequence	236899-236930	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP052871	Enterobacter cloacae strain 3849 plasmid p3846_IncHI2_mcr, complete sequence	252128-252159	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP052873	Enterobacter cloacae strain 3849 plasmid p3846III, complete sequence	41482-41513	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP010351	Acinetobacter johnsonii XBB1 plasmid pXBB1-9, complete sequence	326285-326316	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP021961	Klebsiella pneumoniae strain AR_0139 plasmid tig00000006, complete sequence	15595-15626	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NC_022372	Salmonella enterica subsp. enterica serovar Typhimurium plasmid pYT3 DNA, complete sequence	64816-64847	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP028791	Klebsiella pneumoniae strain WCHKP020030 plasmid pOXA1_020030, complete sequence	165638-165669	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP028993	Klebsiella pneumoniae strain AR_0142 plasmid unnamed3, complete sequence	25440-25471	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP029135	Klebsiella pneumoniae strain AR376 plasmid unnamed1, complete sequence	46263-46294	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	CP049311	Salmonella enterica subsp. enterica serovar Heidelberg strain CVM N53023 plasmid pN53023, complete sequence	16294-16325	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	CP052554	Klebsiella pneumoniae strain A17KP0038 plasmid pA17KP0038-3, complete sequence	26494-26525	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP029396	Acinetobacter defluvii strain WCHA30 plasmid pOXA58_010030, complete sequence	299452-299483	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_LT991958	Enterobacter cloacae complex sp. isolate C45 plasmid pC45-VIM4	136350-136381	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_LT991959	Enterobacter cloacae complex sp. isolate C45 plasmid pC45-p2	48566-48597	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	KU238092	Uncultured bacterium plasmid pDTC28, complete sequence	44020-44051	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP029037	Salmonella enterica subsp. enterica serovar Senftenberg str. 361154004 plasmid unnamed, complete sequence	111671-111702	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP043856	Enterobacter hormaechei strain EB_P6_L3_02.19 plasmid pIMPIncN3_52kb, complete sequence	42162-42193	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP026974	Achromobacter insolitus strain FDAARGOS_88 plasmid unnamed1, complete sequence	62276-62307	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP044215	Klebsiella aerogenes strain KA_P10_L5_03.19 plasmid pIMPIncH12_334kb, complete sequence	136865-136896	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP026753	Klebsiella pneumoniae strain AR_0066 plasmid tig00000084_pilon, complete sequence	22078-22109	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP009562	Salmonella enterica subsp. enterica serovar Newport str. CVM 22513 plasmid pCVM22513, complete sequence	27470-27501	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP021168	Enterobacter hormaechei strain 388 plasmid p388, complete sequence	231-262	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	KM659090	Achromobacter sp. LM16 plasmid pLM16A1, complete sequence	23302-23333	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP039526	Klebsiella pneumoniae subsp. pneumoniae strain HB25-1 plasmid pHB25-1-vir, complete sequence	222638-222669	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP038464	Aeromonas hydrophila strain WCX23 plasmid unnamed, complete sequence	61674-61705	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP027044	Klebsiella pneumoniae strain 1_GR_13 plasmid IncFIB IncFII, complete sequence	100458-100489	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP029599	Klebsiella quasipneumoniae subsp. similipneumoniae strain ATCC 700603 plasmid pDA33145-77, complete sequence	34739-34770	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	CP049307	Salmonella enterica subsp. enterica serovar Heidelberg strain CVM N58631 plasmid p58631, complete sequence	220174-220205	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP032285	Acinetobacter sp. WCHA55 plasmid pOXA58_010055, complete sequence	308482-308513	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NC_019093	Escherichia coli plasmid pLST424C-61, complete sequence	17373-17404	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NC_009140	Salmonella enterica subsp. enterica serovar Newport str. SL254 plasmid pSN254, complete sequence	146572-146603	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP021688	Klebsiella pneumoniae strain AR_0146 plasmid tig00001189, complete sequence	67194-67225	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP012168	Enterobacter hormaechei subsp. steigerwaltii strain 34998 plasmid p34998-239.973kb, complete sequence	139535-139566	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP035277	Citrobacter freundii strain R17 plasmid pCFR17_1, complete sequence	94577-94608	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP021163	Enterobacter hormaechei strain 234 plasmid p234, complete sequence	40759-40790	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP038466	Aeromonas hydrophila strain 23-C-23 plasmid unnamed, complete sequence	22850-22881	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	LT009689	Klebsiella pneumoniae plasmid pIT-12C73, strain 12C73, complete sequence	100734-100765	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	JX469831	Uncultured bacterium plasmid pKSP212, complete sequence	52544-52575	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP042494	Leclercia adecarboxylata strain E61 plasmid pE61_001, complete sequence	103381-103412	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP042495	Leclercia adecarboxylata strain E61 plasmid pE61_002, complete sequence	169156-169187	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP008933	Klebsiella pneumoniae strain PMK1 plasmid pPMK1-NDM, complete sequence	220096-220127	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP032180	Citrobacter freundii strain AR_0116 plasmid unnamed2, complete sequence	36021-36052	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP009116	Klebsiella pneumoniae strain carbapenem-resistant blaNDM-1 plasmid p1, complete sequence	25245-25276	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP040696	Citrobacter freundii strain R47 plasmid pR47-309, complete sequence	58429-58460	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP040697	Citrobacter freundii strain R47 plasmid pR47-54, complete sequence	11020-11051	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP028563	Aeromonas hydrophila subsp. hydrophila strain WCHAH045096 plasmid p2_045096, complete sequence	3757-3788	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP026390	Leclercia sp. LSNIH3 plasmid pLEC-5e18, complete sequence	186566-186597	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP026391	Leclercia sp. LSNIH3 plasmid pLEC-7c0d, complete sequence	246742-246773	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NC_017645	Escherichia coli UMNK88 plasmid pUMNK88, complete sequence	130670-130701	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP009567	Salmonella enterica subsp. enterica serovar Newport str. CVM 22462 plasmid pCFSAN000934_02, complete sequence	106763-106794	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP008899	Enterobacter hormaechei subsp. hoffmannii ECNIH3 plasmid pENT-8a4, complete sequence	179877-179908	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP029142	Klebsiella michiganensis strain AR375 plasmid unnamed2, complete sequence	41172-41203	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP048381	Klebsiella variicola strain 118 plasmid p118_B-OXA1, complete sequence	24605-24636	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP007636	Vibrio cholerae strain 2012EL-2176 plasmid unnamed, complete sequence	154198-154229	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	MF344569	Pseudomonas aeruginosa plasmid p12939-PER, complete sequence	310152-310183	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP041248	Raoultella electrica strain DSM 102253 plasmid unnamed1, complete sequence	89454-89485	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP041248	Raoultella electrica strain DSM 102253 plasmid unnamed1, complete sequence	151452-151483	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP008843	Klebsiella michiganensis strain M1 plasmid pKOXM1B, complete sequence	130342-130373	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_AP019667	Klebsiella pneumoniae strain TA6363 plasmid pTMTA63632, complete sequence	24232-24263	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NC_012690	Escherichia coli plasmid peH4H, complete sequence	118193-118224	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NC_032101	Enterobacter cloacae plasmid pG6809-2, complete sequence	36763-36794	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP025964	Klebsiella pneumoniae strain WCHKP34 plasmid pIMP4_LL34, complete sequence	118532-118563	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP041052	Enterobacter hormaechei strain C126 plasmid pEnC126NDM, complete sequence	30639-30670	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP042552	Enterobacter hormaechei strain C45 plasmid pC45_001, complete sequence	103381-103412	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP042553	Enterobacter hormaechei strain C45 plasmid pC45_002, complete sequence	78140-78171	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP022156	Escherichia coli strain ABWA45 plasmid pABWA45_2, complete sequence	4819-4850	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP020068	Klebsiella pneumoniae strain AR_0068 plasmid unitig_1, complete sequence	221043-221074	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP020070	Klebsiella pneumoniae strain AR_0068 plasmid unitig_4, complete sequence	1051-1082	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP032238	Escherichia coli strain ECCWS199 plasmid pTB221, complete sequence	131332-131363	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	JN106172	Uncultured bacterium plasmid pAKD29, complete sequence	53223-53254	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	JN106173	Uncultured bacterium plasmid pAKD31, complete sequence	52342-52373	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	JN106174	Uncultured bacterium plasmid pAKD33, complete sequence	56176-56207	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP016526	Salmonella enterica subsp. enterica serovar Heidelberg strain 09-036813-1A plasmid p09-036813-1A_261, complete sequence	34421-34452	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP015991	Klebsiella pneumoniae strain BR plasmid pWSZBR, complete sequence	18669-18700	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP028929	Klebsiella pneumoniae strain AR_0153 plasmid unnamed1, complete sequence	96857-96888	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP028931	Klebsiella pneumoniae strain AR_0153 plasmid unnamed3, complete sequence	51171-51202	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP031575	Enterobacter hormaechei strain A1 plasmid pIncHI2-1502264, complete sequence	227819-227850	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP024557	Klebsiella pneumoniae strain INF164 plasmid unnamed1, complete sequence	179619-179650	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	CP050163	Escherichia coli plasmid Carbapenemase(KPC-2)_IncHI2, complete sequence	109156-109187	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP025517	Klebsiella pneumoniae strain 002SK2 plasmid p002SK2_B, complete sequence	60020-60051	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP032520	Cupriavidus oxalaticus strain T2 plasmid unnamed1, complete sequence	2838-2869	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP032520	Cupriavidus oxalaticus strain T2 plasmid unnamed1, complete sequence	76273-76304	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP032520	Cupriavidus oxalaticus strain T2 plasmid unnamed1, complete sequence	559418-559449	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP041172	Salmonella enterica subsp. enterica serovar Thompson strain SH11G0791 plasmid pSH11G0791, complete sequence	50274-50305	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP024641	Klebsiella michiganensis strain F107 plasmid unnamed1, complete sequence	44986-45017	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NC_002698	Shigella flexneri 5a virulence plasmid pWR501, complete sequence	200481-200512	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	KP294350	Uncultured bacterium plasmid pARM26, complete sequence	31158-31189	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	JN106164	Uncultured bacterium plasmid pAKD1, complete sequence	55793-55824	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	JN106165	Uncultured bacterium plasmid pAKD14, complete sequence	46826-46857	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	JN106166	Uncultured bacterium plasmid pAKD15, complete sequence	64752-64783	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	JN106168	Uncultured bacterium plasmid pAKD17, complete sequence	49957-49988	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	JN106169	Uncultured bacterium plasmid pAKD18, complete sequence	65500-65531	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP011614	Klebsiella oxytoca strain CAV1335 plasmid pCAV1335-92, complete sequence	40990-41021	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP041734	Enterobacter hormaechei subsp. steigerwaltii strain ME-1 plasmid pME-1a, complete sequence	117710-117741	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP024529	Klebsiella pneumoniae strain INF157 plasmid unnamed1, complete sequence	181006-181037	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP026230	Aeromonas sp. ASNIH1 plasmid pKPC-038c, complete sequence	46648-46679	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP024682	Citrobacter freundii strain UMH14 plasmid pUMH14_2, complete sequence	53220-53251	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP016919	Klebsiella pneumoniae isolate 11 plasmid pIncR_DHQP1300920, complete sequence	11080-11111	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP016921	Klebsiella pneumoniae isolate 11 plasmid pIncHI1B_DHQP1300920, complete sequence	264213-264244	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	CP050156	Klebsiella pneumoniae plasmid Carbapenemase(NDM-1)_IncH1B, complete sequence	209691-209722	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP017932	Klebsiella oxytoca strain CAV1015 plasmid pCAV1015-76, complete sequence	31773-31804	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP032491	Salmonella enterica subsp. enterica serovar Typhimurium strain SL26 plasmid pSL26_IncA/C2, complete sequence	117666-117697	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP032496	Salmonella enterica subsp. enterica serovar Typhimurium strain SO21 plasmid pSO21_IncA/C2, complete sequence	59567-59598	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP024522	Klebsiella pneumoniae strain INF158 plasmid unnamed1, complete sequence	181006-181037	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP024524	Klebsiella pneumoniae strain INF158 plasmid unnamed3, complete sequence	30482-30513	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP011540	Klebsiella aerogenes strain G7 plasmid pGPN1, complete sequence	47146-47177	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	MN583270	Pseudomonas aeruginosa strain NK546 plasmid pNK546b, complete sequence	16980-17011	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	MN583270	Pseudomonas aeruginosa strain NK546 plasmid pNK546b, complete sequence	221301-221332	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	MK933279	Enterobacter hormaechei strain SCNJ07 plasmid pMCR-SCNJ07, complete sequence	227222-227253	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP015139	Escherichia coli strain Ecol_732 plasmid pEC732_IMP14, complete sequence	3565-3596	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP022612	Klebsiella pneumoniae strain CDC 0106 plasmid unnamed1, complete sequence	159490-159521	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP022612	Klebsiella pneumoniae strain CDC 0106 plasmid unnamed1, complete sequence	229119-229150	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NC_021845	Salmonella enterica subsp. enterica serovar Cubana str. CFSAN002050 plasmid unnamed, complete sequence	80505-80536	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NC_005211	Serratia marcescens plasmid R478, complete sequence	107917-107948	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NC_019066	Escherichia coli plasmid pAPEC1990_61, complete sequence	131178-131209	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP017935	Klebsiella pneumoniae strain CAV1016 plasmid pCAV1016-90, complete sequence	74745-74776	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP017936	Klebsiella pneumoniae strain CAV1016 plasmid pCAV1016-76, complete sequence	46738-46769	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	CP028804	Klebsiella pneumoniae strain WCHKP7E2 plasmid pCMY2_085072, complete sequence	292904-292935	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP046347	Citrobacter portucalensis strain FDAARGOS_738 plasmid unnamed1, complete sequence	40396-40427	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP030270	Klebsiella pneumoniae subsp. pneumoniae strain SC-7 plasmid pSC7-vir, complete sequence	203622-203653	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP026154	Klebsiella pneumoniae strain F10(AN) plasmid pF10AN_1, complete sequence	17789-17820	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP026154	Klebsiella pneumoniae strain F10(AN) plasmid pF10AN_1, complete sequence	293091-293122	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	KY014465	Vibrio parahaemolyticus plasmid pVPS114, complete sequence	89829-89860	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	KY014466	Vibrio vulnificus plasmid pVVS1-per1, complete sequence	56720-56751	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP018451	Klebsiella pneumoniae strain Kp_Goe_71070 plasmid pKp_Goe_070-1, complete sequence	2473-2504	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NC_016976	Klebsiella pneumoniae plasmid pR55, complete sequence	124847-124878	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NC_016978	Comamonas testosteroni plasmid pI2, complete sequence	82406-82437	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NC_016980	Klebsiella pneumoniae plasmid pNDM-MAR, complete sequence	147961-147992	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP017451	Klebsiella sp. LTGPAF-6F plasmid unnamed1, complete sequence	347946-347977	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP043927	Klebsiella quasipneumoniae subsp. quasipneumoniae strain M17277 plasmid p17277A_477, complete sequence	224272-224303	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP011640	Serratia marcescens strain CAV1492 plasmid pCAV1492-73, complete sequence	16488-16519	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP011641	Serratia marcescens strain CAV1492 plasmid pCAV1492-199, complete sequence	37661-37692	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP020902	Klebsiella pneumoniae strain K66-45 plasmid pK66-45-1, complete sequence	218054-218085	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP045675	Klebsiella pneumoniae strain WSD411 plasmid pWSD411_2, complete sequence	151227-151258	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP025275	Salmonella enterica subsp. enterica serovar Newport str. USDA-ARS-USMARC-1923 plasmid pSNE2-1923	112065-112096	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP031103	Leclercia sp. W17 plasmid pW17-2, complete sequence	50962-50993	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP027670	Simplicispira suum strain SC1-8 plasmid unnamed1, complete sequence	19698-19729	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP040362	Klebsiella pneumoniae strain R50 plasmid pR50-74, complete sequence	71277-71308	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP042519	Citrobacter freundii strain E33 plasmid pE33_002, complete sequence	78140-78171	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP042547	Klebsiella michiganensis strain C52 plasmid pC52_002, complete sequence	102086-102117	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP046614	Klebsiella pneumoniae strain WCGKP294 plasmid pWCGKP294-2, complete sequence	210508-210539	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP029723	Klebsiella pneumoniae strain AR_0140 plasmid unnamed1, complete sequence	67697-67728	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP027173	Pseudomonas aeruginosa strain AR_0353 plasmid unnamed1, complete sequence	6480-6511	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	CP051274	Salmonella enterica subsp. enterica serovar Worthington strain OLF-FSR1_WB_Partridge_SW-37 plasmid pSW37-267109, complete sequence	244671-244702	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP038450	Aeromonas media strain R50-22 plasmid pAeme6, complete sequence	67012-67043	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_AP018748	Klebsiella pneumoniae strain KP33 plasmid pKP3301, complete sequence	88472-88503	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	CP028419	Aeromonas hydrophila strain WCX23 plasmid pWCX23_1, complete sequence	123883-123914	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP011632	Klebsiella oxytoca strain CAV1374 plasmid pCAV1374-84, complete sequence	52420-52451	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP011633	Klebsiella oxytoca strain CAV1374 plasmid pCAV1374-150, complete sequence	80609-80640	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP011634	Klebsiella oxytoca strain CAV1374 plasmid pCAV1374-228, complete sequence	54178-54209	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP011634	Klebsiella oxytoca strain CAV1374 plasmid pCAV1374-228, complete sequence	78043-78074	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP011634	Klebsiella oxytoca strain CAV1374 plasmid pCAV1374-228, complete sequence	150496-150527	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP011634	Klebsiella oxytoca strain CAV1374 plasmid pCAV1374-228, complete sequence	174361-174392	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP024550	Klebsiella pneumoniae strain INF163 plasmid unnamed1, complete sequence	149542-149573	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP018318	Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-2, complete sequence	37416-37447	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP014698	Klebsiella quasipneumoniae strain ATCC 700603 isolate K6 plasmid pKQPS2, complete sequence	75162-75193	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	MN842294	Leclercia adecarboxylata strain G426 plasmid pG426-FII, complete sequence	86603-86634	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	KF743817	Proteus mirabilis plasmid R772, complete sequence	58090-58121	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	KF743818	Bordetella bronchiseptica plasmid R906, complete sequence	54846-54877	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	CP051271	Salmonella enterica subsp. enterica serovar Worthington strain OLF-FSR1_WB_Quail_SW-70 plasmid pSW37-267106, complete sequence	228078-228109	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP032340	Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence	354001-354032	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP011595	Klebsiella oxytoca strain CAV1099 plasmid pKPC_CAV1099, complete sequence	105965-105996	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP043767	Enterobacter hormaechei strain EB_P9_L5_03.19 plasmid pIMPIncH12_331kb, complete sequence	189579-189610	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP021712	Klebsiella pneumoniae strain AR_0143 plasmid tig00000857, complete sequence	37804-37835	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP025236	Salmonella enterica subsp. enterica serovar Newport str. USDA-ARS-USMARC-1926 plasmid pSNE2-1926, complete sequence	92700-92731	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	KX957968	Vibrio alginolyticus plasmid pVAS19, complete sequence	70068-70099	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP013115	Shewanella xiamenensis strain T17 plasmid pSx1, complete sequence	158078-158109	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP013215	Klebsiella pneumoniae subsp. pneumoniae strain H11 plasmid pH11, complete sequence	245176-245207	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP053365	Klebsiella pneumoniae strain BA2275 plasmid p1, complete sequence	48697-48728	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP009570	Salmonella enterica subsp. enterica serovar Newport str. CVM N1543 isolate CFSAN000926 plasmid pCVMN1543, complete sequence	103065-103096	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP009564	Salmonella enterica subsp. enterica serovar Newport str. CVM 21550 plasmid pCVM21550, complete sequence	27075-27106	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP009563	Salmonella enterica subsp. enterica serovar Newport str. CVM 21538 plasmid pCVM21538, complete sequence	29729-29760	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NC_006525	Cupriavidus metallidurans CH34 plasmid pMOL28, complete sequence	144147-144178	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NC_020123	Citrobacter freundii strain CFSTE plasmid pT-OXA-181, complete sequence	39657-39688	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NC_024992	Klebsiella pneumoniae plasmid pKp848CTX, complete sequence	9335-9366	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP011622	Klebsiella pneumoniae strain CAV1344 plasmid pKPC_CAV1344, complete sequence	135819-135850	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP013265	Sphingobium baderi strain DE-13 plasmid pDE1, complete sequence	220463-220494	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_AP018752	Klebsiella pneumoniae strain KP64 plasmid pKP6402, complete sequence	13044-13075	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP040595	Klebsiella pneumoniae subsp. pneumoniae strain KpvST15_NDM plasmid pKpvST15, complete sequence	54346-54377	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NC_012556	Enterobacter cloacae plasmid pEC-IMPQ, complete sequence	103381-103412	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NC_012555	Enterobacter cloacae plasmid pEC-IMP, complete sequence	103381-103412	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP041209	Salmonella enterica subsp. enterica serovar Newport strain SAP18-8729 plasmid pCFSAN074384_1, complete sequence	71847-71878	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP011576	Klebsiella pneumoniae strain CAV1392 plasmid pCAV1392-50, complete sequence	38356-38387	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP042579	Enterobacter kobei strain C16 plasmid pC16_001, complete sequence	105697-105728	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NC_019906	Pseudomonas putida HB3267 plasmid pPC9, complete sequence	66382-66413	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP025578	Klebsiella pneumoniae strain 08EU827 plasmid p08EU827_2, complete sequence	75715-75746	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP006799	Klebsiella pneumoniae subsp. pneumoniae PittNDM01 plasmid p1, complete sequence	80245-80276	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP006801	Klebsiella pneumoniae subsp. pneumoniae PittNDM01 plasmid p3, complete sequence	25211-25242	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP011610	Citrobacter freundii strain CAV1321 plasmid pCAV1321-135, complete sequence	76651-76682	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP043516	Enterobacter kobei strain EB_P8_L5_01.19 plasmid pIMPIncN3_57kb, complete sequence	35009-35040	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP018689	Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-2, complete sequence	11939-11970	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NC_019116	Salmonella enterica subsp. enterica serovar Heidelberg plasmid pSH163_135, complete sequence	105266-105297	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NC_019118	Salmonella enterica subsp. enterica serovar Heidelberg plasmid pSH696_135, complete sequence	105521-105552	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NC_019121	Salmonella enterica subsp. enterica serovar Heidelberg plasmid pSH111_166, complete sequence	49784-49815	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP041935	Klebsiella pneumoniae strain KP14003 plasmid unnamed1, complete sequence	158682-158713	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP012956	Acinetobacter baumannii strain D36 plasmid pD36-4 clone GC1, complete sequence	37490-37521	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP024573	Klebsiella pneumoniae strain INF274 plasmid unnamed3, complete sequence	30482-30513	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP026234	Citrobacter freundii complex sp. CFNIH4 plasmid pCFR-4109, complete sequence	187799-187830	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP026234	Citrobacter freundii complex sp. CFNIH4 plasmid pCFR-4109, complete sequence	253407-253438	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	AP022352	Klebsiella pneumoniae E208 plasmid pE208_IMP6 DNA, complete sequence	33875-33906	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP031884	Klebsiella pneumoniae strain WCHKP095845 plasmid pNDM1_095845, complete sequence	48792-48823	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP051135	Enterobacter hormaechei strain AMS-38 plasmid pAMS-38c, complete sequence	206727-206758	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NC_012692	Escherichia coli plasmid pAR060302, complete sequence	136628-136659	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NC_012693	Salmonella enterica plasmid pAM04528, complete sequence	128312-128343	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP032842	Enterobacter hormaechei strain C15117 plasmid pSPRC-Echo1, complete sequence	103381-103412	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP024564	Klebsiella pneumoniae strain INF278 plasmid unnamed1, complete sequence	149542-149573	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP024566	Klebsiella pneumoniae strain INF278 plasmid unnamed3, complete sequence	30482-30513	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP026851	UNVERIFIED_ORG: Enterobacter cloacae strain AR_0072 plasmid unnamed1	1678-1709	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP026851	UNVERIFIED_ORG: Enterobacter cloacae strain AR_0072 plasmid unnamed1	12144-12175	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP026851	UNVERIFIED_ORG: Enterobacter cloacae strain AR_0072 plasmid unnamed1	138252-138283	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP026851	UNVERIFIED_ORG: Enterobacter cloacae strain AR_0072 plasmid unnamed1	148715-148746	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NC_019344	Serratia marcescens plasmid R830b, complete sequence	71834-71865	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NC_019380	Aeromonas hydrophila plasmid pR148, complete sequence	134893-134924	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP027425	Klebsiella oxytoca strain FDAARGOS_335 plasmid unnamed, complete sequence	190915-190946	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP046032	Salmonella sp. HNK130 plasmid pTHNK130-2, complete sequence	69907-69938	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP046034	Salmonella sp. HNK130 plasmid unnamed, complete sequence	35314-35345	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP021695	Proteus mirabilis strain AR_0155 plasmid tig00000123, complete sequence	204331-204362	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP021953	Klebsiella pneumoniae strain AR_0148 plasmid tig00000185_pilon, complete sequence	18418-18449	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP032395	Salmonella enterica subsp. enterica serovar Dublin strain CVM 22453 plasmid p22453_1, complete sequence	48585-48616	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	KY320277	Leclercia adecarboxylata strain Lec-476 plasmid pLec-476, complete sequence	149390-149421	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP042525	Citrobacter freundii strain E11 plasmid pE11_001, complete sequence	103381-103412	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_AP018830	Enterobacter hormaechei subsp. xiangfangensis strain M206 plasmid pM206-NDM1, complete sequence	13044-13075	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	CP052479	Klebsiella pneumoniae strain C16KP0050 plasmid pC16KP0050-3, complete sequence	26494-26525	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_LT991955	Enterobacter hormaechei subsp. steigerwaltii isolate C309 plasmid pC309-VIM4	112352-112383	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_LT991956	Enterobacter hormaechei subsp. steigerwaltii isolate C309 plasmid pC309-p2	30234-30265	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NC_023898	Klebsiella pneumoniae plasmid pRMH760, complete sequence	143096-143127	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	CP020502	Serratia marcescens strain BWH-23 plasmid unnamed, complete sequence	58138-58169	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP026014	Klebsiella variicola strain 13450 plasmid p13450-1, complete sequence	291149-291180	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP026018	Klebsiella pneumoniae strain 13190 plasmid p13190-2, complete sequence	54043-54074	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP022170	Aeromonas salmonicida strain S121 plasmid pS121-1a, complete sequence	86565-86596	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP025144	Klebsiella pneumoniae strain NR5632 plasmid NR5632_p1, complete sequence	115012-115043	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP025147	Klebsiella pneumoniae strain KP1766 plasmid KP1766_p1, complete sequence	120466-120497	8	0.75
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP038654	Citrobacter freundii strain 154 plasmid p154_1, complete sequence	268706-268737	8	0.75
NC_006462_7	7.44\|190767\|32\|NC_006462\|PILER-CR	190767-190798	32	NZ_CP029986	Sphingomonas sp. FARSPH plasmid p01, complete sequence	238761-238792	8	0.75
NC_006462_7	7.44\|190767\|32\|NC_006462\|PILER-CR	190767-190798	32	NZ_CP012477	Arthrobacter sp. ERGS1:01 isolate water plasmid unnamed2, complete sequence	516292-516323	8	0.75
NC_006462_7	7.44\|190767\|32\|NC_006462\|PILER-CR	190767-190798	32	NZ_AP014705	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence	672787-672818	8	0.75
NC_006462_7	7.45\|190828\|32\|NC_006462\|PILER-CR	190828-190859	32	NZ_CP026489	Streptomyces sp. 604F plasmid unnamed, complete sequence	1887-1918	8	0.75
NC_006462_8	8.1\|200840\|32\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	200840-200871	32	NC_022536	Rhizobium sp. IRBG74 plasmid IRBL74_p, complete sequence	28452-28483	8	0.75
NC_006462_8	8.1\|200840\|32\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	200840-200871	32	NC_018022	Mycolicibacterium chubuense NBB4 plasmid pMYCCH.01, complete sequence	403955-403986	8	0.75
NC_006462_8	8.1\|200840\|32\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	200840-200871	32	NZ_CP054616	Azospirillum oryzae strain KACC 14407 plasmid unnamed2, complete sequence	606278-606309	8	0.75
NC_006462_8	8.9\|201332\|33\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	201332-201364	33	NC_011991	Agrobacterium vitis S4 plasmid pAtS4b, complete sequence	34777-34809	8	0.758
NC_006462_8	8.9\|201332\|33\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	201332-201364	33	MN586021	Arthrobacter phage Beagle, complete genome	64853-64885	8	0.758
NC_006462_8	8.9\|201332\|33\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	201332-201364	33	MT889394	Arthrobacter phage Odyssey395, complete genome	64245-64277	8	0.758
NC_006462_8	8.9\|201332\|33\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	201332-201364	33	CP021185	Sphingomonas wittichii DC-6 plasmid pDC04, complete sequence	42091-42123	8	0.758
NC_006462_8	8.9\|201332\|33\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	201332-201364	33	CP021184	Sphingomonas wittichii DC-6 plasmid pDC03, complete sequence	31066-31098	8	0.758
NC_006462_8	8.9\|201332\|33\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	201332-201364	33	CP021184	Sphingomonas wittichii DC-6 plasmid pDC03, complete sequence	98164-98196	8	0.758
NC_006462_8	8.10\|201394\|32\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	201394-201425	32	NZ_AP022338	Mameliella alba strain KU6B plasmid pKUB257, complete sequence	248887-248918	8	0.75
NC_006462_8	8.18\|201889\|34\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	201889-201922	34	NZ_CP032678	Pseudomonas sp. Leaf58 plasmid pBASL58, complete sequence	156893-156926	8	0.765
NC_006462_8	8.18\|201889\|34\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	201889-201922	34	NZ_CP015867	Streptomyces parvulus strain 2297 plasmid pSPA1, complete sequence	40944-40977	8	0.765
NC_006462_8	8.18\|201889\|34\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	201889-201922	34	MH155873	Microbacterium phage Paschalis, complete genome	13059-13092	8	0.765
NC_006462_8	8.18\|201889\|34\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	201889-201922	34	MH590600	Microbacterium phage KaiHaiDragon, complete genome	12954-12987	8	0.765
NC_006462_8	8.18\|201889\|34\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	201889-201922	34	MT818415	Microbacterium phage Scumberland, complete genome	13285-13318	8	0.765
NC_006462_8	8.18\|201889\|34\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	201889-201922	34	NC_047993	Microbacterium phage Quhwah, complete genome	13426-13459	8	0.765
NC_006462_8	8.18\|201889\|34\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	201889-201922	34	MN444877	Microbacterium phage Antares, complete genome	13278-13311	8	0.765
NC_006462_7	7.1\|189536\|32\|NC_006462\|CRISPRCasFinder,CRT	189536-189567	32	AP017627	Pleomorphomonas sp. SM30 plasmid pSM30-1 DNA, complete genome	26481-26512	9	0.719
NC_006462_7	7.3\|189659\|33\|NC_006462\|CRISPRCasFinder,CRT	189659-189691	33	NZ_CP030864	Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence	306061-306093	9	0.727
NC_006462_7	7.5\|189782\|31\|NC_006462\|CRISPRCasFinder,CRT	189782-189812	31	NC_017580	Shewanella baltica OS117 plasmid pSBAL11702, complete sequence	77831-77861	9	0.71
NC_006462_7	7.8\|189964\|33\|NC_006462\|CRISPRCasFinder,CRT	189964-189996	33	NZ_CP017076	Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence	279512-279544	9	0.727
NC_006462_7	7.10\|190088\|32\|NC_006462\|CRISPRCasFinder,CRT	190088-190119	32	NC_008739	Marinobacter hydrocarbonoclasticus VT8 plasmid pMAQU02, complete sequence	7700-7731	9	0.719
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP015881	Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence	1406555-1406586	9	0.719
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP030263	Ensifer adhaerens strain Corn53 plasmid AA, complete sequence	767137-767168	9	0.719
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NC_016585	Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence	294375-294406	9	0.719
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP015737	Shinella sp. HZN7 plasmid pShin-01, complete sequence	352571-352602	9	0.719
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP029452	Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence	961066-961097	9	0.719
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NC_021229	Arthrobacter nicotinovorans pAO1 megaplasmid sequence, strain ATCC 49919	24955-24986	9	0.719
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_AP014706	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_2p, complete sequence	172241-172272	9	0.719
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NC_017966	Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence	509439-509470	9	0.719
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP023071	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence	922202-922233	9	0.719
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NC_015221	Nitrosomonas sp. AL212 plasmid pNAL21202, complete sequence	3939-3970	9	0.719
NC_006462_7	7.21\|190765\|32\|NC_006462\|CRISPRCasFinder,CRT	190765-190796	32	NZ_CP010410	Xanthomonas sacchari strain R1 plasmid unnamed, complete sequence	328107-328138	9	0.719
NC_006462_7	7.21\|190765\|32\|NC_006462\|CRISPRCasFinder,CRT	190765-190796	32	CP007645	Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803d, complete sequence	242932-242963	9	0.719
NC_006462_7	7.21\|190765\|32\|NC_006462\|CRISPRCasFinder,CRT	190765-190796	32	NZ_CP011275	Planctomyces sp. SH-PL62 plasmid pPL62-2, complete sequence	33156-33187	9	0.719
NC_006462_7	7.21\|190765\|32\|NC_006462\|CRISPRCasFinder,CRT	190765-190796	32	NZ_CP050092	Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b6, complete sequence	288793-288824	9	0.719
NC_006462_7	7.21\|190765\|32\|NC_006462\|CRISPRCasFinder,CRT	190765-190796	32	NZ_CP050081	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b5, complete sequence	496999-497030	9	0.719
NC_006462_7	7.21\|190765\|32\|NC_006462\|CRISPRCasFinder,CRT	190765-190796	32	NZ_CP015523	Sphingomonas sp. NIC1 plasmid unnamed2, complete sequence	113883-113914	9	0.719
NC_006462_7	7.21\|190765\|32\|NC_006462\|CRISPRCasFinder,CRT	190765-190796	32	NZ_CP025016	Rhizobium leguminosarum strain Norway plasmid pRLN4, complete sequence	75860-75891	9	0.719
NC_006462_7	7.21\|190765\|32\|NC_006462\|CRISPRCasFinder,CRT	190765-190796	32	NZ_CP049731	Rhizobium leguminosarum strain A1 plasmid pRL12, complete sequence	492397-492428	9	0.719
NC_006462_7	7.21\|190765\|32\|NC_006462\|CRISPRCasFinder,CRT	190765-190796	32	NZ_CP016287	Rhizobium leguminosarum strain Vaf10 plasmid unnamed1, complete sequence	806789-806820	9	0.719
NC_006462_7	7.21\|190765\|32\|NC_006462\|CRISPRCasFinder,CRT	190765-190796	32	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	597662-597693	9	0.719
NC_006462_7	7.21\|190765\|32\|NC_006462\|CRISPRCasFinder,CRT	190765-190796	32	NZ_CP022565	Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK01, complete sequence	925217-925248	9	0.719
NC_006462_7	7.21\|190765\|32\|NC_006462\|CRISPRCasFinder,CRT	190765-190796	32	NZ_CP053206	Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1D, complete sequence	493593-493624	9	0.719
NC_006462_7	7.24\|189538\|32\|NC_006462\|PILER-CR	189538-189569	32	AP017627	Pleomorphomonas sp. SM30 plasmid pSM30-1 DNA, complete genome	26481-26512	9	0.719
NC_006462_7	7.26\|189661\|33\|NC_006462\|PILER-CR	189661-189693	33	NZ_CP030864	Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence	306061-306093	9	0.727
NC_006462_7	7.28\|189784\|31\|NC_006462\|PILER-CR	189784-189814	31	NC_017580	Shewanella baltica OS117 plasmid pSBAL11702, complete sequence	77831-77861	9	0.71
NC_006462_7	7.31\|189966\|33\|NC_006462\|PILER-CR	189966-189998	33	NZ_CP017076	Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence	279512-279544	9	0.727
NC_006462_7	7.33\|190090\|32\|NC_006462\|PILER-CR	190090-190121	32	NC_008739	Marinobacter hydrocarbonoclasticus VT8 plasmid pMAQU02, complete sequence	7700-7731	9	0.719
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP015881	Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence	1406555-1406586	9	0.719
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP030263	Ensifer adhaerens strain Corn53 plasmid AA, complete sequence	767137-767168	9	0.719
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NC_016585	Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence	294375-294406	9	0.719
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP015737	Shinella sp. HZN7 plasmid pShin-01, complete sequence	352571-352602	9	0.719
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP029452	Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence	961066-961097	9	0.719
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NC_021229	Arthrobacter nicotinovorans pAO1 megaplasmid sequence, strain ATCC 49919	24955-24986	9	0.719
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_AP014706	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_2p, complete sequence	172241-172272	9	0.719
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NC_017966	Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence	509439-509470	9	0.719
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP023071	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence	922202-922233	9	0.719
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NC_015221	Nitrosomonas sp. AL212 plasmid pNAL21202, complete sequence	3939-3970	9	0.719
NC_006462_7	7.44\|190767\|32\|NC_006462\|PILER-CR	190767-190798	32	NZ_CP010410	Xanthomonas sacchari strain R1 plasmid unnamed, complete sequence	328107-328138	9	0.719
NC_006462_7	7.44\|190767\|32\|NC_006462\|PILER-CR	190767-190798	32	CP007645	Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803d, complete sequence	242932-242963	9	0.719
NC_006462_7	7.44\|190767\|32\|NC_006462\|PILER-CR	190767-190798	32	NZ_CP011275	Planctomyces sp. SH-PL62 plasmid pPL62-2, complete sequence	33156-33187	9	0.719
NC_006462_7	7.44\|190767\|32\|NC_006462\|PILER-CR	190767-190798	32	NZ_CP050092	Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b6, complete sequence	288793-288824	9	0.719
NC_006462_7	7.44\|190767\|32\|NC_006462\|PILER-CR	190767-190798	32	NZ_CP050081	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b5, complete sequence	496999-497030	9	0.719
NC_006462_7	7.44\|190767\|32\|NC_006462\|PILER-CR	190767-190798	32	NZ_CP015523	Sphingomonas sp. NIC1 plasmid unnamed2, complete sequence	113883-113914	9	0.719
NC_006462_7	7.44\|190767\|32\|NC_006462\|PILER-CR	190767-190798	32	NZ_CP025016	Rhizobium leguminosarum strain Norway plasmid pRLN4, complete sequence	75860-75891	9	0.719
NC_006462_7	7.44\|190767\|32\|NC_006462\|PILER-CR	190767-190798	32	NZ_CP049731	Rhizobium leguminosarum strain A1 plasmid pRL12, complete sequence	492397-492428	9	0.719
NC_006462_7	7.44\|190767\|32\|NC_006462\|PILER-CR	190767-190798	32	NZ_CP016287	Rhizobium leguminosarum strain Vaf10 plasmid unnamed1, complete sequence	806789-806820	9	0.719
NC_006462_7	7.44\|190767\|32\|NC_006462\|PILER-CR	190767-190798	32	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	597662-597693	9	0.719
NC_006462_7	7.44\|190767\|32\|NC_006462\|PILER-CR	190767-190798	32	NZ_CP022565	Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK01, complete sequence	925217-925248	9	0.719
NC_006462_7	7.44\|190767\|32\|NC_006462\|PILER-CR	190767-190798	32	NZ_CP053206	Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1D, complete sequence	493593-493624	9	0.719
NC_006462_8	8.1\|200840\|32\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	200840-200871	32	MT316461	Streptomyces phage Galactica, complete genome	70564-70595	9	0.719
NC_006462_8	8.9\|201332\|33\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	201332-201364	33	KR063280	Gordonia phage GMA6, complete genome	62584-62616	9	0.727
NC_006462_8	8.10\|201394\|32\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	201394-201425	32	NZ_CP015269	Mycobacterium chimaera strain ZUERICH-2 plasmid unnamed 2, complete sequence	135756-135787	9	0.719
NC_006462_8	8.13\|201580\|32\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	201580-201611	32	NZ_CP012940	Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence	235799-235830	9	0.719
NC_006462_8	8.13\|201580\|32\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	201580-201611	32	NZ_CP012944	Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence	146853-146884	9	0.719
NC_006462_8	8.13\|201580\|32\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	201580-201611	32	NC_017575	Ralstonia solanacearum Po82 megaplasmid, complete sequence	1784466-1784497	9	0.719
NC_006462_8	8.13\|201580\|32\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	201580-201611	32	NZ_CP026308	Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence	1784411-1784442	9	0.719
NC_006462_8	8.13\|201580\|32\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	201580-201611	32	NZ_CP051295	Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence	234290-234321	9	0.719
NC_006462_8	8.13\|201580\|32\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	201580-201611	32	CP047137	Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence	349026-349057	9	0.719
NC_006462_8	8.16\|201765\|33\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	201765-201797	33	NZ_CP045329	Labrenzia sp. THAF191b plasmid pTHAF191b_a, complete sequence	348477-348509	9	0.727
NC_006462_8	8.16\|201765\|33\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	201765-201797	33	NZ_CP045345	Labrenzia sp. THAF187b plasmid pTHAF187b_a, complete sequence	57112-57144	9	0.727
NC_006462_8	8.16\|201765\|33\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	201765-201797	33	NZ_CP045335	Labrenzia sp. THAF191a plasmid pTHAF191a_b, complete sequence	100657-100689	9	0.727
NC_006462_8	8.18\|201889\|34\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	201889-201922	34	NC_015178	Acidiphilium multivorum AIU301 plasmid pACMV1, complete sequence	118730-118763	9	0.735
NC_006462_8	8.18\|201889\|34\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	201889-201922	34	NZ_CP029359	Azospirillum sp. CFH 70021 plasmid unnamed4	118125-118158	9	0.735
NC_006462_8	8.18\|201889\|34\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	201889-201922	34	NZ_CP011667	Streptomyces sp. Mg1 plasmid pSMg1-3, complete sequence	7261-7294	9	0.735
NC_006462_8	8.18\|201889\|34\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	201889-201922	34	NZ_CP026517	Deinococcus sp. NW-56 plasmid unnamed1, complete sequence	345084-345117	9	0.735
NC_006462_9	9.6\|227726\|35\|NC_006462\|CRISPRCasFinder	227726-227760	35	AP021851	Deinococcus grandis ATCC 43672 plasmid: pDEGR-2 DNA, complete genome	241081-241115	9	0.743
NC_006462_9	9.18\|227725\|36\|NC_006462\|CRT,PILER-CR	227725-227760	36	AP021851	Deinococcus grandis ATCC 43672 plasmid: pDEGR-2 DNA, complete genome	241081-241116	9	0.75
NC_006462_4	4.7\|135643\|40\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	135643-135682	40	NC_017590	Thermus thermophilus JL-18 plasmid pTTJL1802, complete sequence	7174-7213	10	0.75
NC_006462_4	4.7\|135643\|40\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	135643-135682	40	NC_019388	Thermus oshimai JL-2 plasmid pTHEOS02, complete sequence	8030-8069	10	0.75
NC_006462_4	4.7\|135643\|40\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	135643-135682	40	NZ_CP010825	Thermus aquaticus Y51MC23 plasmid pTA69, complete sequence	58301-58340	10	0.75
NC_006462_7	7.6\|189842\|32\|NC_006462\|CRISPRCasFinder,CRT	189842-189873	32	NZ_CP022775	Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence	911046-911077	10	0.688
NC_006462_7	7.6\|189842\|32\|NC_006462\|CRISPRCasFinder,CRT	189842-189873	32	NZ_CP022762	Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence	811102-811133	10	0.688
NC_006462_7	7.6\|189842\|32\|NC_006462\|CRISPRCasFinder,CRT	189842-189873	32	NZ_CP023017	Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence	879750-879781	10	0.688
NC_006462_7	7.6\|189842\|32\|NC_006462\|CRISPRCasFinder,CRT	189842-189873	32	NZ_CP014703	Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence	810217-810248	10	0.688
NC_006462_7	7.6\|189842\|32\|NC_006462\|CRISPRCasFinder,CRT	189842-189873	32	NZ_CP022771	Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence	811095-811126	10	0.688
NC_006462_7	7.6\|189842\|32\|NC_006462\|CRISPRCasFinder,CRT	189842-189873	32	NZ_CP022777	Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence	811114-811145	10	0.688
NC_006462_7	7.6\|189842\|32\|NC_006462\|CRISPRCasFinder,CRT	189842-189873	32	NZ_CP022799	Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence	811086-811117	10	0.688
NC_006462_7	7.6\|189842\|32\|NC_006462\|CRISPRCasFinder,CRT	189842-189873	32	NZ_CP022764	Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence	911124-911155	10	0.688
NC_006462_7	7.6\|189842\|32\|NC_006462\|CRISPRCasFinder,CRT	189842-189873	32	NZ_CP022797	Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence	911122-911153	10	0.688
NC_006462_7	7.6\|189842\|32\|NC_006462\|CRISPRCasFinder,CRT	189842-189873	32	NZ_CP022758	Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence	911106-911137	10	0.688
NC_006462_7	7.12\|190210\|33\|NC_006462\|CRISPRCasFinder,CRT	190210-190242	33	NC_012970	Methylovorus glucosetrophus SIP3-4 plasmid pMsip01, complete sequence	13898-13930	10	0.697
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	NZ_CP012399	Chelatococcus sp. CO-6 plasmid pCO-6, complete sequence	385342-385373	10	0.688
NC_006462_7	7.20\|190704\|32\|NC_006462\|CRISPRCasFinder,CRT	190704-190735	32	CP040467	Streptomyces albidoflavus strain UYFA156 plasmid unnamed, complete sequence	258218-258249	10	0.688
NC_006462_7	7.21\|190765\|32\|NC_006462\|CRISPRCasFinder,CRT	190765-190796	32	NZ_CP011665	Streptomyces sp. Mg1 plasmid pSMg1-1, complete sequence	67962-67993	10	0.688
NC_006462_7	7.21\|190765\|32\|NC_006462\|CRISPRCasFinder,CRT	190765-190796	32	NZ_CP013553	Rhizobium phaseoli strain N931 plasmid pRphaN931a, complete sequence	232543-232574	10	0.688
NC_006462_7	7.21\|190765\|32\|NC_006462\|CRISPRCasFinder,CRT	190765-190796	32	NZ_CP013586	Rhizobium phaseoli strain N161 plasmid pRphaN161a, complete sequence	237359-237390	10	0.688
NC_006462_7	7.21\|190765\|32\|NC_006462\|CRISPRCasFinder,CRT	190765-190796	32	NZ_CP013597	Rhizobium sp. N741 plasmid pRspN741b, complete sequence	189067-189098	10	0.688
NC_006462_7	7.21\|190765\|32\|NC_006462\|CRISPRCasFinder,CRT	190765-190796	32	NZ_CP013559	Rhizobium phaseoli strain N841 plasmid pRphaN841b, complete sequence	234049-234080	10	0.688
NC_006462_7	7.21\|190765\|32\|NC_006462\|CRISPRCasFinder,CRT	190765-190796	32	NZ_CP013576	Rhizobium phaseoli strain N671 plasmid pRphaN671b, complete sequence	233820-233851	10	0.688
NC_006462_7	7.21\|190765\|32\|NC_006462\|CRISPRCasFinder,CRT	190765-190796	32	NZ_CP013548	Rhizobium phaseoli strain R611 plasmid pRetR611a, complete sequence	233818-233849	10	0.688
NC_006462_7	7.21\|190765\|32\|NC_006462\|CRISPRCasFinder,CRT	190765-190796	32	NZ_CP013533	Rhizobium phaseoli strain R650 plasmid pRphaR650a, complete sequence	233818-233849	10	0.688
NC_006462_7	7.21\|190765\|32\|NC_006462\|CRISPRCasFinder,CRT	190765-190796	32	NZ_CP013543	Rhizobium phaseoli strain R620 plasmid pRphaR620a, complete sequence	237230-237261	10	0.688
NC_006462_7	7.21\|190765\|32\|NC_006462\|CRISPRCasFinder,CRT	190765-190796	32	NZ_CP013564	Rhizobium phaseoli strain N831 plasmid pRphaN831a, complete sequence	232543-232574	10	0.688
NC_006462_7	7.21\|190765\|32\|NC_006462\|CRISPRCasFinder,CRT	190765-190796	32	NZ_CP013501	Rhizobium esperanzae strain N561 plasmid pRspN561a, complete sequence	189433-189464	10	0.688
NC_006462_7	7.21\|190765\|32\|NC_006462\|CRISPRCasFinder,CRT	190765-190796	32	NZ_CP013507	Rhizobium sp. N1341 plasmid pRspN1341b, complete sequence	189067-189098	10	0.688
NC_006462_7	7.21\|190765\|32\|NC_006462\|CRISPRCasFinder,CRT	190765-190796	32	NZ_CP013518	Rhizobium sp. N113 plasmid pRspN113a, complete sequence	189433-189464	10	0.688
NC_006462_7	7.21\|190765\|32\|NC_006462\|CRISPRCasFinder,CRT	190765-190796	32	NZ_CP013570	Rhizobium phaseoli strain N771 plasmid pRphaN771b, complete sequence	233820-233851	10	0.688
NC_006462_7	7.21\|190765\|32\|NC_006462\|CRISPRCasFinder,CRT	190765-190796	32	NZ_CP013491	Rhizobium sp. N6212 plasmid pRspN6212a, complete sequence	189436-189467	10	0.688
NC_006462_7	7.21\|190765\|32\|NC_006462\|CRISPRCasFinder,CRT	190765-190796	32	NZ_CP013513	Rhizobium sp. N1314 plasmid pRspN1314b, complete sequence	210312-210343	10	0.688
NC_006462_7	7.21\|190765\|32\|NC_006462\|CRISPRCasFinder,CRT	190765-190796	32	NZ_CP013496	Rhizobium sp. N621 plasmid pRspN621a, complete sequence	189436-189467	10	0.688
NC_006462_7	7.21\|190765\|32\|NC_006462\|CRISPRCasFinder,CRT	190765-190796	32	NZ_CP013591	Rhizobium sp. N871 plasmid pRspN871a, complete sequence	189436-189467	10	0.688
NC_006462_7	7.21\|190765\|32\|NC_006462\|CRISPRCasFinder,CRT	190765-190796	32	NZ_CP013603	Rhizobium sp. N731 plasmid pRspN731b, complete sequence	210312-210343	10	0.688
NC_006462_7	7.21\|190765\|32\|NC_006462\|CRISPRCasFinder,CRT	190765-190796	32	NC_016585	Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence	453544-453575	10	0.688
NC_006462_7	7.29\|189844\|32\|NC_006462\|PILER-CR	189844-189875	32	NZ_CP022775	Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence	911046-911077	10	0.688
NC_006462_7	7.29\|189844\|32\|NC_006462\|PILER-CR	189844-189875	32	NZ_CP022762	Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence	811102-811133	10	0.688
NC_006462_7	7.29\|189844\|32\|NC_006462\|PILER-CR	189844-189875	32	NZ_CP023017	Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence	879750-879781	10	0.688
NC_006462_7	7.29\|189844\|32\|NC_006462\|PILER-CR	189844-189875	32	NZ_CP014703	Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence	810217-810248	10	0.688
NC_006462_7	7.29\|189844\|32\|NC_006462\|PILER-CR	189844-189875	32	NZ_CP022771	Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence	811095-811126	10	0.688
NC_006462_7	7.29\|189844\|32\|NC_006462\|PILER-CR	189844-189875	32	NZ_CP022777	Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence	811114-811145	10	0.688
NC_006462_7	7.29\|189844\|32\|NC_006462\|PILER-CR	189844-189875	32	NZ_CP022799	Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence	811086-811117	10	0.688
NC_006462_7	7.29\|189844\|32\|NC_006462\|PILER-CR	189844-189875	32	NZ_CP022764	Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence	911124-911155	10	0.688
NC_006462_7	7.29\|189844\|32\|NC_006462\|PILER-CR	189844-189875	32	NZ_CP022797	Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence	911122-911153	10	0.688
NC_006462_7	7.29\|189844\|32\|NC_006462\|PILER-CR	189844-189875	32	NZ_CP022758	Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence	911106-911137	10	0.688
NC_006462_7	7.35\|190212\|33\|NC_006462\|PILER-CR	190212-190244	33	NC_012970	Methylovorus glucosetrophus SIP3-4 plasmid pMsip01, complete sequence	13898-13930	10	0.697
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	NZ_CP012399	Chelatococcus sp. CO-6 plasmid pCO-6, complete sequence	385342-385373	10	0.688
NC_006462_7	7.43\|190706\|32\|NC_006462\|PILER-CR	190706-190737	32	CP040467	Streptomyces albidoflavus strain UYFA156 plasmid unnamed, complete sequence	258218-258249	10	0.688
NC_006462_7	7.44\|190767\|32\|NC_006462\|PILER-CR	190767-190798	32	NZ_CP011665	Streptomyces sp. Mg1 plasmid pSMg1-1, complete sequence	67962-67993	10	0.688
NC_006462_7	7.44\|190767\|32\|NC_006462\|PILER-CR	190767-190798	32	NZ_CP013553	Rhizobium phaseoli strain N931 plasmid pRphaN931a, complete sequence	232543-232574	10	0.688
NC_006462_7	7.44\|190767\|32\|NC_006462\|PILER-CR	190767-190798	32	NZ_CP013586	Rhizobium phaseoli strain N161 plasmid pRphaN161a, complete sequence	237359-237390	10	0.688
NC_006462_7	7.44\|190767\|32\|NC_006462\|PILER-CR	190767-190798	32	NZ_CP013597	Rhizobium sp. N741 plasmid pRspN741b, complete sequence	189067-189098	10	0.688
NC_006462_7	7.44\|190767\|32\|NC_006462\|PILER-CR	190767-190798	32	NZ_CP013559	Rhizobium phaseoli strain N841 plasmid pRphaN841b, complete sequence	234049-234080	10	0.688
NC_006462_7	7.44\|190767\|32\|NC_006462\|PILER-CR	190767-190798	32	NZ_CP013576	Rhizobium phaseoli strain N671 plasmid pRphaN671b, complete sequence	233820-233851	10	0.688
NC_006462_7	7.44\|190767\|32\|NC_006462\|PILER-CR	190767-190798	32	NZ_CP013548	Rhizobium phaseoli strain R611 plasmid pRetR611a, complete sequence	233818-233849	10	0.688
NC_006462_7	7.44\|190767\|32\|NC_006462\|PILER-CR	190767-190798	32	NZ_CP013533	Rhizobium phaseoli strain R650 plasmid pRphaR650a, complete sequence	233818-233849	10	0.688
NC_006462_7	7.44\|190767\|32\|NC_006462\|PILER-CR	190767-190798	32	NZ_CP013543	Rhizobium phaseoli strain R620 plasmid pRphaR620a, complete sequence	237230-237261	10	0.688
NC_006462_7	7.44\|190767\|32\|NC_006462\|PILER-CR	190767-190798	32	NZ_CP013564	Rhizobium phaseoli strain N831 plasmid pRphaN831a, complete sequence	232543-232574	10	0.688
NC_006462_7	7.44\|190767\|32\|NC_006462\|PILER-CR	190767-190798	32	NZ_CP013501	Rhizobium esperanzae strain N561 plasmid pRspN561a, complete sequence	189433-189464	10	0.688
NC_006462_7	7.44\|190767\|32\|NC_006462\|PILER-CR	190767-190798	32	NZ_CP013507	Rhizobium sp. N1341 plasmid pRspN1341b, complete sequence	189067-189098	10	0.688
NC_006462_7	7.44\|190767\|32\|NC_006462\|PILER-CR	190767-190798	32	NZ_CP013518	Rhizobium sp. N113 plasmid pRspN113a, complete sequence	189433-189464	10	0.688
NC_006462_7	7.44\|190767\|32\|NC_006462\|PILER-CR	190767-190798	32	NZ_CP013570	Rhizobium phaseoli strain N771 plasmid pRphaN771b, complete sequence	233820-233851	10	0.688
NC_006462_7	7.44\|190767\|32\|NC_006462\|PILER-CR	190767-190798	32	NZ_CP013491	Rhizobium sp. N6212 plasmid pRspN6212a, complete sequence	189436-189467	10	0.688
NC_006462_7	7.44\|190767\|32\|NC_006462\|PILER-CR	190767-190798	32	NZ_CP013513	Rhizobium sp. N1314 plasmid pRspN1314b, complete sequence	210312-210343	10	0.688
NC_006462_7	7.44\|190767\|32\|NC_006462\|PILER-CR	190767-190798	32	NZ_CP013496	Rhizobium sp. N621 plasmid pRspN621a, complete sequence	189436-189467	10	0.688
NC_006462_7	7.44\|190767\|32\|NC_006462\|PILER-CR	190767-190798	32	NZ_CP013591	Rhizobium sp. N871 plasmid pRspN871a, complete sequence	189436-189467	10	0.688
NC_006462_7	7.44\|190767\|32\|NC_006462\|PILER-CR	190767-190798	32	NZ_CP013603	Rhizobium sp. N731 plasmid pRspN731b, complete sequence	210312-210343	10	0.688
NC_006462_7	7.44\|190767\|32\|NC_006462\|PILER-CR	190767-190798	32	NC_016585	Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence	453544-453575	10	0.688
NC_006462_8	8.1\|200840\|32\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	200840-200871	32	MT663720	Pseudomonas phage DDSR119, complete genome	68-99	10	0.688
NC_006462_8	8.18\|201889\|34\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	201889-201922	34	NZ_CP032928	Agrobacterium tumefaciens strain 1D1460 plasmid pAt1D1460, complete sequence	337898-337931	10	0.706
NC_006462_8	8.18\|201889\|34\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	201889-201922	34	NC_011143	Phenylobacterium zucineum HLK1 plasmid, complete sequence	20574-20607	10	0.706
NC_006462_8	8.18\|201889\|34\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	201889-201922	34	MT316461	Streptomyces phage Galactica, complete genome	5318-5351	10	0.706
NC_006462_5	5.8\|144695\|37\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	144695-144731	37	NZ_CP010826	Thermus aquaticus Y51MC23 plasmid pTA78, complete sequence	68262-68298	11	0.703
NC_006462_7	7.21\|190765\|32\|NC_006462\|CRISPRCasFinder,CRT	190765-190796	32	NC_013779	Nocardiopsis sp. 90127 plasmid pSQ10, complete sequence	16088-16119	11	0.656
NC_006462_7	7.44\|190767\|32\|NC_006462\|PILER-CR	190767-190798	32	NC_013779	Nocardiopsis sp. 90127 plasmid pSQ10, complete sequence	16088-16119	11	0.656
NC_006462_8	8.18\|201889\|34\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	201889-201922	34	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	47640-47673	11	0.676
NC_006462_8	8.18\|201889\|34\|NC_006462\|PILER-CR,CRISPRCasFinder,CRT	201889-201922	34	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	100699-100732	11	0.676

1. spacer 1.1|18080|38|NC_006462|CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

ccggttgtcaacgacgaccgggagataaaggggctcat	CRISPR spacer
ccggttgtcaacgacgaccgggagataaaggggctcat	Protospacer
**************************************

2. spacer 1.2|18154|38|NC_006462|CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

gcgaccatcgtcgcccgccctgacggcggacctaagcg	CRISPR spacer
gcgaccatcgtcgcccgccctgacggcggacctaagcg	Protospacer
**************************************

3. spacer 1.3|18228|40|NC_006462|CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

ccttggagaaggccttggagaaggtttcccccaccctggt	CRISPR spacer
ccttggagaaggccttggagaaggtttcccccaccctggt	Protospacer
****************************************

4. spacer 1.4|18086|36|NC_006462|PILER-CR matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

ggttgtcaacgacgaccgggagataaaggggctcat	CRISPR spacer
ggttgtcaacgacgaccgggagataaaggggctcat	Protospacer
************************************

5. spacer 1.5|18160|36|NC_006462|PILER-CR matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

gaccatcgtcgcccgccctgacggcggacctaagcg	CRISPR spacer
gaccatcgtcgcccgccctgacggcggacctaagcg	Protospacer
************************************

6. spacer 1.6|18234|38|NC_006462|PILER-CR matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

ttggagaaggccttggagaaggtttcccccaccctggt	CRISPR spacer
ttggagaaggccttggagaaggtttcccccaccctggt	Protospacer
**************************************

7. spacer 2.1|113562|38|NC_006462|CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

tttctccccaagtcttccgataggggagggggtcaaca	CRISPR spacer
tttctccccaagtcttccgataggggagggggtcaaca	Protospacer
**************************************

8. spacer 2.1|113562|38|NC_006462|CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

tttctccccaagtcttccgataggggagggggtcaaca	CRISPR spacer
tttctccccaagtcttccgataggggagggggtcaaca	Protospacer
**************************************

9. spacer 2.1|113562|38|NC_006462|CRT matches to NZ_LR027520 (Thermus thermophilus isolate TTHNAR1 plasmid 4, complete sequence) position: , mismatch: 0, identity: 1.0

tttctccccaagtcttccgataggggagggggtcaaca	CRISPR spacer
tttctccccaagtcttccgataggggagggggtcaaca	Protospacer
**************************************

10. spacer 2.2|113618|39|NC_006462|CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

cttttccccaagtcttccgataccccgcaccccccgacg	CRISPR spacer
cttttccccaagtcttccgataccccgcaccccccgacg	Protospacer
***************************************

11. spacer 2.3|113675|38|NC_006462|CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

tttctccccaagtcttccgataggggagggggtcaaca	CRISPR spacer
tttctccccaagtcttccgataggggagggggtcaaca	Protospacer
**************************************

12. spacer 2.3|113675|38|NC_006462|CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

tttctccccaagtcttccgataggggagggggtcaaca	CRISPR spacer
tttctccccaagtcttccgataggggagggggtcaaca	Protospacer
**************************************

13. spacer 2.3|113675|38|NC_006462|CRT matches to NZ_LR027520 (Thermus thermophilus isolate TTHNAR1 plasmid 4, complete sequence) position: , mismatch: 0, identity: 1.0

tttctccccaagtcttccgataggggagggggtcaaca	CRISPR spacer
tttctccccaagtcttccgataggggagggggtcaaca	Protospacer
**************************************

14. spacer 3.1|133802|41|NC_006462|CRISPRCasFinder matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

atgtggcagtccaacgacgacggcttcggcatgttctttcg	CRISPR spacer
atgtggcagtccaacgacgacggcttcggcatgttctttcg	Protospacer
*****************************************

15. spacer 3.2|133879|40|NC_006462|CRISPRCasFinder matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

catgatgagggcgtgagcggcctcgggccgggactgaagg	CRISPR spacer
catgatgagggcgtgagcggcctcgggccgggactgaagg	Protospacer
****************************************

16. spacer 4.1|135192|39|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

tgctctaatcgggcctgttcggctatggccttggggctc	CRISPR spacer
tgctctaatcgggcctgttcggctatggccttggggctc	Protospacer
***************************************

17. spacer 4.2|135267|40|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

acaacccgcccaaagggaatgccgctagccccagacacat	CRISPR spacer
acaacccgcccaaagggaatgccgctagccccagacacat	Protospacer
****************************************

18. spacer 4.3|135343|36|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

cagtcccacccctcgtggggggcggccctgtcgtcg	CRISPR spacer
cagtcccacccctcgtggggggcggccctgtcgtcg	Protospacer
************************************

19. spacer 4.4|135415|39|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

cgcaccctccttccgagcttccacccggcgtacatggcc	CRISPR spacer
cgcaccctccttccgagcttccacccggcgtacatggcc	Protospacer
***************************************

20. spacer 4.5|135490|39|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

ttcagcagaccgaagtgtcttccgttgcgaacagtgtag	CRISPR spacer
ttcagcagaccgaagtgtcttccgttgcgaacagtgtag	Protospacer
***************************************

21. spacer 4.6|135565|42|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

cctcatcagcgcatctagagcctgaattatcctcatttcttc	CRISPR spacer
cctcatcagcgcatctagagcctgaattatcctcatttcttc	Protospacer
******************************************

22. spacer 4.7|135643|40|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

gccatcaccgtgaggccgccctccaccagctccccctcca	CRISPR spacer
gccatcaccgtgaggccgccctccaccagctccccctcca	Protospacer
****************************************

23. spacer 4.8|135719|40|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

tttcttaattacgagccagtcattcggataaaccatgaga	CRISPR spacer
tttcttaattacgagccagtcattcggataaaccatgaga	Protospacer
****************************************

24. spacer 4.9|135795|39|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

tgaaagtttcggtggtcccccccgccctccaccagcgga	CRISPR spacer
tgaaagtttcggtggtcccccccgccctccaccagcgga	Protospacer
***************************************

25. spacer 4.10|135870|40|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

ccgcagctggggcaagtgcaaccgcagtagctcatactcc	CRISPR spacer
ccgcagctggggcaagtgcaaccgcagtagctcatactcc	Protospacer
****************************************

26. spacer 4.11|135946|40|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

ttggcggtcagggtttggtaccgcaccgtgttcggcgtta	CRISPR spacer
ttggcggtcagggtttggtaccgcaccgtgttcggcgtta	Protospacer
****************************************

27. spacer 4.12|136022|42|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

ttcttgattatcctgaccttgtccttcatctttgacctcctt	CRISPR spacer
ttcttgattatcctgaccttgtccttcatctttgacctcctt	Protospacer
******************************************

28. spacer 5.1|144165|41|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

cggaggggcccccttctccccccggggcggcattttcccgg	CRISPR spacer
cggaggggcccccttctccccccggggcggcattttcccgg	Protospacer
*****************************************

29. spacer 5.2|144242|42|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

tcccgaggcccggtagtgggccgttgacctcgggcgcctccg	CRISPR spacer
tcccgaggcccggtagtgggccgttgacctcgggcgcctccg	Protospacer
******************************************

30. spacer 5.3|144320|37|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

gaccttgaggagggctccgagtcttttcagggcgggt	CRISPR spacer
gaccttgaggagggctccgagtcttttcagggcgggt	Protospacer
*************************************

31. spacer 5.4|144393|38|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

aaccctccgcgccatcgcctcccgcctctaccacctct	CRISPR spacer
aaccctccgcgccatcgcctcccgcctctaccacctct	Protospacer
**************************************

32. spacer 5.5|144467|40|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

ccgtagataaggcgcccggggacgaccacgtcaaggcgca	CRISPR spacer
ccgtagataaggcgcccggggacgaccacgtcaaggcgca	Protospacer
****************************************

33. spacer 5.6|144543|38|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

cggggatgtagtccccggagctagccgggggaggacct	CRISPR spacer
cggggatgtagtccccggagctagccgggggaggacct	Protospacer
**************************************

34. spacer 5.7|144617|42|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

ggtgcgagggggtggaccgctagttgcgcctctattcaagat	CRISPR spacer
ggtgcgagggggtggaccgctagttgcgcctctattcaagat	Protospacer
******************************************

35. spacer 5.8|144695|37|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

ccgggaaggccgtgggctcgggcaccgccgccccgag	CRISPR spacer
ccgggaaggccgtgggctcgggcaccgccgccccgag	Protospacer
*************************************

36. spacer 5.9|144768|39|NC_006462|CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

cacagagcggccctttggggtgggttagaagaagaagaa	CRISPR spacer
cacagagcggccctttggggtgggttagaagaagaagaa	Protospacer
***************************************

37. spacer 6.1|146078|42|NC_006462|CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

ttcgaagcgccccgccccgaggcacttcccacaccctttccc	CRISPR spacer
ttcgaagcgccccgccccgaggcacttcccacaccctttccc	Protospacer
******************************************

38. spacer 6.1|146078|42|NC_006462|CRISPRCasFinder,CRT matches to NC_005838 (Thermus thermophilus HB27 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

ttcgaagcgccccgccccgaggcacttcccacaccctttccc	CRISPR spacer
ttcgaagcgccccgccccgaggcacttcccacaccctttccc	Protospacer
******************************************

39. spacer 6.2|146156|44|NC_006462|CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

gtgctccttcaaactcctctccagagcctcctggatcagttcat	CRISPR spacer
gtgctccttcaaactcctctccagagcctcctggatcagttcat	Protospacer
********************************************

40. spacer 6.2|146156|44|NC_006462|CRISPRCasFinder,CRT matches to NC_005838 (Thermus thermophilus HB27 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

gtgctccttcaaactcctctccagagcctcctggatcagttcat	CRISPR spacer
gtgctccttcaaactcctctccagagcctcctggatcagttcat	Protospacer
********************************************

41. spacer 6.3|146236|40|NC_006462|CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

actccctctacgccccctaactcgcggtacgcgaagaggg	CRISPR spacer
actccctctacgccccctaactcgcggtacgcgaagaggg	Protospacer
****************************************

42. spacer 6.3|146236|40|NC_006462|CRISPRCasFinder,CRT matches to NC_005838 (Thermus thermophilus HB27 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

actccctctacgccccctaactcgcggtacgcgaagaggg	CRISPR spacer
actccctctacgccccctaactcgcggtacgcgaagaggg	Protospacer
****************************************

43. spacer 6.4|146312|36|NC_006462|CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

gacaggtaagggtgtagaggtcgtccagcttcataa	CRISPR spacer
gacaggtaagggtgtagaggtcgtccagcttcataa	Protospacer
************************************

44. spacer 6.4|146312|36|NC_006462|CRISPRCasFinder,CRT matches to NC_005838 (Thermus thermophilus HB27 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

gacaggtaagggtgtagaggtcgtccagcttcataa	CRISPR spacer
gacaggtaagggtgtagaggtcgtccagcttcataa	Protospacer
************************************

45. spacer 6.5|146384|37|NC_006462|CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

aagtgaggatgtacccccgccccttgagcttcttctc	CRISPR spacer
aagtgaggatgtacccccgccccttgagcttcttctc	Protospacer
*************************************

46. spacer 6.5|146384|37|NC_006462|CRISPRCasFinder,CRT matches to NC_005838 (Thermus thermophilus HB27 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

aagtgaggatgtacccccgccccttgagcttcttctc	CRISPR spacer
aagtgaggatgtacccccgccccttgagcttcttctc	Protospacer
*************************************

47. spacer 6.6|146457|37|NC_006462|CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

ctttgcgccgcgcggcctagcgccgaccgcgtatccc	CRISPR spacer
ctttgcgccgcgcggcctagcgccgaccgcgtatccc	Protospacer
*************************************

48. spacer 6.6|146457|37|NC_006462|CRISPRCasFinder,CRT matches to NC_005838 (Thermus thermophilus HB27 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

ctttgcgccgcgcggcctagcgccgaccgcgtatccc	CRISPR spacer
ctttgcgccgcgcggcctagcgccgaccgcgtatccc	Protospacer
*************************************

49. spacer 6.7|146530|37|NC_006462|CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

ctttaagggagtcgccttcgcccacgtcttccttggt	CRISPR spacer
ctttaagggagtcgccttcgcccacgtcttccttggt	Protospacer
*************************************

50. spacer 6.7|146530|37|NC_006462|CRISPRCasFinder,CRT matches to NC_005838 (Thermus thermophilus HB27 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

ctttaagggagtcgccttcgcccacgtcttccttggt	CRISPR spacer
ctttaagggagtcgccttcgcccacgtcttccttggt	Protospacer
*************************************

51. spacer 6.8|146603|40|NC_006462|CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

attctccaacgaaccatgagattcaccccctttgagattc	CRISPR spacer
attctccaacgaaccatgagattcaccccctttgagattc	Protospacer
****************************************

52. spacer 6.9|146679|38|NC_006462|CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

gcgaggagccgccgcaccccgatgatgcgcccctggtc	CRISPR spacer
gcgaggagccgccgcaccccgatgatgcgcccctggtc	Protospacer
**************************************

53. spacer 6.9|146679|38|NC_006462|CRISPRCasFinder,CRT matches to NC_005838 (Thermus thermophilus HB27 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

gcgaggagccgccgcaccccgatgatgcgcccctggtc	CRISPR spacer
gcgaggagccgccgcaccccgatgatgcgcccctggtc	Protospacer
**************************************

54. spacer 6.10|146753|40|NC_006462|CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

tccttctttgggccagctgatgccccaggcaagccccggt	CRISPR spacer
tccttctttgggccagctgatgccccaggcaagccccggt	Protospacer
****************************************

55. spacer 6.10|146753|40|NC_006462|CRISPRCasFinder,CRT matches to NC_005838 (Thermus thermophilus HB27 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

tccttctttgggccagctgatgccccaggcaagccccggt	CRISPR spacer
tccttctttgggccagctgatgccccaggcaagccccggt	Protospacer
****************************************

56. spacer 6.11|146829|41|NC_006462|CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

gcttctccgttgcgctgagttcgccgttgctccagacatgg	CRISPR spacer
gcttctccgttgcgctgagttcgccgttgctccagacatgg	Protospacer
*****************************************

57. spacer 6.11|146829|41|NC_006462|CRISPRCasFinder,CRT matches to NC_005838 (Thermus thermophilus HB27 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

gcttctccgttgcgctgagttcgccgttgctccagacatgg	CRISPR spacer
gcttctccgttgcgctgagttcgccgttgctccagacatgg	Protospacer
*****************************************

58. spacer 6.12|146906|42|NC_006462|CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

gtgtggccgcggctgcgcgccgcgcggcccttgcgcccatgc	CRISPR spacer
gtgtggccgcggctgcgcgccgcgcggcccttgcgcccatgc	Protospacer
******************************************

59. spacer 6.12|146906|42|NC_006462|CRISPRCasFinder,CRT matches to NC_005838 (Thermus thermophilus HB27 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

gtgtggccgcggctgcgcgccgcgcggcccttgcgcccatgc	CRISPR spacer
gtgtggccgcggctgcgcgccgcgcggcccttgcgcccatgc	Protospacer
******************************************

60. spacer 7.1|189536|32|NC_006462|CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

tcgtccgcaagctcgtcgggcacctcctccgg	CRISPR spacer
tcgtccgcaagctcgtcgggcacctcctccgg	Protospacer
********************************

61. spacer 7.2|189597|33|NC_006462|CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

gccggaggcccggcccggaggggtcgtaagacc	CRISPR spacer
gccggaggcccggcccggaggggtcgtaagacc	Protospacer
*********************************

62. spacer 7.3|189659|33|NC_006462|CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

gcccccgcgggagcggcgcgccttgctagagga	CRISPR spacer
gcccccgcgggagcggcgcgccttgctagagga	Protospacer
*********************************

63. spacer 7.4|189721|32|NC_006462|CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

gaccgcttcacgtcccggagtcgtgtcagggg	CRISPR spacer
gaccgcttcacgtcccggagtcgtgtcagggg	Protospacer
********************************

64. spacer 7.5|189782|31|NC_006462|CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

ttgccattactattactaccggcaacatcgc	CRISPR spacer
ttgccattactattactaccggcaacatcgc	Protospacer
*******************************

65. spacer 7.6|189842|32|NC_006462|CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

ggcgtggccggagggggtgccgaatggctaag	CRISPR spacer
ggcgtggccggagggggtgccgaatggctaag	Protospacer
********************************

66. spacer 7.7|189903|32|NC_006462|CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

gtggaggtctacgccgggaaccgatttttcac	CRISPR spacer
gtggaggtctacgccgggaaccgatttttcac	Protospacer
********************************

67. spacer 7.8|189964|33|NC_006462|CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

ggcccggagcatggcctgcaggacggcggaggg	CRISPR spacer
ggcccggagcatggcctgcaggacggcggaggg	Protospacer
*********************************

68. spacer 7.9|190026|33|NC_006462|CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

ggcccgggtcctgggccacggctgggctaaagg	CRISPR spacer
ggcccgggtcctgggccacggctgggctaaagg	Protospacer
*********************************

69. spacer 7.10|190088|32|NC_006462|CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

cggaggagccacaggtaggccgcccgggccag	CRISPR spacer
cggaggagccacaggtaggccgcccgggccag	Protospacer
********************************

70. spacer 7.11|190149|32|NC_006462|CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

ccgagtgggtcgtccgcctcgttgagtaccct	CRISPR spacer
ccgagtgggtcgtccgcctcgttgagtaccct	Protospacer
********************************

71. spacer 7.12|190210|33|NC_006462|CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

gaggcgctgctgagccccaaggcactacggccc	CRISPR spacer
gaggcgctgctgagccccaaggcactacggccc	Protospacer
*********************************

72. spacer 7.13|190272|33|NC_006462|CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

gcctccacaccaggccaccaggtctgcggcccc	CRISPR spacer
gcctccacaccaggccaccaggtctgcggcccc	Protospacer
*********************************

73. spacer 7.14|190334|32|NC_006462|CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

ccctcttgttctctctggccgcccaacgaggt	CRISPR spacer
ccctcttgttctctctggccgcccaacgaggt	Protospacer
********************************

74. spacer 7.15|190395|33|NC_006462|CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

cacccccttggccttgggcttatagcgctaacc	CRISPR spacer
cacccccttggccttgggcttatagcgctaacc	Protospacer
*********************************

75. spacer 7.16|190457|33|NC_006462|CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

gctcgcaagcttgaggataaactggatagggcc	CRISPR spacer
gctcgcaagcttgaggataaactggatagggcc	Protospacer
*********************************

76. spacer 7.17|190519|32|NC_006462|CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

cctagcctcctgtgacgggtgggggctgtcag	CRISPR spacer
cctagcctcctgtgacgggtgggggctgtcag	Protospacer
********************************

77. spacer 7.18|190580|33|NC_006462|CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

ggtggagaatcagcccgttgaggaggttgccta	CRISPR spacer
ggtggagaatcagcccgttgaggaggttgccta	Protospacer
*********************************

78. spacer 7.19|190642|33|NC_006462|CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

tagacaaaggtcgtcttatattctgcgtccggc	CRISPR spacer
tagacaaaggtcgtcttatattctgcgtccggc	Protospacer
*********************************

79. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
ttgcagataggcgatgttggcggcgatgacct	Protospacer
********************************

80. spacer 7.21|190765|32|NC_006462|CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
ggagtggcggccgcgaagcgggccaggtctac	Protospacer
********************************

81. spacer 7.22|190826|32|NC_006462|CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

agagagctcgtaaagggccccggccaaatcgt	CRISPR spacer
agagagctcgtaaagggccccggccaaatcgt	Protospacer
********************************

82. spacer 7.23|190887|32|NC_006462|CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

gcgggtcacctcggagtaggagcgggtggcgt	CRISPR spacer
gcgggtcacctcggagtaggagcgggtggcgt	Protospacer
********************************

83. spacer 7.24|189538|32|NC_006462|PILER-CR matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

tcgtccgcaagctcgtcgggcacctcctccgg	CRISPR spacer
tcgtccgcaagctcgtcgggcacctcctccgg	Protospacer
********************************

84. spacer 7.25|189599|33|NC_006462|PILER-CR matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

gccggaggcccggcccggaggggtcgtaagacc	CRISPR spacer
gccggaggcccggcccggaggggtcgtaagacc	Protospacer
*********************************

85. spacer 7.26|189661|33|NC_006462|PILER-CR matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

gcccccgcgggagcggcgcgccttgctagagga	CRISPR spacer
gcccccgcgggagcggcgcgccttgctagagga	Protospacer
*********************************

86. spacer 7.27|189723|32|NC_006462|PILER-CR matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

gaccgcttcacgtcccggagtcgtgtcagggg	CRISPR spacer
gaccgcttcacgtcccggagtcgtgtcagggg	Protospacer
********************************

87. spacer 7.28|189784|31|NC_006462|PILER-CR matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

ttgccattactattactaccggcaacatcgc	CRISPR spacer
ttgccattactattactaccggcaacatcgc	Protospacer
*******************************

88. spacer 7.29|189844|32|NC_006462|PILER-CR matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

ggcgtggccggagggggtgccgaatggctaag	CRISPR spacer
ggcgtggccggagggggtgccgaatggctaag	Protospacer
********************************

89. spacer 7.30|189905|32|NC_006462|PILER-CR matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

gtggaggtctacgccgggaaccgatttttcac	CRISPR spacer
gtggaggtctacgccgggaaccgatttttcac	Protospacer
********************************

90. spacer 7.31|189966|33|NC_006462|PILER-CR matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

ggcccggagcatggcctgcaggacggcggaggg	CRISPR spacer
ggcccggagcatggcctgcaggacggcggaggg	Protospacer
*********************************

91. spacer 7.32|190028|33|NC_006462|PILER-CR matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

ggcccgggtcctgggccacggctgggctaaagg	CRISPR spacer
ggcccgggtcctgggccacggctgggctaaagg	Protospacer
*********************************

92. spacer 7.33|190090|32|NC_006462|PILER-CR matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

cggaggagccacaggtaggccgcccgggccag	CRISPR spacer
cggaggagccacaggtaggccgcccgggccag	Protospacer
********************************

93. spacer 7.34|190151|32|NC_006462|PILER-CR matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

ccgagtgggtcgtccgcctcgttgagtaccct	CRISPR spacer
ccgagtgggtcgtccgcctcgttgagtaccct	Protospacer
********************************

94. spacer 7.35|190212|33|NC_006462|PILER-CR matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

gaggcgctgctgagccccaaggcactacggccc	CRISPR spacer
gaggcgctgctgagccccaaggcactacggccc	Protospacer
*********************************

95. spacer 7.36|190274|33|NC_006462|PILER-CR matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

gcctccacaccaggccaccaggtctgcggcccc	CRISPR spacer
gcctccacaccaggccaccaggtctgcggcccc	Protospacer
*********************************

96. spacer 7.37|190336|32|NC_006462|PILER-CR matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

ccctcttgttctctctggccgcccaacgaggt	CRISPR spacer
ccctcttgttctctctggccgcccaacgaggt	Protospacer
********************************

97. spacer 7.38|190397|33|NC_006462|PILER-CR matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

cacccccttggccttgggcttatagcgctaacc	CRISPR spacer
cacccccttggccttgggcttatagcgctaacc	Protospacer
*********************************

98. spacer 7.39|190459|33|NC_006462|PILER-CR matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

gctcgcaagcttgaggataaactggatagggcc	CRISPR spacer
gctcgcaagcttgaggataaactggatagggcc	Protospacer
*********************************

99. spacer 7.40|190521|32|NC_006462|PILER-CR matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

cctagcctcctgtgacgggtgggggctgtcag	CRISPR spacer
cctagcctcctgtgacgggtgggggctgtcag	Protospacer
********************************

100. spacer 7.41|190582|33|NC_006462|PILER-CR matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

ggtggagaatcagcccgttgaggaggttgccta	CRISPR spacer
ggtggagaatcagcccgttgaggaggttgccta	Protospacer
*********************************

101. spacer 7.42|190644|33|NC_006462|PILER-CR matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

tagacaaaggtcgtcttatattctgcgtccggc	CRISPR spacer
tagacaaaggtcgtcttatattctgcgtccggc	Protospacer
*********************************

102. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
ttgcagataggcgatgttggcggcgatgacct	Protospacer
********************************

103. spacer 7.44|190767|32|NC_006462|PILER-CR matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
ggagtggcggccgcgaagcgggccaggtctac	Protospacer
********************************

104. spacer 7.45|190828|32|NC_006462|PILER-CR matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

agagagctcgtaaagggccccggccaaatcgt	CRISPR spacer
agagagctcgtaaagggccccggccaaatcgt	Protospacer
********************************

105. spacer 7.46|190889|32|NC_006462|PILER-CR matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

gcgggtcacctcggagtaggagcgggtggcgt	CRISPR spacer
gcgggtcacctcggagtaggagcgggtggcgt	Protospacer
********************************

106. spacer 8.1|200840|32|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

gctggcctgcaggacctccagcatctggcggg	CRISPR spacer
gctggcctgcaggacctccagcatctggcggg	Protospacer
********************************

107. spacer 8.2|200901|33|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

gccctagactcgggctatcccgccatcagcggc	CRISPR spacer
gccctagactcgggctatcccgccatcagcggc	Protospacer
*********************************

108. spacer 8.3|200963|32|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

ccagcggatggcgtcctcatagcgcatgcgca	CRISPR spacer
ccagcggatggcgtcctcatagcgcatgcgca	Protospacer
********************************

109. spacer 8.4|201024|33|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

gcaaccccagggttcaggggttcagtcgcccat	CRISPR spacer
gcaaccccagggttcaggggttcagtcgcccat	Protospacer
*********************************

110. spacer 8.5|201086|33|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

ttcacccagcttgacggcgccatcatttcccac	CRISPR spacer
ttcacccagcttgacggcgccatcatttcccac	Protospacer
*********************************

111. spacer 8.6|201148|33|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

gccatcccgaagccgtgcgggttgccttcccac	CRISPR spacer
gccatcccgaagccgtgcgggttgccttcccac	Protospacer
*********************************

112. spacer 8.7|201210|32|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

ctatctttcgcgaactaccgggcttgggccgc	CRISPR spacer
ctatctttcgcgaactaccgggcttgggccgc	Protospacer
********************************

113. spacer 8.8|201271|32|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

taggccatcgtgtctagggaggggttagaccc	CRISPR spacer
taggccatcgtgtctagggaggggttagaccc	Protospacer
********************************

114. spacer 8.9|201332|33|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

gacggtagaccccgagaccggggaaatcctgga	CRISPR spacer
gacggtagaccccgagaccggggaaatcctgga	Protospacer
*********************************

115. spacer 8.10|201394|32|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

gaaagcccgaactcatggcggaccgcgaacac	CRISPR spacer
gaaagcccgaactcatggcggaccgcgaacac	Protospacer
********************************

116. spacer 8.11|201455|33|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

tgcccctctggcggcctaaggagggtcataagc	CRISPR spacer
tgcccctctggcggcctaaggagggtcataagc	Protospacer
*********************************

117. spacer 8.12|201517|34|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

gacgacatccttagcgccctcctcatggccctac	CRISPR spacer
gacgacatccttagcgccctcctcatggccctac	Protospacer
**********************************

118. spacer 8.13|201580|32|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

gttccggcctccaccctccggtacgcggagaa	CRISPR spacer
gttccggcctccaccctccggtacgcggagaa	Protospacer
********************************

119. spacer 8.14|201641|33|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

accatgagcggcgagttagggtgcgaaatcggg	CRISPR spacer
accatgagcggcgagttagggtgcgaaatcggg	Protospacer
*********************************

120. spacer 8.15|201703|33|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

gaggctcgcggagaaggccgccacctgctcccc	CRISPR spacer
gaggctcgcggagaaggccgccacctgctcccc	Protospacer
*********************************

121. spacer 8.16|201765|33|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

tccgacccgcgccgcctcctctctctctccctg	CRISPR spacer
tccgacccgcgccgcctcctctctctctccctg	Protospacer
*********************************

122. spacer 8.17|201827|33|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

actcgggagccaagacgtaggtggagaaccgcc	CRISPR spacer
actcgggagccaagacgtaggtggagaaccgcc	Protospacer
*********************************

123. spacer 8.18|201889|34|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

gacatgacccccgagcagcgccgcgccctcaagc	CRISPR spacer
gacatgacccccgagcagcgccgcgccctcaagc	Protospacer
**********************************

124. spacer 8.19|201952|34|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

gtggagtcttccccttcctcttctggcccccagc	CRISPR spacer
gtggagtcttccccttcctcttctggcccccagc	Protospacer
**********************************

125. spacer 8.20|202015|35|NC_006462|CRISPRCasFinder,CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

agctcccgcttgagctcgtccaggaggtacttcgc	CRISPR spacer
agctcccgcttgagctcgtccaggaggtacttcgc	Protospacer
***********************************

126. spacer 9.1|227361|35|NC_006462|CRISPRCasFinder matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

atcgctgttcaccctcctttcggccttcatcctat	CRISPR spacer
atcgctgttcaccctcctttcggccttcatcctat	Protospacer
***********************************

127. spacer 9.2|227433|39|NC_006462|CRISPRCasFinder matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

cccaagggggggcttcaccccgcgaacaacgcactcgcc	CRISPR spacer
cccaagggggggcttcaccccgcgaacaacgcactcgcc	Protospacer
***************************************

128. spacer 9.3|227509|35|NC_006462|CRISPRCasFinder matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

gggctcaccccccaaccccatacccccccggatgg	CRISPR spacer
gggctcaccccccaaccccatacccccccggatgg	Protospacer
***********************************

129. spacer 9.4|227581|36|NC_006462|CRISPRCasFinder matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

gagtccggcgatgagggcgtagaagcgcccattcct	CRISPR spacer
gagtccggcgatgagggcgtagaagcgcccattcct	Protospacer
************************************

130. spacer 9.5|227654|35|NC_006462|CRISPRCasFinder matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

cggatagggcatagcgatagggtggccgtagtggg	CRISPR spacer
cggatagggcatagcgatagggtggccgtagtggg	Protospacer
***********************************

131. spacer 9.6|227726|35|NC_006462|CRISPRCasFinder matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

ggtacatcacatgggcggacgtggtgaagaggagg	CRISPR spacer
ggtacatcacatgggcggacgtggtgaagaggagg	Protospacer
***********************************

132. spacer 9.7|227798|38|NC_006462|CRISPRCasFinder matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

caaaagaccaaaagggcgataaggatgcttatcactca	CRISPR spacer
caaaagaccaaaagggcgataaggatgcttatcactca	Protospacer
**************************************

133. spacer 9.8|227873|35|NC_006462|CRISPRCasFinder matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

aggagggccgccggggagtagctgggctgggcccg	CRISPR spacer
aggagggccgccggggagtagctgggctgggcccg	Protospacer
***********************************

134. spacer 9.9|227945|35|NC_006462|CRISPRCasFinder matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

ctggtggacgagctggctgaggggcttcccaagcc	CRISPR spacer
ctggtggacgagctggctgaggggcttcccaagcc	Protospacer
***********************************

135. spacer 9.9|227945|35|NC_006462|CRISPRCasFinder matches to NZ_AP019802 (Thermus thermophilus strain HC11 plasmid pHC11, complete sequence) position: , mismatch: 0, identity: 1.0

ctggtggacgagctggctgaggggcttcccaagcc	CRISPR spacer
ctggtggacgagctggctgaggggcttcccaagcc	Protospacer
***********************************

136. spacer 9.10|228017|35|NC_006462|CRISPRCasFinder matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

gaggcccccctggactggagagaggggtatcggct	CRISPR spacer
gaggcccccctggactggagagaggggtatcggct	Protospacer
***********************************

137. spacer 9.10|228017|35|NC_006462|CRISPRCasFinder matches to NZ_AP019802 (Thermus thermophilus strain HC11 plasmid pHC11, complete sequence) position: , mismatch: 0, identity: 1.0

gaggcccccctggactggagagaggggtatcggct	CRISPR spacer
gaggcccccctggactggagagaggggtatcggct	Protospacer
***********************************

138. spacer 9.11|228089|36|NC_006462|CRISPRCasFinder matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

tggcagcggtgccagattgacaacgtggactacaac	CRISPR spacer
tggcagcggtgccagattgacaacgtggactacaac	Protospacer
************************************

139. spacer 9.12|228162|40|NC_006462|CRISPRCasFinder matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

ggattaggttgtgctgttcagcctccctttccacaaccca	CRISPR spacer
ggattaggttgtgctgttcagcctccctttccacaaccca	Protospacer
****************************************

140. spacer 9.13|227360|36|NC_006462|CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

catcgctgttcaccctcctttcggccttcatcctat	CRISPR spacer
catcgctgttcaccctcctttcggccttcatcctat	Protospacer
************************************

141. spacer 9.14|227432|40|NC_006462|CRT,PILER-CR matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

tcccaagggggggcttcaccccgcgaacaacgcactcgcc	CRISPR spacer
tcccaagggggggcttcaccccgcgaacaacgcactcgcc	Protospacer
****************************************

142. spacer 9.15|227508|36|NC_006462|CRT,PILER-CR matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

ggggctcaccccccaaccccatacccccccggatgg	CRISPR spacer
ggggctcaccccccaaccccatacccccccggatgg	Protospacer
************************************

143. spacer 9.16|227580|37|NC_006462|CRT,PILER-CR matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

ggagtccggcgatgagggcgtagaagcgcccattcct	CRISPR spacer
ggagtccggcgatgagggcgtagaagcgcccattcct	Protospacer
*************************************

144. spacer 9.17|227653|36|NC_006462|CRT,PILER-CR matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

gcggatagggcatagcgatagggtggccgtagtggg	CRISPR spacer
gcggatagggcatagcgatagggtggccgtagtggg	Protospacer
************************************

145. spacer 9.18|227725|36|NC_006462|CRT,PILER-CR matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

gggtacatcacatgggcggacgtggtgaagaggagg	CRISPR spacer
gggtacatcacatgggcggacgtggtgaagaggagg	Protospacer
************************************

146. spacer 9.19|227797|39|NC_006462|CRT,PILER-CR matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

ccaaaagaccaaaagggcgataaggatgcttatcactca	CRISPR spacer
ccaaaagaccaaaagggcgataaggatgcttatcactca	Protospacer
***************************************

147. spacer 9.20|227872|36|NC_006462|CRT,PILER-CR matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

caggagggccgccggggagtagctgggctgggcccg	CRISPR spacer
caggagggccgccggggagtagctgggctgggcccg	Protospacer
************************************

148. spacer 9.21|227944|36|NC_006462|CRT,PILER-CR matches to NZ_AP019802 (Thermus thermophilus strain HC11 plasmid pHC11, complete sequence) position: , mismatch: 0, identity: 1.0

gctggtggacgagctggctgaggggcttcccaagcc	CRISPR spacer
gctggtggacgagctggctgaggggcttcccaagcc	Protospacer
************************************

149. spacer 9.21|227944|36|NC_006462|CRT,PILER-CR matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

gctggtggacgagctggctgaggggcttcccaagcc	CRISPR spacer
gctggtggacgagctggctgaggggcttcccaagcc	Protospacer
************************************

150. spacer 9.22|228016|36|NC_006462|CRT,PILER-CR matches to NZ_AP019802 (Thermus thermophilus strain HC11 plasmid pHC11, complete sequence) position: , mismatch: 0, identity: 1.0

ggaggcccccctggactggagagaggggtatcggct	CRISPR spacer
ggaggcccccctggactggagagaggggtatcggct	Protospacer
************************************

151. spacer 9.22|228016|36|NC_006462|CRT,PILER-CR matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

ggaggcccccctggactggagagaggggtatcggct	CRISPR spacer
ggaggcccccctggactggagagaggggtatcggct	Protospacer
************************************

152. spacer 9.23|228088|37|NC_006462|CRT,PILER-CR matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

gtggcagcggtgccagattgacaacgtggactacaac	CRISPR spacer
gtggcagcggtgccagattgacaacgtggactacaac	Protospacer
*************************************

153. spacer 9.24|228161|41|NC_006462|CRT,PILER-CR matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

aggattaggttgtgctgttcagcctccctttccacaaccca	CRISPR spacer
aggattaggttgtgctgttcagcctccctttccacaaccca	Protospacer
*****************************************

154. spacer 10.1|239141|38|NC_006462|CRISPRCasFinder matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 0, identity: 1.0

aacatggacttcctgcacgagcccttcgagctcgccat	CRISPR spacer
aacatggacttcctgcacgagcccttcgagctcgccat	Protospacer
**************************************

155. spacer 2.1|113562|38|NC_006462|CRT matches to NZ_LR027520 (Thermus thermophilus isolate TTHNAR1 plasmid 4, complete sequence) position: , mismatch: 1, identity: 0.974

tttctccccaagtcttccgataggggagggggtcaaca	CRISPR spacer
tttctccccaagtcttccgataggggagggggccaaca	Protospacer
********************************.*****

156. spacer 2.1|113562|38|NC_006462|CRT matches to NZ_CP014142 (Thermus parvatiensis strain RL plasmid pTP143, complete sequence) position: , mismatch: 1, identity: 0.974

tttctccccaagtcttccgataggggagggggtcaaca	CRISPR spacer
tttctccccaagtcttccgataggggagggggccaaca	Protospacer
********************************.*****

157. spacer 2.1|113562|38|NC_006462|CRT matches to NC_005838 (Thermus thermophilus HB27 plasmid pTT27, complete sequence) position: , mismatch: 1, identity: 0.974

tttctccccaagtcttccgataggggagggggtcaaca	CRISPR spacer
tttctccccaagtcttccgataggggagggggccaaca	Protospacer
********************************.*****

158. spacer 2.1|113562|38|NC_006462|CRT matches to NC_005838 (Thermus thermophilus HB27 plasmid pTT27, complete sequence) position: , mismatch: 1, identity: 0.974

tttctccccaagtcttccgataggggagggggtcaaca	CRISPR spacer
tttctccccaagtcttccgataggggagggggccaaca	Protospacer
********************************.*****

159. spacer 2.1|113562|38|NC_006462|CRT matches to NZ_AP019802 (Thermus thermophilus strain HC11 plasmid pHC11, complete sequence) position: , mismatch: 1, identity: 0.974

tttctccccaagtcttccgataggggagggggtcaaca	CRISPR spacer
tttctccccaagtcttccgataggggagggggccaaca	Protospacer
********************************.*****

160. spacer 2.1|113562|38|NC_006462|CRT matches to NZ_AP019802 (Thermus thermophilus strain HC11 plasmid pHC11, complete sequence) position: , mismatch: 1, identity: 0.974

tttctccccaagtcttccgataggggagggggtcaaca	CRISPR spacer
tttctccccaagtcttccgataggggagggggccaaca	Protospacer
********************************.*****

161. spacer 2.1|113562|38|NC_006462|CRT matches to NC_017588 (Thermus thermophilus JL-18 plasmid pTTJL1801, complete sequence) position: , mismatch: 1, identity: 0.974

tttctccccaagtcttccgataggggagggggtcaaca	CRISPR spacer
tttctccccaagtcttccgataggggagggggccaaca	Protospacer
********************************.*****

162. spacer 2.1|113562|38|NC_006462|CRT matches to NC_017588 (Thermus thermophilus JL-18 plasmid pTTJL1801, complete sequence) position: , mismatch: 1, identity: 0.974

tttctccccaagtcttccgataggggagggggtcaaca	CRISPR spacer
tttctccccaagtcttccgataggggagggggccaaca	Protospacer
********************************.*****

163. spacer 2.1|113562|38|NC_006462|CRT matches to NC_017273 (Thermus thermophilus SG0.5JP17-16 plasmid pTHTHE1601, complete sequence) position: , mismatch: 1, identity: 0.974

tttctccccaagtcttccgataggggagggggtcaaca	CRISPR spacer
tttctccccaagtcttccgataggggagggggccaaca	Protospacer
********************************.*****

164. spacer 2.1|113562|38|NC_006462|CRT matches to NC_017273 (Thermus thermophilus SG0.5JP17-16 plasmid pTHTHE1601, complete sequence) position: , mismatch: 1, identity: 0.974

tttctccccaagtcttccgataggggagggggtcaaca	CRISPR spacer
tttctccccaagtcttccgataggggagggggccaaca	Protospacer
********************************.*****

165. spacer 2.1|113562|38|NC_006462|CRT matches to NZ_AP019795 (Thermus thermophilus strain AA2-29 plasmid pAA229, complete sequence) position: , mismatch: 1, identity: 0.974

tttctccccaagtcttccgataggggagggggtcaaca	CRISPR spacer
tttctccccaagtcttccgataggggagggggccaaca	Protospacer
********************************.*****

166. spacer 2.1|113562|38|NC_006462|CRT matches to NZ_AP019795 (Thermus thermophilus strain AA2-29 plasmid pAA229, complete sequence) position: , mismatch: 1, identity: 0.974

tttctccccaagtcttccgataggggagggggtcaaca	CRISPR spacer
tttctccccaagtcttccgataggggagggggccaaca	Protospacer
********************************.*****

167. spacer 2.1|113562|38|NC_006462|CRT matches to NZ_AP019793 (Thermus thermophilus strain AA2-20 plasmid pAA220, complete sequence) position: , mismatch: 1, identity: 0.974

tttctccccaagtcttccgataggggagggggtcaaca	CRISPR spacer
tttctccccaagtcttccgataggggagggggccaaca	Protospacer
********************************.*****

168. spacer 2.1|113562|38|NC_006462|CRT matches to NZ_AP019793 (Thermus thermophilus strain AA2-20 plasmid pAA220, complete sequence) position: , mismatch: 1, identity: 0.974

tttctccccaagtcttccgataggggagggggtcaaca	CRISPR spacer
tttctccccaagtcttccgataggggagggggccaaca	Protospacer
********************************.*****

169. spacer 2.2|113618|39|NC_006462|CRT matches to NC_017273 (Thermus thermophilus SG0.5JP17-16 plasmid pTHTHE1601, complete sequence) position: , mismatch: 1, identity: 0.974

cttttccccaagtcttccgataccccgcaccccccgacg	CRISPR spacer
tttttccccaagtcttccgataccccgcaccccccgacg	Protospacer
.**************************************

170. spacer 2.2|113618|39|NC_006462|CRT matches to NZ_CP014142 (Thermus parvatiensis strain RL plasmid pTP143, complete sequence) position: , mismatch: 1, identity: 0.974

cttttccccaagtcttccgataccccgcaccccccgacg	CRISPR spacer
cttttccccaagtcttccgataccccgcaccccccaacg	Protospacer
***********************************.***

171. spacer 2.2|113618|39|NC_006462|CRT matches to NC_005838 (Thermus thermophilus HB27 plasmid pTT27, complete sequence) position: , mismatch: 1, identity: 0.974

cttttccccaagtcttccgataccccgcaccccccgacg	CRISPR spacer
cttttccccaagtcttccgatatcccgcaccccccgacg	Protospacer
**********************.****************

172. spacer 2.2|113618|39|NC_006462|CRT matches to NZ_AP019802 (Thermus thermophilus strain HC11 plasmid pHC11, complete sequence) position: , mismatch: 1, identity: 0.974

cttttccccaagtcttccgataccccgcaccccccgacg	CRISPR spacer
cttttccccaagtcttccgatatcccgcaccccccgacg	Protospacer
**********************.****************

173. spacer 2.2|113618|39|NC_006462|CRT matches to NC_017588 (Thermus thermophilus JL-18 plasmid pTTJL1801, complete sequence) position: , mismatch: 1, identity: 0.974

cttttccccaagtcttccgataccccgcaccccccgacg	CRISPR spacer
cttttccccaagtcttccgatatcccgcaccccccgacg	Protospacer
**********************.****************

174. spacer 2.2|113618|39|NC_006462|CRT matches to NZ_AP019795 (Thermus thermophilus strain AA2-29 plasmid pAA229, complete sequence) position: , mismatch: 1, identity: 0.974

cttttccccaagtcttccgataccccgcaccccccgacg	CRISPR spacer
cttttccccaagtcttccgatatcccgcaccccccgacg	Protospacer
**********************.****************

175. spacer 2.2|113618|39|NC_006462|CRT matches to NZ_LR027520 (Thermus thermophilus isolate TTHNAR1 plasmid 4, complete sequence) position: , mismatch: 1, identity: 0.974

cttttccccaagtcttccgataccccgcaccccccgacg	CRISPR spacer
cttttccccaagtcttccgatatcccgcaccccccgacg	Protospacer
**********************.****************

176. spacer 2.2|113618|39|NC_006462|CRT matches to NZ_AP019793 (Thermus thermophilus strain AA2-20 plasmid pAA220, complete sequence) position: , mismatch: 1, identity: 0.974

cttttccccaagtcttccgataccccgcaccccccgacg	CRISPR spacer
cttttccccaagtcttccgatatcccgcaccccccgacg	Protospacer
**********************.****************

177. spacer 2.3|113675|38|NC_006462|CRT matches to NZ_LR027520 (Thermus thermophilus isolate TTHNAR1 plasmid 4, complete sequence) position: , mismatch: 1, identity: 0.974

tttctccccaagtcttccgataggggagggggtcaaca	CRISPR spacer
tttctccccaagtcttccgataggggagggggccaaca	Protospacer
********************************.*****

178. spacer 2.3|113675|38|NC_006462|CRT matches to NZ_CP014142 (Thermus parvatiensis strain RL plasmid pTP143, complete sequence) position: , mismatch: 1, identity: 0.974

tttctccccaagtcttccgataggggagggggtcaaca	CRISPR spacer
tttctccccaagtcttccgataggggagggggccaaca	Protospacer
********************************.*****

179. spacer 2.3|113675|38|NC_006462|CRT matches to NC_005838 (Thermus thermophilus HB27 plasmid pTT27, complete sequence) position: , mismatch: 1, identity: 0.974

tttctccccaagtcttccgataggggagggggtcaaca	CRISPR spacer
tttctccccaagtcttccgataggggagggggccaaca	Protospacer
********************************.*****

180. spacer 2.3|113675|38|NC_006462|CRT matches to NC_005838 (Thermus thermophilus HB27 plasmid pTT27, complete sequence) position: , mismatch: 1, identity: 0.974

tttctccccaagtcttccgataggggagggggtcaaca	CRISPR spacer
tttctccccaagtcttccgataggggagggggccaaca	Protospacer
********************************.*****

181. spacer 2.3|113675|38|NC_006462|CRT matches to NZ_AP019802 (Thermus thermophilus strain HC11 plasmid pHC11, complete sequence) position: , mismatch: 1, identity: 0.974

tttctccccaagtcttccgataggggagggggtcaaca	CRISPR spacer
tttctccccaagtcttccgataggggagggggccaaca	Protospacer
********************************.*****

182. spacer 2.3|113675|38|NC_006462|CRT matches to NZ_AP019802 (Thermus thermophilus strain HC11 plasmid pHC11, complete sequence) position: , mismatch: 1, identity: 0.974

tttctccccaagtcttccgataggggagggggtcaaca	CRISPR spacer
tttctccccaagtcttccgataggggagggggccaaca	Protospacer
********************************.*****

183. spacer 2.3|113675|38|NC_006462|CRT matches to NC_017588 (Thermus thermophilus JL-18 plasmid pTTJL1801, complete sequence) position: , mismatch: 1, identity: 0.974

tttctccccaagtcttccgataggggagggggtcaaca	CRISPR spacer
tttctccccaagtcttccgataggggagggggccaaca	Protospacer
********************************.*****

184. spacer 2.3|113675|38|NC_006462|CRT matches to NC_017588 (Thermus thermophilus JL-18 plasmid pTTJL1801, complete sequence) position: , mismatch: 1, identity: 0.974

tttctccccaagtcttccgataggggagggggtcaaca	CRISPR spacer
tttctccccaagtcttccgataggggagggggccaaca	Protospacer
********************************.*****

185. spacer 2.3|113675|38|NC_006462|CRT matches to NC_017273 (Thermus thermophilus SG0.5JP17-16 plasmid pTHTHE1601, complete sequence) position: , mismatch: 1, identity: 0.974

tttctccccaagtcttccgataggggagggggtcaaca	CRISPR spacer
tttctccccaagtcttccgataggggagggggccaaca	Protospacer
********************************.*****

186. spacer 2.3|113675|38|NC_006462|CRT matches to NC_017273 (Thermus thermophilus SG0.5JP17-16 plasmid pTHTHE1601, complete sequence) position: , mismatch: 1, identity: 0.974

tttctccccaagtcttccgataggggagggggtcaaca	CRISPR spacer
tttctccccaagtcttccgataggggagggggccaaca	Protospacer
********************************.*****

187. spacer 2.3|113675|38|NC_006462|CRT matches to NZ_AP019795 (Thermus thermophilus strain AA2-29 plasmid pAA229, complete sequence) position: , mismatch: 1, identity: 0.974

tttctccccaagtcttccgataggggagggggtcaaca	CRISPR spacer
tttctccccaagtcttccgataggggagggggccaaca	Protospacer
********************************.*****

188. spacer 2.3|113675|38|NC_006462|CRT matches to NZ_AP019795 (Thermus thermophilus strain AA2-29 plasmid pAA229, complete sequence) position: , mismatch: 1, identity: 0.974

tttctccccaagtcttccgataggggagggggtcaaca	CRISPR spacer
tttctccccaagtcttccgataggggagggggccaaca	Protospacer
********************************.*****

189. spacer 2.3|113675|38|NC_006462|CRT matches to NZ_AP019793 (Thermus thermophilus strain AA2-20 plasmid pAA220, complete sequence) position: , mismatch: 1, identity: 0.974

tttctccccaagtcttccgataggggagggggtcaaca	CRISPR spacer
tttctccccaagtcttccgataggggagggggccaaca	Protospacer
********************************.*****

190. spacer 2.3|113675|38|NC_006462|CRT matches to NZ_AP019793 (Thermus thermophilus strain AA2-20 plasmid pAA220, complete sequence) position: , mismatch: 1, identity: 0.974

tttctccccaagtcttccgataggggagggggtcaaca	CRISPR spacer
tttctccccaagtcttccgataggggagggggccaaca	Protospacer
********************************.*****

191. spacer 2.4|113731|61|NC_006462|CRT matches to NC_006462 (Thermus thermophilus HB8 plasmid pTT27, complete sequence) position: , mismatch: 1, identity: 0.984

cgcccacccgcaaagaaaaccgcttggggagggcgaaacctggcgcttttccttcccgcc	CRISPR spacer
cgcccacccgcaaagaaaaccgcttggggagggcgaaacctggcgcttttccttcccgcc	Protospacer
************************************************************

192. spacer 2.4|113731|61|NC_006462|CRT matches to NC_017588 (Thermus thermophilus JL-18 plasmid pTTJL1801, complete sequence) position: , mismatch: 1, identity: 0.984

cgcccacccgcaaagaaaaccgcttggggagggcgaaacctggcgcttttccttcccgcc	CRISPR spacer
cgcccacccgcaaagaaaaccgcttggggagggcgaaacctggcgcttttccttcccgcc	Protospacer
************************************************************

193. spacer 8.4|201024|33|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NC_017588 (Thermus thermophilus JL-18 plasmid pTTJL1801, complete sequence) position: , mismatch: 1, identity: 0.97

gcaaccccagggttcaggggttcagtcgcccat	CRISPR spacer
gcaaccccagggttcaggggttcagtcgcccac	Protospacer
********************************.

194. spacer 9.4|227581|36|NC_006462|CRISPRCasFinder matches to NZ_LR027519 (Thermus thermophilus isolate TTHNAR1 plasmid 3, complete sequence) position: , mismatch: 1, identity: 0.972

gagtccggcgatgagggcgtagaagcgcccattcct	CRISPR spacer
gagtccggcgatgagggcgtagaagcgcccatccct	Protospacer
********************************.***

195. spacer 9.6|227726|35|NC_006462|CRISPRCasFinder matches to MH673671 (Thermus phage phiKo, complete genome) position: , mismatch: 1, identity: 0.971

ggtacatcacatgggcggacgtggtgaagaggagg	CRISPR spacer
ggtacatcacatgggcggatgtggtgaagaggagg	Protospacer
*******************.***************

196. spacer 9.16|227580|37|NC_006462|CRT,PILER-CR matches to NZ_LR027519 (Thermus thermophilus isolate TTHNAR1 plasmid 3, complete sequence) position: , mismatch: 1, identity: 0.973

ggagtccggcgatgagggcgtagaagcgcccattcct	CRISPR spacer
ggagtccggcgatgagggcgtagaagcgcccatccct	Protospacer
*********************************.***

197. spacer 9.18|227725|36|NC_006462|CRT,PILER-CR matches to MH673671 (Thermus phage phiKo, complete genome) position: , mismatch: 1, identity: 0.972

gggtacatcacatgggcggacgtggtgaagaggagg	CRISPR spacer
gggtacatcacatgggcggatgtggtgaagaggagg	Protospacer
********************.***************

198. spacer 2.1|113562|38|NC_006462|CRT matches to NZ_CP014142 (Thermus parvatiensis strain RL plasmid pTP143, complete sequence) position: , mismatch: 2, identity: 0.947

tttctccccaagtcttccgataggggagggggtcaaca	CRISPR spacer
tttctccccaagtcttccgataggggaggggaccaaca	Protospacer
*******************************..*****

199. spacer 2.3|113675|38|NC_006462|CRT matches to NZ_CP014142 (Thermus parvatiensis strain RL plasmid pTP143, complete sequence) position: , mismatch: 2, identity: 0.947

tttctccccaagtcttccgataggggagggggtcaaca	CRISPR spacer
tttctccccaagtcttccgataggggaggggaccaaca	Protospacer
*******************************..*****

200. spacer 9.5|227654|35|NC_006462|CRISPRCasFinder matches to MH673671 (Thermus phage phiKo, complete genome) position: , mismatch: 2, identity: 0.943

cggatagggcatagcgatagggtggccgtagtggg	CRISPR spacer
cggatagggcatagcgatagggttgccgtggtggg	Protospacer
*********************** *****.*****

201. spacer 9.17|227653|36|NC_006462|CRT,PILER-CR matches to MH673671 (Thermus phage phiKo, complete genome) position: , mismatch: 2, identity: 0.944

gcggatagggcatagcgatagggtggccgtagtggg	CRISPR spacer
gcggatagggcatagcgatagggttgccgtggtggg	Protospacer
************************ *****.*****

202. spacer 10.1|239141|38|NC_006462|CRISPRCasFinder matches to NC_017590 (Thermus thermophilus JL-18 plasmid pTTJL1802, complete sequence) position: , mismatch: 2, identity: 0.947

aacatggacttcctgcacgagcccttcgagctcgccat	CRISPR spacer
gtcatggacttcctgcacgagcccttcgagctcgccat	Protospacer
. ************************************

203. spacer 10.1|239141|38|NC_006462|CRISPRCasFinder matches to NC_017273 (Thermus thermophilus SG0.5JP17-16 plasmid pTHTHE1601, complete sequence) position: , mismatch: 3, identity: 0.921

aacatggacttcctgcacgagcccttcgagctcgccat	CRISPR spacer
gtcatggacttcctgcacgaacccttcgagctcgccat	Protospacer
. ******************.*****************

204. spacer 10.1|239141|38|NC_006462|CRISPRCasFinder matches to NZ_LR027519 (Thermus thermophilus isolate TTHNAR1 plasmid 3, complete sequence) position: , mismatch: 3, identity: 0.921

aacatggacttcctgcacgagcccttcgagctcgccat	CRISPR spacer
gtcatggacttcctccacgagcccttcgagctcgccat	Protospacer
. ************ ***********************

205. spacer 2.1|113562|38|NC_006462|CRT matches to NZ_CP010826 (Thermus aquaticus Y51MC23 plasmid pTA78, complete sequence) position: , mismatch: 6, identity: 0.842

tttctccccaagtcttccgataggggagggggtcaaca	CRISPR spacer
caactccccaagtcttccgataggggagggggcgaact	Protospacer
.  *****************************. ***

206. spacer 2.1|113562|38|NC_006462|CRT matches to NZ_CP010826 (Thermus aquaticus Y51MC23 plasmid pTA78, complete sequence) position: , mismatch: 6, identity: 0.842

tttctccccaagtcttccgataggggagggggtcaaca	CRISPR spacer
caactccccaagtcttccgataggggagggggcgaact	Protospacer
.  *****************************. ***

207. spacer 2.3|113675|38|NC_006462|CRT matches to NZ_CP010826 (Thermus aquaticus Y51MC23 plasmid pTA78, complete sequence) position: , mismatch: 6, identity: 0.842

tttctccccaagtcttccgataggggagggggtcaaca	CRISPR spacer
caactccccaagtcttccgataggggagggggcgaact	Protospacer
.  *****************************. ***

208. spacer 2.3|113675|38|NC_006462|CRT matches to NZ_CP010826 (Thermus aquaticus Y51MC23 plasmid pTA78, complete sequence) position: , mismatch: 6, identity: 0.842

tttctccccaagtcttccgataggggagggggtcaaca	CRISPR spacer
caactccccaagtcttccgataggggagggggcgaact	Protospacer
.  *****************************. ***

209. spacer 7.21|190765|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP009293 (Novosphingobium pentaromativorans US6-1 plasmid pLA4, complete sequence) position: , mismatch: 6, identity: 0.812

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
cgatcggcggccgcgaagctggccagatcttc	Protospacer
 ** .************** ******.*** *

210. spacer 7.44|190767|32|NC_006462|PILER-CR matches to NZ_CP009293 (Novosphingobium pentaromativorans US6-1 plasmid pLA4, complete sequence) position: , mismatch: 6, identity: 0.812

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
cgatcggcggccgcgaagctggccagatcttc	Protospacer
 ** .************** ******.*** *

211. spacer 8.1|200840|32|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NC_012529 (Deinococcus deserti VCD115 plasmid 2, complete sequence) position: , mismatch: 6, identity: 0.812

gctggcctgcaggacctccagcatctggcggg	CRISPR spacer
gctggcctgtacgacctccagcatcagcctga	Protospacer
*********.* ************* * * *.

212. spacer 8.1|200840|32|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NC_014718 (Paraburkholderia rhizoxinica HKI 454 plasmid pBRH01, complete sequence) position: , mismatch: 6, identity: 0.812

--gctggcctgcaggacctccagcatctggcggg	CRISPR spacer
gtgatggc--gcagcacctccagcatcgggcggc	Protospacer
  * ****  **** ************ *****

213. spacer 8.18|201889|34|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to LC473083 (Cutibacterium acnes TP-CU389 plasmid pTZC1 DNA, complete sequence) position: , mismatch: 6, identity: 0.824

gacatgacccccgagcagcgccgcgccctcaagc--	CRISPR spacer
cacaagacccccgagcagcgccgcacc--gaagcgg	Protospacer
 *** *******************.**   ****

214. spacer 7.1|189536|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP040819 (Paraoceanicella profunda strain D4M1 plasmid pD4M1A, complete sequence) position: , mismatch: 7, identity: 0.781

tcgtccgcaagctcgtcgggcacctcctccgg	CRISPR spacer
cgcgcggcaagctcggcgcgcacctcctccgg	Protospacer
.   * ********* ** *************

215. spacer 7.1|189536|32|NC_006462|CRISPRCasFinder,CRT matches to MK494119 (Mycobacterium Phage Niklas, complete genome) position: , mismatch: 7, identity: 0.781

tcgtccgcaagctcgtcgggcacctcctccgg--	CRISPR spacer
tcgcccgccagctcgtcgggcac--tcgacggcc	Protospacer
***.**** **************  .*  ***

216. spacer 7.1|189536|32|NC_006462|CRISPRCasFinder,CRT matches to MK310138 (Mycobacterium phage Shaobing, complete genome) position: , mismatch: 7, identity: 0.781

tcgtccgcaagctcgtcgggcacctcctccgg--	CRISPR spacer
tcgcccgccagctcgtcgggcac--tcgacggcc	Protospacer
***.**** **************  .*  ***

217. spacer 7.1|189536|32|NC_006462|CRISPRCasFinder,CRT matches to MF185722 (Mycobacterium phage Peanam, complete genome) position: , mismatch: 7, identity: 0.781

tcgtccgcaagctcgtcgggcacctcctccgg--	CRISPR spacer
tcgcccgccagctcgtcgggcac--tcgacggcc	Protospacer
***.**** **************  .*  ***

218. spacer 7.6|189842|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP037896 (Thermaerobacter sp. FW80 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

ggcgtggccggagggggtgccgaatggctaag	CRISPR spacer
ggcggggccggaggggatgccgagccgctggg	Protospacer
**** ***********.******.. ***..*

219. spacer 7.8|189964|33|NC_006462|CRISPRCasFinder,CRT matches to NZ_LR134452 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 10, complete sequence) position: , mismatch: 7, identity: 0.788

ggcccggagcatggcctgcaggacggcggaggg	CRISPR spacer
gctcaggtgcagggcctgcaggacggcggcgcg	Protospacer
* .* ** *** ***************** * *

220. spacer 7.9|190026|33|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP010660 (Phaeobacter piscinae strain P71 plasmid pP71_d, complete sequence) position: , mismatch: 7, identity: 0.788

ggcccgggtcctgggccacggctgggctaaagg	CRISPR spacer
ggtcggacacctgcgccacggcggggctaaagg	Protospacer
**.* *.  **** ******** **********

221. spacer 7.11|190149|32|NC_006462|CRISPRCasFinder,CRT matches to NC_009620 (Sinorhizobium medicae WSM419 plasmid pSMED01, complete sequence) position: , mismatch: 7, identity: 0.781

ccgagtgggtcgtccgcctcgttgagtaccct	CRISPR spacer
ccgagtgggtcggccgcctcgttggaccgctt	Protospacer
************ ***********...  *.*

222. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NC_010333 (Caulobacter sp. K31 plasmid pCAUL02, complete sequence) position: , mismatch: 7, identity: 0.781

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagattggcgatgttggcgtcgatctccg	Protospacer
 .****** ************* ****  **

223. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP032322 (Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.781

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
ctccagcacggcgatgtcggcggcgatggcct	Protospacer
.* ***   ********.**********.***

224. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 7, identity: 0.781

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
ctccagcacggcgatgtcggcggcgatggcct	Protospacer
.* ***   ********.**********.***

225. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 7, identity: 0.781

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
ctccagcacggcgatgtcggcggcgatggcct	Protospacer
.* ***   ********.**********.***

226. spacer 7.24|189538|32|NC_006462|PILER-CR matches to NZ_CP040819 (Paraoceanicella profunda strain D4M1 plasmid pD4M1A, complete sequence) position: , mismatch: 7, identity: 0.781

tcgtccgcaagctcgtcgggcacctcctccgg	CRISPR spacer
cgcgcggcaagctcggcgcgcacctcctccgg	Protospacer
.   * ********* ** *************

227. spacer 7.24|189538|32|NC_006462|PILER-CR matches to MK494119 (Mycobacterium Phage Niklas, complete genome) position: , mismatch: 7, identity: 0.781

tcgtccgcaagctcgtcgggcacctcctccgg--	CRISPR spacer
tcgcccgccagctcgtcgggcac--tcgacggcc	Protospacer
***.**** **************  .*  ***

228. spacer 7.24|189538|32|NC_006462|PILER-CR matches to MK310138 (Mycobacterium phage Shaobing, complete genome) position: , mismatch: 7, identity: 0.781

tcgtccgcaagctcgtcgggcacctcctccgg--	CRISPR spacer
tcgcccgccagctcgtcgggcac--tcgacggcc	Protospacer
***.**** **************  .*  ***

229. spacer 7.24|189538|32|NC_006462|PILER-CR matches to MF185722 (Mycobacterium phage Peanam, complete genome) position: , mismatch: 7, identity: 0.781

tcgtccgcaagctcgtcgggcacctcctccgg--	CRISPR spacer
tcgcccgccagctcgtcgggcac--tcgacggcc	Protospacer
***.**** **************  .*  ***

230. spacer 7.29|189844|32|NC_006462|PILER-CR matches to NZ_CP037896 (Thermaerobacter sp. FW80 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

ggcgtggccggagggggtgccgaatggctaag	CRISPR spacer
ggcggggccggaggggatgccgagccgctggg	Protospacer
**** ***********.******.. ***..*

231. spacer 7.31|189966|33|NC_006462|PILER-CR matches to NZ_LR134452 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 10, complete sequence) position: , mismatch: 7, identity: 0.788

ggcccggagcatggcctgcaggacggcggaggg	CRISPR spacer
gctcaggtgcagggcctgcaggacggcggcgcg	Protospacer
* .* ** *** ***************** * *

232. spacer 7.32|190028|33|NC_006462|PILER-CR matches to NZ_CP010660 (Phaeobacter piscinae strain P71 plasmid pP71_d, complete sequence) position: , mismatch: 7, identity: 0.788

ggcccgggtcctgggccacggctgggctaaagg	CRISPR spacer
ggtcggacacctgcgccacggcggggctaaagg	Protospacer
**.* *.  **** ******** **********

233. spacer 7.34|190151|32|NC_006462|PILER-CR matches to NC_009620 (Sinorhizobium medicae WSM419 plasmid pSMED01, complete sequence) position: , mismatch: 7, identity: 0.781

ccgagtgggtcgtccgcctcgttgagtaccct	CRISPR spacer
ccgagtgggtcggccgcctcgttggaccgctt	Protospacer
************ ***********...  *.*

234. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NC_010333 (Caulobacter sp. K31 plasmid pCAUL02, complete sequence) position: , mismatch: 7, identity: 0.781

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagattggcgatgttggcgtcgatctccg	Protospacer
 .****** ************* ****  **

235. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP032322 (Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.781

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
ctccagcacggcgatgtcggcggcgatggcct	Protospacer
.* ***   ********.**********.***

236. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 7, identity: 0.781

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
ctccagcacggcgatgtcggcggcgatggcct	Protospacer
.* ***   ********.**********.***

237. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 7, identity: 0.781

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
ctccagcacggcgatgtcggcggcgatggcct	Protospacer
.* ***   ********.**********.***

238. spacer 8.1|200840|32|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP024423 (Paracoccus yeei strain TT13 plasmid pTT13-1, complete sequence) position: , mismatch: 7, identity: 0.781

gctggcctgcaggacctccagcatctggcggg	CRISPR spacer
gctggcttgcaggacgtccagcatgtcgggaa	Protospacer
******.******** ******** * * *..

239. spacer 8.1|200840|32|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP020441 (Paracoccus yeei strain FDAARGOS_252 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

gctggcctgcaggacctccagcatctggcggg	CRISPR spacer
gctggcttgcaggacgtccagcatgtcgggaa	Protospacer
******.******** ******** * * *..

240. spacer 8.1|200840|32|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP044080 (Paracoccus yeei strain FDAARGOS_643 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.781

gctggcctgcaggacctccagcatctggcggg	CRISPR spacer
gctggcttgcaggacgtccagcatgtcgggaa	Protospacer
******.******** ******** * * *..

241. spacer 8.1|200840|32|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP031079 (Paracoccus yeei strain CCUG 32053 plasmid pYEE1, complete sequence) position: , mismatch: 7, identity: 0.781

gctggcctgcaggacctccagcatctggcggg	CRISPR spacer
gctggcttgcaggacgtccagcatgtcgggaa	Protospacer
******.******** ******** * * *..

242. spacer 8.1|200840|32|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP041045 (Paracoccus sp. AK26 plasmid pAK1, complete sequence) position: , mismatch: 7, identity: 0.781

gctggcctgcaggacctccagcatctggcggg	CRISPR spacer
gctggcgtgcaggacgtccagcatgtcgggaa	Protospacer
****** ******** ******** * * *..

243. spacer 8.1|200840|32|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP051681 (Cohnella sp. MFER-1 plasmid unnamed1) position: , mismatch: 7, identity: 0.781

--gctggcctgcaggacctccagcatctggcggg	CRISPR spacer
cagcttg--tgcagaaactccagcatctggcgat	Protospacer
  *** *  *****.* ***************.

244. spacer 8.3|200963|32|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP020951 (Rhizobium sp. CIAT894 plasmid pRheCIAT894d, complete sequence) position: , mismatch: 7, identity: 0.781

ccagcggatggcgtcctcatagcgcatgcgca---	CRISPR spacer
tcggccgacggcgtcctcatagcgca---gcagac	Protospacer
.*.** **.*****************   ***

245. spacer 8.3|200963|32|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP034813 (Paracoccus sp. Arc7-R13 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.781

ccagcggatggcgtcctcatagcgcatgcgca-	CRISPR spacer
ctcgcggatctcgtcctcatagcgca-gcgttt	Protospacer
*. ******  *************** ***.

246. spacer 8.16|201765|33|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to MG652450 (Ralstonia phage RsoP1IDN, complete genome) position: , mismatch: 7, identity: 0.788

tccgacccgcgccgcctcctctctctctccctg	CRISPR spacer
gccgaccagtgccgcctcctctctcgcggcgtg	Protospacer
 ****** *.*************** *  * **

247. spacer 7.1|189536|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 8, identity: 0.75

tcgtccgcaagctcgtcgggcacctcctccgg	CRISPR spacer
ccggccgcacgctcgtcgggcacctgtccgag	Protospacer
.** ***** *************** ..* .*

248. spacer 7.1|189536|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP051472 (Rhodobacter sphaeroides strain CH10 plasmid pRspCH10C, complete sequence) position: , mismatch: 8, identity: 0.75

tcgtccgcaagctcgtcgggcacctcctccgg	CRISPR spacer
cgctcccgcagctcctcgcgcacctcctccgg	Protospacer
.  ***   ***** *** *************

249. spacer 7.1|189536|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP012965 (Rhodobacter sphaeroides strain MBTLJ-8 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

tcgtccgcaagctcgtcgggcacctcctccgg	CRISPR spacer
cgctcccgcagctcctcgcgcacctcctccgg	Protospacer
.  ***   ***** *** *************

250. spacer 7.1|189536|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP030275 (Rhodobacter sphaeroides 2.4.1 plasmid pC, complete sequence) position: , mismatch: 8, identity: 0.75

tcgtccgcaagctcgtcgggcacctcctccgg	CRISPR spacer
cgctcccgcagctcctcgcgcacctcctccgg	Protospacer
.  ***   ***** *** *************

251. spacer 7.1|189536|32|NC_006462|CRISPRCasFinder,CRT matches to CP047035 (Rhodobacter sphaeroides strain DSM 158 plasmid pC, complete sequence) position: , mismatch: 8, identity: 0.75

tcgtccgcaagctcgtcgggcacctcctccgg	CRISPR spacer
cgctcccgcagctcctcgcgcacctcctccgg	Protospacer
.  ***   ***** *** *************

252. spacer 7.1|189536|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP015292 (Rhodobacter sphaeroides strain MBTLJ-20 plasmid d, complete sequence) position: , mismatch: 8, identity: 0.75

tcgtccgcaagctcgtcgggcacctcctccgg	CRISPR spacer
cgctcccgcagctcctcgcgcacctcctccgg	Protospacer
.  ***   ***** *** *************

253. spacer 7.1|189536|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP047041 (Rhodobacter sphaeroides strain 2.4.1 substr. H2 plasmid pC, complete sequence) position: , mismatch: 8, identity: 0.75

tcgtccgcaagctcgtcgggcacctcctccgg	CRISPR spacer
cgctcccgcagctcctcgcgcacctcctccgg	Protospacer
.  ***   ***** *** *************

254. spacer 7.1|189536|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP015214 (Rhodobacter sphaeroides strain MBTLJ-13 plasmid c, complete sequence) position: , mismatch: 8, identity: 0.75

tcgtccgcaagctcgtcgggcacctcctccgg	CRISPR spacer
cgctcccgcagctcctcgcgcacctcctccgg	Protospacer
.  ***   ***** *** *************

255. spacer 7.3|189659|33|NC_006462|CRISPRCasFinder,CRT matches to NC_019959 (Mycobacterium sp. JS623 plasmid pMYCSM03, complete sequence) position: , mismatch: 8, identity: 0.758

gcccccgcgggagcggcgcgccttgctagagga	CRISPR spacer
tcccgcgcgggaggggcgcgccttggaggtggc	Protospacer
 *** ******** ***********  .* **

256. spacer 7.10|190088|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 8, identity: 0.75

-----cggaggagccacaggtaggccgcccgggccag	CRISPR spacer
aacttcg-----gccccgggtaggccgcccgggccat	Protospacer
     **     *** *.******************

257. spacer 7.12|190210|33|NC_006462|CRISPRCasFinder,CRT matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 8, identity: 0.758

gaggcgctgctgagccccaaggcactacggccc	CRISPR spacer
tcggcgctgctgagccccgaagcactccagtca	Protospacer
  ****************.*.***** *.*.*

258. spacer 7.12|190210|33|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 8, identity: 0.758

gaggcgctgctgagccccaaggcactacggccc	CRISPR spacer
tcggcgctgctgagccccgaagcactccagtca	Protospacer
  ****************.*.***** *.*.*

259. spacer 7.14|190334|32|NC_006462|CRISPRCasFinder,CRT matches to NC_015851 (Acidithiobacillus caldus SM-1 megaplasmid, complete sequence) position: , mismatch: 8, identity: 0.75

ccctcttgttctctctggccgcc-caacgaggt	CRISPR spacer
ccctcttggtctctgtggccgccgcagctgta-	Protospacer
******** ***** ******** **.* . .

260. spacer 7.14|190334|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP026329 (Acidithiobacillus caldus strain MTH-04 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.75

ccctcttgttctctctggccgcc-caacgaggt	CRISPR spacer
ccctcttggtctctgtggccgccgcagctgta-	Protospacer
******** ***** ******** **.* . .

261. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP030127 (Indioceanicola profundi strain SCSIO 08040 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gaaggcattggcgatgttggcggcgatgaccg	Protospacer
  . . ** **********************

262. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NC_015382 (Burkholderia gladioli BSR3 plasmid bgla_1p, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcccttgtaggcgatgttggcggtgttgacct	Protospacer
 . *  .****************.* ******

263. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP032323 (Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
cagcagataggcgatgatgacggcgaacagca	Protospacer
. ************** **.******  * *

264. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP022363 (Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
cagcagataggcgatgatgacggcgaacagca	Protospacer
. ************** **.******  * *

265. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_HG938356 (Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141 plasmid pHAMBI1141a, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
ggacagataggcgatgccggcggcgatcgcgt	Protospacer
  .*************..********* .* *

266. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP032341 (Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
cagcagataggcgatgatgacggcgaacagca	Protospacer
. ************** **.******  * *

267. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP032347 (Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
cagcagataggcgatgatgacggcgaacagca	Protospacer
. ************** **.******  * *

268. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP012916 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
cagcagataggcgatgatgacggcgaacagca	Protospacer
. ************** **.******  * *

269. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP026282 (Klebsiella oxytoca strain KONIH2 plasmid pKOR-e3cb, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

270. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP026282 (Klebsiella oxytoca strain KONIH2 plasmid pKOR-e3cb, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

271. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_KY020154 (Klebsiella pneumoniae strain Kpn-431cz plasmid pKpn-431cz, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

272. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_KY020154 (Klebsiella pneumoniae strain Kpn-431cz plasmid pKpn-431cz, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

273. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_KX869741 (Enterobacter cloacae strain 20130723 plasmid R222, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

274. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_KY270853 (Raoultella ornithinolytica strain YNKP001 plasmid pYNKP001-dfrA, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

275. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_KY270855 (Pseudomonas putida strain 12969 plasmid p12969-2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

276. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_KY126370 (Enterobacter cloacae subsp. cloacae strain MN201516 plasmid pOP-I, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

277. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_KY270852 (Enterobacter cloacae strain T5282 plasmid pT5282-mphA, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

278. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_KY494864 (Pseudomonas aeruginosa strain FFUP_PS_37 plasmid pJB37, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

279. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP014072 (Klebsiella quasipneumoniae strain FDAARGOS_93 plasmid unnamed1) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

280. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP050835 (Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

281. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP009414 (Salmonella enterica strain CFSAN007428 isolate N11150 plasmid pCFSAN007428_01, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

282. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to LC486677 (Serratia marcescens MRY16-414SMA plasmid pMRY16-414SMA_2 DNA, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

283. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_KU356480 (Vibrio parahaemolyticus strain VPS92 plasmid pVPS92-VEB, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

284. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_KX815983 (Salmonella enterica subsp. enterica serovar Dublin strain N13-01125 plasmid pN13-01125, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

285. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_KX810825 (Salmonella enterica subsp. enterica serovar Typhimurium strain MU1 plasmid pIMP4-SEM1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

286. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_KU302802 (Enterobacter cloacae strain SZECL1 plasmid pNDM1_SZ2 clone ST231, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

287. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_KU302801 (Enterobacter cloacae strain SZECL1 plasmid pNDM1_SZ1 clone ST231, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

288. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP035548 (Salmonella enterica subsp. enterica serovar Typhimurium strain YU07-18 plasmid pYU07-18_IncA/C2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

289. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP009411 (Salmonella enterica strain CFSAN007425 isolate 22697 plasmid pCFSAN007425_01, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

290. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP009413 (Salmonella enterica strain CFSAN007427 isolate N20272 plasmid pCFSAN007427_01, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

291. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_KJ588780 (Achromobacter xylosoxidans strain A22732 plasmid pA22732-IMP, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

292. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_KJ909290 (Aeromonas salmonicida subsp. salmonicida strain 2004-05MF26 plasmid pSN254b, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

293. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_KJ958927 (Klebsiella pneumoniae strain Kpn-3002cz plasmid pS-3002cz, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

294. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_KP688397 (Vibrio parahaemolyticus strain V36 plasmid pVPH1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

295. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_KR559888 (Klebsiella pneumoniae strain Kpn642 plasmid pKP-Gr642, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

296. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_KP791968 (Vibrio parahaemolyticus strain 2011VPH2 plasmid pVPH2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

297. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_KM406488 (Salmonella enterica subsp. enterica serovar Paratyphi B strain R69 plasmid R69, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

298. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_KT818627 (Klebsiella pneumoniae strain U25 plasmid U25P002, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

299. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_KM406490 (Salmonella enterica subsp. enterica serovar Typhimurium strain 202 plasmid pSEM, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

300. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_KM406489 (Serratia marcescens strain R471 plasmid R471, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

301. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_KP975076 (Pseudomonas aeruginosa strain MRSN17623 plasmid pMRVIM0713, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

302. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_KP975077 (Enterobacter cloacae strain MRSN17626 plasmid pMRVIM0813, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

303. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_KP294351 (Escherichia coli strain CZD1527 plasmid pIGT15, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

304. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_KT207463 (Escherichia coli strain VA292 plasmid pDGO100, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

305. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_KU315015 (Serratia marcescens strain NCTC 50331 plasmid R1215, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

306. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NC_014368 (Klebsiella pneumoniae plasmid pNL194, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

307. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to AP018454 (Klebsiella pneumoniae plasmid pMRY13-133KPN_2 DNA, complete genome, strain: MRY13-133) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

308. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to AP018455 (Klebsiella aerogenes plasmid pMRY13-134EAE_1 DNA, complete genome, strain: MRY13-134) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

309. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP028197 (Salmonella enterica subsp. enterica serovar Concord strain CFSAN018747 plasmid pGMI14-002_1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

310. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP025141 (Klebsiella pneumoniae strain KP1768 plasmid KP1768_p1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

311. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP032391 (Salmonella enterica subsp. enterica serovar Dublin strain CVM 34981 plasmid p34981_1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

312. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_AP022376 (Providencia rettgeri strain BML2531 plasmid pBML2531, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

313. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP049911 (Diaphorobacter sp. HDW4A plasmid p_unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

314. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP011599 (Phytobacter ursingii strain CAV1151 plasmid pCAV1151-83, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

315. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP011601 (Phytobacter ursingii strain CAV1151 plasmid pCAV1151-296, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

316. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP017987 (Klebsiella pneumoniae strain 825795-1 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

317. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP047309 (Citrobacter freundii strain L75 plasmid pCf76, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

318. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP045742 (Escherichia coli strain DH5alpha plasmid pTHNK130-1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

319. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP013324 (Klebsiella pneumoniae strain CAV1193 plasmid pCAV1193-166, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

320. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to CP052410 (Klebsiella pneumoniae strain C17KP0008 plasmid pC17KP0008-3, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

321. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP010373 (Escherichia coli strain 6409 plasmid p6409-202.186kb, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

322. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP019187 (Salmonella enterica subsp. enterica serovar Pomona str. ATCC 10729 plasmid pATCC10729_01, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

323. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP023418 (Klebsiella pneumoniae strain 1050 plasmid pKp1050-2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

324. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP044256 (Salmonella enterica strain CFSAN096147 plasmid pCFSAN096147, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

325. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP048305 (Escherichia coli strain 9 plasmid p009_A, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

326. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP025240 (Salmonella enterica subsp. enterica serovar Newport str. USDA-ARS-USMARC-1928 plasmid pSNE3-1928, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

327. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP025242 (Salmonella enterica subsp. enterica serovar Newport str. USDA-ARS-USMARC-1929 plasmid pSNE1-1929, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

328. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_KX426227 (Acinetobacter lwoffii strain ED23-35 plasmid pALWED1.1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

329. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_AP018755 (Klebsiella pneumoniae strain KP67 plasmid pKP6702, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

330. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP024192 (Klebsiella pneumoniae isolate KSB1_5D plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

331. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP024194 (Klebsiella pneumoniae isolate KSB1_5D plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

332. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to MN477204 (Escherichia coli strain S15FP06257 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

333. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP029447 (Serratia marcescens strain CAV1761 plasmid pCAV1761-73, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

334. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP029448 (Serratia marcescens strain CAV1761 plasmid pCAV1761-205, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

335. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP015373 (Pandoraea pnomenusa strain MCB032 plasmid unnamed 2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

336. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP017059 (Citrobacter freundii strain SL151 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

337. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP021328 (Raoultella ornithinolytica strain Ro24724 plasmid pRo24724, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

338. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP026242 (Citrobacter freundii complex sp. CFNIH9 plasmid pCFR-eb27, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

339. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP035636 (Enterobacter cloacae strain EN3600 plasmid unnamed4, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

340. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_LS992184 (Citrobacter freundii isolate Citrobacter freundii str. U2785 plasmid 2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

341. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_KJ187752 (Klebsiella pneumoniae strain 7433 plasmid pTR2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

342. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP042506 (Leclercia adecarboxylata strain E1 plasmid pE1_001, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

343. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP042507 (Leclercia adecarboxylata strain E1 plasmid pE1_002, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

344. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP018716 (Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

345. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP018722 (Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

346. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP018704 (Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

347. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP029249 (Salmonella enterica subsp. enterica serovar Thompson strain HFCDC-SM-846 plasmid p846, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

348. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP019559 (Escherichia coli strain KSC207 plasmid pMRGN207, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

349. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP025467 (Klebsiella pneumoniae strain JS187 plasmid p187-1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

350. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NC_022078 (Klebsiella pneumoniae JM45 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

351. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP009883 (Pantoea sp. PSNIH1 plasmid pPSP-a3e, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

352. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP010378 (Enterobacter hormaechei subsp. hormaechei strain 34983 plasmid p34983-59.134kb, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

353. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_AP022377 (Providencia stuartii strain BML2537 plasmid pBML2537, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

354. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to MT077884 (Escherichia coli plasmid p33, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

355. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to MT077886 (Escherichia coli plasmid p39, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

356. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP026170 (Leclercia sp. LSNIH1 plasmid pLEC-000f, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

357. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP026171 (Leclercia sp. LSNIH1 plasmid pLEC-1cb1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

358. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP022359 (Shewanella bicestrii strain JAB-1 plasmid pSHE-CTX-M, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

359. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to MN336501 (Pseudomonas aeruginosa strain 164130 plasmid p4130-KPC, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

360. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_EU880929 (Klebsiella pneumoniae strain INS23K plasmid pLJ1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

361. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP048293 (Escherichia coli strain CVM N18EC0432 plasmid pN18EC0432-1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

362. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP026196 (Enterobacteriaceae bacterium ENNIH1 plasmid pENT-1f0b, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

363. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP028955 (Klebsiella pneumoniae strain AR_0141 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

364. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP033627 (Klebsiella pneumoniae strain 4743 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

365. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP033628 (Klebsiella pneumoniae strain 4743 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

366. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to MN423361 (Leclercia sp. strain 1106151 plasmid p1106151-mcr, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

367. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to HG969996 (Klebsiella pneumoniae plasmid pIT-12C47, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

368. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to CP009869 (Pantoea sp. PSNIH2 plasmid pPSP-75c, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

369. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to CP033569 (Acinetobacter pittii strain 2014N21-145 plasmid p2014N21-145-1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

370. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP012682 (Salmonella enterica subsp. enterica serovar Typhimurium strain 33676 plasmid p33676_IncA/C, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

371. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to CP044029 (Klebsiella pneumoniae strain RJY9645 plasmid pY9645-166, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

372. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP017750 (Cupriavidus sp. USMAA2-4 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

373. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP017750 (Cupriavidus sp. USMAA2-4 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

374. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP020529 (Enterobacter cloacae strain 174 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

375. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP020531 (Enterobacter cloacae strain 174 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

376. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP032385 (Salmonella enterica subsp. enterica serovar Dublin strain CVM N53043 plasmid pN53043_1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

377. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NC_018107 (Klebsiella michiganensis E718 plasmid pKOX_R1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

378. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP010801 (Ralstonia mannitolilytica strain SN82F48 plasmid pRMAN01, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

379. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP020854 (Klebsiella pneumoniae strain KPN528 plasmid pKPN528-1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

380. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP020856 (Klebsiella pneumoniae strain KPN528 plasmid pKPN528-3, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

381. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NC_003384 (Salmonella enterica subsp. enterica serovar Typhi str. CT18 plasmid pHCM1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

382. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP025277 (Salmonella enterica subsp. enterica strain USDA-ARS-USMARC-60984 plasmid pSJO-60984, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

383. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to LC549808 (Klebsiella pneumoniae VNCKp83 plasmid pVNCKp83 DNA, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

384. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP014978 (Salmonella enterica subsp. enterica serovar Typhimurium str. USDA-ARS-USMARC-1896 isolate ST03-F34 plasmid pSTY1-1896, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

385. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NC_017908 (Mycobacterium abscessus subsp. bolletii F1725 plasmid BRA100, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

386. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP042480 (Citrobacter freundii strain C50 plasmid pC50_002, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

387. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP031567 (Enterobacter hormaechei strain 2013_1a plasmid pIncHI2-1301491, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

388. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP031563 (Klebsiella pneumoniae strain 2-1 plasmid pKP21HI1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

389. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP031564 (Klebsiella pneumoniae strain 2-1 plasmid pKP21AC2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

390. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP032397 (Salmonella enterica subsp. enterica serovar Dublin strain CVM 22429 plasmid p22429, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

391. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP028784 (Klebsiella pneumoniae strain SCKP020049 plasmid p1_020049, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

392. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to MN254970 (Escherichia coli strain EC009 plasmid pEC009.1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

393. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP014658 (Salmonella enterica subsp. enterica serovar Anatum str. USDA-ARS-USMARC-1736 plasmid pSAN1-1736, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

394. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NC_019165 (Klebsiella pneumoniae plasmid pKPN101-IT, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

395. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP035381 (Leclercia adecarboxylata strain R25 plasmid pLA-64, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

396. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP043190 (Escherichia coli O16:H48 strain PG20180175 plasmid pPG20180175.1-IncAC2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

397. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP044142 (Escherichia coli O157 strain AR-0429 plasmid pAR-0429-1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

398. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to MN310380 (Raoultella ornithinolytica strain 170602815 plasmid p602815-NR, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

399. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP025231 (Salmonella enterica subsp. enterica serovar Newport str. USDA-ARS-USMARC-1924 plasmid pSNE1-1924, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

400. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP012754 (Klebsiella pneumoniae strain KP617 plasmid KP-p1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

401. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to MH909331 (Leclercia adecarboxylata plasmid p707804-NDM, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

402. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP031736 (Klebsiella pneumoniae subsp. pneumoniae strain Klebsiella pneumoniae plasmid pKPM502, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

403. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP018819 (Klebsiella pneumoniae strain AR_0049 plasmid unitig_3, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

404. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP037966 (Klebsiella pneumoniae strain SCKP020135 plasmid p1_020135, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

405. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to MF495478 (Aeromonas salmonicida plasmid pS121-1b, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

406. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP038330 (Escherichia coli O157:H7 strain NE 1092-2 plasmid pNE1092-3, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

407. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NC_024997 (Klebsiella oxytoca plasmid pACM1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

408. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP043215 (Salmonella enterica subsp. enterica serovar Heidelberg strain SL-312 plasmid pET8.1-IncAC2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

409. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP023250 (Klebsiella pneumoniae strain CCUG 70742 plasmid pKpn70742_1) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

410. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to KU160531 (Vibrio alginolyticus strain VAS3-1 plasmid pVAS3-1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

411. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to CP052417 (Klebsiella pneumoniae strain C16KP0189 plasmid pC16KP0189-3, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

412. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_MN433457 (Pseudomonas aeruginosa strain PAB546 plasmid pNK546-KPC, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

413. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_MN433457 (Pseudomonas aeruginosa strain PAB546 plasmid pNK546-KPC, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

414. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP008825 (UNVERIFIED_ORG: Enterobacter cloacae ECNIH2 plasmid pKPC-272, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

415. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP028562 (Aeromonas hydrophila subsp. hydrophila strain WCHAH045096 plasmid p1_045096, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

416. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP041100 (Klebsiella pneumoniae subsp. pneumoniae strain KPCTRSRTH07 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

417. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP042483 (Klebsiella pneumoniae strain C51 plasmid pC51_002, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

418. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP046330 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

419. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP046332 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed2) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

420. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to MN310378 (Klebsiella pneumoniae strain A2293 plasmid pA2293-Ct2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

421. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP021835 (Klebsiella pneumoniae strain AR_0120 plasmid tig00000516_pilon, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

422. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP026545 (Cupriavidus metallidurans strain Ni-2 plasmid unnamed1) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

423. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to CP034667 (Proteus vulgaris strain PvSC3 plasmid pPvSC3, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

424. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP009560 (Salmonella enterica subsp. enterica serovar Newport str. CVM 22425 plasmid pCVM22425, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

425. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP033574 (Shewanella algae strain KC-Na-R1 plasmid pKC-Na-R1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

426. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP035180 (Klebsiella pneumoniae strain BA33875 plasmid pBA33875_IncFIB, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

427. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NC_008573 (Shewanella sp. ANA-3 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

428. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP022696 (Citrobacter farmeri strain AUSMDU00008141 plasmid pAUSMDU8141-1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

429. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP052871 (Enterobacter cloacae strain 3849 plasmid p3846_IncHI2_mcr, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

430. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP052873 (Enterobacter cloacae strain 3849 plasmid p3846III, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

431. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP010351 (Acinetobacter johnsonii XBB1 plasmid pXBB1-9, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

432. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP021961 (Klebsiella pneumoniae strain AR_0139 plasmid tig00000006, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

433. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NC_022372 (Salmonella enterica subsp. enterica serovar Typhimurium plasmid pYT3 DNA, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

434. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP028791 (Klebsiella pneumoniae strain WCHKP020030 plasmid pOXA1_020030, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

435. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP028993 (Klebsiella pneumoniae strain AR_0142 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

436. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP029135 (Klebsiella pneumoniae strain AR376 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

437. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to CP049311 (Salmonella enterica subsp. enterica serovar Heidelberg strain CVM N53023 plasmid pN53023, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

438. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to CP052554 (Klebsiella pneumoniae strain A17KP0038 plasmid pA17KP0038-3, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

439. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP029396 (Acinetobacter defluvii strain WCHA30 plasmid pOXA58_010030, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

440. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_LT991958 (Enterobacter cloacae complex sp. isolate C45 plasmid pC45-VIM4) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

441. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_LT991959 (Enterobacter cloacae complex sp. isolate C45 plasmid pC45-p2) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

442. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to KU238092 (Uncultured bacterium plasmid pDTC28, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

443. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP029037 (Salmonella enterica subsp. enterica serovar Senftenberg str. 361154004 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

444. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP043856 (Enterobacter hormaechei strain EB_P6_L3_02.19 plasmid pIMPIncN3_52kb, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

445. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP026974 (Achromobacter insolitus strain FDAARGOS_88 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

446. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP044215 (Klebsiella aerogenes strain KA_P10_L5_03.19 plasmid pIMPIncH12_334kb, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

447. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP026753 (Klebsiella pneumoniae strain AR_0066 plasmid tig00000084_pilon, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

448. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP009562 (Salmonella enterica subsp. enterica serovar Newport str. CVM 22513 plasmid pCVM22513, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

449. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP021168 (Enterobacter hormaechei strain 388 plasmid p388, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

450. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to KM659090 (Achromobacter sp. LM16 plasmid pLM16A1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

451. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP039526 (Klebsiella pneumoniae subsp. pneumoniae strain HB25-1 plasmid pHB25-1-vir, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

452. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP038464 (Aeromonas hydrophila strain WCX23 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

453. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP027044 (Klebsiella pneumoniae strain 1_GR_13 plasmid IncFIB IncFII, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

454. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP029599 (Klebsiella quasipneumoniae subsp. similipneumoniae strain ATCC 700603 plasmid pDA33145-77, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

455. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to CP049307 (Salmonella enterica subsp. enterica serovar Heidelberg strain CVM N58631 plasmid p58631, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

456. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP032285 (Acinetobacter sp. WCHA55 plasmid pOXA58_010055, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

457. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NC_019093 (Escherichia coli plasmid pLST424C-61, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

458. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NC_009140 (Salmonella enterica subsp. enterica serovar Newport str. SL254 plasmid pSN254, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

459. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP021688 (Klebsiella pneumoniae strain AR_0146 plasmid tig00001189, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

460. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP012168 (Enterobacter hormaechei subsp. steigerwaltii strain 34998 plasmid p34998-239.973kb, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

461. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP035277 (Citrobacter freundii strain R17 plasmid pCFR17_1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

462. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP021163 (Enterobacter hormaechei strain 234 plasmid p234, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

463. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP038466 (Aeromonas hydrophila strain 23-C-23 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

464. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to LT009689 (Klebsiella pneumoniae plasmid pIT-12C73, strain 12C73, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

465. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to JX469831 (Uncultured bacterium plasmid pKSP212, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

466. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP042494 (Leclercia adecarboxylata strain E61 plasmid pE61_001, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

467. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP042495 (Leclercia adecarboxylata strain E61 plasmid pE61_002, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

468. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP008933 (Klebsiella pneumoniae strain PMK1 plasmid pPMK1-NDM, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

469. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP032180 (Citrobacter freundii strain AR_0116 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

470. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP009116 (Klebsiella pneumoniae strain carbapenem-resistant blaNDM-1 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

471. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP040696 (Citrobacter freundii strain R47 plasmid pR47-309, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

472. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP040697 (Citrobacter freundii strain R47 plasmid pR47-54, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

473. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP028563 (Aeromonas hydrophila subsp. hydrophila strain WCHAH045096 plasmid p2_045096, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

474. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP026390 (Leclercia sp. LSNIH3 plasmid pLEC-5e18, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

475. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP026391 (Leclercia sp. LSNIH3 plasmid pLEC-7c0d, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

476. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NC_017645 (Escherichia coli UMNK88 plasmid pUMNK88, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

477. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP009567 (Salmonella enterica subsp. enterica serovar Newport str. CVM 22462 plasmid pCFSAN000934_02, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

478. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP008899 (Enterobacter hormaechei subsp. hoffmannii ECNIH3 plasmid pENT-8a4, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

479. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP029142 (Klebsiella michiganensis strain AR375 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

480. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP048381 (Klebsiella variicola strain 118 plasmid p118_B-OXA1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

481. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP007636 (Vibrio cholerae strain 2012EL-2176 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

482. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to MF344569 (Pseudomonas aeruginosa plasmid p12939-PER, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

483. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP041248 (Raoultella electrica strain DSM 102253 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

484. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP041248 (Raoultella electrica strain DSM 102253 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

485. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP008843 (Klebsiella michiganensis strain M1 plasmid pKOXM1B, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

486. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_AP019667 (Klebsiella pneumoniae strain TA6363 plasmid pTMTA63632, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

487. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NC_012690 (Escherichia coli plasmid peH4H, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

488. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NC_032101 (Enterobacter cloacae plasmid pG6809-2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

489. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP025964 (Klebsiella pneumoniae strain WCHKP34 plasmid pIMP4_LL34, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

490. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP041052 (Enterobacter hormaechei strain C126 plasmid pEnC126NDM, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatcg	Protospacer
 .******.******** *******  **.*

491. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP042552 (Enterobacter hormaechei strain C45 plasmid pC45_001, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

492. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP042553 (Enterobacter hormaechei strain C45 plasmid pC45_002, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

493. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP022156 (Escherichia coli strain ABWA45 plasmid pABWA45_2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

494. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP020068 (Klebsiella pneumoniae strain AR_0068 plasmid unitig_1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

495. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP020070 (Klebsiella pneumoniae strain AR_0068 plasmid unitig_4, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

496. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP032238 (Escherichia coli strain ECCWS199 plasmid pTB221, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

497. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to JN106172 (Uncultured bacterium plasmid pAKD29, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

498. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to JN106173 (Uncultured bacterium plasmid pAKD31, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

499. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to JN106174 (Uncultured bacterium plasmid pAKD33, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

500. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP016526 (Salmonella enterica subsp. enterica serovar Heidelberg strain 09-036813-1A plasmid p09-036813-1A_261, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

501. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP015991 (Klebsiella pneumoniae strain BR plasmid pWSZBR, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

502. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP028929 (Klebsiella pneumoniae strain AR_0153 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

503. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP028931 (Klebsiella pneumoniae strain AR_0153 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

504. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP031575 (Enterobacter hormaechei strain A1 plasmid pIncHI2-1502264, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

505. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP024557 (Klebsiella pneumoniae strain INF164 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

506. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to CP050163 (Escherichia coli plasmid Carbapenemase(KPC-2)_IncHI2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

507. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP025517 (Klebsiella pneumoniae strain 002SK2 plasmid p002SK2_B, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

508. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP032520 (Cupriavidus oxalaticus strain T2 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

509. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP032520 (Cupriavidus oxalaticus strain T2 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

510. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP032520 (Cupriavidus oxalaticus strain T2 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

511. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP041172 (Salmonella enterica subsp. enterica serovar Thompson strain SH11G0791 plasmid pSH11G0791, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

512. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP024641 (Klebsiella michiganensis strain F107 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

513. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NC_002698 (Shigella flexneri 5a virulence plasmid pWR501, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

514. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to KP294350 (Uncultured bacterium plasmid pARM26, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

515. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to JN106164 (Uncultured bacterium plasmid pAKD1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

516. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to JN106165 (Uncultured bacterium plasmid pAKD14, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

517. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to JN106166 (Uncultured bacterium plasmid pAKD15, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

518. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to JN106168 (Uncultured bacterium plasmid pAKD17, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

519. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to JN106169 (Uncultured bacterium plasmid pAKD18, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

520. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP011614 (Klebsiella oxytoca strain CAV1335 plasmid pCAV1335-92, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

521. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP041734 (Enterobacter hormaechei subsp. steigerwaltii strain ME-1 plasmid pME-1a, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

522. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP024529 (Klebsiella pneumoniae strain INF157 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

523. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP026230 (Aeromonas sp. ASNIH1 plasmid pKPC-038c, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

524. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP024682 (Citrobacter freundii strain UMH14 plasmid pUMH14_2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

525. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP016919 (Klebsiella pneumoniae isolate 11 plasmid pIncR_DHQP1300920, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

526. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP016921 (Klebsiella pneumoniae isolate 11 plasmid pIncHI1B_DHQP1300920, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

527. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to CP050156 (Klebsiella pneumoniae plasmid Carbapenemase(NDM-1)_IncH1B, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

528. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP017932 (Klebsiella oxytoca strain CAV1015 plasmid pCAV1015-76, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

529. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP032491 (Salmonella enterica subsp. enterica serovar Typhimurium strain SL26 plasmid pSL26_IncA/C2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

530. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP032496 (Salmonella enterica subsp. enterica serovar Typhimurium strain SO21 plasmid pSO21_IncA/C2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

531. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP024522 (Klebsiella pneumoniae strain INF158 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

532. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP024524 (Klebsiella pneumoniae strain INF158 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

533. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP011540 (Klebsiella aerogenes strain G7 plasmid pGPN1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

534. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to MN583270 (Pseudomonas aeruginosa strain NK546 plasmid pNK546b, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

535. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to MN583270 (Pseudomonas aeruginosa strain NK546 plasmid pNK546b, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

536. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to MK933279 (Enterobacter hormaechei strain SCNJ07 plasmid pMCR-SCNJ07, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

537. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP015139 (Escherichia coli strain Ecol_732 plasmid pEC732_IMP14, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

538. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP022612 (Klebsiella pneumoniae strain CDC 0106 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

539. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP022612 (Klebsiella pneumoniae strain CDC 0106 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

540. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NC_021845 (Salmonella enterica subsp. enterica serovar Cubana str. CFSAN002050 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

541. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NC_005211 (Serratia marcescens plasmid R478, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

542. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NC_019066 (Escherichia coli plasmid pAPEC1990_61, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

543. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP017935 (Klebsiella pneumoniae strain CAV1016 plasmid pCAV1016-90, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

544. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP017936 (Klebsiella pneumoniae strain CAV1016 plasmid pCAV1016-76, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

545. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to CP028804 (Klebsiella pneumoniae strain WCHKP7E2 plasmid pCMY2_085072, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

546. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP046347 (Citrobacter portucalensis strain FDAARGOS_738 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

547. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP030270 (Klebsiella pneumoniae subsp. pneumoniae strain SC-7 plasmid pSC7-vir, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

548. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP026154 (Klebsiella pneumoniae strain F10(AN) plasmid pF10AN_1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

549. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP026154 (Klebsiella pneumoniae strain F10(AN) plasmid pF10AN_1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

550. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to KY014465 (Vibrio parahaemolyticus plasmid pVPS114, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

551. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to KY014466 (Vibrio vulnificus plasmid pVVS1-per1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

552. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP018451 (Klebsiella pneumoniae strain Kp_Goe_71070 plasmid pKp_Goe_070-1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

553. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NC_016976 (Klebsiella pneumoniae plasmid pR55, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

554. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NC_016978 (Comamonas testosteroni plasmid pI2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

555. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NC_016980 (Klebsiella pneumoniae plasmid pNDM-MAR, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

556. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP017451 (Klebsiella sp. LTGPAF-6F plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

557. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP043927 (Klebsiella quasipneumoniae subsp. quasipneumoniae strain M17277 plasmid p17277A_477, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

558. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP011640 (Serratia marcescens strain CAV1492 plasmid pCAV1492-73, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

559. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP011641 (Serratia marcescens strain CAV1492 plasmid pCAV1492-199, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

560. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP020902 (Klebsiella pneumoniae strain K66-45 plasmid pK66-45-1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

561. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP045675 (Klebsiella pneumoniae strain WSD411 plasmid pWSD411_2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

562. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP025275 (Salmonella enterica subsp. enterica serovar Newport str. USDA-ARS-USMARC-1923 plasmid pSNE2-1923) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

563. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP031103 (Leclercia sp. W17 plasmid pW17-2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

564. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP027670 (Simplicispira suum strain SC1-8 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

565. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP040362 (Klebsiella pneumoniae strain R50 plasmid pR50-74, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

566. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP042519 (Citrobacter freundii strain E33 plasmid pE33_002, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

567. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP042547 (Klebsiella michiganensis strain C52 plasmid pC52_002, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

568. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP046614 (Klebsiella pneumoniae strain WCGKP294 plasmid pWCGKP294-2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

569. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP029723 (Klebsiella pneumoniae strain AR_0140 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

570. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP027173 (Pseudomonas aeruginosa strain AR_0353 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

571. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to CP051274 (Salmonella enterica subsp. enterica serovar Worthington strain OLF-FSR1_WB_Partridge_SW-37 plasmid pSW37-267109, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

572. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP038450 (Aeromonas media strain R50-22 plasmid pAeme6, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

573. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_AP018748 (Klebsiella pneumoniae strain KP33 plasmid pKP3301, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

574. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to CP028419 (Aeromonas hydrophila strain WCX23 plasmid pWCX23_1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

575. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP011632 (Klebsiella oxytoca strain CAV1374 plasmid pCAV1374-84, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

576. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP011633 (Klebsiella oxytoca strain CAV1374 plasmid pCAV1374-150, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

577. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP011634 (Klebsiella oxytoca strain CAV1374 plasmid pCAV1374-228, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

578. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP011634 (Klebsiella oxytoca strain CAV1374 plasmid pCAV1374-228, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

579. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP011634 (Klebsiella oxytoca strain CAV1374 plasmid pCAV1374-228, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

580. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP011634 (Klebsiella oxytoca strain CAV1374 plasmid pCAV1374-228, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

581. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP024550 (Klebsiella pneumoniae strain INF163 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

582. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP018318 (Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

583. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP014698 (Klebsiella quasipneumoniae strain ATCC 700603 isolate K6 plasmid pKQPS2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

584. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to MN842294 (Leclercia adecarboxylata strain G426 plasmid pG426-FII, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

585. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to KF743817 (Proteus mirabilis plasmid R772, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

586. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to KF743818 (Bordetella bronchiseptica plasmid R906, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

587. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to CP051271 (Salmonella enterica subsp. enterica serovar Worthington strain OLF-FSR1_WB_Quail_SW-70 plasmid pSW37-267106, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

588. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP032340 (Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
ctccaacacggcgatgtcggcggcgatggcct	Protospacer
.* **.   ********.**********.***

589. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP011595 (Klebsiella oxytoca strain CAV1099 plasmid pKPC_CAV1099, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

590. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP043767 (Enterobacter hormaechei strain EB_P9_L5_03.19 plasmid pIMPIncH12_331kb, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

591. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP021712 (Klebsiella pneumoniae strain AR_0143 plasmid tig00000857, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

592. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP025236 (Salmonella enterica subsp. enterica serovar Newport str. USDA-ARS-USMARC-1926 plasmid pSNE2-1926, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

593. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to KX957968 (Vibrio alginolyticus plasmid pVAS19, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

594. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP013115 (Shewanella xiamenensis strain T17 plasmid pSx1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

595. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP013215 (Klebsiella pneumoniae subsp. pneumoniae strain H11 plasmid pH11, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

596. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP053365 (Klebsiella pneumoniae strain BA2275 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

597. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP009570 (Salmonella enterica subsp. enterica serovar Newport str. CVM N1543 isolate CFSAN000926 plasmid pCVMN1543, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

598. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP009564 (Salmonella enterica subsp. enterica serovar Newport str. CVM 21550 plasmid pCVM21550, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

599. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP009563 (Salmonella enterica subsp. enterica serovar Newport str. CVM 21538 plasmid pCVM21538, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

600. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NC_006525 (Cupriavidus metallidurans CH34 plasmid pMOL28, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

601. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NC_020123 (Citrobacter freundii strain CFSTE plasmid pT-OXA-181, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

602. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NC_024992 (Klebsiella pneumoniae plasmid pKp848CTX, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

603. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP011622 (Klebsiella pneumoniae strain CAV1344 plasmid pKPC_CAV1344, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

604. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP013265 (Sphingobium baderi strain DE-13 plasmid pDE1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcag-ataggcgatgttggcggcgatgacct	CRISPR spacer
-ggcggaataggcgatgctgccggcgatgaaga	Protospacer
  **.* **********.** *********

605. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_AP018752 (Klebsiella pneumoniae strain KP64 plasmid pKP6402, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

606. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP040595 (Klebsiella pneumoniae subsp. pneumoniae strain KpvST15_NDM plasmid pKpvST15, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

607. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NC_012556 (Enterobacter cloacae plasmid pEC-IMPQ, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

608. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NC_012555 (Enterobacter cloacae plasmid pEC-IMP, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

609. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP041209 (Salmonella enterica subsp. enterica serovar Newport strain SAP18-8729 plasmid pCFSAN074384_1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

610. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP011576 (Klebsiella pneumoniae strain CAV1392 plasmid pCAV1392-50, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

611. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP042579 (Enterobacter kobei strain C16 plasmid pC16_001, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

612. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NC_019906 (Pseudomonas putida HB3267 plasmid pPC9, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

613. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP025578 (Klebsiella pneumoniae strain 08EU827 plasmid p08EU827_2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

614. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP006799 (Klebsiella pneumoniae subsp. pneumoniae PittNDM01 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

615. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP006801 (Klebsiella pneumoniae subsp. pneumoniae PittNDM01 plasmid p3, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

616. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP011610 (Citrobacter freundii strain CAV1321 plasmid pCAV1321-135, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

617. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP043516 (Enterobacter kobei strain EB_P8_L5_01.19 plasmid pIMPIncN3_57kb, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

618. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP018689 (Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

619. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NC_019116 (Salmonella enterica subsp. enterica serovar Heidelberg plasmid pSH163_135, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

620. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NC_019118 (Salmonella enterica subsp. enterica serovar Heidelberg plasmid pSH696_135, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

621. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NC_019121 (Salmonella enterica subsp. enterica serovar Heidelberg plasmid pSH111_166, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

622. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP041935 (Klebsiella pneumoniae strain KP14003 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

623. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP012956 (Acinetobacter baumannii strain D36 plasmid pD36-4 clone GC1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

624. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP024573 (Klebsiella pneumoniae strain INF274 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

625. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP026234 (Citrobacter freundii complex sp. CFNIH4 plasmid pCFR-4109, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

626. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP026234 (Citrobacter freundii complex sp. CFNIH4 plasmid pCFR-4109, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

627. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to AP022352 (Klebsiella pneumoniae E208 plasmid pE208_IMP6 DNA, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

628. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP031884 (Klebsiella pneumoniae strain WCHKP095845 plasmid pNDM1_095845, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

629. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP051135 (Enterobacter hormaechei strain AMS-38 plasmid pAMS-38c, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

630. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NC_012692 (Escherichia coli plasmid pAR060302, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

631. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NC_012693 (Salmonella enterica plasmid pAM04528, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

632. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP032842 (Enterobacter hormaechei strain C15117 plasmid pSPRC-Echo1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

633. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP024564 (Klebsiella pneumoniae strain INF278 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

634. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP024566 (Klebsiella pneumoniae strain INF278 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

635. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP026851 (UNVERIFIED_ORG: Enterobacter cloacae strain AR_0072 plasmid unnamed1) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

636. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP026851 (UNVERIFIED_ORG: Enterobacter cloacae strain AR_0072 plasmid unnamed1) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

637. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP026851 (UNVERIFIED_ORG: Enterobacter cloacae strain AR_0072 plasmid unnamed1) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

638. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP026851 (UNVERIFIED_ORG: Enterobacter cloacae strain AR_0072 plasmid unnamed1) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

639. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NC_019344 (Serratia marcescens plasmid R830b, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

640. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NC_019380 (Aeromonas hydrophila plasmid pR148, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

641. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP027425 (Klebsiella oxytoca strain FDAARGOS_335 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

642. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP046032 (Salmonella sp. HNK130 plasmid pTHNK130-2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

643. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP046034 (Salmonella sp. HNK130 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

644. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP021695 (Proteus mirabilis strain AR_0155 plasmid tig00000123, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

645. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP021953 (Klebsiella pneumoniae strain AR_0148 plasmid tig00000185_pilon, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

646. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP032395 (Salmonella enterica subsp. enterica serovar Dublin strain CVM 22453 plasmid p22453_1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

647. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to KY320277 (Leclercia adecarboxylata strain Lec-476 plasmid pLec-476, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

648. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP042525 (Citrobacter freundii strain E11 plasmid pE11_001, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

649. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_AP018830 (Enterobacter hormaechei subsp. xiangfangensis strain M206 plasmid pM206-NDM1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

650. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to CP052479 (Klebsiella pneumoniae strain C16KP0050 plasmid pC16KP0050-3, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

651. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_LT991955 (Enterobacter hormaechei subsp. steigerwaltii isolate C309 plasmid pC309-VIM4) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

652. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_LT991956 (Enterobacter hormaechei subsp. steigerwaltii isolate C309 plasmid pC309-p2) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

653. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NC_023898 (Klebsiella pneumoniae plasmid pRMH760, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

654. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to CP020502 (Serratia marcescens strain BWH-23 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

655. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP026014 (Klebsiella variicola strain 13450 plasmid p13450-1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

656. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP026018 (Klebsiella pneumoniae strain 13190 plasmid p13190-2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

657. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP022170 (Aeromonas salmonicida strain S121 plasmid pS121-1a, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

658. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP025144 (Klebsiella pneumoniae strain NR5632 plasmid NR5632_p1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

659. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP025147 (Klebsiella pneumoniae strain KP1766 plasmid KP1766_p1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

660. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP038654 (Citrobacter freundii strain 154 plasmid p154_1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

661. spacer 7.21|190765|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP029986 (Sphingomonas sp. FARSPH plasmid p01, complete sequence) position: , mismatch: 8, identity: 0.75

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
cgactggcggccgcgaagcgggtcagtgccgg	Protospacer
 ** ******************.***  *..

662. spacer 7.21|190765|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP012477 (Arthrobacter sp. ERGS1:01 isolate water plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
cccgggccggccgcgaagtggtccaggtctat	Protospacer
   * * ***********.** *********.

663. spacer 7.21|190765|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_AP014705 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence) position: , mismatch: 8, identity: 0.75

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
aggatcgcggccgcgacgcgggccgggtcggc	Protospacer
.*..* ********** *******.**** .*

664. spacer 7.22|190826|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP026489 (Streptomyces sp. 604F plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

agagagctcgtaaagggccccggccaaatcgt	CRISPR spacer
gaagagctggtagagggccccggcccgagcgg	Protospacer
..****** ***.************ .* **

665. spacer 7.24|189538|32|NC_006462|PILER-CR matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 8, identity: 0.75

tcgtccgcaagctcgtcgggcacctcctccgg	CRISPR spacer
ccggccgcacgctcgtcgggcacctgtccgag	Protospacer
.** ***** *************** ..* .*

666. spacer 7.24|189538|32|NC_006462|PILER-CR matches to NZ_CP051472 (Rhodobacter sphaeroides strain CH10 plasmid pRspCH10C, complete sequence) position: , mismatch: 8, identity: 0.75

tcgtccgcaagctcgtcgggcacctcctccgg	CRISPR spacer
cgctcccgcagctcctcgcgcacctcctccgg	Protospacer
.  ***   ***** *** *************

667. spacer 7.24|189538|32|NC_006462|PILER-CR matches to NZ_CP012965 (Rhodobacter sphaeroides strain MBTLJ-8 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

tcgtccgcaagctcgtcgggcacctcctccgg	CRISPR spacer
cgctcccgcagctcctcgcgcacctcctccgg	Protospacer
.  ***   ***** *** *************

668. spacer 7.24|189538|32|NC_006462|PILER-CR matches to NZ_CP030275 (Rhodobacter sphaeroides 2.4.1 plasmid pC, complete sequence) position: , mismatch: 8, identity: 0.75

tcgtccgcaagctcgtcgggcacctcctccgg	CRISPR spacer
cgctcccgcagctcctcgcgcacctcctccgg	Protospacer
.  ***   ***** *** *************

669. spacer 7.24|189538|32|NC_006462|PILER-CR matches to CP047035 (Rhodobacter sphaeroides strain DSM 158 plasmid pC, complete sequence) position: , mismatch: 8, identity: 0.75

tcgtccgcaagctcgtcgggcacctcctccgg	CRISPR spacer
cgctcccgcagctcctcgcgcacctcctccgg	Protospacer
.  ***   ***** *** *************

670. spacer 7.24|189538|32|NC_006462|PILER-CR matches to NZ_CP015292 (Rhodobacter sphaeroides strain MBTLJ-20 plasmid d, complete sequence) position: , mismatch: 8, identity: 0.75

tcgtccgcaagctcgtcgggcacctcctccgg	CRISPR spacer
cgctcccgcagctcctcgcgcacctcctccgg	Protospacer
.  ***   ***** *** *************

671. spacer 7.24|189538|32|NC_006462|PILER-CR matches to NZ_CP047041 (Rhodobacter sphaeroides strain 2.4.1 substr. H2 plasmid pC, complete sequence) position: , mismatch: 8, identity: 0.75

tcgtccgcaagctcgtcgggcacctcctccgg	CRISPR spacer
cgctcccgcagctcctcgcgcacctcctccgg	Protospacer
.  ***   ***** *** *************

672. spacer 7.24|189538|32|NC_006462|PILER-CR matches to NZ_CP015214 (Rhodobacter sphaeroides strain MBTLJ-13 plasmid c, complete sequence) position: , mismatch: 8, identity: 0.75

tcgtccgcaagctcgtcgggcacctcctccgg	CRISPR spacer
cgctcccgcagctcctcgcgcacctcctccgg	Protospacer
.  ***   ***** *** *************

673. spacer 7.26|189661|33|NC_006462|PILER-CR matches to NC_019959 (Mycobacterium sp. JS623 plasmid pMYCSM03, complete sequence) position: , mismatch: 8, identity: 0.758

gcccccgcgggagcggcgcgccttgctagagga	CRISPR spacer
tcccgcgcgggaggggcgcgccttggaggtggc	Protospacer
 *** ******** ***********  .* **

674. spacer 7.33|190090|32|NC_006462|PILER-CR matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 8, identity: 0.75

-----cggaggagccacaggtaggccgcccgggccag	CRISPR spacer
aacttcg-----gccccgggtaggccgcccgggccat	Protospacer
     **     *** *.******************

675. spacer 7.35|190212|33|NC_006462|PILER-CR matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 8, identity: 0.758

gaggcgctgctgagccccaaggcactacggccc	CRISPR spacer
tcggcgctgctgagccccgaagcactccagtca	Protospacer
  ****************.*.***** *.*.*

676. spacer 7.35|190212|33|NC_006462|PILER-CR matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 8, identity: 0.758

gaggcgctgctgagccccaaggcactacggccc	CRISPR spacer
tcggcgctgctgagccccgaagcactccagtca	Protospacer
  ****************.*.***** *.*.*

677. spacer 7.37|190336|32|NC_006462|PILER-CR matches to NC_015851 (Acidithiobacillus caldus SM-1 megaplasmid, complete sequence) position: , mismatch: 8, identity: 0.75

ccctcttgttctctctggccgcc-caacgaggt	CRISPR spacer
ccctcttggtctctgtggccgccgcagctgta-	Protospacer
******** ***** ******** **.* . .

678. spacer 7.37|190336|32|NC_006462|PILER-CR matches to NZ_CP026329 (Acidithiobacillus caldus strain MTH-04 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.75

ccctcttgttctctctggccgcc-caacgaggt	CRISPR spacer
ccctcttggtctctgtggccgccgcagctgta-	Protospacer
******** ***** ******** **.* . .

679. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP030127 (Indioceanicola profundi strain SCSIO 08040 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gaaggcattggcgatgttggcggcgatgaccg	Protospacer
  . . ** **********************

680. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NC_015382 (Burkholderia gladioli BSR3 plasmid bgla_1p, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcccttgtaggcgatgttggcggtgttgacct	Protospacer
 . *  .****************.* ******

681. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP032323 (Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
cagcagataggcgatgatgacggcgaacagca	Protospacer
. ************** **.******  * *

682. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP022363 (Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
cagcagataggcgatgatgacggcgaacagca	Protospacer
. ************** **.******  * *

683. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_HG938356 (Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141 plasmid pHAMBI1141a, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
ggacagataggcgatgccggcggcgatcgcgt	Protospacer
  .*************..********* .* *

684. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP032341 (Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
cagcagataggcgatgatgacggcgaacagca	Protospacer
. ************** **.******  * *

685. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP032347 (Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
cagcagataggcgatgatgacggcgaacagca	Protospacer
. ************** **.******  * *

686. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP012916 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
cagcagataggcgatgatgacggcgaacagca	Protospacer
. ************** **.******  * *

687. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP026282 (Klebsiella oxytoca strain KONIH2 plasmid pKOR-e3cb, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

688. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP026282 (Klebsiella oxytoca strain KONIH2 plasmid pKOR-e3cb, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

689. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_KY020154 (Klebsiella pneumoniae strain Kpn-431cz plasmid pKpn-431cz, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

690. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_KY020154 (Klebsiella pneumoniae strain Kpn-431cz plasmid pKpn-431cz, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

691. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_KX869741 (Enterobacter cloacae strain 20130723 plasmid R222, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

692. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_KY270853 (Raoultella ornithinolytica strain YNKP001 plasmid pYNKP001-dfrA, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

693. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_KY270855 (Pseudomonas putida strain 12969 plasmid p12969-2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

694. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_KY126370 (Enterobacter cloacae subsp. cloacae strain MN201516 plasmid pOP-I, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

695. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_KY270852 (Enterobacter cloacae strain T5282 plasmid pT5282-mphA, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

696. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_KY494864 (Pseudomonas aeruginosa strain FFUP_PS_37 plasmid pJB37, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

697. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP014072 (Klebsiella quasipneumoniae strain FDAARGOS_93 plasmid unnamed1) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

698. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP050835 (Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

699. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP009414 (Salmonella enterica strain CFSAN007428 isolate N11150 plasmid pCFSAN007428_01, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

700. spacer 7.43|190706|32|NC_006462|PILER-CR matches to LC486677 (Serratia marcescens MRY16-414SMA plasmid pMRY16-414SMA_2 DNA, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

701. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_KU356480 (Vibrio parahaemolyticus strain VPS92 plasmid pVPS92-VEB, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

702. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_KX815983 (Salmonella enterica subsp. enterica serovar Dublin strain N13-01125 plasmid pN13-01125, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

703. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_KX810825 (Salmonella enterica subsp. enterica serovar Typhimurium strain MU1 plasmid pIMP4-SEM1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

704. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_KU302802 (Enterobacter cloacae strain SZECL1 plasmid pNDM1_SZ2 clone ST231, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

705. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_KU302801 (Enterobacter cloacae strain SZECL1 plasmid pNDM1_SZ1 clone ST231, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

706. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP035548 (Salmonella enterica subsp. enterica serovar Typhimurium strain YU07-18 plasmid pYU07-18_IncA/C2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

707. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP009411 (Salmonella enterica strain CFSAN007425 isolate 22697 plasmid pCFSAN007425_01, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

708. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP009413 (Salmonella enterica strain CFSAN007427 isolate N20272 plasmid pCFSAN007427_01, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

709. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_KJ588780 (Achromobacter xylosoxidans strain A22732 plasmid pA22732-IMP, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

710. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_KJ909290 (Aeromonas salmonicida subsp. salmonicida strain 2004-05MF26 plasmid pSN254b, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

711. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_KJ958927 (Klebsiella pneumoniae strain Kpn-3002cz plasmid pS-3002cz, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

712. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_KP688397 (Vibrio parahaemolyticus strain V36 plasmid pVPH1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

713. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_KR559888 (Klebsiella pneumoniae strain Kpn642 plasmid pKP-Gr642, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

714. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_KP791968 (Vibrio parahaemolyticus strain 2011VPH2 plasmid pVPH2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

715. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_KM406488 (Salmonella enterica subsp. enterica serovar Paratyphi B strain R69 plasmid R69, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

716. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_KT818627 (Klebsiella pneumoniae strain U25 plasmid U25P002, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

717. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_KM406490 (Salmonella enterica subsp. enterica serovar Typhimurium strain 202 plasmid pSEM, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

718. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_KM406489 (Serratia marcescens strain R471 plasmid R471, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

719. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_KP975076 (Pseudomonas aeruginosa strain MRSN17623 plasmid pMRVIM0713, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

720. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_KP975077 (Enterobacter cloacae strain MRSN17626 plasmid pMRVIM0813, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

721. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_KP294351 (Escherichia coli strain CZD1527 plasmid pIGT15, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

722. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_KT207463 (Escherichia coli strain VA292 plasmid pDGO100, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

723. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_KU315015 (Serratia marcescens strain NCTC 50331 plasmid R1215, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

724. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NC_014368 (Klebsiella pneumoniae plasmid pNL194, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

725. spacer 7.43|190706|32|NC_006462|PILER-CR matches to AP018454 (Klebsiella pneumoniae plasmid pMRY13-133KPN_2 DNA, complete genome, strain: MRY13-133) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

726. spacer 7.43|190706|32|NC_006462|PILER-CR matches to AP018455 (Klebsiella aerogenes plasmid pMRY13-134EAE_1 DNA, complete genome, strain: MRY13-134) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

727. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP028197 (Salmonella enterica subsp. enterica serovar Concord strain CFSAN018747 plasmid pGMI14-002_1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

728. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP025141 (Klebsiella pneumoniae strain KP1768 plasmid KP1768_p1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

729. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP032391 (Salmonella enterica subsp. enterica serovar Dublin strain CVM 34981 plasmid p34981_1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

730. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_AP022376 (Providencia rettgeri strain BML2531 plasmid pBML2531, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

731. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP049911 (Diaphorobacter sp. HDW4A plasmid p_unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

732. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP011599 (Phytobacter ursingii strain CAV1151 plasmid pCAV1151-83, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

733. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP011601 (Phytobacter ursingii strain CAV1151 plasmid pCAV1151-296, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

734. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP017987 (Klebsiella pneumoniae strain 825795-1 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

735. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP047309 (Citrobacter freundii strain L75 plasmid pCf76, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

736. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP045742 (Escherichia coli strain DH5alpha plasmid pTHNK130-1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

737. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP013324 (Klebsiella pneumoniae strain CAV1193 plasmid pCAV1193-166, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

738. spacer 7.43|190706|32|NC_006462|PILER-CR matches to CP052410 (Klebsiella pneumoniae strain C17KP0008 plasmid pC17KP0008-3, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

739. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP010373 (Escherichia coli strain 6409 plasmid p6409-202.186kb, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

740. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP019187 (Salmonella enterica subsp. enterica serovar Pomona str. ATCC 10729 plasmid pATCC10729_01, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

741. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP023418 (Klebsiella pneumoniae strain 1050 plasmid pKp1050-2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

742. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP044256 (Salmonella enterica strain CFSAN096147 plasmid pCFSAN096147, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

743. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP048305 (Escherichia coli strain 9 plasmid p009_A, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

744. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP025240 (Salmonella enterica subsp. enterica serovar Newport str. USDA-ARS-USMARC-1928 plasmid pSNE3-1928, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

745. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP025242 (Salmonella enterica subsp. enterica serovar Newport str. USDA-ARS-USMARC-1929 plasmid pSNE1-1929, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

746. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_KX426227 (Acinetobacter lwoffii strain ED23-35 plasmid pALWED1.1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

747. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_AP018755 (Klebsiella pneumoniae strain KP67 plasmid pKP6702, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

748. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP024192 (Klebsiella pneumoniae isolate KSB1_5D plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

749. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP024194 (Klebsiella pneumoniae isolate KSB1_5D plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

750. spacer 7.43|190706|32|NC_006462|PILER-CR matches to MN477204 (Escherichia coli strain S15FP06257 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

751. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP029447 (Serratia marcescens strain CAV1761 plasmid pCAV1761-73, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

752. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP029448 (Serratia marcescens strain CAV1761 plasmid pCAV1761-205, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

753. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP015373 (Pandoraea pnomenusa strain MCB032 plasmid unnamed 2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

754. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP017059 (Citrobacter freundii strain SL151 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

755. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP021328 (Raoultella ornithinolytica strain Ro24724 plasmid pRo24724, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

756. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP026242 (Citrobacter freundii complex sp. CFNIH9 plasmid pCFR-eb27, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

757. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP035636 (Enterobacter cloacae strain EN3600 plasmid unnamed4, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

758. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_LS992184 (Citrobacter freundii isolate Citrobacter freundii str. U2785 plasmid 2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

759. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_KJ187752 (Klebsiella pneumoniae strain 7433 plasmid pTR2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

760. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP042506 (Leclercia adecarboxylata strain E1 plasmid pE1_001, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

761. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP042507 (Leclercia adecarboxylata strain E1 plasmid pE1_002, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

762. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP018716 (Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

763. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP018722 (Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

764. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP018704 (Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

765. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP029249 (Salmonella enterica subsp. enterica serovar Thompson strain HFCDC-SM-846 plasmid p846, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

766. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP019559 (Escherichia coli strain KSC207 plasmid pMRGN207, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

767. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP025467 (Klebsiella pneumoniae strain JS187 plasmid p187-1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

768. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NC_022078 (Klebsiella pneumoniae JM45 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

769. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP009883 (Pantoea sp. PSNIH1 plasmid pPSP-a3e, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

770. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP010378 (Enterobacter hormaechei subsp. hormaechei strain 34983 plasmid p34983-59.134kb, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

771. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_AP022377 (Providencia stuartii strain BML2537 plasmid pBML2537, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

772. spacer 7.43|190706|32|NC_006462|PILER-CR matches to MT077884 (Escherichia coli plasmid p33, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

773. spacer 7.43|190706|32|NC_006462|PILER-CR matches to MT077886 (Escherichia coli plasmid p39, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

774. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP026170 (Leclercia sp. LSNIH1 plasmid pLEC-000f, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

775. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP026171 (Leclercia sp. LSNIH1 plasmid pLEC-1cb1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

776. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP022359 (Shewanella bicestrii strain JAB-1 plasmid pSHE-CTX-M, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

777. spacer 7.43|190706|32|NC_006462|PILER-CR matches to MN336501 (Pseudomonas aeruginosa strain 164130 plasmid p4130-KPC, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

778. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_EU880929 (Klebsiella pneumoniae strain INS23K plasmid pLJ1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

779. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP048293 (Escherichia coli strain CVM N18EC0432 plasmid pN18EC0432-1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

780. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP026196 (Enterobacteriaceae bacterium ENNIH1 plasmid pENT-1f0b, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

781. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP028955 (Klebsiella pneumoniae strain AR_0141 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

782. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP033627 (Klebsiella pneumoniae strain 4743 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

783. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP033628 (Klebsiella pneumoniae strain 4743 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

784. spacer 7.43|190706|32|NC_006462|PILER-CR matches to MN423361 (Leclercia sp. strain 1106151 plasmid p1106151-mcr, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

785. spacer 7.43|190706|32|NC_006462|PILER-CR matches to HG969996 (Klebsiella pneumoniae plasmid pIT-12C47, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

786. spacer 7.43|190706|32|NC_006462|PILER-CR matches to CP009869 (Pantoea sp. PSNIH2 plasmid pPSP-75c, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

787. spacer 7.43|190706|32|NC_006462|PILER-CR matches to CP033569 (Acinetobacter pittii strain 2014N21-145 plasmid p2014N21-145-1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

788. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP012682 (Salmonella enterica subsp. enterica serovar Typhimurium strain 33676 plasmid p33676_IncA/C, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

789. spacer 7.43|190706|32|NC_006462|PILER-CR matches to CP044029 (Klebsiella pneumoniae strain RJY9645 plasmid pY9645-166, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

790. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP017750 (Cupriavidus sp. USMAA2-4 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

791. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP017750 (Cupriavidus sp. USMAA2-4 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

792. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP020529 (Enterobacter cloacae strain 174 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

793. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP020531 (Enterobacter cloacae strain 174 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

794. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP032385 (Salmonella enterica subsp. enterica serovar Dublin strain CVM N53043 plasmid pN53043_1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

795. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NC_018107 (Klebsiella michiganensis E718 plasmid pKOX_R1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

796. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP010801 (Ralstonia mannitolilytica strain SN82F48 plasmid pRMAN01, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

797. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP020854 (Klebsiella pneumoniae strain KPN528 plasmid pKPN528-1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

798. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP020856 (Klebsiella pneumoniae strain KPN528 plasmid pKPN528-3, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

799. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NC_003384 (Salmonella enterica subsp. enterica serovar Typhi str. CT18 plasmid pHCM1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

800. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP025277 (Salmonella enterica subsp. enterica strain USDA-ARS-USMARC-60984 plasmid pSJO-60984, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

801. spacer 7.43|190706|32|NC_006462|PILER-CR matches to LC549808 (Klebsiella pneumoniae VNCKp83 plasmid pVNCKp83 DNA, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

802. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP014978 (Salmonella enterica subsp. enterica serovar Typhimurium str. USDA-ARS-USMARC-1896 isolate ST03-F34 plasmid pSTY1-1896, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

803. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NC_017908 (Mycobacterium abscessus subsp. bolletii F1725 plasmid BRA100, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

804. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP042480 (Citrobacter freundii strain C50 plasmid pC50_002, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

805. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP031567 (Enterobacter hormaechei strain 2013_1a plasmid pIncHI2-1301491, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

806. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP031563 (Klebsiella pneumoniae strain 2-1 plasmid pKP21HI1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

807. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP031564 (Klebsiella pneumoniae strain 2-1 plasmid pKP21AC2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

808. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP032397 (Salmonella enterica subsp. enterica serovar Dublin strain CVM 22429 plasmid p22429, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

809. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP028784 (Klebsiella pneumoniae strain SCKP020049 plasmid p1_020049, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

810. spacer 7.43|190706|32|NC_006462|PILER-CR matches to MN254970 (Escherichia coli strain EC009 plasmid pEC009.1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

811. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP014658 (Salmonella enterica subsp. enterica serovar Anatum str. USDA-ARS-USMARC-1736 plasmid pSAN1-1736, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

812. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NC_019165 (Klebsiella pneumoniae plasmid pKPN101-IT, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

813. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP035381 (Leclercia adecarboxylata strain R25 plasmid pLA-64, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

814. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP043190 (Escherichia coli O16:H48 strain PG20180175 plasmid pPG20180175.1-IncAC2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

815. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP044142 (Escherichia coli O157 strain AR-0429 plasmid pAR-0429-1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

816. spacer 7.43|190706|32|NC_006462|PILER-CR matches to MN310380 (Raoultella ornithinolytica strain 170602815 plasmid p602815-NR, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

817. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP025231 (Salmonella enterica subsp. enterica serovar Newport str. USDA-ARS-USMARC-1924 plasmid pSNE1-1924, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

818. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP012754 (Klebsiella pneumoniae strain KP617 plasmid KP-p1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

819. spacer 7.43|190706|32|NC_006462|PILER-CR matches to MH909331 (Leclercia adecarboxylata plasmid p707804-NDM, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

820. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP031736 (Klebsiella pneumoniae subsp. pneumoniae strain Klebsiella pneumoniae plasmid pKPM502, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

821. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP018819 (Klebsiella pneumoniae strain AR_0049 plasmid unitig_3, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

822. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP037966 (Klebsiella pneumoniae strain SCKP020135 plasmid p1_020135, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

823. spacer 7.43|190706|32|NC_006462|PILER-CR matches to MF495478 (Aeromonas salmonicida plasmid pS121-1b, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

824. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP038330 (Escherichia coli O157:H7 strain NE 1092-2 plasmid pNE1092-3, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

825. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NC_024997 (Klebsiella oxytoca plasmid pACM1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

826. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP043215 (Salmonella enterica subsp. enterica serovar Heidelberg strain SL-312 plasmid pET8.1-IncAC2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

827. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP023250 (Klebsiella pneumoniae strain CCUG 70742 plasmid pKpn70742_1) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

828. spacer 7.43|190706|32|NC_006462|PILER-CR matches to KU160531 (Vibrio alginolyticus strain VAS3-1 plasmid pVAS3-1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

829. spacer 7.43|190706|32|NC_006462|PILER-CR matches to CP052417 (Klebsiella pneumoniae strain C16KP0189 plasmid pC16KP0189-3, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

830. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_MN433457 (Pseudomonas aeruginosa strain PAB546 plasmid pNK546-KPC, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

831. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_MN433457 (Pseudomonas aeruginosa strain PAB546 plasmid pNK546-KPC, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

832. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP008825 (UNVERIFIED_ORG: Enterobacter cloacae ECNIH2 plasmid pKPC-272, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

833. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP028562 (Aeromonas hydrophila subsp. hydrophila strain WCHAH045096 plasmid p1_045096, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

834. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP041100 (Klebsiella pneumoniae subsp. pneumoniae strain KPCTRSRTH07 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

835. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP042483 (Klebsiella pneumoniae strain C51 plasmid pC51_002, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

836. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP046330 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

837. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP046332 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed2) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

838. spacer 7.43|190706|32|NC_006462|PILER-CR matches to MN310378 (Klebsiella pneumoniae strain A2293 plasmid pA2293-Ct2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

839. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP021835 (Klebsiella pneumoniae strain AR_0120 plasmid tig00000516_pilon, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

840. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP026545 (Cupriavidus metallidurans strain Ni-2 plasmid unnamed1) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

841. spacer 7.43|190706|32|NC_006462|PILER-CR matches to CP034667 (Proteus vulgaris strain PvSC3 plasmid pPvSC3, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

842. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP009560 (Salmonella enterica subsp. enterica serovar Newport str. CVM 22425 plasmid pCVM22425, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

843. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP033574 (Shewanella algae strain KC-Na-R1 plasmid pKC-Na-R1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

844. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP035180 (Klebsiella pneumoniae strain BA33875 plasmid pBA33875_IncFIB, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

845. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NC_008573 (Shewanella sp. ANA-3 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

846. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP022696 (Citrobacter farmeri strain AUSMDU00008141 plasmid pAUSMDU8141-1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

847. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP052871 (Enterobacter cloacae strain 3849 plasmid p3846_IncHI2_mcr, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

848. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP052873 (Enterobacter cloacae strain 3849 plasmid p3846III, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

849. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP010351 (Acinetobacter johnsonii XBB1 plasmid pXBB1-9, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

850. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP021961 (Klebsiella pneumoniae strain AR_0139 plasmid tig00000006, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

851. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NC_022372 (Salmonella enterica subsp. enterica serovar Typhimurium plasmid pYT3 DNA, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

852. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP028791 (Klebsiella pneumoniae strain WCHKP020030 plasmid pOXA1_020030, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

853. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP028993 (Klebsiella pneumoniae strain AR_0142 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

854. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP029135 (Klebsiella pneumoniae strain AR376 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

855. spacer 7.43|190706|32|NC_006462|PILER-CR matches to CP049311 (Salmonella enterica subsp. enterica serovar Heidelberg strain CVM N53023 plasmid pN53023, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

856. spacer 7.43|190706|32|NC_006462|PILER-CR matches to CP052554 (Klebsiella pneumoniae strain A17KP0038 plasmid pA17KP0038-3, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

857. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP029396 (Acinetobacter defluvii strain WCHA30 plasmid pOXA58_010030, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

858. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_LT991958 (Enterobacter cloacae complex sp. isolate C45 plasmid pC45-VIM4) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

859. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_LT991959 (Enterobacter cloacae complex sp. isolate C45 plasmid pC45-p2) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

860. spacer 7.43|190706|32|NC_006462|PILER-CR matches to KU238092 (Uncultured bacterium plasmid pDTC28, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

861. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP029037 (Salmonella enterica subsp. enterica serovar Senftenberg str. 361154004 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

862. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP043856 (Enterobacter hormaechei strain EB_P6_L3_02.19 plasmid pIMPIncN3_52kb, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

863. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP026974 (Achromobacter insolitus strain FDAARGOS_88 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

864. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP044215 (Klebsiella aerogenes strain KA_P10_L5_03.19 plasmid pIMPIncH12_334kb, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

865. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP026753 (Klebsiella pneumoniae strain AR_0066 plasmid tig00000084_pilon, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

866. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP009562 (Salmonella enterica subsp. enterica serovar Newport str. CVM 22513 plasmid pCVM22513, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

867. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP021168 (Enterobacter hormaechei strain 388 plasmid p388, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

868. spacer 7.43|190706|32|NC_006462|PILER-CR matches to KM659090 (Achromobacter sp. LM16 plasmid pLM16A1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

869. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP039526 (Klebsiella pneumoniae subsp. pneumoniae strain HB25-1 plasmid pHB25-1-vir, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

870. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP038464 (Aeromonas hydrophila strain WCX23 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

871. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP027044 (Klebsiella pneumoniae strain 1_GR_13 plasmid IncFIB IncFII, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

872. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP029599 (Klebsiella quasipneumoniae subsp. similipneumoniae strain ATCC 700603 plasmid pDA33145-77, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

873. spacer 7.43|190706|32|NC_006462|PILER-CR matches to CP049307 (Salmonella enterica subsp. enterica serovar Heidelberg strain CVM N58631 plasmid p58631, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

874. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP032285 (Acinetobacter sp. WCHA55 plasmid pOXA58_010055, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

875. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NC_019093 (Escherichia coli plasmid pLST424C-61, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

876. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NC_009140 (Salmonella enterica subsp. enterica serovar Newport str. SL254 plasmid pSN254, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

877. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP021688 (Klebsiella pneumoniae strain AR_0146 plasmid tig00001189, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

878. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP012168 (Enterobacter hormaechei subsp. steigerwaltii strain 34998 plasmid p34998-239.973kb, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

879. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP035277 (Citrobacter freundii strain R17 plasmid pCFR17_1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

880. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP021163 (Enterobacter hormaechei strain 234 plasmid p234, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

881. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP038466 (Aeromonas hydrophila strain 23-C-23 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

882. spacer 7.43|190706|32|NC_006462|PILER-CR matches to LT009689 (Klebsiella pneumoniae plasmid pIT-12C73, strain 12C73, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

883. spacer 7.43|190706|32|NC_006462|PILER-CR matches to JX469831 (Uncultured bacterium plasmid pKSP212, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

884. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP042494 (Leclercia adecarboxylata strain E61 plasmid pE61_001, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

885. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP042495 (Leclercia adecarboxylata strain E61 plasmid pE61_002, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

886. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP008933 (Klebsiella pneumoniae strain PMK1 plasmid pPMK1-NDM, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

887. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP032180 (Citrobacter freundii strain AR_0116 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

888. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP009116 (Klebsiella pneumoniae strain carbapenem-resistant blaNDM-1 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

889. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP040696 (Citrobacter freundii strain R47 plasmid pR47-309, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

890. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP040697 (Citrobacter freundii strain R47 plasmid pR47-54, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

891. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP028563 (Aeromonas hydrophila subsp. hydrophila strain WCHAH045096 plasmid p2_045096, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

892. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP026390 (Leclercia sp. LSNIH3 plasmid pLEC-5e18, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

893. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP026391 (Leclercia sp. LSNIH3 plasmid pLEC-7c0d, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

894. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NC_017645 (Escherichia coli UMNK88 plasmid pUMNK88, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

895. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP009567 (Salmonella enterica subsp. enterica serovar Newport str. CVM 22462 plasmid pCFSAN000934_02, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

896. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP008899 (Enterobacter hormaechei subsp. hoffmannii ECNIH3 plasmid pENT-8a4, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

897. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP029142 (Klebsiella michiganensis strain AR375 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

898. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP048381 (Klebsiella variicola strain 118 plasmid p118_B-OXA1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

899. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP007636 (Vibrio cholerae strain 2012EL-2176 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

900. spacer 7.43|190706|32|NC_006462|PILER-CR matches to MF344569 (Pseudomonas aeruginosa plasmid p12939-PER, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

901. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP041248 (Raoultella electrica strain DSM 102253 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

902. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP041248 (Raoultella electrica strain DSM 102253 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

903. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP008843 (Klebsiella michiganensis strain M1 plasmid pKOXM1B, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

904. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_AP019667 (Klebsiella pneumoniae strain TA6363 plasmid pTMTA63632, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

905. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NC_012690 (Escherichia coli plasmid peH4H, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

906. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NC_032101 (Enterobacter cloacae plasmid pG6809-2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

907. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP025964 (Klebsiella pneumoniae strain WCHKP34 plasmid pIMP4_LL34, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

908. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP041052 (Enterobacter hormaechei strain C126 plasmid pEnC126NDM, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatcg	Protospacer
 .******.******** *******  **.*

909. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP042552 (Enterobacter hormaechei strain C45 plasmid pC45_001, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

910. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP042553 (Enterobacter hormaechei strain C45 plasmid pC45_002, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

911. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP022156 (Escherichia coli strain ABWA45 plasmid pABWA45_2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

912. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP020068 (Klebsiella pneumoniae strain AR_0068 plasmid unitig_1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

913. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP020070 (Klebsiella pneumoniae strain AR_0068 plasmid unitig_4, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

914. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP032238 (Escherichia coli strain ECCWS199 plasmid pTB221, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

915. spacer 7.43|190706|32|NC_006462|PILER-CR matches to JN106172 (Uncultured bacterium plasmid pAKD29, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

916. spacer 7.43|190706|32|NC_006462|PILER-CR matches to JN106173 (Uncultured bacterium plasmid pAKD31, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

917. spacer 7.43|190706|32|NC_006462|PILER-CR matches to JN106174 (Uncultured bacterium plasmid pAKD33, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

918. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP016526 (Salmonella enterica subsp. enterica serovar Heidelberg strain 09-036813-1A plasmid p09-036813-1A_261, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

919. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP015991 (Klebsiella pneumoniae strain BR plasmid pWSZBR, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

920. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP028929 (Klebsiella pneumoniae strain AR_0153 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

921. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP028931 (Klebsiella pneumoniae strain AR_0153 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

922. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP031575 (Enterobacter hormaechei strain A1 plasmid pIncHI2-1502264, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

923. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP024557 (Klebsiella pneumoniae strain INF164 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

924. spacer 7.43|190706|32|NC_006462|PILER-CR matches to CP050163 (Escherichia coli plasmid Carbapenemase(KPC-2)_IncHI2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

925. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP025517 (Klebsiella pneumoniae strain 002SK2 plasmid p002SK2_B, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

926. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP032520 (Cupriavidus oxalaticus strain T2 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

927. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP032520 (Cupriavidus oxalaticus strain T2 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

928. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP032520 (Cupriavidus oxalaticus strain T2 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

929. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP041172 (Salmonella enterica subsp. enterica serovar Thompson strain SH11G0791 plasmid pSH11G0791, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

930. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP024641 (Klebsiella michiganensis strain F107 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

931. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NC_002698 (Shigella flexneri 5a virulence plasmid pWR501, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

932. spacer 7.43|190706|32|NC_006462|PILER-CR matches to KP294350 (Uncultured bacterium plasmid pARM26, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

933. spacer 7.43|190706|32|NC_006462|PILER-CR matches to JN106164 (Uncultured bacterium plasmid pAKD1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

934. spacer 7.43|190706|32|NC_006462|PILER-CR matches to JN106165 (Uncultured bacterium plasmid pAKD14, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

935. spacer 7.43|190706|32|NC_006462|PILER-CR matches to JN106166 (Uncultured bacterium plasmid pAKD15, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

936. spacer 7.43|190706|32|NC_006462|PILER-CR matches to JN106168 (Uncultured bacterium plasmid pAKD17, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

937. spacer 7.43|190706|32|NC_006462|PILER-CR matches to JN106169 (Uncultured bacterium plasmid pAKD18, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

938. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP011614 (Klebsiella oxytoca strain CAV1335 plasmid pCAV1335-92, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

939. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP041734 (Enterobacter hormaechei subsp. steigerwaltii strain ME-1 plasmid pME-1a, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

940. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP024529 (Klebsiella pneumoniae strain INF157 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

941. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP026230 (Aeromonas sp. ASNIH1 plasmid pKPC-038c, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

942. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP024682 (Citrobacter freundii strain UMH14 plasmid pUMH14_2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

943. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP016919 (Klebsiella pneumoniae isolate 11 plasmid pIncR_DHQP1300920, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

944. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP016921 (Klebsiella pneumoniae isolate 11 plasmid pIncHI1B_DHQP1300920, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

945. spacer 7.43|190706|32|NC_006462|PILER-CR matches to CP050156 (Klebsiella pneumoniae plasmid Carbapenemase(NDM-1)_IncH1B, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

946. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP017932 (Klebsiella oxytoca strain CAV1015 plasmid pCAV1015-76, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

947. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP032491 (Salmonella enterica subsp. enterica serovar Typhimurium strain SL26 plasmid pSL26_IncA/C2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

948. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP032496 (Salmonella enterica subsp. enterica serovar Typhimurium strain SO21 plasmid pSO21_IncA/C2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

949. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP024522 (Klebsiella pneumoniae strain INF158 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

950. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP024524 (Klebsiella pneumoniae strain INF158 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

951. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP011540 (Klebsiella aerogenes strain G7 plasmid pGPN1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

952. spacer 7.43|190706|32|NC_006462|PILER-CR matches to MN583270 (Pseudomonas aeruginosa strain NK546 plasmid pNK546b, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

953. spacer 7.43|190706|32|NC_006462|PILER-CR matches to MN583270 (Pseudomonas aeruginosa strain NK546 plasmid pNK546b, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

954. spacer 7.43|190706|32|NC_006462|PILER-CR matches to MK933279 (Enterobacter hormaechei strain SCNJ07 plasmid pMCR-SCNJ07, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

955. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP015139 (Escherichia coli strain Ecol_732 plasmid pEC732_IMP14, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

956. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP022612 (Klebsiella pneumoniae strain CDC 0106 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

957. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP022612 (Klebsiella pneumoniae strain CDC 0106 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

958. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NC_021845 (Salmonella enterica subsp. enterica serovar Cubana str. CFSAN002050 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

959. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NC_005211 (Serratia marcescens plasmid R478, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

960. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NC_019066 (Escherichia coli plasmid pAPEC1990_61, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

961. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP017935 (Klebsiella pneumoniae strain CAV1016 plasmid pCAV1016-90, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

962. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP017936 (Klebsiella pneumoniae strain CAV1016 plasmid pCAV1016-76, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

963. spacer 7.43|190706|32|NC_006462|PILER-CR matches to CP028804 (Klebsiella pneumoniae strain WCHKP7E2 plasmid pCMY2_085072, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

964. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP046347 (Citrobacter portucalensis strain FDAARGOS_738 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

965. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP030270 (Klebsiella pneumoniae subsp. pneumoniae strain SC-7 plasmid pSC7-vir, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

966. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP026154 (Klebsiella pneumoniae strain F10(AN) plasmid pF10AN_1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

967. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP026154 (Klebsiella pneumoniae strain F10(AN) plasmid pF10AN_1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

968. spacer 7.43|190706|32|NC_006462|PILER-CR matches to KY014465 (Vibrio parahaemolyticus plasmid pVPS114, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

969. spacer 7.43|190706|32|NC_006462|PILER-CR matches to KY014466 (Vibrio vulnificus plasmid pVVS1-per1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

970. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP018451 (Klebsiella pneumoniae strain Kp_Goe_71070 plasmid pKp_Goe_070-1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

971. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NC_016976 (Klebsiella pneumoniae plasmid pR55, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

972. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NC_016978 (Comamonas testosteroni plasmid pI2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

973. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NC_016980 (Klebsiella pneumoniae plasmid pNDM-MAR, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

974. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP017451 (Klebsiella sp. LTGPAF-6F plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

975. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP043927 (Klebsiella quasipneumoniae subsp. quasipneumoniae strain M17277 plasmid p17277A_477, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

976. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP011640 (Serratia marcescens strain CAV1492 plasmid pCAV1492-73, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

977. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP011641 (Serratia marcescens strain CAV1492 plasmid pCAV1492-199, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

978. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP020902 (Klebsiella pneumoniae strain K66-45 plasmid pK66-45-1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

979. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP045675 (Klebsiella pneumoniae strain WSD411 plasmid pWSD411_2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

980. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP025275 (Salmonella enterica subsp. enterica serovar Newport str. USDA-ARS-USMARC-1923 plasmid pSNE2-1923) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

981. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP031103 (Leclercia sp. W17 plasmid pW17-2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

982. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP027670 (Simplicispira suum strain SC1-8 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

983. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP040362 (Klebsiella pneumoniae strain R50 plasmid pR50-74, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

984. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP042519 (Citrobacter freundii strain E33 plasmid pE33_002, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

985. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP042547 (Klebsiella michiganensis strain C52 plasmid pC52_002, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

986. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP046614 (Klebsiella pneumoniae strain WCGKP294 plasmid pWCGKP294-2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

987. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP029723 (Klebsiella pneumoniae strain AR_0140 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

988. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP027173 (Pseudomonas aeruginosa strain AR_0353 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

989. spacer 7.43|190706|32|NC_006462|PILER-CR matches to CP051274 (Salmonella enterica subsp. enterica serovar Worthington strain OLF-FSR1_WB_Partridge_SW-37 plasmid pSW37-267109, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

990. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP038450 (Aeromonas media strain R50-22 plasmid pAeme6, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

991. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_AP018748 (Klebsiella pneumoniae strain KP33 plasmid pKP3301, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

992. spacer 7.43|190706|32|NC_006462|PILER-CR matches to CP028419 (Aeromonas hydrophila strain WCX23 plasmid pWCX23_1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

993. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP011632 (Klebsiella oxytoca strain CAV1374 plasmid pCAV1374-84, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

994. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP011633 (Klebsiella oxytoca strain CAV1374 plasmid pCAV1374-150, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

995. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP011634 (Klebsiella oxytoca strain CAV1374 plasmid pCAV1374-228, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

996. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP011634 (Klebsiella oxytoca strain CAV1374 plasmid pCAV1374-228, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

997. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP011634 (Klebsiella oxytoca strain CAV1374 plasmid pCAV1374-228, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

998. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP011634 (Klebsiella oxytoca strain CAV1374 plasmid pCAV1374-228, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

999. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP024550 (Klebsiella pneumoniae strain INF163 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1000. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP018318 (Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1001. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP014698 (Klebsiella quasipneumoniae strain ATCC 700603 isolate K6 plasmid pKQPS2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1002. spacer 7.43|190706|32|NC_006462|PILER-CR matches to MN842294 (Leclercia adecarboxylata strain G426 plasmid pG426-FII, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1003. spacer 7.43|190706|32|NC_006462|PILER-CR matches to KF743817 (Proteus mirabilis plasmid R772, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1004. spacer 7.43|190706|32|NC_006462|PILER-CR matches to KF743818 (Bordetella bronchiseptica plasmid R906, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1005. spacer 7.43|190706|32|NC_006462|PILER-CR matches to CP051271 (Salmonella enterica subsp. enterica serovar Worthington strain OLF-FSR1_WB_Quail_SW-70 plasmid pSW37-267106, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1006. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP032340 (Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
ctccaacacggcgatgtcggcggcgatggcct	Protospacer
.* **.   ********.**********.***

1007. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP011595 (Klebsiella oxytoca strain CAV1099 plasmid pKPC_CAV1099, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1008. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP043767 (Enterobacter hormaechei strain EB_P9_L5_03.19 plasmid pIMPIncH12_331kb, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1009. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP021712 (Klebsiella pneumoniae strain AR_0143 plasmid tig00000857, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1010. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP025236 (Salmonella enterica subsp. enterica serovar Newport str. USDA-ARS-USMARC-1926 plasmid pSNE2-1926, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1011. spacer 7.43|190706|32|NC_006462|PILER-CR matches to KX957968 (Vibrio alginolyticus plasmid pVAS19, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1012. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP013115 (Shewanella xiamenensis strain T17 plasmid pSx1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1013. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP013215 (Klebsiella pneumoniae subsp. pneumoniae strain H11 plasmid pH11, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1014. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP053365 (Klebsiella pneumoniae strain BA2275 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1015. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP009570 (Salmonella enterica subsp. enterica serovar Newport str. CVM N1543 isolate CFSAN000926 plasmid pCVMN1543, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1016. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP009564 (Salmonella enterica subsp. enterica serovar Newport str. CVM 21550 plasmid pCVM21550, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1017. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP009563 (Salmonella enterica subsp. enterica serovar Newport str. CVM 21538 plasmid pCVM21538, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1018. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NC_006525 (Cupriavidus metallidurans CH34 plasmid pMOL28, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1019. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NC_020123 (Citrobacter freundii strain CFSTE plasmid pT-OXA-181, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1020. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NC_024992 (Klebsiella pneumoniae plasmid pKp848CTX, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1021. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP011622 (Klebsiella pneumoniae strain CAV1344 plasmid pKPC_CAV1344, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1022. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP013265 (Sphingobium baderi strain DE-13 plasmid pDE1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcag-ataggcgatgttggcggcgatgacct	CRISPR spacer
-ggcggaataggcgatgctgccggcgatgaaga	Protospacer
  **.* **********.** *********

1023. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_AP018752 (Klebsiella pneumoniae strain KP64 plasmid pKP6402, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1024. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP040595 (Klebsiella pneumoniae subsp. pneumoniae strain KpvST15_NDM plasmid pKpvST15, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1025. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NC_012556 (Enterobacter cloacae plasmid pEC-IMPQ, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1026. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NC_012555 (Enterobacter cloacae plasmid pEC-IMP, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1027. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP041209 (Salmonella enterica subsp. enterica serovar Newport strain SAP18-8729 plasmid pCFSAN074384_1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1028. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP011576 (Klebsiella pneumoniae strain CAV1392 plasmid pCAV1392-50, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1029. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP042579 (Enterobacter kobei strain C16 plasmid pC16_001, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1030. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NC_019906 (Pseudomonas putida HB3267 plasmid pPC9, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1031. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP025578 (Klebsiella pneumoniae strain 08EU827 plasmid p08EU827_2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1032. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP006799 (Klebsiella pneumoniae subsp. pneumoniae PittNDM01 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1033. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP006801 (Klebsiella pneumoniae subsp. pneumoniae PittNDM01 plasmid p3, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1034. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP011610 (Citrobacter freundii strain CAV1321 plasmid pCAV1321-135, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1035. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP043516 (Enterobacter kobei strain EB_P8_L5_01.19 plasmid pIMPIncN3_57kb, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1036. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP018689 (Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1037. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NC_019116 (Salmonella enterica subsp. enterica serovar Heidelberg plasmid pSH163_135, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1038. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NC_019118 (Salmonella enterica subsp. enterica serovar Heidelberg plasmid pSH696_135, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1039. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NC_019121 (Salmonella enterica subsp. enterica serovar Heidelberg plasmid pSH111_166, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1040. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP041935 (Klebsiella pneumoniae strain KP14003 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1041. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP012956 (Acinetobacter baumannii strain D36 plasmid pD36-4 clone GC1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1042. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP024573 (Klebsiella pneumoniae strain INF274 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1043. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP026234 (Citrobacter freundii complex sp. CFNIH4 plasmid pCFR-4109, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1044. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP026234 (Citrobacter freundii complex sp. CFNIH4 plasmid pCFR-4109, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1045. spacer 7.43|190706|32|NC_006462|PILER-CR matches to AP022352 (Klebsiella pneumoniae E208 plasmid pE208_IMP6 DNA, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1046. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP031884 (Klebsiella pneumoniae strain WCHKP095845 plasmid pNDM1_095845, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1047. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP051135 (Enterobacter hormaechei strain AMS-38 plasmid pAMS-38c, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1048. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NC_012692 (Escherichia coli plasmid pAR060302, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1049. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NC_012693 (Salmonella enterica plasmid pAM04528, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1050. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP032842 (Enterobacter hormaechei strain C15117 plasmid pSPRC-Echo1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1051. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP024564 (Klebsiella pneumoniae strain INF278 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1052. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP024566 (Klebsiella pneumoniae strain INF278 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1053. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP026851 (UNVERIFIED_ORG: Enterobacter cloacae strain AR_0072 plasmid unnamed1) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1054. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP026851 (UNVERIFIED_ORG: Enterobacter cloacae strain AR_0072 plasmid unnamed1) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1055. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP026851 (UNVERIFIED_ORG: Enterobacter cloacae strain AR_0072 plasmid unnamed1) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1056. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP026851 (UNVERIFIED_ORG: Enterobacter cloacae strain AR_0072 plasmid unnamed1) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1057. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NC_019344 (Serratia marcescens plasmid R830b, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1058. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NC_019380 (Aeromonas hydrophila plasmid pR148, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1059. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP027425 (Klebsiella oxytoca strain FDAARGOS_335 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1060. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP046032 (Salmonella sp. HNK130 plasmid pTHNK130-2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1061. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP046034 (Salmonella sp. HNK130 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1062. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP021695 (Proteus mirabilis strain AR_0155 plasmid tig00000123, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1063. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP021953 (Klebsiella pneumoniae strain AR_0148 plasmid tig00000185_pilon, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1064. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP032395 (Salmonella enterica subsp. enterica serovar Dublin strain CVM 22453 plasmid p22453_1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1065. spacer 7.43|190706|32|NC_006462|PILER-CR matches to KY320277 (Leclercia adecarboxylata strain Lec-476 plasmid pLec-476, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1066. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP042525 (Citrobacter freundii strain E11 plasmid pE11_001, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1067. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_AP018830 (Enterobacter hormaechei subsp. xiangfangensis strain M206 plasmid pM206-NDM1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1068. spacer 7.43|190706|32|NC_006462|PILER-CR matches to CP052479 (Klebsiella pneumoniae strain C16KP0050 plasmid pC16KP0050-3, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1069. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_LT991955 (Enterobacter hormaechei subsp. steigerwaltii isolate C309 plasmid pC309-VIM4) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1070. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_LT991956 (Enterobacter hormaechei subsp. steigerwaltii isolate C309 plasmid pC309-p2) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1071. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NC_023898 (Klebsiella pneumoniae plasmid pRMH760, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1072. spacer 7.43|190706|32|NC_006462|PILER-CR matches to CP020502 (Serratia marcescens strain BWH-23 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1073. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP026014 (Klebsiella variicola strain 13450 plasmid p13450-1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1074. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP026018 (Klebsiella pneumoniae strain 13190 plasmid p13190-2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1075. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP022170 (Aeromonas salmonicida strain S121 plasmid pS121-1a, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1076. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP025144 (Klebsiella pneumoniae strain NR5632 plasmid NR5632_p1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1077. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP025147 (Klebsiella pneumoniae strain KP1766 plasmid KP1766_p1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1078. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP038654 (Citrobacter freundii strain 154 plasmid p154_1, complete sequence) position: , mismatch: 8, identity: 0.75

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcgcagatgggcgatgtgggcggcgcggatca	Protospacer
 .******.******** *******  **.*

1079. spacer 7.44|190767|32|NC_006462|PILER-CR matches to NZ_CP029986 (Sphingomonas sp. FARSPH plasmid p01, complete sequence) position: , mismatch: 8, identity: 0.75

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
cgactggcggccgcgaagcgggtcagtgccgg	Protospacer
 ** ******************.***  *..

1080. spacer 7.44|190767|32|NC_006462|PILER-CR matches to NZ_CP012477 (Arthrobacter sp. ERGS1:01 isolate water plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
cccgggccggccgcgaagtggtccaggtctat	Protospacer
   * * ***********.** *********.

1081. spacer 7.44|190767|32|NC_006462|PILER-CR matches to NZ_AP014705 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence) position: , mismatch: 8, identity: 0.75

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
aggatcgcggccgcgacgcgggccgggtcggc	Protospacer
.*..* ********** *******.**** .*

1082. spacer 7.45|190828|32|NC_006462|PILER-CR matches to NZ_CP026489 (Streptomyces sp. 604F plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

agagagctcgtaaagggccccggccaaatcgt	CRISPR spacer
gaagagctggtagagggccccggcccgagcgg	Protospacer
..****** ***.************ .* **

1083. spacer 8.1|200840|32|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NC_022536 (Rhizobium sp. IRBG74 plasmid IRBL74_p, complete sequence) position: , mismatch: 8, identity: 0.75

gctggcctgcaggacctccagcatctggcggg	CRISPR spacer
catggcctgctggaccgccagcatcagcgcgg	Protospacer
  ******** ***** ******** *   **

1084. spacer 8.1|200840|32|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NC_018022 (Mycolicibacterium chubuense NBB4 plasmid pMYCCH.01, complete sequence) position: , mismatch: 8, identity: 0.75

gctggcctgcaggacctccagcatctggcggg	CRISPR spacer
ccccgtctgctgggcctccagcatctggccgt	Protospacer
 *. *.**** **.*************** *

1085. spacer 8.1|200840|32|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP054616 (Azospirillum oryzae strain KACC 14407 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

gctggcctgcaggacctccagcatctggcggg	CRISPR spacer
gccgagatgcaggtcctccagcttctggcgca	Protospacer
**.*.  ****** ******** ******* .

1086. spacer 8.9|201332|33|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NC_011991 (Agrobacterium vitis S4 plasmid pAtS4b, complete sequence) position: , mismatch: 8, identity: 0.758

gacggtagaccccgagaccggggaaatcctgga	CRISPR spacer
tgtgctagacgccgagacgggggaaatcctcgc	Protospacer
 ..* ***** ******* *********** *

1087. spacer 8.9|201332|33|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to MN586021 (Arthrobacter phage Beagle, complete genome) position: , mismatch: 8, identity: 0.758

gacggtagaccccgagaccggggaaatcctgga	CRISPR spacer
cgtgatggaccgcgagaccagggaaatcctggc	Protospacer
 ..*.*.**** *******.************

1088. spacer 8.9|201332|33|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to MT889394 (Arthrobacter phage Odyssey395, complete genome) position: , mismatch: 8, identity: 0.758

gacggtagaccccgagaccggggaaatcctgga	CRISPR spacer
cgtgatggaccgcgagaccagggaaatcctggc	Protospacer
 ..*.*.**** *******.************

1089. spacer 8.9|201332|33|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to CP021185 (Sphingomonas wittichii DC-6 plasmid pDC04, complete sequence) position: , mismatch: 8, identity: 0.758

gacggtagaccccgagaccggggaaatcctgga	CRISPR spacer
gatcgttgaccccgacaccggggaaatcaccgc	Protospacer
**. ** ******** ************ . *

1090. spacer 8.9|201332|33|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to CP021184 (Sphingomonas wittichii DC-6 plasmid pDC03, complete sequence) position: , mismatch: 8, identity: 0.758

gacggtagaccccgagaccggggaaatcctgga	CRISPR spacer
gatcgttgaccccgacaccggggaaatcaccgc	Protospacer
**. ** ******** ************ . *

1091. spacer 8.9|201332|33|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to CP021184 (Sphingomonas wittichii DC-6 plasmid pDC03, complete sequence) position: , mismatch: 8, identity: 0.758

gacggtagaccccgagaccggggaaatcctgga	CRISPR spacer
gatcgttgaccccgacaccggggaaatcaccgc	Protospacer
**. ** ******** ************ . *

1092. spacer 8.10|201394|32|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NZ_AP022338 (Mameliella alba strain KU6B plasmid pKUB257, complete sequence) position: , mismatch: 8, identity: 0.75

gaaagcccgaactcatggcggaccgcgaacac	CRISPR spacer
tgatcgccgaactcaaggccgaccgcgaacgc	Protospacer
 .*   ********* *** **********.*

1093. spacer 8.18|201889|34|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032678 (Pseudomonas sp. Leaf58 plasmid pBASL58, complete sequence) position: , mismatch: 8, identity: 0.765

gacatgacccccgagcagcgccgcgccctcaagc	CRISPR spacer
tccatgacacccgagcagcgccacgccctgtact	Protospacer
  ****** *************.******  * .

1094. spacer 8.18|201889|34|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP015867 (Streptomyces parvulus strain 2297 plasmid pSPA1, complete sequence) position: , mismatch: 8, identity: 0.765

gacatgacccccgagcagcgccgcgccctcaagc	CRISPR spacer
gacatgacacccgaccagcgccgcctgctggacc	Protospacer
******** ***** ********* . ** .* *

1095. spacer 8.18|201889|34|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to MH155873 (Microbacterium phage Paschalis, complete genome) position: , mismatch: 8, identity: 0.765

gacatgacccccgagcagcgccgcgccctcaagc	CRISPR spacer
aacctgacccccgaacagcgccgcgagttcatgg	Protospacer
.** **********.**********  .*** *

1096. spacer 8.18|201889|34|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to MH590600 (Microbacterium phage KaiHaiDragon, complete genome) position: , mismatch: 8, identity: 0.765

gacatgacccccgagcagcgccgcgccctcaagc	CRISPR spacer
aacctgacccccgaacagcgccgcgagttcatgg	Protospacer
.** **********.**********  .*** *

1097. spacer 8.18|201889|34|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to MT818415 (Microbacterium phage Scumberland, complete genome) position: , mismatch: 8, identity: 0.765

gacatgacccccgagcagcgccgcgccctcaagc	CRISPR spacer
aacctgacccccgaacagcgccgcgagttcatgg	Protospacer
.** **********.**********  .*** *

1098. spacer 8.18|201889|34|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NC_047993 (Microbacterium phage Quhwah, complete genome) position: , mismatch: 8, identity: 0.765

gacatgacccccgagcagcgccgcgccctcaagc	CRISPR spacer
aacctgacccccgaacagcgccgcgagttcatgg	Protospacer
.** **********.**********  .*** *

1099. spacer 8.18|201889|34|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to MN444877 (Microbacterium phage Antares, complete genome) position: , mismatch: 8, identity: 0.765

gacatgacccccgagcagcgccgcgccctcaagc	CRISPR spacer
aacctgacccccgaacagcgccgcgagttcatgg	Protospacer
.** **********.**********  .*** *

1100. spacer 7.1|189536|32|NC_006462|CRISPRCasFinder,CRT matches to AP017627 (Pleomorphomonas sp. SM30 plasmid pSM30-1 DNA, complete genome) position: , mismatch: 9, identity: 0.719

tcgtccgcaagctcgtcgggcacctcctccgg	CRISPR spacer
taccaggagagctcgtcggccacctgctccgg	Protospacer
*  .  * .********** ***** ******

1101. spacer 7.3|189659|33|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP030864 (Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.727

gcccccgcgggagcggcgcgccttgctagagga	CRISPR spacer
gccccctcgggagcggctcgccttccacggctt	Protospacer
****** ********** ****** *  *.

1102. spacer 7.5|189782|31|NC_006462|CRISPRCasFinder,CRT matches to NC_017580 (Shewanella baltica OS117 plasmid pSBAL11702, complete sequence) position: , mismatch: 9, identity: 0.71

ttgccattactattactaccggcaacatcgc	CRISPR spacer
cgcattttactattacttccgacaacatcgt	Protospacer
.   . *********** ***.********.

1103. spacer 7.8|189964|33|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP017076 (Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence) position: , mismatch: 9, identity: 0.727

ggcccggagcatggcctgcaggacggcggaggg	CRISPR spacer
gccgaccagcgtggactgcaggacggcggagcc	Protospacer
* *    ***.*** ****************

1104. spacer 7.10|190088|32|NC_006462|CRISPRCasFinder,CRT matches to NC_008739 (Marinobacter hydrocarbonoclasticus VT8 plasmid pMAQU02, complete sequence) position: , mismatch: 9, identity: 0.719

cggaggagccacaggtaggccgcccgggccag	CRISPR spacer
aagtgctgccagaggtaggccgcccggacctt	Protospacer
 .* *  **** ***************.**

1105. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP015881 (Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence) position: , mismatch: 9, identity: 0.719

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
caagggataggcgatgttgtcggcgatgttca	Protospacer
. . .************** ******** .*

1106. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP030263 (Ensifer adhaerens strain Corn53 plasmid AA, complete sequence) position: , mismatch: 9, identity: 0.719

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
caagggataggcgatgttgtcggcgatgttca	Protospacer
. . .************** ******** .*

1107. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NC_016585 (Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence) position: , mismatch: 9, identity: 0.719

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gggcagataggcaatgtcggcggcggtcaggc	Protospacer
  **********.****.*******.* *  .

1108. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP015737 (Shinella sp. HZN7 plasmid pShin-01, complete sequence) position: , mismatch: 9, identity: 0.719

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
cgcccgccaggcgatgacggcggcgatgaccg	Protospacer
.  * * .******** .*************

1109. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP029452 (Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence) position: , mismatch: 9, identity: 0.719

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcggagataggcgatgttgacgccgatcgacg	Protospacer
 .* ***************.** **** . *

1110. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NC_021229 (Arthrobacter nicotinovorans pAO1 megaplasmid sequence, strain ATCC 49919) position: , mismatch: 9, identity: 0.719

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
ctcacgccaggcgacgttgacggcgatgaccg	Protospacer
.*   * .******.****.***********

1111. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_AP014706 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_2p, complete sequence) position: , mismatch: 9, identity: 0.719

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
cgccatccaggcgaggttggcggcgatgtccg	Protospacer
.  **  .****** ************* **

1112. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NC_017966 (Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence) position: , mismatch: 9, identity: 0.719

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
cgccaacaaggcgatgttcgaggcgatgaccg	Protospacer
.  **.  ********** * **********

1113. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP023071 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence) position: , mismatch: 9, identity: 0.719

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcggagataggcgatgttgacgccgatcgacg	Protospacer
 .* ***************.** **** . *

1114. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NC_015221 (Nitrosomonas sp. AL212 plasmid pNAL21202, complete sequence) position: , mismatch: 9, identity: 0.719

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
acgcagatgggcgatgtgggcggcgcgaatca	Protospacer
 .******.******** *******  .*.*

1115. spacer 7.21|190765|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP010410 (Xanthomonas sacchari strain R1 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
cagcaggcggcggcgaagccggccaggtcgcc	Protospacer
 ..  ****** ******* *********  *

1116. spacer 7.21|190765|32|NC_006462|CRISPRCasFinder,CRT matches to CP007645 (Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803d, complete sequence) position: , mismatch: 9, identity: 0.719

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
gccatggcggccgcgaagccggcccggtgcgg	Protospacer
*  .*************** **** *** ..

1117. spacer 7.21|190765|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP011275 (Planctomyces sp. SH-PL62 plasmid pPL62-2, complete sequence) position: , mismatch: 9, identity: 0.719

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
ctggtggcggtcgcgaagcgggccggggcgca	Protospacer
  .*******.*************.** *

1118. spacer 7.21|190765|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP050092 (Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b6, complete sequence) position: , mismatch: 9, identity: 0.719

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
ggattggcggcctcgaagcgggcggcaacgtc	Protospacer
*** ******** ********** . . *  *

1119. spacer 7.21|190765|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP050081 (Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b5, complete sequence) position: , mismatch: 9, identity: 0.719

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
ggattggcggcctcgaagcgggcggcaacgtc	Protospacer
*** ******** ********** . . *  *

1120. spacer 7.21|190765|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP015523 (Sphingomonas sp. NIC1 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
gcgattgcggccgcgaagcgggaaaggtcgct	Protospacer
* ..* ****************  *****  .

1121. spacer 7.21|190765|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP025016 (Rhizobium leguminosarum strain Norway plasmid pRLN4, complete sequence) position: , mismatch: 9, identity: 0.719

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
ggattggcggcctcgaagcgggcggcaacgtc	Protospacer
*** ******** ********** . . *  *

1122. spacer 7.21|190765|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP049731 (Rhizobium leguminosarum strain A1 plasmid pRL12, complete sequence) position: , mismatch: 9, identity: 0.719

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
ggattggcggcctcgaagcgggcggcaacgtc	Protospacer
*** ******** ********** . . *  *

1123. spacer 7.21|190765|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP016287 (Rhizobium leguminosarum strain Vaf10 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
ggattggcggcctcgaagcgggcggcaacgtc	Protospacer
*** ******** ********** . . *  *

1124. spacer 7.21|190765|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 9, identity: 0.719

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
tggacgagtgccgcgaagcgggcgaggtcgac	Protospacer
 *...*.  ************** ***** **

1125. spacer 7.21|190765|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP022565 (Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK01, complete sequence) position: , mismatch: 9, identity: 0.719

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
ggattggcggcctcgaagcgggcggcaacgtc	Protospacer
*** ******** ********** . . *  *

1126. spacer 7.21|190765|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP053206 (Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1D, complete sequence) position: , mismatch: 9, identity: 0.719

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
ggattggcggcctcgaagcgggcggcaacgtc	Protospacer
*** ******** ********** . . *  *

1127. spacer 7.24|189538|32|NC_006462|PILER-CR matches to AP017627 (Pleomorphomonas sp. SM30 plasmid pSM30-1 DNA, complete genome) position: , mismatch: 9, identity: 0.719

tcgtccgcaagctcgtcgggcacctcctccgg	CRISPR spacer
taccaggagagctcgtcggccacctgctccgg	Protospacer
*  .  * .********** ***** ******

1128. spacer 7.26|189661|33|NC_006462|PILER-CR matches to NZ_CP030864 (Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.727

gcccccgcgggagcggcgcgccttgctagagga	CRISPR spacer
gccccctcgggagcggctcgccttccacggctt	Protospacer
****** ********** ****** *  *.

1129. spacer 7.28|189784|31|NC_006462|PILER-CR matches to NC_017580 (Shewanella baltica OS117 plasmid pSBAL11702, complete sequence) position: , mismatch: 9, identity: 0.71

ttgccattactattactaccggcaacatcgc	CRISPR spacer
cgcattttactattacttccgacaacatcgt	Protospacer
.   . *********** ***.********.

1130. spacer 7.31|189966|33|NC_006462|PILER-CR matches to NZ_CP017076 (Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence) position: , mismatch: 9, identity: 0.727

ggcccggagcatggcctgcaggacggcggaggg	CRISPR spacer
gccgaccagcgtggactgcaggacggcggagcc	Protospacer
* *    ***.*** ****************

1131. spacer 7.33|190090|32|NC_006462|PILER-CR matches to NC_008739 (Marinobacter hydrocarbonoclasticus VT8 plasmid pMAQU02, complete sequence) position: , mismatch: 9, identity: 0.719

cggaggagccacaggtaggccgcccgggccag	CRISPR spacer
aagtgctgccagaggtaggccgcccggacctt	Protospacer
 .* *  **** ***************.**

1132. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP015881 (Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence) position: , mismatch: 9, identity: 0.719

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
caagggataggcgatgttgtcggcgatgttca	Protospacer
. . .************** ******** .*

1133. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP030263 (Ensifer adhaerens strain Corn53 plasmid AA, complete sequence) position: , mismatch: 9, identity: 0.719

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
caagggataggcgatgttgtcggcgatgttca	Protospacer
. . .************** ******** .*

1134. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NC_016585 (Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence) position: , mismatch: 9, identity: 0.719

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gggcagataggcaatgtcggcggcggtcaggc	Protospacer
  **********.****.*******.* *  .

1135. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP015737 (Shinella sp. HZN7 plasmid pShin-01, complete sequence) position: , mismatch: 9, identity: 0.719

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
cgcccgccaggcgatgacggcggcgatgaccg	Protospacer
.  * * .******** .*************

1136. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP029452 (Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence) position: , mismatch: 9, identity: 0.719

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcggagataggcgatgttgacgccgatcgacg	Protospacer
 .* ***************.** **** . *

1137. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NC_021229 (Arthrobacter nicotinovorans pAO1 megaplasmid sequence, strain ATCC 49919) position: , mismatch: 9, identity: 0.719

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
ctcacgccaggcgacgttgacggcgatgaccg	Protospacer
.*   * .******.****.***********

1138. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_AP014706 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_2p, complete sequence) position: , mismatch: 9, identity: 0.719

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
cgccatccaggcgaggttggcggcgatgtccg	Protospacer
.  **  .****** ************* **

1139. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NC_017966 (Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence) position: , mismatch: 9, identity: 0.719

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
cgccaacaaggcgatgttcgaggcgatgaccg	Protospacer
.  **.  ********** * **********

1140. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP023071 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence) position: , mismatch: 9, identity: 0.719

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gcggagataggcgatgttgacgccgatcgacg	Protospacer
 .* ***************.** **** . *

1141. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NC_015221 (Nitrosomonas sp. AL212 plasmid pNAL21202, complete sequence) position: , mismatch: 9, identity: 0.719

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
acgcagatgggcgatgtgggcggcgcgaatca	Protospacer
 .******.******** *******  .*.*

1142. spacer 7.44|190767|32|NC_006462|PILER-CR matches to NZ_CP010410 (Xanthomonas sacchari strain R1 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
cagcaggcggcggcgaagccggccaggtcgcc	Protospacer
 ..  ****** ******* *********  *

1143. spacer 7.44|190767|32|NC_006462|PILER-CR matches to CP007645 (Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803d, complete sequence) position: , mismatch: 9, identity: 0.719

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
gccatggcggccgcgaagccggcccggtgcgg	Protospacer
*  .*************** **** *** ..

1144. spacer 7.44|190767|32|NC_006462|PILER-CR matches to NZ_CP011275 (Planctomyces sp. SH-PL62 plasmid pPL62-2, complete sequence) position: , mismatch: 9, identity: 0.719

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
ctggtggcggtcgcgaagcgggccggggcgca	Protospacer
  .*******.*************.** *

1145. spacer 7.44|190767|32|NC_006462|PILER-CR matches to NZ_CP050092 (Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b6, complete sequence) position: , mismatch: 9, identity: 0.719

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
ggattggcggcctcgaagcgggcggcaacgtc	Protospacer
*** ******** ********** . . *  *

1146. spacer 7.44|190767|32|NC_006462|PILER-CR matches to NZ_CP050081 (Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b5, complete sequence) position: , mismatch: 9, identity: 0.719

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
ggattggcggcctcgaagcgggcggcaacgtc	Protospacer
*** ******** ********** . . *  *

1147. spacer 7.44|190767|32|NC_006462|PILER-CR matches to NZ_CP015523 (Sphingomonas sp. NIC1 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
gcgattgcggccgcgaagcgggaaaggtcgct	Protospacer
* ..* ****************  *****  .

1148. spacer 7.44|190767|32|NC_006462|PILER-CR matches to NZ_CP025016 (Rhizobium leguminosarum strain Norway plasmid pRLN4, complete sequence) position: , mismatch: 9, identity: 0.719

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
ggattggcggcctcgaagcgggcggcaacgtc	Protospacer
*** ******** ********** . . *  *

1149. spacer 7.44|190767|32|NC_006462|PILER-CR matches to NZ_CP049731 (Rhizobium leguminosarum strain A1 plasmid pRL12, complete sequence) position: , mismatch: 9, identity: 0.719

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
ggattggcggcctcgaagcgggcggcaacgtc	Protospacer
*** ******** ********** . . *  *

1150. spacer 7.44|190767|32|NC_006462|PILER-CR matches to NZ_CP016287 (Rhizobium leguminosarum strain Vaf10 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
ggattggcggcctcgaagcgggcggcaacgtc	Protospacer
*** ******** ********** . . *  *

1151. spacer 7.44|190767|32|NC_006462|PILER-CR matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 9, identity: 0.719

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
tggacgagtgccgcgaagcgggcgaggtcgac	Protospacer
 *...*.  ************** ***** **

1152. spacer 7.44|190767|32|NC_006462|PILER-CR matches to NZ_CP022565 (Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK01, complete sequence) position: , mismatch: 9, identity: 0.719

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
ggattggcggcctcgaagcgggcggcaacgtc	Protospacer
*** ******** ********** . . *  *

1153. spacer 7.44|190767|32|NC_006462|PILER-CR matches to NZ_CP053206 (Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1D, complete sequence) position: , mismatch: 9, identity: 0.719

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
ggattggcggcctcgaagcgggcggcaacgtc	Protospacer
*** ******** ********** . . *  *

1154. spacer 8.1|200840|32|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to MT316461 (Streptomyces phage Galactica, complete genome) position: , mismatch: 9, identity: 0.719

gctggcctgcaggacctccagcatctggcggg	CRISPR spacer
ggcggccttcaggacctccagcacctcaacgc	Protospacer
* .***** **************.** .  *

1155. spacer 8.9|201332|33|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to KR063280 (Gordonia phage GMA6, complete genome) position: , mismatch: 9, identity: 0.727

gacggtagaccccgagaccggggaaatcctgga	CRISPR spacer
aacggtcgaccccgaaaccggggaagagaaggg	Protospacer
.***** ********.*********.    **.

1156. spacer 8.10|201394|32|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP015269 (Mycobacterium chimaera strain ZUERICH-2 plasmid unnamed 2, complete sequence) position: , mismatch: 9, identity: 0.719

gaaagcccgaactcatggcggaccgcgaacac	CRISPR spacer
ggcggcccgaactcaaggcgcaccgcgctgaa	Protospacer
*. .*********** **** ******   *

1157. spacer 8.13|201580|32|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP012940 (Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gttccggcctccaccctccggtacgcggagaa	CRISPR spacer
gtcacggccttcaccctctggtacgcgacccg	Protospacer
**. ******.*******.********.   .

1158. spacer 8.13|201580|32|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP012944 (Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gttccggcctccaccctccggtacgcggagaa	CRISPR spacer
gtcacggccttcaccctctggtacgcgacccg	Protospacer
**. ******.*******.********.   .

1159. spacer 8.13|201580|32|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NC_017575 (Ralstonia solanacearum Po82 megaplasmid, complete sequence) position: , mismatch: 9, identity: 0.719

gttccggcctccaccctccggtacgcggagaa	CRISPR spacer
gtcacggccttcaccctctggtacgcgacccg	Protospacer
**. ******.*******.********.   .

1160. spacer 8.13|201580|32|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP026308 (Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gttccggcctccaccctccggtacgcggagaa	CRISPR spacer
gtcacggccttcaccctctggtacgcgacccg	Protospacer
**. ******.*******.********.   .

1161. spacer 8.13|201580|32|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP051295 (Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence) position: , mismatch: 9, identity: 0.719

gttccggcctccaccctccggtacgcggagaa	CRISPR spacer
gtcacggccttcaccctctggtacgcgacccg	Protospacer
**. ******.*******.********.   .

1162. spacer 8.13|201580|32|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to CP047137 (Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gttccggcctccaccctccggtacgcggagaa	CRISPR spacer
gtcacggccttcaccctctggtacgcgacccg	Protospacer
**. ******.*******.********.   .

1163. spacer 8.16|201765|33|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP045329 (Labrenzia sp. THAF191b plasmid pTHAF191b_a, complete sequence) position: , mismatch: 9, identity: 0.727

tccgacccgcgccgcctcctctctctctccctg	CRISPR spacer
cttcatgagcgccgccccctctctctctctctg	Protospacer
... *.  ********.************.***

1164. spacer 8.16|201765|33|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP045345 (Labrenzia sp. THAF187b plasmid pTHAF187b_a, complete sequence) position: , mismatch: 9, identity: 0.727

tccgacccgcgccgcctcctctctctctccctg	CRISPR spacer
cttcatgagcgccgccccctctctctctctctg	Protospacer
... *.  ********.************.***

1165. spacer 8.16|201765|33|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP045335 (Labrenzia sp. THAF191a plasmid pTHAF191a_b, complete sequence) position: , mismatch: 9, identity: 0.727

tccgacccgcgccgcctcctctctctctccctg	CRISPR spacer
cttcatgagcgccgccccctctctctctctctg	Protospacer
... *.  ********.************.***

1166. spacer 8.18|201889|34|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NC_015178 (Acidiphilium multivorum AIU301 plasmid pACMV1, complete sequence) position: , mismatch: 9, identity: 0.735

gacatgacccccgagcagcgccgcgccctcaagc	CRISPR spacer
cccctgaccgccgagcagcgccgcgacctactgg	Protospacer
  * ***** *************** ***   *

1167. spacer 8.18|201889|34|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP029359 (Azospirillum sp. CFH 70021 plasmid unnamed4) position: , mismatch: 9, identity: 0.735

gacatgacccccgagcagcgccgcgccctcaagc	CRISPR spacer
gagcacttcgccgaggagcgcctcgccctcaagc	Protospacer
**     .* ***** ****** ***********

1168. spacer 8.18|201889|34|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP011667 (Streptomyces sp. Mg1 plasmid pSMg1-3, complete sequence) position: , mismatch: 9, identity: 0.735

gacatgacccccgagcagcgccgcgccct-caagc	CRISPR spacer
cgtgtgaccccagagcagcgccccgccccgcgag-	Protospacer
 ...******* ********** *****. *.**

1169. spacer 8.18|201889|34|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP026517 (Deinococcus sp. NW-56 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.735

gacatgacccccgagcagcgccgcgccctcaagc	CRISPR spacer
gagctggcccgcgagcagcgccgcgcccaccccg	Protospacer
**  **.*** ***************** *

1170. spacer 9.6|227726|35|NC_006462|CRISPRCasFinder matches to AP021851 (Deinococcus grandis ATCC 43672 plasmid: pDEGR-2 DNA, complete genome) position: , mismatch: 9, identity: 0.743

ggtacatcacatgggcggacgtggtgaagaggagg	CRISPR spacer
ctggcgccacaggggcggacgtggtgaagcggaga	Protospacer
   .*..**** ***************** ****.

1171. spacer 9.18|227725|36|NC_006462|CRT,PILER-CR matches to AP021851 (Deinococcus grandis ATCC 43672 plasmid: pDEGR-2 DNA, complete genome) position: , mismatch: 9, identity: 0.75

gggtacatcacatgggcggacgtggtgaagaggagg	CRISPR spacer
gctggcgccacaggggcggacgtggtgaagcggaga	Protospacer
*   .*..**** ***************** ****.

1172. spacer 4.7|135643|40|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NC_017590 (Thermus thermophilus JL-18 plasmid pTTJL1802, complete sequence) position: , mismatch: 10, identity: 0.75

gccatcaccgtgaggccgccctccaccagctccccctcca	CRISPR spacer
gcggcgctcaccaggccgccctccaccagctccccttcca	Protospacer
** ..  .*.. ***********************.****

1173. spacer 4.7|135643|40|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NC_019388 (Thermus oshimai JL-2 plasmid pTHEOS02, complete sequence) position: , mismatch: 10, identity: 0.75

gccatcaccgtgaggccgccctccaccagctccccctcca	CRISPR spacer
gcggcgctcaccaggccgccctccaccagctccccttcca	Protospacer
** ..  .*.. ***********************.****

1174. spacer 4.7|135643|40|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP010825 (Thermus aquaticus Y51MC23 plasmid pTA69, complete sequence) position: , mismatch: 10, identity: 0.75

gccatcaccgtgaggccgccctccaccagctccccctcca	CRISPR spacer
gcggcgctcaccaggcccccctccaccagctccccctcca	Protospacer
** ..  .*.. ***** **********************

1175. spacer 7.6|189842|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP022775 (Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

ggcgtggccggagggggtgccgaatggctaag	CRISPR spacer
aaccgcgccgaaggcggtgccgaatggctgct	Protospacer
..*   ****.*** **************.

1176. spacer 7.6|189842|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP022762 (Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

ggcgtggccggagggggtgccgaatggctaag	CRISPR spacer
aaccgcgccgaaggcggtgccgaatggctgct	Protospacer
..*   ****.*** **************.

1177. spacer 7.6|189842|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP023017 (Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

ggcgtggccggagggggtgccgaatggctaag	CRISPR spacer
aaccgcgccgaaggcggtgccgaatggctgct	Protospacer
..*   ****.*** **************.

1178. spacer 7.6|189842|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP014703 (Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence) position: , mismatch: 10, identity: 0.688

ggcgtggccggagggggtgccgaatggctaag	CRISPR spacer
aaccgcgccgaaggcggtgccgaatggctgct	Protospacer
..*   ****.*** **************.

1179. spacer 7.6|189842|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP022771 (Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

ggcgtggccggagggggtgccgaatggctaag	CRISPR spacer
aaccgcgccgaaggcggtgccgaatggctgct	Protospacer
..*   ****.*** **************.

1180. spacer 7.6|189842|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP022777 (Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

ggcgtggccggagggggtgccgaatggctaag	CRISPR spacer
aaccgcgccgaaggcggtgccgaatggctgct	Protospacer
..*   ****.*** **************.

1181. spacer 7.6|189842|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP022799 (Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

ggcgtggccggagggggtgccgaatggctaag	CRISPR spacer
aaccgcgccgaaggcggtgccgaatggctgct	Protospacer
..*   ****.*** **************.

1182. spacer 7.6|189842|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP022764 (Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

ggcgtggccggagggggtgccgaatggctaag	CRISPR spacer
aaccgcgccgaaggcggtgccgaatggctgct	Protospacer
..*   ****.*** **************.

1183. spacer 7.6|189842|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP022797 (Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

ggcgtggccggagggggtgccgaatggctaag	CRISPR spacer
aaccgcgccgaaggcggtgccgaatggctgct	Protospacer
..*   ****.*** **************.

1184. spacer 7.6|189842|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP022758 (Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

ggcgtggccggagggggtgccgaatggctaag	CRISPR spacer
aaccgcgccgaaggcggtgccgaatggctgct	Protospacer
..*   ****.*** **************.

1185. spacer 7.12|190210|33|NC_006462|CRISPRCasFinder,CRT matches to NC_012970 (Methylovorus glucosetrophus SIP3-4 plasmid pMsip01, complete sequence) position: , mismatch: 10, identity: 0.697

gaggcgctgctgagccccaaggcactacggccc	CRISPR spacer
aaggagctgctgagccacaaggcacaagaagaa	Protospacer
.*** *********** ******** * ..

1186. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP012399 (Chelatococcus sp. CO-6 plasmid pCO-6, complete sequence) position: , mismatch: 10, identity: 0.688

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gaaggaagaggcgctggtggcggcgatgaccg	Protospacer
  . ..* ***** ** **************

1187. spacer 7.20|190704|32|NC_006462|CRISPRCasFinder,CRT matches to CP040467 (Streptomyces albidoflavus strain UYFA156 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
cagggcgtaggcgatgcgggcggcgatgacgg	Protospacer
. * . .*********. ************

1188. spacer 7.21|190765|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP011665 (Streptomyces sp. Mg1 plasmid pSMg1-1, complete sequence) position: , mismatch: 10, identity: 0.688

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
ttgaaggcggcctcgaagcgggccatgtcgct	Protospacer
  .. ******* ************ ***  .

1189. spacer 7.21|190765|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP013553 (Rhizobium phaseoli strain N931 plasmid pRphaN931a, complete sequence) position: , mismatch: 10, identity: 0.688

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
tcttcggcggccgcgaagcgcgccgggtgatc	Protospacer
    .*************** ***.***   *

1190. spacer 7.21|190765|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP013586 (Rhizobium phaseoli strain N161 plasmid pRphaN161a, complete sequence) position: , mismatch: 10, identity: 0.688

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
tcttcggcggccgcgaagcgcgccgggtgatc	Protospacer
    .*************** ***.***   *

1191. spacer 7.21|190765|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP013597 (Rhizobium sp. N741 plasmid pRspN741b, complete sequence) position: , mismatch: 10, identity: 0.688

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
tcttcggcggccgcgaagcgcgccgggtgatc	Protospacer
    .*************** ***.***   *

1192. spacer 7.21|190765|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP013559 (Rhizobium phaseoli strain N841 plasmid pRphaN841b, complete sequence) position: , mismatch: 10, identity: 0.688

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
tcttcggcggccgcgaagcgcgccgggtgatc	Protospacer
    .*************** ***.***   *

1193. spacer 7.21|190765|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP013576 (Rhizobium phaseoli strain N671 plasmid pRphaN671b, complete sequence) position: , mismatch: 10, identity: 0.688

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
tcttcggcggccgcgaagcgcgccgggtgatc	Protospacer
    .*************** ***.***   *

1194. spacer 7.21|190765|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP013548 (Rhizobium phaseoli strain R611 plasmid pRetR611a, complete sequence) position: , mismatch: 10, identity: 0.688

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
tcttcggcggccgcgaagcgcgccgggtgatc	Protospacer
    .*************** ***.***   *

1195. spacer 7.21|190765|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP013533 (Rhizobium phaseoli strain R650 plasmid pRphaR650a, complete sequence) position: , mismatch: 10, identity: 0.688

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
tcttcggcggccgcgaagcgcgccgggtgatc	Protospacer
    .*************** ***.***   *

1196. spacer 7.21|190765|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP013543 (Rhizobium phaseoli strain R620 plasmid pRphaR620a, complete sequence) position: , mismatch: 10, identity: 0.688

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
tcttcggcggccgcgaagcgcgccgggtgatc	Protospacer
    .*************** ***.***   *

1197. spacer 7.21|190765|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP013564 (Rhizobium phaseoli strain N831 plasmid pRphaN831a, complete sequence) position: , mismatch: 10, identity: 0.688

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
tcttcggcggccgcgaagcgcgccgggtgatc	Protospacer
    .*************** ***.***   *

1198. spacer 7.21|190765|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP013501 (Rhizobium esperanzae strain N561 plasmid pRspN561a, complete sequence) position: , mismatch: 10, identity: 0.688

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
tcttcggcggccgcgaagcgcgccgggtgatc	Protospacer
    .*************** ***.***   *

1199. spacer 7.21|190765|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP013507 (Rhizobium sp. N1341 plasmid pRspN1341b, complete sequence) position: , mismatch: 10, identity: 0.688

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
tcttcggcggccgcgaagcgcgccgggtgatc	Protospacer
    .*************** ***.***   *

1200. spacer 7.21|190765|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP013518 (Rhizobium sp. N113 plasmid pRspN113a, complete sequence) position: , mismatch: 10, identity: 0.688

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
tcttcggcggccgcgaagcgcgccgggtgatc	Protospacer
    .*************** ***.***   *

1201. spacer 7.21|190765|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP013570 (Rhizobium phaseoli strain N771 plasmid pRphaN771b, complete sequence) position: , mismatch: 10, identity: 0.688

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
tcttcggcggccgcgaagcgcgccgggtgatc	Protospacer
    .*************** ***.***   *

1202. spacer 7.21|190765|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP013491 (Rhizobium sp. N6212 plasmid pRspN6212a, complete sequence) position: , mismatch: 10, identity: 0.688

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
tcttcggcggccgcgaagcgcgccgggtgatc	Protospacer
    .*************** ***.***   *

1203. spacer 7.21|190765|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP013513 (Rhizobium sp. N1314 plasmid pRspN1314b, complete sequence) position: , mismatch: 10, identity: 0.688

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
tcttcggcggccgcgaagcgcgccgggtgatc	Protospacer
    .*************** ***.***   *

1204. spacer 7.21|190765|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP013496 (Rhizobium sp. N621 plasmid pRspN621a, complete sequence) position: , mismatch: 10, identity: 0.688

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
tcttcggcggccgcgaagcgcgccgggtgatc	Protospacer
    .*************** ***.***   *

1205. spacer 7.21|190765|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP013591 (Rhizobium sp. N871 plasmid pRspN871a, complete sequence) position: , mismatch: 10, identity: 0.688

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
tcttcggcggccgcgaagcgcgccgggtgatc	Protospacer
    .*************** ***.***   *

1206. spacer 7.21|190765|32|NC_006462|CRISPRCasFinder,CRT matches to NZ_CP013603 (Rhizobium sp. N731 plasmid pRspN731b, complete sequence) position: , mismatch: 10, identity: 0.688

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
tcttcggcggccgcgaagcgcgccgggtgatc	Protospacer
    .*************** ***.***   *

1207. spacer 7.21|190765|32|NC_006462|CRISPRCasFinder,CRT matches to NC_016585 (Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence) position: , mismatch: 10, identity: 0.688

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
ctggtggcggcctcgacgcgggccagcagggc	Protospacer
  .********* *** *********    .*

1208. spacer 7.29|189844|32|NC_006462|PILER-CR matches to NZ_CP022775 (Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

ggcgtggccggagggggtgccgaatggctaag	CRISPR spacer
aaccgcgccgaaggcggtgccgaatggctgct	Protospacer
..*   ****.*** **************.

1209. spacer 7.29|189844|32|NC_006462|PILER-CR matches to NZ_CP022762 (Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

ggcgtggccggagggggtgccgaatggctaag	CRISPR spacer
aaccgcgccgaaggcggtgccgaatggctgct	Protospacer
..*   ****.*** **************.

1210. spacer 7.29|189844|32|NC_006462|PILER-CR matches to NZ_CP023017 (Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

ggcgtggccggagggggtgccgaatggctaag	CRISPR spacer
aaccgcgccgaaggcggtgccgaatggctgct	Protospacer
..*   ****.*** **************.

1211. spacer 7.29|189844|32|NC_006462|PILER-CR matches to NZ_CP014703 (Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence) position: , mismatch: 10, identity: 0.688

ggcgtggccggagggggtgccgaatggctaag	CRISPR spacer
aaccgcgccgaaggcggtgccgaatggctgct	Protospacer
..*   ****.*** **************.

1212. spacer 7.29|189844|32|NC_006462|PILER-CR matches to NZ_CP022771 (Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

ggcgtggccggagggggtgccgaatggctaag	CRISPR spacer
aaccgcgccgaaggcggtgccgaatggctgct	Protospacer
..*   ****.*** **************.

1213. spacer 7.29|189844|32|NC_006462|PILER-CR matches to NZ_CP022777 (Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

ggcgtggccggagggggtgccgaatggctaag	CRISPR spacer
aaccgcgccgaaggcggtgccgaatggctgct	Protospacer
..*   ****.*** **************.

1214. spacer 7.29|189844|32|NC_006462|PILER-CR matches to NZ_CP022799 (Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

ggcgtggccggagggggtgccgaatggctaag	CRISPR spacer
aaccgcgccgaaggcggtgccgaatggctgct	Protospacer
..*   ****.*** **************.

1215. spacer 7.29|189844|32|NC_006462|PILER-CR matches to NZ_CP022764 (Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

ggcgtggccggagggggtgccgaatggctaag	CRISPR spacer
aaccgcgccgaaggcggtgccgaatggctgct	Protospacer
..*   ****.*** **************.

1216. spacer 7.29|189844|32|NC_006462|PILER-CR matches to NZ_CP022797 (Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

ggcgtggccggagggggtgccgaatggctaag	CRISPR spacer
aaccgcgccgaaggcggtgccgaatggctgct	Protospacer
..*   ****.*** **************.

1217. spacer 7.29|189844|32|NC_006462|PILER-CR matches to NZ_CP022758 (Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

ggcgtggccggagggggtgccgaatggctaag	CRISPR spacer
aaccgcgccgaaggcggtgccgaatggctgct	Protospacer
..*   ****.*** **************.

1218. spacer 7.35|190212|33|NC_006462|PILER-CR matches to NC_012970 (Methylovorus glucosetrophus SIP3-4 plasmid pMsip01, complete sequence) position: , mismatch: 10, identity: 0.697

gaggcgctgctgagccccaaggcactacggccc	CRISPR spacer
aaggagctgctgagccacaaggcacaagaagaa	Protospacer
.*** *********** ******** * ..

1219. spacer 7.43|190706|32|NC_006462|PILER-CR matches to NZ_CP012399 (Chelatococcus sp. CO-6 plasmid pCO-6, complete sequence) position: , mismatch: 10, identity: 0.688

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
gaaggaagaggcgctggtggcggcgatgaccg	Protospacer
  . ..* ***** ** **************

1220. spacer 7.43|190706|32|NC_006462|PILER-CR matches to CP040467 (Streptomyces albidoflavus strain UYFA156 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

ttgcagataggcgatgttggcggcgatgacct	CRISPR spacer
cagggcgtaggcgatgcgggcggcgatgacgg	Protospacer
. * . .*********. ************

1221. spacer 7.44|190767|32|NC_006462|PILER-CR matches to NZ_CP011665 (Streptomyces sp. Mg1 plasmid pSMg1-1, complete sequence) position: , mismatch: 10, identity: 0.688

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
ttgaaggcggcctcgaagcgggccatgtcgct	Protospacer
  .. ******* ************ ***  .

1222. spacer 7.44|190767|32|NC_006462|PILER-CR matches to NZ_CP013553 (Rhizobium phaseoli strain N931 plasmid pRphaN931a, complete sequence) position: , mismatch: 10, identity: 0.688

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
tcttcggcggccgcgaagcgcgccgggtgatc	Protospacer
    .*************** ***.***   *

1223. spacer 7.44|190767|32|NC_006462|PILER-CR matches to NZ_CP013586 (Rhizobium phaseoli strain N161 plasmid pRphaN161a, complete sequence) position: , mismatch: 10, identity: 0.688

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
tcttcggcggccgcgaagcgcgccgggtgatc	Protospacer
    .*************** ***.***   *

1224. spacer 7.44|190767|32|NC_006462|PILER-CR matches to NZ_CP013597 (Rhizobium sp. N741 plasmid pRspN741b, complete sequence) position: , mismatch: 10, identity: 0.688

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
tcttcggcggccgcgaagcgcgccgggtgatc	Protospacer
    .*************** ***.***   *

1225. spacer 7.44|190767|32|NC_006462|PILER-CR matches to NZ_CP013559 (Rhizobium phaseoli strain N841 plasmid pRphaN841b, complete sequence) position: , mismatch: 10, identity: 0.688

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
tcttcggcggccgcgaagcgcgccgggtgatc	Protospacer
    .*************** ***.***   *

1226. spacer 7.44|190767|32|NC_006462|PILER-CR matches to NZ_CP013576 (Rhizobium phaseoli strain N671 plasmid pRphaN671b, complete sequence) position: , mismatch: 10, identity: 0.688

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
tcttcggcggccgcgaagcgcgccgggtgatc	Protospacer
    .*************** ***.***   *

1227. spacer 7.44|190767|32|NC_006462|PILER-CR matches to NZ_CP013548 (Rhizobium phaseoli strain R611 plasmid pRetR611a, complete sequence) position: , mismatch: 10, identity: 0.688

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
tcttcggcggccgcgaagcgcgccgggtgatc	Protospacer
    .*************** ***.***   *

1228. spacer 7.44|190767|32|NC_006462|PILER-CR matches to NZ_CP013533 (Rhizobium phaseoli strain R650 plasmid pRphaR650a, complete sequence) position: , mismatch: 10, identity: 0.688

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
tcttcggcggccgcgaagcgcgccgggtgatc	Protospacer
    .*************** ***.***   *

1229. spacer 7.44|190767|32|NC_006462|PILER-CR matches to NZ_CP013543 (Rhizobium phaseoli strain R620 plasmid pRphaR620a, complete sequence) position: , mismatch: 10, identity: 0.688

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
tcttcggcggccgcgaagcgcgccgggtgatc	Protospacer
    .*************** ***.***   *

1230. spacer 7.44|190767|32|NC_006462|PILER-CR matches to NZ_CP013564 (Rhizobium phaseoli strain N831 plasmid pRphaN831a, complete sequence) position: , mismatch: 10, identity: 0.688

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
tcttcggcggccgcgaagcgcgccgggtgatc	Protospacer
    .*************** ***.***   *

1231. spacer 7.44|190767|32|NC_006462|PILER-CR matches to NZ_CP013501 (Rhizobium esperanzae strain N561 plasmid pRspN561a, complete sequence) position: , mismatch: 10, identity: 0.688

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
tcttcggcggccgcgaagcgcgccgggtgatc	Protospacer
    .*************** ***.***   *

1232. spacer 7.44|190767|32|NC_006462|PILER-CR matches to NZ_CP013507 (Rhizobium sp. N1341 plasmid pRspN1341b, complete sequence) position: , mismatch: 10, identity: 0.688

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
tcttcggcggccgcgaagcgcgccgggtgatc	Protospacer
    .*************** ***.***   *

1233. spacer 7.44|190767|32|NC_006462|PILER-CR matches to NZ_CP013518 (Rhizobium sp. N113 plasmid pRspN113a, complete sequence) position: , mismatch: 10, identity: 0.688

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
tcttcggcggccgcgaagcgcgccgggtgatc	Protospacer
    .*************** ***.***   *

1234. spacer 7.44|190767|32|NC_006462|PILER-CR matches to NZ_CP013570 (Rhizobium phaseoli strain N771 plasmid pRphaN771b, complete sequence) position: , mismatch: 10, identity: 0.688

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
tcttcggcggccgcgaagcgcgccgggtgatc	Protospacer
    .*************** ***.***   *

1235. spacer 7.44|190767|32|NC_006462|PILER-CR matches to NZ_CP013491 (Rhizobium sp. N6212 plasmid pRspN6212a, complete sequence) position: , mismatch: 10, identity: 0.688

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
tcttcggcggccgcgaagcgcgccgggtgatc	Protospacer
    .*************** ***.***   *

1236. spacer 7.44|190767|32|NC_006462|PILER-CR matches to NZ_CP013513 (Rhizobium sp. N1314 plasmid pRspN1314b, complete sequence) position: , mismatch: 10, identity: 0.688

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
tcttcggcggccgcgaagcgcgccgggtgatc	Protospacer
    .*************** ***.***   *

1237. spacer 7.44|190767|32|NC_006462|PILER-CR matches to NZ_CP013496 (Rhizobium sp. N621 plasmid pRspN621a, complete sequence) position: , mismatch: 10, identity: 0.688

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
tcttcggcggccgcgaagcgcgccgggtgatc	Protospacer
    .*************** ***.***   *

1238. spacer 7.44|190767|32|NC_006462|PILER-CR matches to NZ_CP013591 (Rhizobium sp. N871 plasmid pRspN871a, complete sequence) position: , mismatch: 10, identity: 0.688

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
tcttcggcggccgcgaagcgcgccgggtgatc	Protospacer
    .*************** ***.***   *

1239. spacer 7.44|190767|32|NC_006462|PILER-CR matches to NZ_CP013603 (Rhizobium sp. N731 plasmid pRspN731b, complete sequence) position: , mismatch: 10, identity: 0.688

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
tcttcggcggccgcgaagcgcgccgggtgatc	Protospacer
    .*************** ***.***   *

1240. spacer 7.44|190767|32|NC_006462|PILER-CR matches to NC_016585 (Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence) position: , mismatch: 10, identity: 0.688

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
ctggtggcggcctcgacgcgggccagcagggc	Protospacer
  .********* *** *********    .*

1241. spacer 8.1|200840|32|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to MT663720 (Pseudomonas phage DDSR119, complete genome) position: , mismatch: 10, identity: 0.688

gctggcctgcaggacctccagcatctggcggg	CRISPR spacer
ggtggcctgcagcgcctccagcatcaaagtac	Protospacer
* ********** .*********** ..  .

1242. spacer 8.18|201889|34|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032928 (Agrobacterium tumefaciens strain 1D1460 plasmid pAt1D1460, complete sequence) position: , mismatch: 10, identity: 0.706

gacatgacccccgagcagcgccgcgccctcaagc	CRISPR spacer
cgcgcgaacgccgagcagcgccgcgcccttggcc	Protospacer
 .*..** * *******************... *

1243. spacer 8.18|201889|34|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NC_011143 (Phenylobacterium zucineum HLK1 plasmid, complete sequence) position: , mismatch: 10, identity: 0.706

gacatgacccccgagcagcgccgcgccctcaagc	CRISPR spacer
acaacggattccgagcagcgccgcgcgctcatgc	Protospacer
.  *.*. ..**************** **** **

1244. spacer 8.18|201889|34|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to MT316461 (Streptomyces phage Galactica, complete genome) position: , mismatch: 10, identity: 0.706

gacatgacccccgagcagcgccgcgccctcaagc	CRISPR spacer
cagctcacccccgagcagctccgcgacctcctcg	Protospacer
 *  * ************* ***** ****

1245. spacer 5.8|144695|37|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP010826 (Thermus aquaticus Y51MC23 plasmid pTA78, complete sequence) position: , mismatch: 11, identity: 0.703

ccgggaaggccgtgggctcgggcaccgccgccccgag	CRISPR spacer
gctttgtggcggtgggctcgggaaccgccgccctcac	Protospacer
 *   . *** *********** **********. *

1246. spacer 7.21|190765|32|NC_006462|CRISPRCasFinder,CRT matches to NC_013779 (Nocardiopsis sp. 90127 plasmid pSQ10, complete sequence) position: , mismatch: 11, identity: 0.656

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
atgacggcggccgcgatccgggccaggtggta	Protospacer
. ...***********  **********

1247. spacer 7.44|190767|32|NC_006462|PILER-CR matches to NC_013779 (Nocardiopsis sp. 90127 plasmid pSQ10, complete sequence) position: , mismatch: 11, identity: 0.656

ggagtggcggccgcgaagcgggccaggtctac	CRISPR spacer
atgacggcggccgcgatccgggccaggtggta	Protospacer
. ...***********  **********

1248. spacer 8.18|201889|34|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 11, identity: 0.676

gacatgacccccgagcagcgccgcgccctcaagc	CRISPR spacer
gcggcagatgccgagcagcgccgcggcctcacgc	Protospacer
*  .... . *************** ***** **

1249. spacer 8.18|201889|34|NC_006462|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 11, identity: 0.676

gacatgacccccgagcagcgccgcgccctcaagc	CRISPR spacer
gcggcagatgccgagcagcgccgcggcctcacgc	Protospacer
*  .... . *************** ***** **

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NC_006461

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NC_006462

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection